F492302

General Info

Members Datasets Scaffolds Average Seq Length
1261 515 2522 85

Family's Representative Sequence

Representative Sequence 3300000549|LJQas_1002902|LJQas_10029023
Length 99
Sequence MAHKKGAASTKNGRDSNSQRLGVKRYGGQTVNAGEIIVRQRGTHFHPGSGVGRGGDDTLFALIGGAVEFGTRAVAGSSTSSRASELTLARTPRSSEGRP

Samples

Sample ID Description Type Environment
1 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
4 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
5 3300002872 Avena fatua rhizosphere microbial communities - H1_Bulk_Litter_5 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
6 3300003162 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
7 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
8 3300003300 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
9 3300003308 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
10 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
11 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
12 3300003559 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_43 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
13 3300003568 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_24 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
14 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
15 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
16 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
17 3300003611 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_27 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
18 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
19 3300003735 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_23 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
20 3300004785 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-1 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
21 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
22 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
23 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
24 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
25 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
26 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
27 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
28 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
29 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
30 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
31 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
32 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
33 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
34 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
35 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
36 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
37 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
38 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
39 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
40 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
41 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
42 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
43 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
44 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
45 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
46 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
47 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
48 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
49 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
50 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
51 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
52 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
53 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
54 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
55 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
56 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
57 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
58 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
59 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
60 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
61 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
62 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
63 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
64 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
65 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
66 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
67 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
68 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
69 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
70 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
71 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
72 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
73 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
74 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
75 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
76 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
77 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
78 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
79 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
80 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
81 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
82 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
83 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
84 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
85 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
86 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
87 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
88 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
89 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
90 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
91 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
92 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
93 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
94 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
95 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
96 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
97 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
98 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
99 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
100 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
101 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
102 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
103 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
104 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
105 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
106 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
107 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
108 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
109 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
110 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
111 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
112 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
113 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
114 3300012485 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.7.old.040610 Metagenome Rhizosphere
115 3300012491 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610 Metagenome Rhizosphere
116 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
117 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
118 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
119 3300013044 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
120 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
121 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
122 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
123 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
124 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
125 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
126 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
127 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
128 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
129 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
130 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
131 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
132 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
133 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
134 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
135 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
136 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
137 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
138 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
139 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
140 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
141 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
142 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
143 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
144 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
145 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
146 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
147 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
148 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
149 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
150 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
195 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
196 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
197 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
198 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
201 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
202 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
203 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
204 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
205 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
206 3300030836 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
207 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
208 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
209 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
210 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
211 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
212 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
213 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
214 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
215 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
216 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
217 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
218 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
219 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
220 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
221 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
222 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
223 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
224 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
225 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
226 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
227 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
228 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
229 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
230 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
231 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
232 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
233 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
234 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
235 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
236 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
237 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
238 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
239 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
240 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
241 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
242 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
243 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
244 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
245 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
246 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
247 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
248 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
249 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
250 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
251 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
252 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
253 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
254 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
255 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
256 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
257 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
258 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
259 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
260 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
261 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
262 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
263 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
264 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
265 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
266 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
267 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
268 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
269 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
270 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
271 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
272 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
273 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
274 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
275 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
276 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
277 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
278 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
279 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
280 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
281 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
282 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
283 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
284 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
285 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
286 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
287 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
288 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
289 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
290 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
291 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
292 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
293 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
294 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
295 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
296 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
297 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
298 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
299 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
300 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
301 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
302 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
303 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
304 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
305 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
306 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
307 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
308 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
309 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
310 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
311 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
312 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
313 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
314 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
315 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
316 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
317 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
318 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
319 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
320 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
321 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
322 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
323 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
324 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
325 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
326 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
327 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
328 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
329 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
330 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
331 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
332 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
333 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
334 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
335 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
336 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
337 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
338 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
339 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
340 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
341 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
342 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
343 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
344 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
345 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
346 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
347 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
348 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
349 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
350 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
351 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
352 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
353 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
354 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
355 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
356 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
357 3300049538 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
358 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
359 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
360 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
361 3300049545 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
362 3300049549 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
363 3300049554 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
364 3300049556 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
365 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
366 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
367 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
368 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
369 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
370 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
371 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
372 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
373 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
374 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
375 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
376 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
377 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
378 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
379 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
380 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
381 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
382 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
383 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
384 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
385 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
386 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
387 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
388 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
389 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
390 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
391 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
392 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
393 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
394 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
395 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
396 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
397 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
398 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
399 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
400 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
401 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
402 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
403 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
404 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
405 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
406 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
407 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
408 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
409 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
410 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
411 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
412 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
413 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
414 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
415 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
416 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
417 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
418 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
419 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
420 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
421 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
422 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
423 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
424 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
425 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
426 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
427 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
428 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
429 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
430 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
431 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
432 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
433 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
434 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
435 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
436 3300059509 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
437 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
438 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
439 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
440 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
441 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
442 3300059606 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 159R_AD_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
443 3300059608 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 166R_SD_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
444 3300059622 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
445 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
446 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
447 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
448 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
449 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
450 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
451 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
452 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
453 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
454 3300059649 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
455 3300059651 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 70R_SD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
456 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
457 3300059657 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 156R_AW_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
458 3300059658 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
459 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
460 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
461 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
462 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
463 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
464 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
465 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
466 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
467 2643221561 Nocardioides sp. Root151 Isolate Unclassified
468 2643221578 Streptomyces sp. Root63 Isolate Unclassified
469 2643221601 Kitasatospora sp. Root187 Isolate Unclassified
470 2643221615 Nocardioides sp. Root224 Isolate Unclassified
471 2643221631 Kitasatospora sp. Root107 Isolate Unclassified
472 2643221632 Leifsonia sp. Root112D2 Isolate Unclassified
473 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
474 2643221670 Streptomyces sp. Root431 Isolate Unclassified
475 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
476 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
477 2643221696 Nocardioides sp. Root140 Isolate Unclassified
478 2728369276 Kineococcus rhizosphaerae DSM 19711 Isolate Rhizosphere
479 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
480 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
481 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
482 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
483 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
484 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
485 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified
486 2857481737 Nocardioides sp. R-74106 Isolate Unclassified
487 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
488 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
489 2867428634 Streptomyces sp. RP5T Isolate Unclassified
490 2867475112 Streptomyces sp. TM32 Isolate Unclassified
491 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
492 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
493 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
494 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
495 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
496 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
497 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
498 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
499 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
500 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
501 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
502 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
503 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
504 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
505 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified
506 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
507 8033684223 Streptomyces phytophilus PIP175 Isolate Unclassified
508 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
509 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
510 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
511 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
512 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
513 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
514 8054609563 Nocardioides astragali CGMCC 4.7327 Isolate Nodule
515 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 70.1
Metatranscriptomes 25.77
Isolates 4.12

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.15
Nodule 0.08
Rhizoplane 6.26
Rhizosphere 84.93
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJQas_1002902 3300000549 Bacteria 2334
2 LJQas_1008780 3300000549 Bacteria 1224
3 JGI24735J21928_10094491 3300002067 Bacteria 858
4 JGI24738J21930_10028799 3300002075 Bacteria 1136
5 JGI24744J21845_10098387 3300002077 Bacteria 539
6 Ga0006762J43184_106160 3300002872 Bacteria 523
7 Ga0006778J45830_1005237 3300003162 Bacteria 824
8 Ga0006778J45830_1017350 3300003162 Bacteria 621
9 Ga0006778J45830_1018865 3300003162 Bacteria 618
10 Ga0006778J45830_1024217 3300003162 Bacteria 707
11 Ga0006778J45830_1076135 3300003162 Bacteria 608
12 Ga0006759J45824_1007731 3300003163 Bacteria 744
13 Ga0006759J45824_1033594 3300003163 Bacteria 548
14 Ga0006759J45824_1040332 3300003163 Bacteria 623
15 Ga0006759J45824_1056525 3300003163 Bacteria 526
16 Ga0006758J48902_1008537 3300003300 Bacteria 729
17 Ga0006777J48905_1029661 3300003308 Bacteria 710
18 Ga0006777J48905_1050436 3300003308 Bacteria 502
19 Ga0006777J48905_1056291 3300003308 Bacteria 504
20 rootL2_10084680 3300003322 Bacteria 1328
21 Ga0007417J51691_1034199 3300003544 Bacteria 634
22 Ga0007417J51691_1045249 3300003544 Bacteria 642
23 Ga0007427J51700_105542 3300003559 Bacteria 671
24 Ga0007427J51700_112829 3300003559 Bacteria 723
25 Ga0006781J51513_1004365 3300003568 Bacteria 743
26 Ga0006781J51513_1012022 3300003568 Bacteria 712
27 Ga0006781J51513_1017605 3300003568 Bacteria 589
28 Ga0007409J51694_1007139 3300003575 Bacteria 738
29 Ga0007409J51694_1055501 3300003575 Bacteria 511
30 Ga0007416J51690_1008794 3300003577 Bacteria 738
31 Ga0007416J51690_1032047 3300003577 Bacteria 622
32 Ga0007429J51699_1004976 3300003579 Bacteria 754
33 Ga0007429J51699_1026481 3300003579 Bacteria 696
34 Ga0007429J51699_1028743 3300003579 Bacteria 733
35 Ga0007429J51699_1147323 3300003579 Bacteria 555
36 Ga0007411J51799_104538 3300003611 Bacteria 734
37 Ga0032354_1003953 3300003693 Bacteria 642
38 Ga0032354_1020597 3300003693 Bacteria 679
39 Ga0032354_1021921 3300003693 Bacteria 807
40 Ga0006780_1002679 3300003735 Bacteria 709
41 Ga0006780_1018908 3300003735 Bacteria 646
42 Ga0058858_1005265 3300004785 Bacteria 570
43 Ga0058858_1008839 3300004785 Bacteria 723
44 Ga0058859_10007251 3300004798 Bacteria 765
45 Ga0058859_10031544 3300004798 Bacteria 617
46 Ga0058861_10020666 3300004800 Bacteria 744
47 Ga0058860_12069996 3300004801 Bacteria 1121
48 Ga0070658_10845028 3300005327 Bacteria 796
49 Ga0070658_11319472 3300005327 Bacteria 627
50 Ga0070683_100013284 3300005329 Bacteria 7178
51 Ga0070683_100094819 3300005329 Bacteria 2805
52 Ga0070683_100760098 3300005329 Bacteria 929
53 Ga0070683_100864030 3300005329 Bacteria 867
54 Ga0070683_101329895 3300005329 Bacteria 691
55 Ga0070683_101794826 3300005329 Bacteria 590
56 Ga0070683_102190730 3300005329 Bacteria 531
57 Ga0070670_100763874 3300005331 Bacteria 872
58 Ga0070680_101902148 3300005336 Bacteria 516
59 Ga0070682_100243391 3300005337 Bacteria 1292
60 Ga0070682_100414100 3300005337 Bacteria 1022
61 Ga0070682_100824630 3300005337 Bacteria 756
62 Ga0068868_100352581 3300005338 Bacteria 1260
63 Ga0068868_101943940 3300005338 Bacteria 558
64 Ga0070660_100036431 3300005339 Bacteria 3727
65 Ga0070660_101221018 3300005339 Bacteria 637
66 Ga0070691_10295104 3300005341 Bacteria 884
67 Ga0070687_101495327 3300005343 Bacteria 507
68 Ga0070692_10458023 3300005345 Bacteria 818
69 Ga0070692_10719656 3300005345 Bacteria 674
70 Ga0070692_10786013 3300005345 Bacteria 648
71 Ga0070668_100035938 3300005347 Bacteria 3780
72 Ga0070668_100631463 3300005347 Bacteria 940
73 Ga0070669_101938912 3300005353 Bacteria 515
74 Ga0070671_101803509 3300005355 Bacteria 544
75 Ga0070674_100754251 3300005356 Bacteria 837
76 Ga0070674_101764301 3300005356 Bacteria 561
77 Ga0070674_102056534 3300005356 Bacteria 521
78 Ga0070673_100248121 3300005364 Bacteria 1551
79 Ga0070673_100622564 3300005364 Bacteria 986
80 Ga0070688_100241705 3300005365 Bacteria 1282
81 Ga0070659_100030400 3300005366 Bacteria 4180
82 Ga0070659_100155252 3300005366 Bacteria 1869
83 Ga0070659_100628514 3300005366 Bacteria 924
84 Ga0070667_100806611 3300005367 Bacteria 871
85 Ga0070714_100536709 3300005435 Bacteria 1119
86 Ga0070714_101692607 3300005435 Bacteria 618
87 Ga0070713_100530506 3300005436 Bacteria 1113
88 Ga0070710_11519626 3300005437 Bacteria 504
89 Ga0070701_10001495 3300005438 Bacteria 8661
90 Ga0070711_101157707 3300005439 Bacteria 668
91 Ga0070711_101648264 3300005439 Bacteria 561
92 Ga0070700_100541634 3300005441 Bacteria 903
93 Ga0070700_101157639 3300005441 Bacteria 644
94 Ga0070700_101361181 3300005441 Bacteria 599
95 Ga0070694_100906884 3300005444 Bacteria 728
96 Ga0070663_100101383 3300005455 Bacteria 2148
97 Ga0070663_101045818 3300005455 Bacteria 712
98 Ga0070663_101524739 3300005455 Bacteria 594
99 Ga0070678_100193025 3300005456 Bacteria 1675
100 Ga0070678_101010375 3300005456 Bacteria 765
101 Ga0070678_101960762 3300005456 Bacteria 554
102 Ga0070662_100466784 3300005457 Bacteria 1050
103 Ga0070662_100784202 3300005457 Bacteria 810
104 Ga0070662_101113450 3300005457 Bacteria 678
105 Ga0070662_101417856 3300005457 Bacteria 599
106 Ga0070662_101955886 3300005457 Bacteria 507
107 Ga0068867_101061423 3300005459 Bacteria 737
108 Ga0070685_10298080 3300005466 Bacteria 1086
109 Ga0070706_100471117 3300005467 Bacteria 1168
110 Ga0070707_101134928 3300005468 Bacteria 748
111 Ga0070698_100020921 3300005471 Bacteria 6855
112 Ga0070698_100069006 3300005471 Bacteria 3551
113 Ga0070698_100183995 3300005471 Bacteria 2027
114 Ga0070698_101941342 3300005471 Bacteria 542
115 Ga0070699_100185071 3300005518 Bacteria 1849
116 Ga0070684_100182637 3300005535 Bacteria 1908
117 Ga0070684_100293314 3300005535 Bacteria 1491
118 Ga0070684_100695765 3300005535 Bacteria 947
119 Ga0070684_101450315 3300005535 Bacteria 647
120 Ga0070697_100060437 3300005536 Bacteria 3089
121 Ga0070697_100911186 3300005536 Bacteria 780
122 Ga0068853_100286912 3300005539 Bacteria 1518
123 Ga0068853_100912865 3300005539 Bacteria 844
124 Ga0070672_100296536 3300005543 Bacteria 1370
125 Ga0070672_100320053 3300005543 Bacteria 1318
126 Ga0070695_101903205 3300005545 Bacteria 500
127 Ga0070693_100205218 3300005547 Bacteria 1282
128 Ga0070693_101035927 3300005547 Bacteria 623
129 Ga0070665_100971977 3300005548 Bacteria 862
130 Ga0070665_101939604 3300005548 Bacteria 594
131 Ga0070704_101787462 3300005549 Bacteria 569
132 Ga0068855_100630693 3300005563 Bacteria 1153
133 Ga0070664_101452530 3300005564 Bacteria 649
134 Ga0068857_100493991 3300005577 Bacteria 1148
135 Ga0068857_101275372 3300005577 Bacteria 713
136 Ga0068854_101599800 3300005578 Bacteria 594
137 Ga0068856_100569818 3300005614 Bacteria 1153
138 Ga0068856_102161422 3300005614 Bacteria 566
139 Ga0070702_100156947 3300005615 Bacteria 1466
140 Ga0070702_100201224 3300005615 Bacteria 1318
141 Ga0070702_101367788 3300005615 Bacteria 578
142 Ga0068852_100153229 3300005616 Bacteria 2145
143 Ga0068852_100395299 3300005616 Bacteria 1359
144 Ga0068852_100645393 3300005616 Bacteria 1066
145 Ga0068852_100666133 3300005616 Bacteria 1049
146 Ga0068852_100790617 3300005616 Bacteria 962
147 Ga0068864_101609751 3300005618 Bacteria 653
148 Ga0068864_102313612 3300005618 Bacteria 544
149 Ga0068866_11125236 3300005718 Bacteria 563
150 Ga0068861_100012521 3300005719 Bacteria 5917
151 Ga0068861_100282735 3300005719 Bacteria 1429
152 Ga0068861_100513312 3300005719 Bacteria 1086
153 Ga0068861_101792514 3300005719 Bacteria 609
154 Ga0068861_101811761 3300005719 Bacteria 606
155 Ga0068851_10415460 3300005834 Bacteria 794
156 Ga0068870_10197818 3300005840 Bacteria 1217
157 Ga0068870_10606301 3300005840 Bacteria 744
158 Ga0068863_100524148 3300005841 Bacteria 1168
159 Ga0068858_100146607 3300005842 Bacteria 2217
160 Ga0068858_100644044 3300005842 Bacteria 1030
161 Ga0068860_101350529 3300005843 Bacteria 734
162 Ga0068862_100231939 3300005844 Bacteria 1675
163 Ga0081455_10060081 3300005937 Bacteria 3206
164 Ga0081455_10060828 3300005937 Bacteria 3182
165 Ga0070717_11239366 3300006028 Bacteria 679
166 Ga0070717_11389491 3300006028 Bacteria 638
167 Ga0075365_10020619 3300006038 Bacteria 4091
168 Ga0075365_10050267 3300006038 Bacteria 2749
169 Ga0075365_10059522 3300006038 Bacteria 2546
170 Ga0075365_10065852 3300006038 Bacteria 2429
171 Ga0075365_10075248 3300006038 Bacteria 2278
172 Ga0075365_10393035 3300006038 Bacteria 978
173 Ga0075365_10930423 3300006038 Bacteria 613
174 Ga0075368_10044391 3300006042 Bacteria 1753
175 Ga0075368_10079066 3300006042 Bacteria 1336
176 Ga0075368_10260889 3300006042 Bacteria 742
177 Ga0075363_100015057 3300006048 Bacteria 3793
178 Ga0075363_100021527 3300006048 Bacteria 3249
179 Ga0075363_100229529 3300006048 Bacteria 1065
180 Ga0075363_100429537 3300006048 Bacteria 778
181 Ga0075364_10087465 3300006051 Bacteria 2065
182 Ga0075364_10148049 3300006051 Bacteria 1581
183 Ga0075364_10647691 3300006051 Bacteria 721
184 Ga0075432_10330601 3300006058 Bacteria 641
185 Ga0075362_10451630 3300006177 Bacteria 653
186 Ga0075367_10002048 3300006178 Bacteria 9020
187 Ga0075367_10025702 3300006178 Bacteria 3332
188 Ga0075367_10049721 3300006178 Bacteria 2472
189 Ga0075367_10225041 3300006178 Bacteria 1174
190 Ga0075367_10512255 3300006178 Bacteria 761
191 Ga0075367_10744803 3300006178 Bacteria 623
192 Ga0075366_10731231 3300006195 Bacteria 615
193 Ga0075370_10014839 3300006353 Bacteria 4161
194 Ga0075370_10180306 3300006353 Bacteria 1243
195 Ga0068871_100317943 3300006358 Bacteria 1370
196 Ga0068871_100584129 3300006358 Bacteria 1015
197 Ga0068871_101375018 3300006358 Bacteria 665
198 Ga0075428_100260935 3300006844 Bacteria 1865
199 Ga0075428_100646516 3300006844 Bacteria 1128
200 Ga0075428_101775237 3300006844 Bacteria 643
201 Ga0075430_100502409 3300006846 Bacteria 1001
202 Ga0075431_100033157 3300006847 Bacteria 5322
203 Ga0075433_11545404 3300006852 Bacteria 573
204 Ga0075434_100139910 3300006871 Bacteria 2440
205 Ga0075429_101567449 3300006880 Bacteria 573
206 Ga0068865_100004169 3300006881 Bacteria 8700
207 Ga0068865_100297926 3300006881 Bacteria 1290
208 Ga0068865_100579678 3300006881 Bacteria 946
209 Ga0068865_101617696 3300006881 Bacteria 582
210 Ga0105244_10419995 3300009036 Bacteria 615
211 Ga0111539_10151003 3300009094 Bacteria 2719
212 Ga0111539_10642356 3300009094 Bacteria 1236
213 Ga0111539_10940256 3300009094 Bacteria 1005
214 Ga0111539_11069108 3300009094 Bacteria 938
215 Ga0105245_10249048 3300009098 Bacteria 1725
216 Ga0105245_10531644 3300009098 Bacteria 1196
217 Ga0105245_11425255 3300009098 Bacteria 743
218 Ga0105245_12169899 3300009098 Bacteria 609
219 Ga0105245_12398861 3300009098 Bacteria 581
220 Ga0105245_13015450 3300009098 Bacteria 522
221 Ga0105247_10524934 3300009101 Bacteria 866
222 Ga0114129_10743879 3300009147 Bacteria 1256
223 Ga0114129_10759352 3300009147 Bacteria 1241
224 Ga0105243_10030084 3300009148 Bacteria 4179
225 Ga0105243_10521358 3300009148 Bacteria 1130
226 Ga0105243_12526635 3300009148 Bacteria 553
227 Ga0105243_12982984 3300009148 Bacteria 513
228 Ga0105242_10260974 3300009176 Bacteria 1565
229 Ga0105242_10743478 3300009176 Bacteria 965
230 Ga0105242_11006070 3300009176 Bacteria 842
231 Ga0105242_11192736 3300009176 Bacteria 780
232 Ga0105242_13318279 3300009176 Bacteria 500
233 Ga0105248_13335018 3300009177 Bacteria 510
234 Ga0105237_10412363 3300009545 Bacteria 1356
235 Ga0105237_11209967 3300009545 Bacteria 762
236 Ga0105238_10250200 3300009551 Bacteria 1750
237 Ga0105238_11549406 3300009551 Bacteria 692
238 Ga0105249_10305871 3300009553 Bacteria 1596
239 Ga0105249_10329858 3300009553 Bacteria 1539
240 Ga0105249_10547608 3300009553 Bacteria 1207
241 Ga0105249_11183872 3300009553 Bacteria 835
242 Ga0105239_10609564 3300010375 Bacteria 1245
243 Ga0105239_11119887 3300010375 Bacteria 906
244 Ga0105239_11164300 3300010375 Bacteria 888
245 Ga0105239_12066599 3300010375 Bacteria 662
246 Ga0105246_10323084 3300011119 Bacteria 1255
247 Ga0105246_10479972 3300011119 Bacteria 1051
248 Ga0105246_10669010 3300011119 Bacteria 906
249 Ga0105246_11155406 3300011119 Bacteria 710
250 Ga0157325_1003207 3300012485 Bacteria 887
251 Ga0157329_1012523 3300012491 Bacteria 695
252 Ga0157319_1051975 3300012497 Bacteria 511
253 Ga0157347_1060874 3300012502 Bacteria 540
254 Ga0157338_1005833 3300012515 Bacteria 1120
255 Ga0154019_122374 3300013044 Bacteria 685
256 Ga0157371_10585195 3300013102 Bacteria 829
257 Ga0157371_10768523 3300013102 Bacteria 724
258 Ga0157370_10628559 3300013104 Bacteria 982
259 Ga0157370_11062013 3300013104 Bacteria 732
260 Ga0157369_10894158 3300013105 Bacteria 911
261 Ga0157369_12569122 3300013105 Bacteria 515
262 Ga0157374_10273795 3300013296 Bacteria 1665
263 Ga0157374_11876874 3300013296 Bacteria 625
264 Ga0157378_12540985 3300013297 Bacteria 564
265 Ga0163162_11484571 3300013306 Bacteria 772
266 Ga0163162_12807463 3300013306 Bacteria 561
267 Ga0157372_10059287 3300013307 Bacteria 4281
268 Ga0157372_10172105 3300013307 Bacteria 2506
269 Ga0157372_10503764 3300013307 Bacteria 1412
270 Ga0157372_11027338 3300013307 Bacteria 954
271 Ga0157372_11325455 3300013307 Bacteria 831
272 Ga0157372_11600511 3300013307 Bacteria 750
273 Ga0157372_12529321 3300013307 Bacteria 589
274 Ga0157375_10117822 3300013308 Bacteria 2762
275 Ga0157375_10207102 3300013308 Bacteria 2118
276 Ga0157375_11302756 3300013308 Bacteria 854
277 Ga0157375_11327476 3300013308 Bacteria 846
278 Ga0157375_11441689 3300013308 Bacteria 812
279 Ga0157375_11868773 3300013308 Bacteria 713
280 Ga0157375_13114082 3300013308 Bacteria 553
281 Ga0163163_10092876 3300014325 Bacteria 3033
282 Ga0163163_10184171 3300014325 Bacteria 2136
283 Ga0163163_11908767 3300014325 Bacteria 654
284 Ga0157380_10390506 3300014326 Bacteria 1317
285 Ga0157380_11114894 3300014326 Bacteria 829
286 Ga0182008_10010166 3300014497 Bacteria 5042
287 Ga0182008_10108171 3300014497 Bacteria 1377
288 Ga0182008_10156609 3300014497 Bacteria 1144
289 Ga0182008_10189306 3300014497 Bacteria 1044
290 Ga0182008_10268822 3300014497 Bacteria 884
291 Ga0157377_11327930 3300014745 Bacteria 563
292 Ga0157379_10959986 3300014968 Bacteria 813
293 Ga0157379_11596800 3300014968 Bacteria 637
294 Ga0157376_10220883 3300014969 Bacteria 1755
295 Ga0157376_10264018 3300014969 Bacteria 1614
296 Ga0157376_11286300 3300014969 Bacteria 761
297 Ga0157376_11928956 3300014969 Bacteria 628
298 Ga0182006_1011838 3300015261 Bacteria 3823
299 Ga0182006_1161826 3300015261 Bacteria 754
300 Ga0182007_10000257 3300015262 Bacteria 35765
301 Ga0182005_1049585 3300015265 Bacteria 1141
302 Ga0183367_1006 3300015688 Bacteria 648044
303 Ga0163161_10036002 3300017792 Bacteria 3544
304 Ga0163161_10046953 3300017792 Bacteria 3117
305 Ga0163161_10886545 3300017792 Bacteria 755
306 Ga0163161_11009518 3300017792 Bacteria 711
307 Ga0163161_11415791 3300017792 Bacteria 608
308 Ga0197907_10010884 3300020069 Bacteria 910
309 Ga0197907_10100526 3300020069 Bacteria 676
310 Ga0197907_10162151 3300020069 Bacteria 859
311 Ga0197907_10423704 3300020069 Bacteria 1133
312 Ga0197907_10445121 3300020069 Bacteria 625
313 Ga0197907_10580340 3300020069 Bacteria 504
314 Ga0197907_10881272 3300020069 Bacteria 763
315 Ga0197907_11016439 3300020069 Bacteria 738
316 Ga0206356_10271762 3300020070 Bacteria 823
317 Ga0206356_10339076 3300020070 Bacteria 742
318 Ga0206356_10857575 3300020070 Bacteria 544
319 Ga0206356_10936297 3300020070 Bacteria 589
320 Ga0206356_11242763 3300020070 Bacteria 814
321 Ga0206356_11403629 3300020070 Bacteria 548
322 Ga0206356_11461478 3300020070 Bacteria 1088
323 Ga0206356_11471271 3300020070 Bacteria 757
324 Ga0206356_11747499 3300020070 Bacteria 689
325 Ga0206356_11764094 3300020070 Bacteria 569
326 Ga0206349_1064364 3300020075 Bacteria 702
327 Ga0206349_1321983 3300020075 Bacteria 651
328 Ga0206349_1598135 3300020075 Bacteria 860
329 Ga0206349_1620869 3300020075 Bacteria 1072
330 Ga0206349_1646901 3300020075 Bacteria 688
331 Ga0206349_1726464 3300020075 Bacteria 606
332 Ga0206349_1944080 3300020075 Bacteria 661
333 Ga0206355_1004665 3300020076 Bacteria 1216
334 Ga0206355_1045632 3300020076 Bacteria 533
335 Ga0206355_1081111 3300020076 Bacteria 684
336 Ga0206355_1085433 3300020076 Bacteria 1620
337 Ga0206355_1165990 3300020076 Bacteria 776
338 Ga0206355_1174712 3300020076 Bacteria 823
339 Ga0206355_1185040 3300020076 Bacteria 811
340 Ga0206355_1198663 3300020076 Bacteria 675
341 Ga0206355_1203687 3300020076 Bacteria 720
342 Ga0206355_1650912 3300020076 Bacteria 1245
343 Ga0206351_10026933 3300020077 Bacteria 740
344 Ga0206351_10121054 3300020077 Bacteria 827
345 Ga0206351_10470376 3300020077 Bacteria 770
346 Ga0206351_10495102 3300020077 Bacteria 819
347 Ga0206352_10057118 3300020078 Bacteria 741
348 Ga0206352_10160481 3300020078 Bacteria 717
349 Ga0206352_10319419 3300020078 Bacteria 502
350 Ga0206352_10701397 3300020078 Bacteria 660
351 Ga0206352_11027925 3300020078 Bacteria 573
352 Ga0206350_10120654 3300020080 Bacteria 747
353 Ga0206350_10126363 3300020080 Bacteria 517
354 Ga0206350_10593967 3300020080 Bacteria 636
355 Ga0206350_10633254 3300020080 Bacteria 727
356 Ga0206350_10703881 3300020080 Bacteria 618
357 Ga0206354_10117707 3300020081 Bacteria 795
358 Ga0206354_10150451 3300020081 Bacteria 1615
359 Ga0206354_10188052 3300020081 Bacteria 666
360 Ga0206354_10455429 3300020081 Bacteria 957
361 Ga0206354_10514478 3300020081 Bacteria 645
362 Ga0206354_10570582 3300020081 Bacteria 816
363 Ga0206354_10685371 3300020081 Bacteria 735
364 Ga0206354_10807495 3300020081 Bacteria 854
365 Ga0206354_10823330 3300020081 Bacteria 708
366 Ga0206354_10884654 3300020081 Bacteria 615
367 Ga0206354_11030020 3300020081 Bacteria 1310
368 Ga0206354_11280122 3300020081 Bacteria 517
369 Ga0206354_11465456 3300020081 Bacteria 2695
370 Ga0206354_11499587 3300020081 Bacteria 731
371 Ga0206354_11571020 3300020081 Bacteria 862
372 Ga0206353_10517557 3300020082 Bacteria 1025
373 Ga0206353_10665903 3300020082 Bacteria 925
374 Ga0206353_10902826 3300020082 Bacteria 505
375 Ga0206353_11170554 3300020082 Bacteria 5234
376 Ga0206353_11903580 3300020082 Bacteria 765
377 Ga0154015_1405206 3300020610 Bacteria 758
378 Ga0154015_1487719 3300020610 Bacteria 588
379 Ga0154015_1567755 3300020610 Bacteria 836
380 Ga0224712_10137350 3300022467 Bacteria 1073
381 Ga0224712_10182418 3300022467 Bacteria 946
382 Ga0224712_10249337 3300022467 Bacteria 820
383 Ga0224712_10339589 3300022467 Bacteria 708
384 Ga0224712_10357098 3300022467 Bacteria 691
385 Ga0207656_10467683 3300025321 Bacteria 638
386 Ga0207682_10334667 3300025893 Bacteria 712
387 Ga0207642_10262575 3300025899 Bacteria 985
388 Ga0207642_10973417 3300025899 Bacteria 546
389 Ga0207710_10223626 3300025900 Bacteria 935
390 Ga0207688_10025596 3300025901 Bacteria 3242
391 Ga0207688_10311213 3300025901 Bacteria 964
392 Ga0207688_10813352 3300025901 Bacteria 592
393 Ga0207647_10489695 3300025904 Bacteria 686
394 Ga0207647_10547097 3300025904 Bacteria 642
395 Ga0207645_10797813 3300025907 Bacteria 642
396 Ga0207643_10495500 3300025908 Bacteria 781
397 Ga0207684_11153748 3300025910 Bacteria 643
398 Ga0207654_10215980 3300025911 Bacteria 1269
399 Ga0207671_10074558 3300025914 Bacteria 2536
400 Ga0207662_10214551 3300025918 Bacteria 1251
401 Ga0207662_10369830 3300025918 Bacteria 966
402 Ga0207657_10019609 3300025919 Bacteria 6414
403 Ga0207646_10272029 3300025922 Bacteria 1531
404 Ga0207694_10835467 3300025924 Bacteria 778
405 Ga0207650_10559646 3300025925 Bacteria 959
406 Ga0207650_11223413 3300025925 Bacteria 639
407 Ga0207687_10037459 3300025927 Bacteria 3309
408 Ga0207687_11278374 3300025927 Bacteria 631
409 Ga0207700_10390082 3300025928 Bacteria 1219
410 Ga0207644_11775000 3300025931 Bacteria 516
411 Ga0207690_10012467 3300025932 Bacteria 5084
412 Ga0207690_10509924 3300025932 Bacteria 974
413 Ga0207690_10576743 3300025932 Bacteria 916
414 Ga0207690_11704268 3300025932 Bacteria 526
415 Ga0207706_10503447 3300025933 Bacteria 1045
416 Ga0207706_10685248 3300025933 Bacteria 876
417 Ga0207706_11493515 3300025933 Bacteria 551
418 Ga0207686_10742607 3300025934 Bacteria 783
419 Ga0207709_10045382 3300025935 Bacteria 2661
420 Ga0207709_10057256 3300025935 Bacteria 2416
421 Ga0207709_10279604 3300025935 Bacteria 1232
422 Ga0207670_10143275 3300025936 Bacteria 1764
423 Ga0207669_10814544 3300025937 Bacteria 775
424 Ga0207704_10013539 3300025938 Bacteria 4085
425 Ga0207704_10890107 3300025938 Bacteria 748
426 Ga0207691_10004838 3300025940 Bacteria 13020
427 Ga0207691_10585265 3300025940 Bacteria 945
428 Ga0207661_10005390 3300025944 Bacteria 9006
429 Ga0207661_10134557 3300025944 Bacteria 2122
430 Ga0207661_10147369 3300025944 Bacteria 2032
431 Ga0207661_10152040 3300025944 Bacteria 2001
432 Ga0207661_10816864 3300025944 Bacteria 858
433 Ga0207679_10911350 3300025945 Bacteria 804
434 Ga0207679_12078591 3300025945 Bacteria 516
435 Ga0207667_10365360 3300025949 Bacteria 1471
436 Ga0207712_10124511 3300025961 Bacteria 1955
437 Ga0207712_10226840 3300025961 Bacteria 1497
438 Ga0207712_10281262 3300025961 Bacteria 1358
439 Ga0207712_10491982 3300025961 Bacteria 1047
440 Ga0207712_10877630 3300025961 Bacteria 792
441 Ga0207668_10242452 3300025972 Bacteria 1459
442 Ga0207668_11046612 3300025972 Bacteria 731
443 Ga0207658_10688307 3300025986 Bacteria 923
444 Ga0207658_11391538 3300025986 Bacteria 642
445 Ga0207677_10534068 3300026023 Bacteria 1019
446 Ga0207677_11208663 3300026023 Bacteria 692
447 Ga0207639_10362230 3300026041 Bacteria 1298
448 Ga0207639_10698485 3300026041 Bacteria 941
449 Ga0207639_10803461 3300026041 Bacteria 877
450 Ga0207639_11880463 3300026041 Bacteria 559
451 Ga0207639_12160881 3300026041 Bacteria 518
452 Ga0207678_10083431 3300026067 Bacteria 2733
453 Ga0207678_10337552 3300026067 Bacteria 1298
454 Ga0207678_10407772 3300026067 Bacteria 1177
455 Ga0207678_11061938 3300026067 Bacteria 717
456 Ga0207708_10160824 3300026075 Bacteria 1773
457 Ga0207708_10433952 3300026075 Bacteria 1091
458 Ga0207702_11163541 3300026078 Bacteria 765
459 Ga0207648_10648988 3300026089 Bacteria 975
460 Ga0207648_10666245 3300026089 Bacteria 962
461 Ga0207676_10637908 3300026095 Bacteria 1027
462 Ga0207676_11279424 3300026095 Bacteria 728
463 Ga0207676_12342142 3300026095 Bacteria 531
464 Ga0207674_10346220 3300026116 Bacteria 1437
465 Ga0207675_100005816 3300026118 Bacteria 11783
466 Ga0207675_100334858 3300026118 Bacteria 1480
467 Ga0207675_100574327 3300026118 Bacteria 1128
468 Ga0207675_100873753 3300026118 Bacteria 915
469 Ga0207675_101478482 3300026118 Bacteria 700
470 Ga0207683_10133865 3300026121 Bacteria 2230
471 Ga0207683_10262477 3300026121 Bacteria 1577
472 Ga0207683_10707569 3300026121 Bacteria 934
473 Ga0207683_11115472 3300026121 Bacteria 732
474 Ga0207698_10165197 3300026142 Bacteria 1942
475 Ga0207698_10595557 3300026142 Bacteria 1089
476 Ga0207698_10633966 3300026142 Bacteria 1057
477 Ga0207698_12399362 3300026142 Bacteria 538
478 Ga0209371_1053740 3300027312 Bacteria 763
479 Ga0209813_10048110 3300027866 Bacteria 1323
480 Ga0209813_10182124 3300027866 Bacteria 769
481 Ga0209974_10188801 3300027876 Bacteria 757
482 Ga0207428_10021772 3300027907 Bacteria 5423
483 Ga0207428_10812545 3300027907 Bacteria 664
484 Ga0207428_11101326 3300027907 Bacteria 555
485 Ga0268266_10724679 3300028379 Bacteria 959
486 Ga0268266_10939358 3300028379 Bacteria 837
487 Ga0268265_10077732 3300028380 Bacteria 2608
488 Ga0268265_10603979 3300028380 Bacteria 1049
489 Ga0268256_1033589 3300030500 Bacteria 1210
490 Ga0316177_1045098 3300030731 Bacteria 876
491 Ga0314311_1173936 3300030733 Bacteria 1864
492 Ga0316178_1165051 3300030735 Bacteria 562
493 Ga0316178_1179262 3300030735 Bacteria 656
494 Ga0316181_1041643 3300030744 Bacteria 1009
495 Ga0316182_1346959 3300030745 Bacteria 1290
496 Ga0265767_113894 3300030836 Bacteria 569
497 Ga0307408_100293410 3300031548 Bacteria 1359
498 Ga0307408_100376247 3300031548 Bacteria 1213
499 Ga0307408_100706609 3300031548 Bacteria 907
500 Ga0307408_100964583 3300031548 Bacteria 784
501 Ga0307408_102018325 3300031548 Bacteria 555
502 Ga0307405_10340997 3300031731 Bacteria 1152
503 Ga0307405_11249360 3300031731 Bacteria 644
504 Ga0307413_10449709 3300031824 Bacteria 1022
505 Ga0307413_10775499 3300031824 Bacteria 804
506 Ga0307413_10848997 3300031824 Bacteria 771
507 Ga0307413_11451754 3300031824 Bacteria 605
508 Ga0307413_11621239 3300031824 Bacteria 575
509 Ga0307413_12017882 3300031824 Bacteria 520
510 Ga0307410_10009256 3300031852 Bacteria 5515
511 Ga0307410_10042196 3300031852 Bacteria 3014
512 Ga0307410_10781796 3300031852 Bacteria 810
513 Ga0307410_11601633 3300031852 Bacteria 575
514 Ga0326468_10039036 3300031889 Bacteria 669
515 Ga0307406_10106069 3300031901 Bacteria 1924
516 Ga0307406_10224293 3300031901 Bacteria 1399
517 Ga0307407_10079818 3300031903 Bacteria 1975
518 Ga0307407_10377044 3300031903 Bacteria 1012
519 Ga0307407_10721502 3300031903 Bacteria 752
520 Ga0307412_10012017 3300031911 Bacteria 5031
521 Ga0307412_10135001 3300031911 Bacteria 1799
522 Ga0307412_10232109 3300031911 Bacteria 1421
523 Ga0307412_10257585 3300031911 Bacteria 1358
524 Ga0307412_10615273 3300031911 Bacteria 922
525 Ga0307412_11329918 3300031911 Bacteria 648
526 Ga0307412_11724866 3300031911 Bacteria 574
527 Ga0307409_100253434 3300031995 Bacteria 1610
528 Ga0307409_100323991 3300031995 Bacteria 1443
529 Ga0307409_100387487 3300031995 Bacteria 1331
530 Ga0307409_100462385 3300031995 Bacteria 1227
531 Ga0307409_100467320 3300031995 Bacteria 1221
532 Ga0307409_100531778 3300031995 Bacteria 1150
533 Ga0307409_100653745 3300031995 Bacteria 1045
534 Ga0307409_100738501 3300031995 Bacteria 987
535 Ga0307409_100760817 3300031995 Bacteria 973
536 Ga0307409_101266058 3300031995 Bacteria 762
537 Ga0307416_100023381 3300032002 Bacteria 4484
538 Ga0307416_100051292 3300032002 Bacteria 3294
539 Ga0307416_100274016 3300032002 Bacteria 1659
540 Ga0307416_101119485 3300032002 Bacteria 892
541 Ga0307416_101425278 3300032002 Bacteria 798
542 Ga0307416_101833458 3300032002 Bacteria 710
543 Ga0307416_102888590 3300032002 Bacteria 575
544 Ga0307416_103412945 3300032002 Bacteria 532
545 Ga0307414_10316611 3300032004 Bacteria 1326
546 Ga0307414_10365454 3300032004 Bacteria 1243
547 Ga0307414_10491897 3300032004 Bacteria 1084
548 Ga0307414_10970337 3300032004 Bacteria 781
549 Ga0307414_11686443 3300032004 Bacteria 591
550 Ga0307411_10206703 3300032005 Bacteria 1512
551 Ga0307411_10542227 3300032005 Bacteria 991
552 Ga0307411_10546767 3300032005 Bacteria 987
553 Ga0307411_11416603 3300032005 Bacteria 636
554 Ga0307415_100025195 3300032126 Bacteria 3728
555 Ga0307415_100107212 3300032126 Bacteria 2064
556 Ga0307415_100139115 3300032126 Bacteria 1851
557 Ga0307415_100139360 3300032126 Bacteria 1850
558 Ga0307415_100391562 3300032126 Bacteria 1183
559 Ga0307415_102032379 3300032126 Bacteria 560
560 Ga0373948_0159127 3300034817 Bacteria 569
561 Ga0373959_0073073 3300034820 Bacteria 778
562 Ga0373938_0058549 3300034957 Bacteria 896
563 Ga0373932_0215705 3300035112 Bacteria 688
564 Ga0373941_0088401 3300035115 Bacteria 1059
565 Ga0373961_0259592 3300035241 Bacteria 631
566 Ga0373935_0420804 3300035692 Bacteria 962
567 Ga0373927_0914518 3300035695 Bacteria 579
568 Ga0395899_0080716 3300037312 Bacteria 2367
569 Ga0395900_0234898 3300037418 Bacteria 1842
570 Ga0395900_1006335 3300037418 Bacteria 753
571 Ga0395898_0009689 3300037466 Bacteria 10101
572 Ga0395898_1091356 3300037466 Bacteria 732
573 Ga0395905_0522861 3300037471 Bacteria 1087
574 Ga0436364_1007385 3300037853 Bacteria 16796
575 Ga0395901_0017303 3300038443 Bacteria 7358
576 Ga0395901_0171557 3300038443 Bacteria 2276
577 Ga0395901_0252907 3300038443 Bacteria 1835
578 Ga0395901_0903212 3300038443 Bacteria 865
579 Ga0242420_089934 3300038996 Bacteria 643
580 Ga0439438_036869 3300041405 Bacteria 1280
581 Ga0439461_0013684 3300041410 Bacteria 1534
582 Ga0439461_0049830 3300041410 Bacteria 926
583 Ga0439466_0186302 3300041411 Bacteria 632
584 Ga0439465_0212643 3300041413 Bacteria 707
585 Ga0439465_0437567 3300041413 Bacteria 500
586 Ga0451789_0153543 3300041443 Bacteria 779
587 Ga0451791_1527912 3300041451 Bacteria 770
588 Ga0451793_1573171 3300041452 Bacteria 507
589 Ga0451797_0012973 3300041453 Bacteria 721
590 Ga0451797_1419428 3300041453 Bacteria 712
591 Ga0451795_1254865 3300041456 Bacteria 554
592 Ga0451800_0914374 3300041459 Bacteria 644
593 Ga0451800_1586772 3300041459 Bacteria 531
594 Ga0451806_447833 3300041462 Bacteria 600
595 Ga0451807_0661331 3300041486 Bacteria 769
596 Ga0451835_0266313 3300041492 Bacteria 807
597 Ga0451837_0825915 3300041494 Bacteria 881
598 Ga0451837_1659218 3300041494 Bacteria 893
599 Ga0451839_0489610 3300041496 Bacteria 748
600 Ga0451841_0727502 3300041498 Bacteria 1497
601 Ga0451841_1160484 3300041498 Bacteria 525
602 Ga0451851_0096184 3300041507 Bacteria 679
603 Ga0451843_0926354 3300041509 Bacteria 537
604 Ga0451843_1549413 3300041509 Bacteria 1692
605 Ga0451855_0881732 3300041511 Bacteria 718
606 Ga0451853_0300070 3300041512 Bacteria 629
607 Ga0451853_0980644 3300041512 Bacteria 604
608 Ga0439431_0009865 3300041997 Bacteria 2161
609 Ga0439445_0043816 3300042004 Bacteria 1195
610 Ga0439452_126350 3300042010 Bacteria 543
611 Ga0450920_060327 3300042122 Bacteria 766
612 Ga0450907_004399 3300042146 Bacteria 2435
613 Ga0450907_049964 3300042146 Bacteria 719
614 Ga0439446_0023771 3300042156 Bacteria 1745
615 Ga0450908_110271 3300042184 Bacteria 508
616 Ga0439434_0007913 3300042435 Bacteria 3117
617 Ga0466969_0008402 3300044656 Bacteria 5475
618 Ga0466969_0020970 3300044656 Bacteria 3380
619 Ga0466969_0117977 3300044656 Bacteria 1237
620 Ga0466969_0480291 3300044656 Bacteria 566
621 Ga0466972_0114456 3300044658 Bacteria 1274
622 Ga0466972_0193084 3300044658 Bacteria 954
623 Ga0466965_0023797 3300044683 Bacteria 2959
624 Ga0466965_0024478 3300044683 Bacteria 2921
625 Ga0466965_0128522 3300044683 Bacteria 1312
626 Ga0466966_0001007 3300044684 Bacteria 17992
627 Ga0466966_0026977 3300044684 Bacteria 3746
628 Ga0466966_0243809 3300044684 Bacteria 1083
629 Ga0466966_0433986 3300044684 Bacteria 790
630 Ga0466966_0450983 3300044684 Bacteria 773
631 Ga0466966_0622853 3300044684 Bacteria 650
632 Ga0466966_0805136 3300044684 Bacteria 566
633 Ga0466961_0006966 3300044693 Bacteria 7190
634 Ga0466961_0025062 3300044693 Bacteria 3838
635 Ga0466961_0102651 3300044693 Bacteria 1801
636 Ga0466961_0205714 3300044693 Bacteria 1216
637 Ga0466961_0285234 3300044693 Bacteria 1010
638 Ga0466961_0349237 3300044693 Bacteria 900
639 Ga0466961_0899765 3300044693 Bacteria 527
640 Ga0466963_0023179 3300044694 Bacteria 3937
641 Ga0466963_0059063 3300044694 Bacteria 2559
642 Ga0466963_0130406 3300044694 Bacteria 1736
643 Ga0466963_0133911 3300044694 Bacteria 1714
644 Ga0466963_0228265 3300044694 Bacteria 1304
645 Ga0466963_1245814 3300044694 Bacteria 522
646 Ga0466963_1313944 3300044694 Bacteria 507
647 Ga0466964_0006469 3300044706 Bacteria 4368
648 Ga0466964_0049478 3300044706 Bacteria 1721
649 Ga0466964_0306581 3300044706 Bacteria 802
650 Ga0466971_0002183 3300044719 Bacteria 8272
651 Ga0466971_0067901 3300044719 Bacteria 1616
652 Ga0466971_0258605 3300044719 Bacteria 830
653 Ga0466968_0134486 3300044735 Bacteria 1127
654 Ga0466968_0276370 3300044735 Bacteria 803
655 Ga0466968_0632702 3300044735 Bacteria 542
656 Ga0466970_0013504 3300044765 Bacteria 4188
657 Ga0466970_0037477 3300044765 Bacteria 2570
658 Ga0466970_0276749 3300044765 Bacteria 943
659 Ga0466970_0476848 3300044765 Bacteria 717
660 Ga0466970_0601109 3300044765 Bacteria 638
661 Ga0466957_0099778 3300044842 Bacteria 1829
662 Ga0466957_0259216 3300044842 Bacteria 1158
663 Ga0466957_0312129 3300044842 Bacteria 1059
664 Ga0466957_0445139 3300044842 Bacteria 892
665 Ga0466957_0693173 3300044842 Bacteria 718
666 Ga0466957_0977386 3300044842 Bacteria 607
667 Ga0466960_0055686 3300044901 Bacteria 1923
668 Ga0466960_0084952 3300044901 Bacteria 1602
669 Ga0466960_0284489 3300044901 Bacteria 927
670 Ga0466960_0352295 3300044901 Bacteria 840
671 Ga0466960_0436731 3300044901 Bacteria 759
672 Ga0466960_0566361 3300044901 Bacteria 671
673 Ga0466959_0007811 3300045049 Bacteria 7527
674 Ga0466959_0037699 3300045049 Bacteria 3572
675 Ga0466959_0162764 3300045049 Bacteria 1568
676 Ga0466959_0264484 3300045049 Bacteria 1183
677 Ga0466959_0368784 3300045049 Bacteria 978
678 Ga0466959_1028123 3300045049 Bacteria 548
679 Ga0466958_0312071 3300045836 Bacteria 1010
680 Ga0466958_0430331 3300045836 Bacteria 853
681 Ga0466958_0576461 3300045836 Bacteria 731
682 Ga0466958_0989157 3300045836 Bacteria 549
683 Ga0466967_0005383 3300045976 Bacteria 8861
684 Ga0466967_0023415 3300045976 Bacteria 5060
685 Ga0466967_0052461 3300045976 Bacteria 3579
686 Ga0466967_0094127 3300045976 Bacteria 2727
687 Ga0466967_0183131 3300045976 Bacteria 1976
688 Ga0466967_0273860 3300045976 Bacteria 1618
689 Ga0466967_0295415 3300045976 Bacteria 1557
690 Ga0466967_0378891 3300045976 Bacteria 1373
691 Ga0466967_0665346 3300045976 Bacteria 1030
692 Ga0466967_0943155 3300045976 Bacteria 859
693 Ga0466967_1589754 3300045976 Bacteria 651
694 Ga0495627_076005 3300046453 Bacteria 977
695 Ga0495603_0038876 3300046455 Bacteria 2852
696 Ga0495603_0157309 3300046455 Bacteria 1319
697 Ga0495629_0286904 3300046459 Bacteria 1129
698 Ga0495629_0292279 3300046459 Bacteria 1117
699 Ga0495641_0053880 3300046461 Bacteria 1829
700 Ga0495641_0289754 3300046461 Bacteria 737
701 Ga0495653_0164882 3300046463 Bacteria 1535
702 Ga0495653_0653209 3300046463 Bacteria 642
703 Ga0495582_0174195 3300046473 Bacteria 1225
704 Ga0495582_0442341 3300046473 Bacteria 750
705 Ga0495639_0296446 3300046475 Bacteria 806
706 Ga0495664_0900376 3300046477 Bacteria 517
707 Ga0495584_0040319 3300046491 Bacteria 2358
708 Ga0495585_0479363 3300046492 Bacteria 593
709 Ga0495594_0892398 3300046499 Bacteria 500
710 Ga0495608_0646085 3300046511 Bacteria 632
711 Ga0495644_0163773 3300046523 Bacteria 853
712 Ga0495663_0098378 3300046525 Bacteria 961
713 Ga0495666_0290213 3300046526 Bacteria 741
714 Ga0495642_0091206 3300046528 Bacteria 1290
715 Ga0495652_0477682 3300046529 Bacteria 868
716 Ga0495652_0945846 3300046529 Bacteria 566
717 Ga0495665_0286646 3300046531 Bacteria 844
718 Ga0495640_0479897 3300046533 Bacteria 758
719 Ga0495598_0345565 3300046537 Bacteria 572
720 Ga0495609_0178380 3300046538 Bacteria 895
721 Ga0495621_0193659 3300046539 Bacteria 816
722 Ga0495667_0359825 3300046559 Bacteria 919
723 Ga0495656_0123817 3300046615 Bacteria 1223
724 Ga0495668_0587995 3300046616 Bacteria 615
725 Ga0495635_0074159 3300046663 Bacteria 2331
726 Ga0495661_0361097 3300046665 Bacteria 713
727 Ga0495588_0021810 3300046674 Bacteria 3160
728 Ga0495588_0034853 3300046674 Bacteria 2548
729 Ga0495588_0387479 3300046674 Bacteria 734
730 Ga0495657_0073773 3300046675 Bacteria 2221
731 Ga0495647_0206755 3300046681 Bacteria 862
732 Ga0495658_0317101 3300046683 Bacteria 988
733 Ga0495669_0460494 3300046684 Bacteria 618
734 Ga0495613_0352271 3300046689 Bacteria 1011
735 Ga0495624_0222345 3300046690 Bacteria 1145
736 Ga0495600_0157529 3300046809 Bacteria 1469
737 Ga0495600_0310100 3300046809 Bacteria 994
738 Ga0495581_0347457 3300047315 Bacteria 866
739 Ga0495636_0211944 3300047318 Bacteria 887
740 Ga0495636_0621869 3300047318 Bacteria 529
741 Ga0495676_0019766 3300047321 Bacteria 5921
742 Ga0495676_0348583 3300047321 Bacteria 990
743 Ga0495676_0368058 3300047321 Bacteria 958
744 Ga0495680_0828233 3300047322 Bacteria 603
745 Ga0495675_0074917 3300047444 Bacteria 2133
746 Ga0495677_0055559 3300047445 Bacteria 1462
747 Ga0495679_190768 3300047446 Bacteria 541
748 Ga0495685_048654 3300047447 Bacteria 1441
749 Ga0495614_0643088 3300048089 Bacteria 511
750 Ga0496100_0084513 3300048903 Bacteria 2151
751 Ga0496100_0206070 3300048903 Bacteria 1436
752 Ga0496100_0335971 3300048903 Bacteria 1138
753 Ga0496100_0503393 3300048903 Bacteria 933
754 Ga0496101_0069312 3300048904 Bacteria 2580
755 Ga0496101_0315315 3300048904 Bacteria 1226
756 Ga0496102_0244649 3300048905 Bacteria 1691
757 Ga0496102_0280539 3300048905 Bacteria 1570
758 Ga0496102_0829722 3300048905 Bacteria 847
759 Ga0496103_0025062 3300048906 Bacteria 3602
760 Ga0496103_0076288 3300048906 Bacteria 2103
761 Ga0496103_0123938 3300048906 Bacteria 1647
762 Ga0496103_1052964 3300048906 Bacteria 505
763 Ga0496104_0286302 3300048907 Bacteria 1560
764 Ga0496104_0538679 3300048907 Bacteria 1078
765 Ga0496105_0004021 3300048908 Bacteria 10999
766 Ga0496105_0319417 3300048908 Bacteria 1245
767 Ga0496106_0011919 3300048909 Bacteria 6419
768 Ga0496106_0054636 3300048909 Bacteria 3017
769 Ga0496106_0534215 3300048909 Bacteria 941
770 Ga0496106_0865133 3300048909 Bacteria 715
771 Ga0496107_0004467 3300048910 Bacteria 9484
772 Ga0496107_0044951 3300048910 Bacteria 3176
773 Ga0496107_0243886 3300048910 Bacteria 1337
774 Ga0496107_0777957 3300048910 Bacteria 701
775 Ga0496107_0975642 3300048910 Bacteria 616
776 Ga0496108_0082588 3300048911 Bacteria 2725
777 Ga0496108_0174124 3300048911 Bacteria 1862
778 Ga0496108_0252756 3300048911 Bacteria 1533
779 Ga0496108_0302077 3300048911 Bacteria 1394
780 Ga0496108_0306622 3300048911 Bacteria 1383
781 Ga0496108_0610392 3300048911 Bacteria 950
782 Ga0496108_0812070 3300048911 Bacteria 806
783 Ga0496108_1262806 3300048911 Bacteria 622
784 Ga0496109_0012536 3300048912 Bacteria 7318
785 Ga0496109_0039506 3300048912 Bacteria 4271
786 Ga0496109_0049936 3300048912 Bacteria 3810
787 Ga0496109_0074843 3300048912 Bacteria 3113
788 Ga0496109_0188724 3300048912 Bacteria 1936
789 Ga0496109_0328612 3300048912 Bacteria 1443
790 Ga0496109_0442065 3300048912 Bacteria 1228
791 Ga0496109_0675222 3300048912 Bacteria 970
792 Ga0496109_1279193 3300048912 Bacteria 670
793 Ga0496110_0072144 3300048913 Bacteria 3063
794 Ga0496110_0477572 3300048913 Bacteria 1136
795 Ga0496110_0543247 3300048913 Bacteria 1056
796 Ga0496110_0566733 3300048913 Bacteria 1031
797 Ga0496110_0826452 3300048913 Bacteria 831
798 Ga0496110_0887940 3300048913 Bacteria 797
799 Ga0496110_1318934 3300048913 Bacteria 631
800 Ga0496111_0082292 3300048914 Bacteria 2351
801 Ga0496111_0098485 3300048914 Bacteria 2147
802 Ga0496111_0816564 3300048914 Bacteria 674
803 Ga0496112_0327452 3300048915 Bacteria 1476
804 Ga0496112_0956987 3300048915 Bacteria 777
805 Ga0496113_0134702 3300048916 Bacteria 1940
806 Ga0496113_0553532 3300048916 Bacteria 923
807 Ga0496113_0934413 3300048916 Bacteria 685
808 Ga0496113_1302893 3300048916 Bacteria 565
809 Ga0496113_1555388 3300048916 Bacteria 510
810 Ga0496114_0001671 3300048917 Bacteria 16838
811 Ga0496114_0006007 3300048917 Bacteria 9554
812 Ga0496114_0068005 3300048917 Bacteria 2990
813 Ga0496114_0076549 3300048917 Bacteria 2819
814 Ga0496114_0443641 3300048917 Bacteria 1149
815 Ga0496114_0815233 3300048917 Bacteria 812
816 Ga0496115_0001227 3300048918 Bacteria 18411
817 Ga0496115_0297740 3300048918 Bacteria 1322
818 Ga0496124_0776053 3300048927 Bacteria 597
819 Ga0501306_001808 3300049127 Bacteria 2084
820 Ga0501306_013656 3300049127 Bacteria 1062
821 Ga0501306_016836 3300049127 Bacteria 986
822 Ga0501306_017358 3300049127 Bacteria 976
823 Ga0501306_020215 3300049127 Bacteria 924
824 Ga0501306_029031 3300049127 Bacteria 813
825 Ga0501306_035807 3300049127 Bacteria 754
826 Ga0501306_062970 3300049127 Bacteria 614
827 Ga0501308_021624 3300049128 Bacteria 809
828 Ga0501308_021633 3300049128 Bacteria 809
829 Ga0501308_023877 3300049128 Bacteria 783
830 Ga0501308_031288 3300049128 Bacteria 715
831 Ga0501308_039849 3300049128 Bacteria 658
832 Ga0501308_040120 3300049128 Bacteria 657
833 Ga0501308_056385 3300049128 Bacteria 585
834 Ga0501309_003424 3300049129 Bacteria 1795
835 Ga0501309_015570 3300049129 Bacteria 1030
836 Ga0501309_029953 3300049129 Bacteria 799
837 Ga0501309_032265 3300049129 Bacteria 777
838 Ga0501309_050103 3300049129 Bacteria 654
839 Ga0501309_076735 3300049129 Bacteria 556
840 Ga0501309_083299 3300049129 Bacteria 538
841 Ga0501310_001945 3300049130 Bacteria 1922
842 Ga0501310_011600 3300049130 Bacteria 999
843 Ga0501310_013209 3300049130 Bacteria 956
844 Ga0501310_030076 3300049130 Bacteria 718
845 Ga0501310_035015 3300049130 Bacteria 680
846 Ga0501310_050061 3300049130 Bacteria 602
847 Ga0501304_007690 3300049160 Bacteria 895
848 Ga0501304_007781 3300049160 Bacteria 891
849 Ga0501304_010640 3300049160 Bacteria 807
850 Ga0501304_018671 3300049160 Bacteria 672
851 Ga0501305_026071 3300049161 Bacteria 889
852 Ga0501305_031116 3300049161 Bacteria 832
853 Ga0501305_041709 3300049161 Bacteria 748
854 Ga0501305_042298 3300049161 Bacteria 744
855 Ga0501305_046151 3300049161 Bacteria 721
856 Ga0501305_046663 3300049161 Bacteria 718
857 Ga0501305_065182 3300049161 Bacteria 633
858 Ga0501305_067071 3300049161 Bacteria 626
859 Ga0501307_023930 3300049162 Bacteria 812
860 Ga0501307_030595 3300049162 Bacteria 744
861 Ga0501307_033842 3300049162 Bacteria 719
862 Ga0501307_075933 3300049162 Bacteria 542
863 Ga0501307_092011 3300049162 Bacteria 507
864 Ga0501307_095332 3300049162 Bacteria 501
865 Ga0501311_008511 3300049527 Bacteria 1205
866 Ga0501311_016036 3300049527 Bacteria 973
867 Ga0501311_022794 3300049527 Bacteria 863
868 Ga0501311_024651 3300049527 Bacteria 839
869 Ga0501311_026435 3300049527 Bacteria 818
870 Ga0501311_032471 3300049527 Bacteria 762
871 Ga0501311_037685 3300049527 Bacteria 723
872 Ga0501311_041851 3300049527 Bacteria 697
873 Ga0501311_042658 3300049527 Bacteria 692
874 Ga0501311_047757 3300049527 Bacteria 664
875 Ga0501311_064427 3300049527 Bacteria 598
876 Ga0501311_080307 3300049527 Bacteria 554
877 Ga0501311_092970 3300049527 Bacteria 526
878 Ga0501312_003439 3300049528 Bacteria 1797
879 Ga0501312_013348 3300049528 Bacteria 1141
880 Ga0501312_026366 3300049528 Bacteria 891
881 Ga0501312_066940 3300049528 Bacteria 631
882 Ga0501312_072770 3300049528 Bacteria 612
883 Ga0501312_116380 3300049528 Bacteria 514
884 Ga0501313_011819 3300049529 Bacteria 1011
885 Ga0501313_025678 3300049529 Bacteria 746
886 Ga0501313_034760 3300049529 Bacteria 663
887 Ga0501313_045363 3300049529 Bacteria 599
888 Ga0501314_012398 3300049530 Bacteria 817
889 Ga0501315_014882 3300049531 Bacteria 991
890 Ga0501315_032100 3300049531 Bacteria 762
891 Ga0501315_033949 3300049531 Bacteria 747
892 Ga0501315_047004 3300049531 Bacteria 669
893 Ga0501315_053230 3300049531 Bacteria 640
894 Ga0501316_001753 3300049532 Bacteria 1911
895 Ga0501316_006908 3300049532 Bacteria 1221
896 Ga0501316_009901 3300049532 Bacteria 1078
897 Ga0501316_023202 3300049532 Bacteria 795
898 Ga0501316_024413 3300049532 Bacteria 781
899 Ga0501316_029644 3300049532 Bacteria 727
900 Ga0501316_069325 3300049532 Bacteria 532
901 Ga0501316_074464 3300049532 Bacteria 518
902 Ga0501317_006833 3300049533 Bacteria 1269
903 Ga0501317_010826 3300049533 Bacteria 1098
904 Ga0501317_013603 3300049533 Bacteria 1020
905 Ga0501317_019297 3300049533 Bacteria 909
906 Ga0501317_019458 3300049533 Bacteria 907
907 Ga0501317_022503 3300049533 Bacteria 864
908 Ga0501317_036202 3300049533 Bacteria 737
909 Ga0501317_052370 3300049533 Bacteria 652
910 Ga0501317_057948 3300049533 Bacteria 630
911 Ga0501317_066654 3300049533 Bacteria 600
912 Ga0501317_075081 3300049533 Bacteria 576
913 Ga0501317_104197 3300049533 Bacteria 515
914 Ga0501317_112009 3300049533 Bacteria 502
915 Ga0501318_000807 3300049534 Bacteria 2184
916 Ga0501318_001117 3300049534 Bacteria 2007
917 Ga0501318_002464 3300049534 Bacteria 1606
918 Ga0501318_007220 3300049534 Bacteria 1155
919 Ga0501318_011664 3300049534 Bacteria 997
920 Ga0501318_016507 3300049534 Bacteria 893
921 Ga0501318_019180 3300049534 Bacteria 851
922 Ga0501318_026279 3300049534 Bacteria 767
923 Ga0501318_034608 3300049534 Bacteria 701
924 Ga0501318_048217 3300049534 Bacteria 627
925 Ga0501318_089044 3300049534 Bacteria 509
926 Ga0501319_001340 3300049535 Bacteria 1404
927 Ga0501319_004671 3300049535 Bacteria 959
928 Ga0501319_006144 3300049535 Bacteria 879
929 Ga0501319_029295 3300049535 Bacteria 525
930 Ga0501320_003000 3300049536 Bacteria 1398
931 Ga0501320_009483 3300049536 Bacteria 975
932 Ga0501320_013645 3300049536 Bacteria 869
933 Ga0501320_014275 3300049536 Bacteria 857
934 Ga0501320_022258 3300049536 Bacteria 742
935 Ga0501320_033960 3300049536 Bacteria 646
936 Ga0501321_001598 3300049537 Bacteria 1834
937 Ga0501321_003025 3300049537 Bacteria 1510
938 Ga0501321_014152 3300049537 Bacteria 925
939 Ga0501321_015626 3300049537 Bacteria 895
940 Ga0501321_023878 3300049537 Bacteria 779
941 Ga0501321_025363 3300049537 Bacteria 764
942 Ga0501321_028308 3300049537 Bacteria 736
943 Ga0501321_037521 3300049537 Bacteria 671
944 Ga0501321_039034 3300049537 Bacteria 662
945 Ga0501321_040241 3300049537 Bacteria 655
946 Ga0501321_061083 3300049537 Bacteria 569
947 Ga0501321_062986 3300049537 Bacteria 564
948 Ga0501322_017659 3300049538 Bacteria 606
949 Ga0501323_000424 3300049539 Bacteria 3097
950 Ga0501323_000806 3300049539 Bacteria 2511
951 Ga0501323_006932 3300049539 Bacteria 1279
952 Ga0501323_023204 3300049539 Bacteria 832
953 Ga0501323_033560 3300049539 Bacteria 730
954 Ga0501323_037637 3300049539 Bacteria 700
955 Ga0501323_060551 3300049539 Bacteria 590
956 Ga0501323_064690 3300049539 Bacteria 576
957 Ga0501323_095189 3300049539 Bacteria 500
958 Ga0501324_006356 3300049540 Bacteria 994
959 Ga0501324_007590 3300049540 Bacteria 940
960 Ga0501324_010250 3300049540 Bacteria 851
961 Ga0501324_012919 3300049540 Bacteria 786
962 Ga0501324_016833 3300049540 Bacteria 720
963 Ga0501324_021918 3300049540 Bacteria 658
964 Ga0501324_033373 3300049540 Bacteria 569
965 Ga0501324_035899 3300049540 Bacteria 554
966 Ga0501325_003146 3300049541 Bacteria 1183
967 Ga0501325_009286 3300049541 Bacteria 870
968 Ga0501325_019142 3300049541 Bacteria 707
969 Ga0501325_023722 3300049541 Bacteria 664
970 Ga0501329_01449 3300049545 Bacteria 1040
971 Ga0501333_004646 3300049549 Bacteria 869
972 Ga0501333_006364 3300049549 Bacteria 784
973 Ga0501338_06517 3300049554 Bacteria 739
974 Ga0501340_007576 3300049556 Bacteria 751
975 Ga0501031_0062259 3300049568 Bacteria 2431
976 Ga0501031_0155910 3300049568 Bacteria 1492
977 Ga0501032_0017464 3300049569 Bacteria 5040
978 Ga0501032_0159374 3300049569 Bacteria 1482
979 Ga0501032_0526640 3300049569 Bacteria 754
980 Ga0501032_0682780 3300049569 Bacteria 651
981 Ga0501033_0107440 3300049570 Bacteria 2032
982 Ga0501034_0011971 3300049571 Bacteria 8966
983 Ga0501034_0159328 3300049571 Bacteria 2229
984 Ga0501036_0037115 3300049572 Bacteria 4122
985 Ga0501036_0041412 3300049572 Bacteria 3897
986 Ga0501036_0290693 3300049572 Bacteria 1367
987 Ga0501036_0675603 3300049572 Bacteria 854
988 Ga0501036_1356736 3300049572 Bacteria 577
989 Ga0501036_1483303 3300049572 Bacteria 549
990 Ga0501037_0009850 3300049573 Bacteria 7014
991 Ga0501038_0008979 3300049574 Bacteria 9172
992 Ga0501038_0009072 3300049574 Bacteria 9132
993 Ga0501038_0010481 3300049574 Bacteria 8479
994 Ga0501038_0352243 3300049574 Bacteria 1146
995 Ga0501039_0006825 3300049575 Bacteria 8685
996 Ga0501039_0086264 3300049575 Bacteria 2445
997 Ga0501039_0254242 3300049575 Bacteria 1381
998 Ga0501039_0506053 3300049575 Bacteria 948
999 Ga0501039_0839420 3300049575 Bacteria 716
1000 Ga0501040_0005127 3300049576 Bacteria 8471
1001 Ga0501040_0061519 3300049576 Bacteria 2582
1002 Ga0501040_0329601 3300049576 Bacteria 1092
1003 Ga0501040_0512914 3300049576 Bacteria 864
1004 Ga0501041_0070654 3300049577 Bacteria 2143
1005 Ga0501041_0284266 3300049577 Bacteria 1041
1006 Ga0501041_0284827 3300049577 Bacteria 1040
1007 Ga0501041_0377349 3300049577 Bacteria 897
1008 Ga0501041_0891188 3300049577 Bacteria 571
1009 Ga0501042_0024296 3300049578 Bacteria 4250
1010 Ga0501042_0034695 3300049578 Bacteria 3578
1011 Ga0501042_0040727 3300049578 Bacteria 3302
1012 Ga0501042_0785296 3300049578 Bacteria 693
1013 Ga0501042_0785463 3300049578 Bacteria 693
1014 Ga0501042_1035756 3300049578 Bacteria 598
1015 Ga0501043_0039304 3300049579 Bacteria 3718
1016 Ga0501043_0086168 3300049579 Bacteria 2468
1017 Ga0501043_0153971 3300049579 Bacteria 1798
1018 Ga0501043_0297510 3300049579 Bacteria 1234
1019 Ga0501043_0999871 3300049579 Bacteria 595
1020 Ga0501046_0000184 3300049580 Bacteria 63497
1021 Ga0501046_0014510 3300049580 Bacteria 6645
1022 Ga0501046_0036642 3300049580 Bacteria 3947
1023 Ga0501046_0102430 3300049580 Bacteria 2195
1024 Ga0501047_0030501 3300049581 Bacteria 5197
1025 Ga0501047_0091108 3300049581 Bacteria 2926
1026 Ga0501048_0009925 3300049582 Bacteria 7132
1027 Ga0501048_0068780 3300049582 Bacteria 2501
1028 Ga0501048_0656887 3300049582 Bacteria 753
1029 Ga0501067_0038315 3300049583 Bacteria 2662
1030 Ga0501067_0098556 3300049583 Bacteria 1623
1031 Ga0501067_0230796 3300049583 Bacteria 1030
1032 Ga0501067_0492870 3300049583 Bacteria 685
1033 Ga0501067_0794604 3300049583 Bacteria 533
1034 Ga0501068_0088194 3300049584 Bacteria 1911
1035 Ga0501068_0194588 3300049584 Bacteria 1285
1036 Ga0501068_0226659 3300049584 Bacteria 1188
1037 Ga0501068_0278538 3300049584 Bacteria 1069
1038 Ga0501069_0023811 3300049585 Bacteria 3338
1039 Ga0501069_0076909 3300049585 Bacteria 1877
1040 Ga0501069_0580461 3300049585 Bacteria 672
1041 Ga0501070_0014863 3300049586 Bacteria 6549
1042 Ga0501070_0157098 3300049586 Bacteria 1875
1043 Ga0501070_0157879 3300049586 Bacteria 1870
1044 Ga0501070_0171686 3300049586 Bacteria 1786
1045 Ga0501070_1076811 3300049586 Bacteria 621
1046 Ga0501070_1344402 3300049586 Bacteria 544
1047 Ga0501071_0055572 3300049587 Bacteria 2858
1048 Ga0501071_0075525 3300049587 Bacteria 2460
1049 Ga0501071_0988430 3300049587 Bacteria 650
1050 Ga0501071_1122033 3300049587 Bacteria 607
1051 Ga0501071_1166474 3300049587 Bacteria 595
1052 Ga0501072_0248284 3300049588 Bacteria 1417
1053 Ga0501072_0332595 3300049588 Bacteria 1207
1054 Ga0501072_1174049 3300049588 Bacteria 597
1055 Ga0501072_1450056 3300049588 Bacteria 530
1056 Ga0501073_0076730 3300049589 Bacteria 2325
1057 Ga0501073_0287670 3300049589 Bacteria 1134
1058 Ga0501073_0962914 3300049589 Bacteria 587
1059 Ga0501074_0013659 3300049590 Bacteria 5903
1060 Ga0501074_0239633 3300049590 Bacteria 1290
1061 Ga0501074_0439599 3300049590 Bacteria 925
1062 Ga0501074_0510938 3300049590 Bacteria 851
1063 Ga0501074_1111784 3300049590 Bacteria 555
1064 Ga0501075_0068644 3300049591 Bacteria 2678
1065 Ga0501076_1174490 3300049592 Bacteria 632
1066 Ga0501076_1254812 3300049592 Bacteria 610
1067 Ga0501077_0188376 3300049593 Bacteria 1311
1068 Ga0501202_066601 3300049652 Bacteria 823
1069 Ga0501208_153501 3300049655 Bacteria 523
1070 Ga0501217_118011 3300049661 Bacteria 768
1071 Ga0501224_047026 3300049664 Bacteria 657
1072 Ga0501243_046446 3300049675 Bacteria 774
1073 Ga0501243_077072 3300049675 Bacteria 643
1074 Ga0501257_124927 3300049686 Bacteria 692
1075 Ga0501257_260959 3300049686 Bacteria 516
1076 Ga0501221_074062 3300049704 Bacteria 809
1077 Ga0501225_0200766 3300049705 Bacteria 633
1078 Ga0501080_0164141 3300049742 Bacteria 2050
1079 Ga0501080_0361873 3300049742 Bacteria 1309
1080 Ga0501080_1688910 3300049742 Bacteria 534
1081 Ga0501081_0067962 3300049743 Bacteria 2480
1082 Ga0501081_0414458 3300049743 Bacteria 998
1083 Ga0501081_0481541 3300049743 Bacteria 924
1084 Ga0501035_0007374 3300049822 Bacteria 10279
1085 Ga0501035_0046149 3300049822 Bacteria 3918
1086 Ga0501044_0010047 3300049823 Bacteria 10284
1087 Ga0501044_0070278 3300049823 Bacteria 3561
1088 Ga0501045_0000777 3300049824 Bacteria 20521
1089 Ga0501045_0114781 3300049824 Bacteria 1998
1090 Ga0501045_0248232 3300049824 Bacteria 1325
1091 Ga0501045_0249796 3300049824 Bacteria 1320
1092 Ga0501045_0489383 3300049824 Bacteria 914
1093 Ga0501212_083475 3300049851 Bacteria 581
1094 nmdc:mga03n38_183427_c1 3300050490 Bacteria 1074
1095 nmdc:mga03n38_28651_c1 3300050490 Bacteria 2324
1096 nmdc:mga03n38_59143_c1 3300050490 Bacteria 1739
1097 nmdc:mga03n38_772347_c1 3300050490 Bacteria 558
1098 nmdc:mga03n38_787875_c1 3300050490 Bacteria 553
1099 nmdc:mga00v17_14491_c1 3300050491 Bacteria 4402
1100 nmdc:mga00v17_21161_c1 3300050491 Bacteria 3737
1101 nmdc:mga00v17_217682_c1 3300050491 Bacteria 1236
1102 nmdc:mga0yw44_123191_c1 3300050492 Bacteria 1672
1103 nmdc:mga0yw44_204303_c1 3300050492 Bacteria 1306
1104 nmdc:mga0yw44_22344_c1 3300050492 Bacteria 3547
1105 nmdc:mga0yw44_337032_c1 3300050492 Bacteria 1014
1106 nmdc:mga0yw44_353012_c1 3300050492 Bacteria 990
1107 nmdc:mga0yw44_357158_c1 3300050492 Bacteria 984
1108 nmdc:mga0yw44_367219_c1 3300050492 Bacteria 970
1109 nmdc:mga0yw44_374504_c1 3300050492 Bacteria 961
1110 nmdc:mga0yw44_381190_c1 3300050492 Bacteria 952
1111 nmdc:mga0yw44_45943_c1 3300050492 Bacteria 2620
1112 nmdc:mga0yw44_551358_c1 3300050492 Bacteria 783
1113 nmdc:mga0yw44_59761_c1 3300050492 Bacteria 2333
1114 nmdc:mga0yw44_80998_c1 3300050492 Bacteria 2035
1115 nmdc:mga06z11_144871_c1 3300050494 Bacteria 1346
1116 nmdc:mga06z11_1605_c1 3300050494 Bacteria 8433
1117 nmdc:mga06z11_178624_c1 3300050494 Bacteria 1223
1118 nmdc:mga06z11_209757_c1 3300050494 Bacteria 1135
1119 nmdc:mga06z11_924000_c1 3300050494 Bacteria 532
1120 nmdc:mga04h51_226825_c1 3300050495 Bacteria 742
1121 nmdc:mga04h51_303980_c1 3300050495 Bacteria 651
1122 nmdc:mga04h51_74600_c1 3300050495 Bacteria 1192
1123 nmdc:mga07m45_209218_c1 3300050496 Bacteria 1135
1124 nmdc:mga05p37_712347_c1 3300050507 Bacteria 1113
1125 nmdc:mga0qj67_1320512_c1 3300050509 Bacteria 558
1126 nmdc:mga06r32_280_c4 3300050510 Bacteria 18036
1127 nmdc:mga08y16_2141246_c1 3300050511 Bacteria 506
1128 nmdc:mga08y16_602382_c1 3300050511 Bacteria 1107
1129 nmdc:mga08y16_904192_c1 3300050511 Bacteria 869
1130 nmdc:mga08y16_99916_c1 3300050511 Bacteria 3021
1131 nmdc:mga0n895_1023800_c1 3300050512 Bacteria 806
1132 nmdc:mga0a205_1473818_c1 3300050515 Bacteria 528
1133 Ga0495601_0530620 3300053077 Bacteria 758
1134 Ga0495612_0176920 3300053078 Bacteria 936
1135 Ga0495612_0316891 3300053078 Bacteria 701
1136 Ga0495655_0052079 3300053083 Bacteria 1087
1137 Ga0495595_0207570 3300053084 Bacteria 976
1138 Ga0495619_0026939 3300053085 Bacteria 3702
1139 Ga0495619_0128753 3300053085 Bacteria 1739
1140 Ga0495619_0463856 3300053085 Bacteria 873
1141 Ga0495619_0766655 3300053085 Bacteria 654
1142 Ga0500556_0000417 3300053104 Bacteria 30638
1143 Ga0500593_001815 3300053117 Bacteria 7667
1144 Ga0500655_020453 3300053133 Bacteria 1237
1145 Ga0500573_0024690 3300053140 Bacteria 3455
1146 Ga0500573_0442141 3300053140 Bacteria 603
1147 Ga0500604_0194012 3300053151 Bacteria 698
1148 Ga0501084_0003572 3300054114 Bacteria 12619
1149 Ga0501084_1800560 3300054114 Bacteria 511
1150 Ga0590075_040531 3300059424 Bacteria 1190
1151 Ga0587084_004447 3300059477 Bacteria 1605
1152 Ga0587066_111690 3300059490 Bacteria 634
1153 Ga0587070_082332 3300059491 Bacteria 708
1154 Ga0587070_092236 3300059491 Bacteria 683
1155 Ga0587073_0233261 3300059492 Bacteria 568
1156 Ga0587080_037179 3300059503 Bacteria 873
1157 Ga0587082_045183 3300059504 Bacteria 822
1158 Ga0587088_059670 3300059508 Bacteria 769
1159 Ga0587088_069115 3300059508 Bacteria 732
1160 Ga0587089_058620 3300059509 Bacteria 632
1161 Ga0587090_040745 3300059510 Bacteria 817
1162 Ga0587090_055418 3300059510 Bacteria 738
1163 Ga0587090_061702 3300059510 Bacteria 713
1164 Ga0587090_102896 3300059510 Bacteria 600
1165 Ga0587091_120095 3300059511 Bacteria 637
1166 Ga0587092_027209 3300059512 Bacteria 924
1167 Ga0587092_057562 3300059512 Bacteria 720
1168 Ga0587098_019778 3300059604 Bacteria 845
1169 Ga0587106_007298 3300059605 Bacteria 1337
1170 Ga0587106_035889 3300059605 Bacteria 819
1171 Ga0587106_052337 3300059605 Bacteria 727
1172 Ga0587121_05808 3300059606 Bacteria 717
1173 Ga0587129_009787 3300059608 Bacteria 731
1174 Ga0587099_013537 3300059622 Bacteria 851
1175 Ga0587101_022425 3300059623 Bacteria 921
1176 Ga0587115_041527 3300059626 Bacteria 720
1177 Ga0587115_061526 3300059626 Bacteria 631
1178 Ga0587128_039404 3300059630 Bacteria 820
1179 Ga0587128_050313 3300059630 Bacteria 759
1180 Ga0587062_045267 3300059639 Bacteria 728
1181 Ga0587068_018484 3300059641 Bacteria 1123
1182 Ga0587068_091541 3300059641 Bacteria 627
1183 Ga0587069_044260 3300059642 Bacteria 771
1184 Ga0587075_034598 3300059644 Bacteria 821
1185 Ga0587075_043431 3300059644 Bacteria 762
1186 Ga0587075_049328 3300059644 Bacteria 730
1187 Ga0587078_042830 3300059646 Bacteria 644
1188 Ga0587079_069729 3300059647 Bacteria 781
1189 Ga0587102_045529 3300059649 Bacteria 578
1190 Ga0587105_004205 3300059651 Bacteria 911
1191 Ga0587114_024577 3300059655 Bacteria 878
1192 Ga0587114_045626 3300059655 Bacteria 725
1193 Ga0587118_14263 3300059657 Bacteria 629
1194 Ga0587119_014442 3300059658 Bacteria 947
1195 Ga0587071_068556 3300060344 Bacteria 768
1196 Ga0587071_082121 3300060344 Bacteria 719
1197 Ga0587111_0045587 3300060346 Bacteria 951
1198 Ga0587111_0098702 3300060346 Bacteria 724
1199 Ga0587111_0227970 3300060346 Bacteria 541
1200 Ga0501082_0007916 3300060353 Bacteria 9180
1201 Ga0501082_0724991 3300060353 Bacteria 870
1202 Ga0501082_1447759 3300060353 Bacteria 600
1203 Ga0466962_0002275 3300061719 Bacteria 9104
1204 Ga0466962_0038742 3300061719 Bacteria 2283
1205 Ga0466962_0130887 3300061719 Bacteria 1212
1206 Ga0466962_0147740 3300061719 Bacteria 1140
1207 Ga0530510_0165889 3300061734 Bacteria 1635
1208 Ga0530510_0172128 3300061734 Bacteria 1604
1209 Ga0530510_1127169 3300061734 Bacteria 601
1210 2585301890 2582581312 Bacteria 7308206
1211 2585304852 2582581313 Bacteria 10042643
1212 2616899875 2616644941 Bacteria 8510691
1213 2643828134 2643221561 Bacteria 4984412
1214 2643897863 2643221578 Bacteria 9213798
1215 2644018699 2643221601 Bacteria 7493239
1216 2644090068 2643221615 Bacteria 5487866
1217 2644179834 2643221631 Bacteria 8168043
1218 2644183216 2643221632 Bacteria 3406696
1219 2644319913 2643221657 Bacteria 5490246
1220 2644385381 2643221670 Bacteria 6497041
1221 2644409008 2643221673 Bacteria 9196637
1222 2644436358 2643221678 Bacteria 9540101
1223 2644531223 2643221696 Bacteria 5431823
1224 2729905770 2728369276 Bacteria 5610032
1225 2785344289 2784746763 Bacteria 9783172
1226 2785368568 2784746768 Bacteria 10036182
1227 2786669657 2786546132 Bacteria 10419719
1228 2793976154 2791355406 Bacteria 11364898
1229 2808841256 2808606359 Bacteria 9866990
1230 2819742873 2818991472 Bacteria 10089953
1231 2855387467 2855386786 Bacteria 4752232
1232 2857484884 2857481737 Bacteria 4761446
1233 2862184904 2862178590 Bacteria 8583590
1234 2862288159 2862281513 Bacteria 9621493
1235 2867431117 2867428634 Bacteria 9590268
1236 2867479659 2867475112 Bacteria 6909112
1237 2875393779 2875391855 Bacteria 7600475
1238 2877681968 2877676314 Bacteria 9512378
1239 2912720930 2912715099 Bacteria 9460473
1240 2919468657 2919468124 Bacteria 9133025
1241 2946050878 2946045630 Bacteria 8527308
1242 2954676082 2954673503 Bacteria 9685905
1243 2954688084 2954682443 Bacteria 9862841
1244 2954717034 2954711539 Bacteria 10867210
1245 2954726982 2954721474 Bacteria 10456478
1246 2954734799 2954731030 Bacteria 10243860
1247 2954745905 2954740390 Bacteria 10229294
1248 2954753685 2954749733 Bacteria 10366972
1249 2954764877 2954759201 Bacteria 9358192
1250 2990094188 2990088156 Bacteria 6657676
1251 2995471105 2995463766 Bacteria 8577691
1252 2997456539 2997451912 Bacteria 8492419
1253 8033690549 8033684223 Bacteria 6906479
1254 8047898955 8047893842 Bacteria 11723082
1255 8048127682 8048127548 Bacteria 11053136
1256 8048359964 8048356638 Bacteria 11044339
1257 8048375913 8048369669 Bacteria 11666822
1258 8048382294 8048379754 Bacteria 11877923
1259 8048408398 8048406513 Bacteria 8936924
1260 8054612376 8054609563 Bacteria 5170090
1261 8056453597 8056447290 Bacteria 7680491
1262 LJQas_1002902
1263 LJQas_1008780
1264 JGI24735J21928_10094491
1265 JGI24738J21930_10028799
1266 JGI24744J21845_10098387
1267 Ga0006762J43184_106160
1268 Ga0006778J45830_1005237
1269 Ga0006778J45830_1017350
1270 Ga0006778J45830_1018865
1271 Ga0006778J45830_1024217
1272 Ga0006778J45830_1076135
1273 Ga0006759J45824_1007731
1274 Ga0006759J45824_1033594
1275 Ga0006759J45824_1040332
1276 Ga0006759J45824_1056525
1277 Ga0006758J48902_1008537
1278 Ga0006777J48905_1029661
1279 Ga0006777J48905_1050436
1280 Ga0006777J48905_1056291
1281 rootL2_10084680
1282 Ga0007417J51691_1034199
1283 Ga0007417J51691_1045249
1284 Ga0007427J51700_105542
1285 Ga0007427J51700_112829
1286 Ga0006781J51513_1004365
1287 Ga0006781J51513_1012022
1288 Ga0006781J51513_1017605
1289 Ga0007409J51694_1007139
1290 Ga0007409J51694_1055501
1291 Ga0007416J51690_1008794
1292 Ga0007416J51690_1032047
1293 Ga0007429J51699_1004976
1294 Ga0007429J51699_1026481
1295 Ga0007429J51699_1028743
1296 Ga0007429J51699_1147323
1297 Ga0007411J51799_104538
1298 Ga0032354_1003953
1299 Ga0032354_1020597
1300 Ga0032354_1021921
1301 Ga0006780_1002679
1302 Ga0006780_1018908
1303 Ga0058858_1005265
1304 Ga0058858_1008839
1305 Ga0058859_10007251
1306 Ga0058859_10031544
1307 Ga0058861_10020666
1308 Ga0058860_12069996
1309 Ga0070658_10845028
1310 Ga0070658_11319472
1311 Ga0070683_100013284
1312 Ga0070683_100094819
1313 Ga0070683_100760098
1314 Ga0070683_100864030
1315 Ga0070683_101329895
1316 Ga0070683_101794826
1317 Ga0070683_102190730
1318 Ga0070670_100763874
1319 Ga0070680_101902148
1320 Ga0070682_100243391
1321 Ga0070682_100414100
1322 Ga0070682_100824630
1323 Ga0068868_100352581
1324 Ga0068868_101943940
1325 Ga0070660_100036431
1326 Ga0070660_101221018
1327 Ga0070691_10295104
1328 Ga0070687_101495327
1329 Ga0070692_10458023
1330 Ga0070692_10719656
1331 Ga0070692_10786013
1332 Ga0070668_100035938
1333 Ga0070668_100631463
1334 Ga0070669_101938912
1335 Ga0070671_101803509
1336 Ga0070674_100754251
1337 Ga0070674_101764301
1338 Ga0070674_102056534
1339 Ga0070673_100248121
1340 Ga0070673_100622564
1341 Ga0070688_100241705
1342 Ga0070659_100030400
1343 Ga0070659_100155252
1344 Ga0070659_100628514
1345 Ga0070667_100806611
1346 Ga0070714_100536709
1347 Ga0070714_101692607
1348 Ga0070713_100530506
1349 Ga0070710_11519626
1350 Ga0070701_10001495
1351 Ga0070711_101157707
1352 Ga0070711_101648264
1353 Ga0070700_100541634
1354 Ga0070700_101157639
1355 Ga0070700_101361181
1356 Ga0070694_100906884
1357 Ga0070663_100101383
1358 Ga0070663_101045818
1359 Ga0070663_101524739
1360 Ga0070678_100193025
1361 Ga0070678_101010375
1362 Ga0070678_101960762
1363 Ga0070662_100466784
1364 Ga0070662_100784202
1365 Ga0070662_101113450
1366 Ga0070662_101417856
1367 Ga0070662_101955886
1368 Ga0068867_101061423
1369 Ga0070685_10298080
1370 Ga0070706_100471117
1371 Ga0070707_101134928
1372 Ga0070698_100020921
1373 Ga0070698_100069006
1374 Ga0070698_100183995
1375 Ga0070698_101941342
1376 Ga0070699_100185071
1377 Ga0070684_100182637
1378 Ga0070684_100293314
1379 Ga0070684_100695765
1380 Ga0070684_101450315
1381 Ga0070697_100060437
1382 Ga0070697_100911186
1383 Ga0068853_100286912
1384 Ga0068853_100912865
1385 Ga0070672_100296536
1386 Ga0070672_100320053
1387 Ga0070695_101903205
1388 Ga0070693_100205218
1389 Ga0070693_101035927
1390 Ga0070665_100971977
1391 Ga0070665_101939604
1392 Ga0070704_101787462
1393 Ga0068855_100630693
1394 Ga0070664_101452530
1395 Ga0068857_100493991
1396 Ga0068857_101275372
1397 Ga0068854_101599800
1398 Ga0068856_100569818
1399 Ga0068856_102161422
1400 Ga0070702_100156947
1401 Ga0070702_100201224
1402 Ga0070702_101367788
1403 Ga0068852_100153229
1404 Ga0068852_100395299
1405 Ga0068852_100645393
1406 Ga0068852_100666133
1407 Ga0068852_100790617
1408 Ga0068864_101609751
1409 Ga0068864_102313612
1410 Ga0068866_11125236
1411 Ga0068861_100012521
1412 Ga0068861_100282735
1413 Ga0068861_100513312
1414 Ga0068861_101792514
1415 Ga0068861_101811761
1416 Ga0068851_10415460
1417 Ga0068870_10197818
1418 Ga0068870_10606301
1419 Ga0068863_100524148
1420 Ga0068858_100146607
1421 Ga0068858_100644044
1422 Ga0068860_101350529
1423 Ga0068862_100231939
1424 Ga0081455_10060081
1425 Ga0081455_10060828
1426 Ga0070717_11239366
1427 Ga0070717_11389491
1428 Ga0075365_10020619
1429 Ga0075365_10050267
1430 Ga0075365_10059522
1431 Ga0075365_10065852
1432 Ga0075365_10075248
1433 Ga0075365_10393035
1434 Ga0075365_10930423
1435 Ga0075368_10044391
1436 Ga0075368_10079066
1437 Ga0075368_10260889
1438 Ga0075363_100015057
1439 Ga0075363_100021527
1440 Ga0075363_100229529
1441 Ga0075363_100429537
1442 Ga0075364_10087465
1443 Ga0075364_10148049
1444 Ga0075364_10647691
1445 Ga0075432_10330601
1446 Ga0075362_10451630
1447 Ga0075367_10002048
1448 Ga0075367_10025702
1449 Ga0075367_10049721
1450 Ga0075367_10225041
1451 Ga0075367_10512255
1452 Ga0075367_10744803
1453 Ga0075366_10731231
1454 Ga0075370_10014839
1455 Ga0075370_10180306
1456 Ga0068871_100317943
1457 Ga0068871_100584129
1458 Ga0068871_101375018
1459 Ga0075428_100260935
1460 Ga0075428_100646516
1461 Ga0075428_101775237
1462 Ga0075430_100502409
1463 Ga0075431_100033157
1464 Ga0075433_11545404
1465 Ga0075434_100139910
1466 Ga0075429_101567449
1467 Ga0068865_100004169
1468 Ga0068865_100297926
1469 Ga0068865_100579678
1470 Ga0068865_101617696
1471 Ga0105244_10419995
1472 Ga0111539_10151003
1473 Ga0111539_10642356
1474 Ga0111539_10940256
1475 Ga0111539_11069108
1476 Ga0105245_10249048
1477 Ga0105245_10531644
1478 Ga0105245_11425255
1479 Ga0105245_12169899
1480 Ga0105245_12398861
1481 Ga0105245_13015450
1482 Ga0105247_10524934
1483 Ga0114129_10743879
1484 Ga0114129_10759352
1485 Ga0105243_10030084
1486 Ga0105243_10521358
1487 Ga0105243_12526635
1488 Ga0105243_12982984
1489 Ga0105242_10260974
1490 Ga0105242_10743478
1491 Ga0105242_11006070
1492 Ga0105242_11192736
1493 Ga0105242_13318279
1494 Ga0105248_13335018
1495 Ga0105237_10412363
1496 Ga0105237_11209967
1497 Ga0105238_10250200
1498 Ga0105238_11549406
1499 Ga0105249_10305871
1500 Ga0105249_10329858
1501 Ga0105249_10547608
1502 Ga0105249_11183872
1503 Ga0105239_10609564
1504 Ga0105239_11119887
1505 Ga0105239_11164300
1506 Ga0105239_12066599
1507 Ga0105246_10323084
1508 Ga0105246_10479972
1509 Ga0105246_10669010
1510 Ga0105246_11155406
1511 Ga0157325_1003207
1512 Ga0157329_1012523
1513 Ga0157319_1051975
1514 Ga0157347_1060874
1515 Ga0157338_1005833
1516 Ga0154019_122374
1517 Ga0157371_10585195
1518 Ga0157371_10768523
1519 Ga0157370_10628559
1520 Ga0157370_11062013
1521 Ga0157369_10894158
1522 Ga0157369_12569122
1523 Ga0157374_10273795
1524 Ga0157374_11876874
1525 Ga0157378_12540985
1526 Ga0163162_11484571
1527 Ga0163162_12807463
1528 Ga0157372_10059287
1529 Ga0157372_10172105
1530 Ga0157372_10503764
1531 Ga0157372_11027338
1532 Ga0157372_11325455
1533 Ga0157372_11600511
1534 Ga0157372_12529321
1535 Ga0157375_10117822
1536 Ga0157375_10207102
1537 Ga0157375_11302756
1538 Ga0157375_11327476
1539 Ga0157375_11441689
1540 Ga0157375_11868773
1541 Ga0157375_13114082
1542 Ga0163163_10092876
1543 Ga0163163_10184171
1544 Ga0163163_11908767
1545 Ga0157380_10390506
1546 Ga0157380_11114894
1547 Ga0182008_10010166
1548 Ga0182008_10108171
1549 Ga0182008_10156609
1550 Ga0182008_10189306
1551 Ga0182008_10268822
1552 Ga0157377_11327930
1553 Ga0157379_10959986
1554 Ga0157379_11596800
1555 Ga0157376_10220883
1556 Ga0157376_10264018
1557 Ga0157376_11286300
1558 Ga0157376_11928956
1559 Ga0182006_1011838
1560 Ga0182006_1161826
1561 Ga0182007_10000257
1562 Ga0182005_1049585
1563 Ga0183367_1006
1564 Ga0163161_10036002
1565 Ga0163161_10046953
1566 Ga0163161_10886545
1567 Ga0163161_11009518
1568 Ga0163161_11415791
1569 Ga0197907_10010884
1570 Ga0197907_10100526
1571 Ga0197907_10162151
1572 Ga0197907_10423704
1573 Ga0197907_10445121
1574 Ga0197907_10580340
1575 Ga0197907_10881272
1576 Ga0197907_11016439
1577 Ga0206356_10271762
1578 Ga0206356_10339076
1579 Ga0206356_10857575
1580 Ga0206356_10936297
1581 Ga0206356_11242763
1582 Ga0206356_11403629
1583 Ga0206356_11461478
1584 Ga0206356_11471271
1585 Ga0206356_11747499
1586 Ga0206356_11764094
1587 Ga0206349_1064364
1588 Ga0206349_1321983
1589 Ga0206349_1598135
1590 Ga0206349_1620869
1591 Ga0206349_1646901
1592 Ga0206349_1726464
1593 Ga0206349_1944080
1594 Ga0206355_1004665
1595 Ga0206355_1045632
1596 Ga0206355_1081111
1597 Ga0206355_1085433
1598 Ga0206355_1165990
1599 Ga0206355_1174712
1600 Ga0206355_1185040
1601 Ga0206355_1198663
1602 Ga0206355_1203687
1603 Ga0206355_1650912
1604 Ga0206351_10026933
1605 Ga0206351_10121054
1606 Ga0206351_10470376
1607 Ga0206351_10495102
1608 Ga0206352_10057118
1609 Ga0206352_10160481
1610 Ga0206352_10319419
1611 Ga0206352_10701397
1612 Ga0206352_11027925
1613 Ga0206350_10120654
1614 Ga0206350_10126363
1615 Ga0206350_10593967
1616 Ga0206350_10633254
1617 Ga0206350_10703881
1618 Ga0206354_10117707
1619 Ga0206354_10150451
1620 Ga0206354_10188052
1621 Ga0206354_10455429
1622 Ga0206354_10514478
1623 Ga0206354_10570582
1624 Ga0206354_10685371
1625 Ga0206354_10807495
1626 Ga0206354_10823330
1627 Ga0206354_10884654
1628 Ga0206354_11030020
1629 Ga0206354_11280122
1630 Ga0206354_11465456
1631 Ga0206354_11499587
1632 Ga0206354_11571020
1633 Ga0206353_10517557
1634 Ga0206353_10665903
1635 Ga0206353_10902826
1636 Ga0206353_11170554
1637 Ga0206353_11903580
1638 Ga0154015_1405206
1639 Ga0154015_1487719
1640 Ga0154015_1567755
1641 Ga0224712_10137350
1642 Ga0224712_10182418
1643 Ga0224712_10249337
1644 Ga0224712_10339589
1645 Ga0224712_10357098
1646 Ga0207656_10467683
1647 Ga0207682_10334667
1648 Ga0207642_10262575
1649 Ga0207642_10973417
1650 Ga0207710_10223626
1651 Ga0207688_10025596
1652 Ga0207688_10311213
1653 Ga0207688_10813352
1654 Ga0207647_10489695
1655 Ga0207647_10547097
1656 Ga0207645_10797813
1657 Ga0207643_10495500
1658 Ga0207684_11153748
1659 Ga0207654_10215980
1660 Ga0207671_10074558
1661 Ga0207662_10214551
1662 Ga0207662_10369830
1663 Ga0207657_10019609
1664 Ga0207646_10272029
1665 Ga0207694_10835467
1666 Ga0207650_10559646
1667 Ga0207650_11223413
1668 Ga0207687_10037459
1669 Ga0207687_11278374
1670 Ga0207700_10390082
1671 Ga0207644_11775000
1672 Ga0207690_10012467
1673 Ga0207690_10509924
1674 Ga0207690_10576743
1675 Ga0207690_11704268
1676 Ga0207706_10503447
1677 Ga0207706_10685248
1678 Ga0207706_11493515
1679 Ga0207686_10742607
1680 Ga0207709_10045382
1681 Ga0207709_10057256
1682 Ga0207709_10279604
1683 Ga0207670_10143275
1684 Ga0207669_10814544
1685 Ga0207704_10013539
1686 Ga0207704_10890107
1687 Ga0207691_10004838
1688 Ga0207691_10585265
1689 Ga0207661_10005390
1690 Ga0207661_10134557
1691 Ga0207661_10147369
1692 Ga0207661_10152040
1693 Ga0207661_10816864
1694 Ga0207679_10911350
1695 Ga0207679_12078591
1696 Ga0207667_10365360
1697 Ga0207712_10124511
1698 Ga0207712_10226840
1699 Ga0207712_10281262
1700 Ga0207712_10491982
1701 Ga0207712_10877630
1702 Ga0207668_10242452
1703 Ga0207668_11046612
1704 Ga0207658_10688307
1705 Ga0207658_11391538
1706 Ga0207677_10534068
1707 Ga0207677_11208663
1708 Ga0207639_10362230
1709 Ga0207639_10698485
1710 Ga0207639_10803461
1711 Ga0207639_11880463
1712 Ga0207639_12160881
1713 Ga0207678_10083431
1714 Ga0207678_10337552
1715 Ga0207678_10407772
1716 Ga0207678_11061938
1717 Ga0207708_10160824
1718 Ga0207708_10433952
1719 Ga0207702_11163541
1720 Ga0207648_10648988
1721 Ga0207648_10666245
1722 Ga0207676_10637908
1723 Ga0207676_11279424
1724 Ga0207676_12342142
1725 Ga0207674_10346220
1726 Ga0207675_100005816
1727 Ga0207675_100334858
1728 Ga0207675_100574327
1729 Ga0207675_100873753
1730 Ga0207675_101478482
1731 Ga0207683_10133865
1732 Ga0207683_10262477
1733 Ga0207683_10707569
1734 Ga0207683_11115472
1735 Ga0207698_10165197
1736 Ga0207698_10595557
1737 Ga0207698_10633966
1738 Ga0207698_12399362
1739 Ga0209371_1053740
1740 Ga0209813_10048110
1741 Ga0209813_10182124
1742 Ga0209974_10188801
1743 Ga0207428_10021772
1744 Ga0207428_10812545
1745 Ga0207428_11101326
1746 Ga0268266_10724679
1747 Ga0268266_10939358
1748 Ga0268265_10077732
1749 Ga0268265_10603979
1750 Ga0268256_1033589
1751 Ga0316177_1045098
1752 Ga0314311_1173936
1753 Ga0316178_1165051
1754 Ga0316178_1179262
1755 Ga0316181_1041643
1756 Ga0316182_1346959
1757 Ga0265767_113894
1758 Ga0307408_100293410
1759 Ga0307408_100376247
1760 Ga0307408_100706609
1761 Ga0307408_100964583
1762 Ga0307408_102018325
1763 Ga0307405_10340997
1764 Ga0307405_11249360
1765 Ga0307413_10449709
1766 Ga0307413_10775499
1767 Ga0307413_10848997
1768 Ga0307413_11451754
1769 Ga0307413_11621239
1770 Ga0307413_12017882
1771 Ga0307410_10009256
1772 Ga0307410_10042196
1773 Ga0307410_10781796
1774 Ga0307410_11601633
1775 Ga0326468_10039036
1776 Ga0307406_10106069
1777 Ga0307406_10224293
1778 Ga0307407_10079818
1779 Ga0307407_10377044
1780 Ga0307407_10721502
1781 Ga0307412_10012017
1782 Ga0307412_10135001
1783 Ga0307412_10232109
1784 Ga0307412_10257585
1785 Ga0307412_10615273
1786 Ga0307412_11329918
1787 Ga0307412_11724866
1788 Ga0307409_100253434
1789 Ga0307409_100323991
1790 Ga0307409_100387487
1791 Ga0307409_100462385
1792 Ga0307409_100467320
1793 Ga0307409_100531778
1794 Ga0307409_100653745
1795 Ga0307409_100738501
1796 Ga0307409_100760817
1797 Ga0307409_101266058
1798 Ga0307416_100023381
1799 Ga0307416_100051292
1800 Ga0307416_100274016
1801 Ga0307416_101119485
1802 Ga0307416_101425278
1803 Ga0307416_101833458
1804 Ga0307416_102888590
1805 Ga0307416_103412945
1806 Ga0307414_10316611
1807 Ga0307414_10365454
1808 Ga0307414_10491897
1809 Ga0307414_10970337
1810 Ga0307414_11686443
1811 Ga0307411_10206703
1812 Ga0307411_10542227
1813 Ga0307411_10546767
1814 Ga0307411_11416603
1815 Ga0307415_100025195
1816 Ga0307415_100107212
1817 Ga0307415_100139115
1818 Ga0307415_100139360
1819 Ga0307415_100391562
1820 Ga0307415_102032379
1821 Ga0373948_0159127
1822 Ga0373959_0073073
1823 Ga0373938_0058549
1824 Ga0373932_0215705
1825 Ga0373941_0088401
1826 Ga0373961_0259592
1827 Ga0373935_0420804
1828 Ga0373927_0914518
1829 Ga0395899_0080716
1830 Ga0395900_0234898
1831 Ga0395900_1006335
1832 Ga0395898_0009689
1833 Ga0395898_1091356
1834 Ga0395905_0522861
1835 Ga0436364_1007385
1836 Ga0395901_0017303
1837 Ga0395901_0171557
1838 Ga0395901_0252907
1839 Ga0395901_0903212
1840 Ga0242420_089934
1841 Ga0439438_036869
1842 Ga0439461_0013684
1843 Ga0439461_0049830
1844 Ga0439466_0186302
1845 Ga0439465_0212643
1846 Ga0439465_0437567
1847 Ga0451789_0153543
1848 Ga0451791_1527912
1849 Ga0451793_1573171
1850 Ga0451797_0012973
1851 Ga0451797_1419428
1852 Ga0451795_1254865
1853 Ga0451800_0914374
1854 Ga0451800_1586772
1855 Ga0451806_447833
1856 Ga0451807_0661331
1857 Ga0451835_0266313
1858 Ga0451837_0825915
1859 Ga0451837_1659218
1860 Ga0451839_0489610
1861 Ga0451841_0727502
1862 Ga0451841_1160484
1863 Ga0451851_0096184
1864 Ga0451843_0926354
1865 Ga0451843_1549413
1866 Ga0451855_0881732
1867 Ga0451853_0300070
1868 Ga0451853_0980644
1869 Ga0439431_0009865
1870 Ga0439445_0043816
1871 Ga0439452_126350
1872 Ga0450920_060327
1873 Ga0450907_004399
1874 Ga0450907_049964
1875 Ga0439446_0023771
1876 Ga0450908_110271
1877 Ga0439434_0007913
1878 Ga0466969_0008402
1879 Ga0466969_0020970
1880 Ga0466969_0117977
1881 Ga0466969_0480291
1882 Ga0466972_0114456
1883 Ga0466972_0193084
1884 Ga0466965_0023797
1885 Ga0466965_0024478
1886 Ga0466965_0128522
1887 Ga0466966_0001007
1888 Ga0466966_0026977
1889 Ga0466966_0243809
1890 Ga0466966_0433986
1891 Ga0466966_0450983
1892 Ga0466966_0622853
1893 Ga0466966_0805136
1894 Ga0466961_0006966
1895 Ga0466961_0025062
1896 Ga0466961_0102651
1897 Ga0466961_0205714
1898 Ga0466961_0285234
1899 Ga0466961_0349237
1900 Ga0466961_0899765
1901 Ga0466963_0023179
1902 Ga0466963_0059063
1903 Ga0466963_0130406
1904 Ga0466963_0133911
1905 Ga0466963_0228265
1906 Ga0466963_1245814
1907 Ga0466963_1313944
1908 Ga0466964_0006469
1909 Ga0466964_0049478
1910 Ga0466964_0306581
1911 Ga0466971_0002183
1912 Ga0466971_0067901
1913 Ga0466971_0258605
1914 Ga0466968_0134486
1915 Ga0466968_0276370
1916 Ga0466968_0632702
1917 Ga0466970_0013504
1918 Ga0466970_0037477
1919 Ga0466970_0276749
1920 Ga0466970_0476848
1921 Ga0466970_0601109
1922 Ga0466957_0099778
1923 Ga0466957_0259216
1924 Ga0466957_0312129
1925 Ga0466957_0445139
1926 Ga0466957_0693173
1927 Ga0466957_0977386
1928 Ga0466960_0055686
1929 Ga0466960_0084952
1930 Ga0466960_0284489
1931 Ga0466960_0352295
1932 Ga0466960_0436731
1933 Ga0466960_0566361
1934 Ga0466959_0007811
1935 Ga0466959_0037699
1936 Ga0466959_0162764
1937 Ga0466959_0264484
1938 Ga0466959_0368784
1939 Ga0466959_1028123
1940 Ga0466958_0312071
1941 Ga0466958_0430331
1942 Ga0466958_0576461
1943 Ga0466958_0989157
1944 Ga0466967_0005383
1945 Ga0466967_0023415
1946 Ga0466967_0052461
1947 Ga0466967_0094127
1948 Ga0466967_0183131
1949 Ga0466967_0273860
1950 Ga0466967_0295415
1951 Ga0466967_0378891
1952 Ga0466967_0665346
1953 Ga0466967_0943155
1954 Ga0466967_1589754
1955 Ga0495627_076005
1956 Ga0495603_0038876
1957 Ga0495603_0157309
1958 Ga0495629_0286904
1959 Ga0495629_0292279
1960 Ga0495641_0053880
1961 Ga0495641_0289754
1962 Ga0495653_0164882
1963 Ga0495653_0653209
1964 Ga0495582_0174195
1965 Ga0495582_0442341
1966 Ga0495639_0296446
1967 Ga0495664_0900376
1968 Ga0495584_0040319
1969 Ga0495585_0479363
1970 Ga0495594_0892398
1971 Ga0495608_0646085
1972 Ga0495644_0163773
1973 Ga0495663_0098378
1974 Ga0495666_0290213
1975 Ga0495642_0091206
1976 Ga0495652_0477682
1977 Ga0495652_0945846
1978 Ga0495665_0286646
1979 Ga0495640_0479897
1980 Ga0495598_0345565
1981 Ga0495609_0178380
1982 Ga0495621_0193659
1983 Ga0495667_0359825
1984 Ga0495656_0123817
1985 Ga0495668_0587995
1986 Ga0495635_0074159
1987 Ga0495661_0361097
1988 Ga0495588_0021810
1989 Ga0495588_0034853
1990 Ga0495588_0387479
1991 Ga0495657_0073773
1992 Ga0495647_0206755
1993 Ga0495658_0317101
1994 Ga0495669_0460494
1995 Ga0495613_0352271
1996 Ga0495624_0222345
1997 Ga0495600_0157529
1998 Ga0495600_0310100
1999 Ga0495581_0347457
2000 Ga0495636_0211944
2001 Ga0495636_0621869
2002 Ga0495676_0019766
2003 Ga0495676_0348583
2004 Ga0495676_0368058
2005 Ga0495680_0828233
2006 Ga0495675_0074917
2007 Ga0495677_0055559
2008 Ga0495679_190768
2009 Ga0495685_048654
2010 Ga0495614_0643088
2011 Ga0496100_0084513
2012 Ga0496100_0206070
2013 Ga0496100_0335971
2014 Ga0496100_0503393
2015 Ga0496101_0069312
2016 Ga0496101_0315315
2017 Ga0496102_0244649
2018 Ga0496102_0280539
2019 Ga0496102_0829722
2020 Ga0496103_0025062
2021 Ga0496103_0076288
2022 Ga0496103_0123938
2023 Ga0496103_1052964
2024 Ga0496104_0286302
2025 Ga0496104_0538679
2026 Ga0496105_0004021
2027 Ga0496105_0319417
2028 Ga0496106_0011919
2029 Ga0496106_0054636
2030 Ga0496106_0534215
2031 Ga0496106_0865133
2032 Ga0496107_0004467
2033 Ga0496107_0044951
2034 Ga0496107_0243886
2035 Ga0496107_0777957
2036 Ga0496107_0975642
2037 Ga0496108_0082588
2038 Ga0496108_0174124
2039 Ga0496108_0252756
2040 Ga0496108_0302077
2041 Ga0496108_0306622
2042 Ga0496108_0610392
2043 Ga0496108_0812070
2044 Ga0496108_1262806
2045 Ga0496109_0012536
2046 Ga0496109_0039506
2047 Ga0496109_0049936
2048 Ga0496109_0074843
2049 Ga0496109_0188724
2050 Ga0496109_0328612
2051 Ga0496109_0442065
2052 Ga0496109_0675222
2053 Ga0496109_1279193
2054 Ga0496110_0072144
2055 Ga0496110_0477572
2056 Ga0496110_0543247
2057 Ga0496110_0566733
2058 Ga0496110_0826452
2059 Ga0496110_0887940
2060 Ga0496110_1318934
2061 Ga0496111_0082292
2062 Ga0496111_0098485
2063 Ga0496111_0816564
2064 Ga0496112_0327452
2065 Ga0496112_0956987
2066 Ga0496113_0134702
2067 Ga0496113_0553532
2068 Ga0496113_0934413
2069 Ga0496113_1302893
2070 Ga0496113_1555388
2071 Ga0496114_0001671
2072 Ga0496114_0006007
2073 Ga0496114_0068005
2074 Ga0496114_0076549
2075 Ga0496114_0443641
2076 Ga0496114_0815233
2077 Ga0496115_0001227
2078 Ga0496115_0297740
2079 Ga0496124_0776053
2080 Ga0501306_001808
2081 Ga0501306_013656
2082 Ga0501306_016836
2083 Ga0501306_017358
2084 Ga0501306_020215
2085 Ga0501306_029031
2086 Ga0501306_035807
2087 Ga0501306_062970
2088 Ga0501308_021624
2089 Ga0501308_021633
2090 Ga0501308_023877
2091 Ga0501308_031288
2092 Ga0501308_039849
2093 Ga0501308_040120
2094 Ga0501308_056385
2095 Ga0501309_003424
2096 Ga0501309_015570
2097 Ga0501309_029953
2098 Ga0501309_032265
2099 Ga0501309_050103
2100 Ga0501309_076735
2101 Ga0501309_083299
2102 Ga0501310_001945
2103 Ga0501310_011600
2104 Ga0501310_013209
2105 Ga0501310_030076
2106 Ga0501310_035015
2107 Ga0501310_050061
2108 Ga0501304_007690
2109 Ga0501304_007781
2110 Ga0501304_010640
2111 Ga0501304_018671
2112 Ga0501305_026071
2113 Ga0501305_031116
2114 Ga0501305_041709
2115 Ga0501305_042298
2116 Ga0501305_046151
2117 Ga0501305_046663
2118 Ga0501305_065182
2119 Ga0501305_067071
2120 Ga0501307_023930
2121 Ga0501307_030595
2122 Ga0501307_033842
2123 Ga0501307_075933
2124 Ga0501307_092011
2125 Ga0501307_095332
2126 Ga0501311_008511
2127 Ga0501311_016036
2128 Ga0501311_022794
2129 Ga0501311_024651
2130 Ga0501311_026435
2131 Ga0501311_032471
2132 Ga0501311_037685
2133 Ga0501311_041851
2134 Ga0501311_042658
2135 Ga0501311_047757
2136 Ga0501311_064427
2137 Ga0501311_080307
2138 Ga0501311_092970
2139 Ga0501312_003439
2140 Ga0501312_013348
2141 Ga0501312_026366
2142 Ga0501312_066940
2143 Ga0501312_072770
2144 Ga0501312_116380
2145 Ga0501313_011819
2146 Ga0501313_025678
2147 Ga0501313_034760
2148 Ga0501313_045363
2149 Ga0501314_012398
2150 Ga0501315_014882
2151 Ga0501315_032100
2152 Ga0501315_033949
2153 Ga0501315_047004
2154 Ga0501315_053230
2155 Ga0501316_001753
2156 Ga0501316_006908
2157 Ga0501316_009901
2158 Ga0501316_023202
2159 Ga0501316_024413
2160 Ga0501316_029644
2161 Ga0501316_069325
2162 Ga0501316_074464
2163 Ga0501317_006833
2164 Ga0501317_010826
2165 Ga0501317_013603
2166 Ga0501317_019297
2167 Ga0501317_019458
2168 Ga0501317_022503
2169 Ga0501317_036202
2170 Ga0501317_052370
2171 Ga0501317_057948
2172 Ga0501317_066654
2173 Ga0501317_075081
2174 Ga0501317_104197
2175 Ga0501317_112009
2176 Ga0501318_000807
2177 Ga0501318_001117
2178 Ga0501318_002464
2179 Ga0501318_007220
2180 Ga0501318_011664
2181 Ga0501318_016507
2182 Ga0501318_019180
2183 Ga0501318_026279
2184 Ga0501318_034608
2185 Ga0501318_048217
2186 Ga0501318_089044
2187 Ga0501319_001340
2188 Ga0501319_004671
2189 Ga0501319_006144
2190 Ga0501319_029295
2191 Ga0501320_003000
2192 Ga0501320_009483
2193 Ga0501320_013645
2194 Ga0501320_014275
2195 Ga0501320_022258
2196 Ga0501320_033960
2197 Ga0501321_001598
2198 Ga0501321_003025
2199 Ga0501321_014152
2200 Ga0501321_015626
2201 Ga0501321_023878
2202 Ga0501321_025363
2203 Ga0501321_028308
2204 Ga0501321_037521
2205 Ga0501321_039034
2206 Ga0501321_040241
2207 Ga0501321_061083
2208 Ga0501321_062986
2209 Ga0501322_017659
2210 Ga0501323_000424
2211 Ga0501323_000806
2212 Ga0501323_006932
2213 Ga0501323_023204
2214 Ga0501323_033560
2215 Ga0501323_037637
2216 Ga0501323_060551
2217 Ga0501323_064690
2218 Ga0501323_095189
2219 Ga0501324_006356
2220 Ga0501324_007590
2221 Ga0501324_010250
2222 Ga0501324_012919
2223 Ga0501324_016833
2224 Ga0501324_021918
2225 Ga0501324_033373
2226 Ga0501324_035899
2227 Ga0501325_003146
2228 Ga0501325_009286
2229 Ga0501325_019142
2230 Ga0501325_023722
2231 Ga0501329_01449
2232 Ga0501333_004646
2233 Ga0501333_006364
2234 Ga0501338_06517
2235 Ga0501340_007576
2236 Ga0501031_0062259
2237 Ga0501031_0155910
2238 Ga0501032_0017464
2239 Ga0501032_0159374
2240 Ga0501032_0526640
2241 Ga0501032_0682780
2242 Ga0501033_0107440
2243 Ga0501034_0011971
2244 Ga0501034_0159328
2245 Ga0501036_0037115
2246 Ga0501036_0041412
2247 Ga0501036_0290693
2248 Ga0501036_0675603
2249 Ga0501036_1356736
2250 Ga0501036_1483303
2251 Ga0501037_0009850
2252 Ga0501038_0008979
2253 Ga0501038_0009072
2254 Ga0501038_0010481
2255 Ga0501038_0352243
2256 Ga0501039_0006825
2257 Ga0501039_0086264
2258 Ga0501039_0254242
2259 Ga0501039_0506053
2260 Ga0501039_0839420
2261 Ga0501040_0005127
2262 Ga0501040_0061519
2263 Ga0501040_0329601
2264 Ga0501040_0512914
2265 Ga0501041_0070654
2266 Ga0501041_0284266
2267 Ga0501041_0284827
2268 Ga0501041_0377349
2269 Ga0501041_0891188
2270 Ga0501042_0024296
2271 Ga0501042_0034695
2272 Ga0501042_0040727
2273 Ga0501042_0785296
2274 Ga0501042_0785463
2275 Ga0501042_1035756
2276 Ga0501043_0039304
2277 Ga0501043_0086168
2278 Ga0501043_0153971
2279 Ga0501043_0297510
2280 Ga0501043_0999871
2281 Ga0501046_0000184
2282 Ga0501046_0014510
2283 Ga0501046_0036642
2284 Ga0501046_0102430
2285 Ga0501047_0030501
2286 Ga0501047_0091108
2287 Ga0501048_0009925
2288 Ga0501048_0068780
2289 Ga0501048_0656887
2290 Ga0501067_0038315
2291 Ga0501067_0098556
2292 Ga0501067_0230796
2293 Ga0501067_0492870
2294 Ga0501067_0794604
2295 Ga0501068_0088194
2296 Ga0501068_0194588
2297 Ga0501068_0226659
2298 Ga0501068_0278538
2299 Ga0501069_0023811
2300 Ga0501069_0076909
2301 Ga0501069_0580461
2302 Ga0501070_0014863
2303 Ga0501070_0157098
2304 Ga0501070_0157879
2305 Ga0501070_0171686
2306 Ga0501070_1076811
2307 Ga0501070_1344402
2308 Ga0501071_0055572
2309 Ga0501071_0075525
2310 Ga0501071_0988430
2311 Ga0501071_1122033
2312 Ga0501071_1166474
2313 Ga0501072_0248284
2314 Ga0501072_0332595
2315 Ga0501072_1174049
2316 Ga0501072_1450056
2317 Ga0501073_0076730
2318 Ga0501073_0287670
2319 Ga0501073_0962914
2320 Ga0501074_0013659
2321 Ga0501074_0239633
2322 Ga0501074_0439599
2323 Ga0501074_0510938
2324 Ga0501074_1111784
2325 Ga0501075_0068644
2326 Ga0501076_1174490
2327 Ga0501076_1254812
2328 Ga0501077_0188376
2329 Ga0501202_066601
2330 Ga0501208_153501
2331 Ga0501217_118011
2332 Ga0501224_047026
2333 Ga0501243_046446
2334 Ga0501243_077072
2335 Ga0501257_124927
2336 Ga0501257_260959
2337 Ga0501221_074062
2338 Ga0501225_0200766
2339 Ga0501080_0164141
2340 Ga0501080_0361873
2341 Ga0501080_1688910
2342 Ga0501081_0067962
2343 Ga0501081_0414458
2344 Ga0501081_0481541
2345 Ga0501035_0007374
2346 Ga0501035_0046149
2347 Ga0501044_0010047
2348 Ga0501044_0070278
2349 Ga0501045_0000777
2350 Ga0501045_0114781
2351 Ga0501045_0248232
2352 Ga0501045_0249796
2353 Ga0501045_0489383
2354 Ga0501212_083475
2355 nmdc:mga03n38_183427_c1
2356 nmdc:mga03n38_28651_c1
2357 nmdc:mga03n38_59143_c1
2358 nmdc:mga03n38_772347_c1
2359 nmdc:mga03n38_787875_c1
2360 nmdc:mga00v17_14491_c1
2361 nmdc:mga00v17_21161_c1
2362 nmdc:mga00v17_217682_c1
2363 nmdc:mga0yw44_123191_c1
2364 nmdc:mga0yw44_204303_c1
2365 nmdc:mga0yw44_22344_c1
2366 nmdc:mga0yw44_337032_c1
2367 nmdc:mga0yw44_353012_c1
2368 nmdc:mga0yw44_357158_c1
2369 nmdc:mga0yw44_367219_c1
2370 nmdc:mga0yw44_374504_c1
2371 nmdc:mga0yw44_381190_c1
2372 nmdc:mga0yw44_45943_c1
2373 nmdc:mga0yw44_551358_c1
2374 nmdc:mga0yw44_59761_c1
2375 nmdc:mga0yw44_80998_c1
2376 nmdc:mga06z11_144871_c1
2377 nmdc:mga06z11_1605_c1
2378 nmdc:mga06z11_178624_c1
2379 nmdc:mga06z11_209757_c1
2380 nmdc:mga06z11_924000_c1
2381 nmdc:mga04h51_226825_c1
2382 nmdc:mga04h51_303980_c1
2383 nmdc:mga04h51_74600_c1
2384 nmdc:mga07m45_209218_c1
2385 nmdc:mga05p37_712347_c1
2386 nmdc:mga0qj67_1320512_c1
2387 nmdc:mga06r32_280_c4
2388 nmdc:mga08y16_2141246_c1
2389 nmdc:mga08y16_602382_c1
2390 nmdc:mga08y16_904192_c1
2391 nmdc:mga08y16_99916_c1
2392 nmdc:mga0n895_1023800_c1
2393 nmdc:mga0a205_1473818_c1
2394 Ga0495601_0530620
2395 Ga0495612_0176920
2396 Ga0495612_0316891
2397 Ga0495655_0052079
2398 Ga0495595_0207570
2399 Ga0495619_0026939
2400 Ga0495619_0128753
2401 Ga0495619_0463856
2402 Ga0495619_0766655
2403 Ga0500556_0000417
2404 Ga0500593_001815
2405 Ga0500655_020453
2406 Ga0500573_0024690
2407 Ga0500573_0442141
2408 Ga0500604_0194012
2409 Ga0501084_0003572
2410 Ga0501084_1800560
2411 Ga0590075_040531
2412 Ga0587084_004447
2413 Ga0587066_111690
2414 Ga0587070_082332
2415 Ga0587070_092236
2416 Ga0587073_0233261
2417 Ga0587080_037179
2418 Ga0587082_045183
2419 Ga0587088_059670
2420 Ga0587088_069115
2421 Ga0587089_058620
2422 Ga0587090_040745
2423 Ga0587090_055418
2424 Ga0587090_061702
2425 Ga0587090_102896
2426 Ga0587091_120095
2427 Ga0587092_027209
2428 Ga0587092_057562
2429 Ga0587098_019778
2430 Ga0587106_007298
2431 Ga0587106_035889
2432 Ga0587106_052337
2433 Ga0587121_05808
2434 Ga0587129_009787
2435 Ga0587099_013537
2436 Ga0587101_022425
2437 Ga0587115_041527
2438 Ga0587115_061526
2439 Ga0587128_039404
2440 Ga0587128_050313
2441 Ga0587062_045267
2442 Ga0587068_018484
2443 Ga0587068_091541
2444 Ga0587069_044260
2445 Ga0587075_034598
2446 Ga0587075_043431
2447 Ga0587075_049328
2448 Ga0587078_042830
2449 Ga0587079_069729
2450 Ga0587102_045529
2451 Ga0587105_004205
2452 Ga0587114_024577
2453 Ga0587114_045626
2454 Ga0587118_14263
2455 Ga0587119_014442
2456 Ga0587071_068556
2457 Ga0587071_082121
2458 Ga0587111_0045587
2459 Ga0587111_0098702
2460 Ga0587111_0227970
2461 Ga0501082_0007916
2462 Ga0501082_0724991
2463 Ga0501082_1447759
2464 Ga0466962_0002275
2465 Ga0466962_0038742
2466 Ga0466962_0130887
2467 Ga0466962_0147740
2468 Ga0530510_0165889
2469 Ga0530510_0172128
2470 Ga0530510_1127169
2471 2585301890
2472 2585304852
2473 2616899875
2474 2643828134
2475 2643897863
2476 2644018699
2477 2644090068
2478 2644179834
2479 2644183216
2480 2644319913
2481 2644385381
2482 2644409008
2483 2644436358
2484 2644531223
2485 2729905770
2486 2785344289
2487 2785368568
2488 2786669657
2489 2793976154
2490 2808841256
2491 2819742873
2492 2855387467
2493 2857484884
2494 2862184904
2495 2862288159
2496 2867431117
2497 2867479659
2498 2875393779
2499 2877681968
2500 2912720930
2501 2919468657
2502 2946050878
2503 2954676082
2504 2954688084
2505 2954717034
2506 2954726982
2507 2954734799
2508 2954745905
2509 2954753685
2510 2954764877
2511 2990094188
2512 2995471105
2513 2997456539
2514 8033690549
2515 8047898955
2516 8048127682
2517 8048359964
2518 8048375913
2519 8048382294
2520 8048408398
2521 8054612376
2522 8056453597

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01016

Ribosomal_L27

Ribosomal L27 protein

2

84

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
8c94-assembly1.cif.gz_W cryo-em captures early ribosome assembly in action 0.9114 20 89
4ce4-assembly1.cif.gz_0 39s large subunit of the porcine mitochondrial ribosome 0.91 19 89
8c8z-assembly1.cif.gz_W cryo-em captures early ribosome assembly in action 0.8973 20 89
7pkt-assembly1.cif.gz_u large subunit of the chlamydomonas reinhardtii mitoribosome 0.8911 23 92
1v8q-assembly1.cif.gz_A crystal structure of ribosomal protein l27 from thermus thermophilus hb8 0.8857 20 89
ID Description Score Start End Superfamily
1v8qA00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.8857 20 89 2.40.50.100
af_Q9XXD2_5_60_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.8444 29 89 2.40.50.100
1v8qA00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.8368 20 89 2.40.50.100
af_Q9XXD2_5_60_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.8314 29 89 2.40.50.100
af_Q9Y3B2_6_56_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.8071 29 89 2.40.50.100
ID Description Score Start End GO Terms
AF-V6UNU0-F1-model_v4 deleted 0.9386 24 89
AF-A0A7W7FST9-F1-model_v4 Large ribosomal subunit protein bL27 (50S ribosomal protein L27) 0.9165 24 93 GO:0003735
GO:0006412
GO:0022625
AF-A0A2D3WHH1-F1-model_v4 Uncharacterized protein 0.9104 23 89 GO:0003735
GO:0005840
GO:0006412
AF-A0A1V5VQS4-F1-model_v4 Large ribosomal subunit protein bL27 (50S ribosomal protein L27) 0.9099 19 89 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-A0A2S6T0A6-F1-model_v4 Large ribosomal subunit protein bL27 (50S ribosomal protein L27) 0.9086 20 91 GO:0003735
GO:0005840
GO:0006412
GO:1990904

Map