F492302
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1261 | 515 | 2522 | 85 |
Family's Representative Sequence
| Representative Sequence | 3300000549|LJQas_1002902|LJQas_10029023 |
| Length | 99 |
| Sequence | MAHKKGAASTKNGRDSNSQRLGVKRYGGQTVNAGEIIVRQRGTHFHPGSGVGRGGDDTLFALIGGAVEFGTRAVAGSSTSSRASELTLARTPRSSEGRP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300000549 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled | Metagenome | Rhizosphere |
| 2 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 3 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 4 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 5 | 3300002872 | Avena fatua rhizosphere microbial communities - H1_Bulk_Litter_5 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 6 | 3300003162 | Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 7 | 3300003163 | Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 8 | 3300003300 | Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_1 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 9 | 3300003308 | Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 10 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 11 | 3300003544 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 12 | 3300003559 | Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_43 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 13 | 3300003568 | Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_24 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 14 | 3300003575 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 15 | 3300003577 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 16 | 3300003579 | Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 17 | 3300003611 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_27 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 18 | 3300003693 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 19 | 3300003735 | Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_23 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 20 | 3300004785 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-1 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 21 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 22 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 23 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 24 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 28 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 30 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 40 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 53 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 59 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 60 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 61 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 66 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 67 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 69 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 70 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 71 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 73 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 74 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 75 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 76 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 77 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 78 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 79 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 80 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 81 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 82 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 83 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 85 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 86 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 87 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 88 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 89 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 90 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 91 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 92 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 93 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 94 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 95 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 96 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 97 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 98 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 99 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 100 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 101 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300012485 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.7.old.040610 | Metagenome | Rhizosphere |
| 115 | 3300012491 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610 | Metagenome | Rhizosphere |
| 116 | 3300012497 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 | Metagenome | Rhizosphere |
| 117 | 3300012502 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 | Metagenome | Rhizosphere |
| 118 | 3300012515 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 | Metagenome | Rhizosphere |
| 119 | 3300013044 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 120 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 131 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 135 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 136 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 137 | 3300015688 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 | Metagenome | Rhizosphere |
| 138 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 140 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 141 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 142 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 143 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 144 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 145 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 146 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 147 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 148 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 149 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 150 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 196 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 198 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 201 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 202 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 203 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 204 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 205 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 206 | 3300030836 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 207 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 208 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 209 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 210 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 211 | 3300031889 | Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO | Metagenome | Rhizosphere |
| 212 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 213 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 214 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 215 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 216 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 217 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 218 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 219 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 220 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 221 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 222 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 223 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 224 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 225 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 226 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 227 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 228 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 229 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 230 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 231 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 232 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 233 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 234 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 235 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 236 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 237 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 238 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 239 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 240 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 241 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 242 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 243 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 244 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 245 | 3300041462 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG | Metagenome | Rhizoplane |
| 246 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 247 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 248 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 249 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 250 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 251 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 252 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 253 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 254 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 255 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 256 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 257 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 258 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 259 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 260 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 261 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 262 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 263 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 264 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 265 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 266 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 267 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 268 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 269 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 270 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 271 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 272 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 273 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 274 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 275 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 276 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 277 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 278 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 323 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 324 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 325 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 326 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 327 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 328 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 329 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 330 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 331 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 332 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 333 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 334 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 335 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 336 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 337 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 338 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 339 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 340 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 341 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 342 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 343 | 3300049160 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 344 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 345 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 346 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 347 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 348 | 3300049529 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 349 | 3300049530 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 350 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 351 | 3300049532 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 352 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 353 | 3300049534 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 354 | 3300049535 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 355 | 3300049536 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 356 | 3300049537 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 357 | 3300049538 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 358 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 359 | 3300049540 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 360 | 3300049541 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 361 | 3300049545 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 362 | 3300049549 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 363 | 3300049554 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_A_7_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 364 | 3300049556 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 365 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 366 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 367 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 368 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 369 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 370 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 371 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 372 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 373 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 374 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 375 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 376 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 377 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 378 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 379 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 380 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 381 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 382 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 383 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 384 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 385 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 386 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 387 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 388 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 389 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 390 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 391 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 392 | 3300049655 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought | Metagenome | Rhizosphere |
| 393 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 394 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 395 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 396 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 397 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 398 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 399 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 400 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 401 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 402 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 403 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 404 | 3300049851 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought | Metagenome | Rhizosphere |
| 405 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 406 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 407 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 408 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 409 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 410 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 411 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 412 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 413 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 414 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 415 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 416 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 417 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 422 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 423 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 424 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 425 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 426 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 427 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 428 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 429 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 430 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 431 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 432 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 433 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 434 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 435 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 436 | 3300059509 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 437 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 438 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 439 | 3300059512 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 440 | 3300059604 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 441 | 3300059605 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 442 | 3300059606 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 159R_AD_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 443 | 3300059608 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 166R_SD_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 444 | 3300059622 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 445 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 446 | 3300059626 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 447 | 3300059630 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 448 | 3300059639 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 449 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 450 | 3300059642 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 451 | 3300059644 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 452 | 3300059646 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 453 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 454 | 3300059649 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 455 | 3300059651 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 70R_SD_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 456 | 3300059655 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 457 | 3300059657 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 156R_AW_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 458 | 3300059658 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 459 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 460 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 461 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 462 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 463 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 464 | 2582581312 | Streptomyces atratus OK008 | Isolate | Rhizosphere |
| 465 | 2582581313 | Streptomyces mirabilis OV308 | Isolate | Rhizosphere |
| 466 | 2616644941 | Streptomyces atratus OK807 | Isolate | Rhizosphere |
| 467 | 2643221561 | Nocardioides sp. Root151 | Isolate | Unclassified |
| 468 | 2643221578 | Streptomyces sp. Root63 | Isolate | Unclassified |
| 469 | 2643221601 | Kitasatospora sp. Root187 | Isolate | Unclassified |
| 470 | 2643221615 | Nocardioides sp. Root224 | Isolate | Unclassified |
| 471 | 2643221631 | Kitasatospora sp. Root107 | Isolate | Unclassified |
| 472 | 2643221632 | Leifsonia sp. Root112D2 | Isolate | Unclassified |
| 473 | 2643221657 | Nocardioides sp. Root1257 | Isolate | Unclassified |
| 474 | 2643221670 | Streptomyces sp. Root431 | Isolate | Unclassified |
| 475 | 2643221673 | Streptomyces sp. Root1295 | Isolate | Unclassified |
| 476 | 2643221678 | Streptomyces sp. Root1310 | Isolate | Unclassified |
| 477 | 2643221696 | Nocardioides sp. Root140 | Isolate | Unclassified |
| 478 | 2728369276 | Kineococcus rhizosphaerae DSM 19711 | Isolate | Rhizosphere |
| 479 | 2784746763 | Streptomyces ossamyceticus SAI-001 | Isolate | Unclassified |
| 480 | 2784746768 | Streptomyces griseorubiginosus SAI-142 | Isolate | Unclassified |
| 481 | 2786546132 | Streptomyces sp. W SAI-097 | Isolate | Unclassified |
| 482 | 2791355406 | Streptomyces rhizosphaericus NRRL B-24304 | Isolate | Unclassified |
| 483 | 2808606359 | Streptomyces sp. RJA2910 | Isolate | Unclassified |
| 484 | 2818991472 | Kitasatospora viridis DSM 44826 | Isolate | Rhizosphere |
| 485 | 2855386786 | Nocardioides ferulae EGI 63112 | Isolate | Unclassified |
| 486 | 2857481737 | Nocardioides sp. R-74106 | Isolate | Unclassified |
| 487 | 2862178590 | Streptomyces sp. SDr-06 | Isolate | Rhizosphere |
| 488 | 2862281513 | Streptomyces sp. Act143 | Isolate | Rhizosphere |
| 489 | 2867428634 | Streptomyces sp. RP5T | Isolate | Unclassified |
| 490 | 2867475112 | Streptomyces sp. TM32 | Isolate | Unclassified |
| 491 | 2875391855 | Streptomyces cavourensis 1AS2a | Isolate | Rhizosphere |
| 492 | 2877676314 | Streptomyces griseorubiginosus 3E-1 | Isolate | Unclassified |
| 493 | 2912715099 | Streptomyces sp. Z423-1 | Isolate | Rhizosphere |
| 494 | 2919468124 | Streptomyces sp. 3330 | Isolate | Rhizosphere |
| 495 | 2946045630 | Streptomyces sp. W4I9-2 | Isolate | Rhizosphere |
| 496 | 2954673503 | Streptomyces sp. SAI-119 | Isolate | Rhizosphere |
| 497 | 2954682443 | Streptomyces sp. SAI-149 | Isolate | Rhizosphere |
| 498 | 2954711539 | Streptomyces sp. SAI-090 | Isolate | Rhizosphere |
| 499 | 2954721474 | Streptomyces sp. SAI-117 | Isolate | Rhizosphere |
| 500 | 2954731030 | Streptomyces sp. SAI-133 | Isolate | Rhizosphere |
| 501 | 2954740390 | Streptomyces sp. SAI-041 | Isolate | Rhizosphere |
| 502 | 2954749733 | Streptomyces sp. SAI-135 | Isolate | Rhizosphere |
| 503 | 2954759201 | Streptomyces sp. SAI-208 | Isolate | Rhizosphere |
| 504 | 2990088156 | Streptomyces albidus CAP 215 | Isolate | Unclassified |
| 505 | 2995463766 | Streptacidiphilus fuscans NEAU-YB345 | Isolate | Unclassified |
| 506 | 2997451912 | Streptomyces piniterrae jys28 | Isolate | Rhizosphere |
| 507 | 8033684223 | Streptomyces phytophilus PIP175 | Isolate | Unclassified |
| 508 | 8047893842 | Streptomyces cangkringensis DSM 41769 | Isolate | Rhizosphere |
| 509 | 8048127548 | Streptomyces samsunensis DSM 42010 | Isolate | Rhizosphere |
| 510 | 8048356638 | Streptomyces rhizosphaericus DSM 41760 | Isolate | Rhizosphere |
| 511 | 8048369669 | Streptomyces indonesiensis DSM 41759 | Isolate | Rhizoplane |
| 512 | 8048379754 | Streptomyces asiaticus DSM 41761 | Isolate | Rhizosphere |
| 513 | 8048406513 | Streptomyces heilongjiangensis NEAU-W2 | Isolate | Unclassified |
| 514 | 8054609563 | Nocardioides astragali CGMCC 4.7327 | Isolate | Nodule |
| 515 | 8056447290 | Streptomyces huiliensis SCA2-4 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 70.1 |
| Metatranscriptomes | 25.77 |
| Isolates | 4.12 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.15 |
| Nodule | 0.08 |
| Rhizoplane | 6.26 |
| Rhizosphere | 84.93 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | LJQas_1002902 | 3300000549 | Bacteria | 2334 |
| 2 | LJQas_1008780 | 3300000549 | Bacteria | 1224 |
| 3 | JGI24735J21928_10094491 | 3300002067 | Bacteria | 858 |
| 4 | JGI24738J21930_10028799 | 3300002075 | Bacteria | 1136 |
| 5 | JGI24744J21845_10098387 | 3300002077 | Bacteria | 539 |
| 6 | Ga0006762J43184_106160 | 3300002872 | Bacteria | 523 |
| 7 | Ga0006778J45830_1005237 | 3300003162 | Bacteria | 824 |
| 8 | Ga0006778J45830_1017350 | 3300003162 | Bacteria | 621 |
| 9 | Ga0006778J45830_1018865 | 3300003162 | Bacteria | 618 |
| 10 | Ga0006778J45830_1024217 | 3300003162 | Bacteria | 707 |
| 11 | Ga0006778J45830_1076135 | 3300003162 | Bacteria | 608 |
| 12 | Ga0006759J45824_1007731 | 3300003163 | Bacteria | 744 |
| 13 | Ga0006759J45824_1033594 | 3300003163 | Bacteria | 548 |
| 14 | Ga0006759J45824_1040332 | 3300003163 | Bacteria | 623 |
| 15 | Ga0006759J45824_1056525 | 3300003163 | Bacteria | 526 |
| 16 | Ga0006758J48902_1008537 | 3300003300 | Bacteria | 729 |
| 17 | Ga0006777J48905_1029661 | 3300003308 | Bacteria | 710 |
| 18 | Ga0006777J48905_1050436 | 3300003308 | Bacteria | 502 |
| 19 | Ga0006777J48905_1056291 | 3300003308 | Bacteria | 504 |
| 20 | rootL2_10084680 | 3300003322 | Bacteria | 1328 |
| 21 | Ga0007417J51691_1034199 | 3300003544 | Bacteria | 634 |
| 22 | Ga0007417J51691_1045249 | 3300003544 | Bacteria | 642 |
| 23 | Ga0007427J51700_105542 | 3300003559 | Bacteria | 671 |
| 24 | Ga0007427J51700_112829 | 3300003559 | Bacteria | 723 |
| 25 | Ga0006781J51513_1004365 | 3300003568 | Bacteria | 743 |
| 26 | Ga0006781J51513_1012022 | 3300003568 | Bacteria | 712 |
| 27 | Ga0006781J51513_1017605 | 3300003568 | Bacteria | 589 |
| 28 | Ga0007409J51694_1007139 | 3300003575 | Bacteria | 738 |
| 29 | Ga0007409J51694_1055501 | 3300003575 | Bacteria | 511 |
| 30 | Ga0007416J51690_1008794 | 3300003577 | Bacteria | 738 |
| 31 | Ga0007416J51690_1032047 | 3300003577 | Bacteria | 622 |
| 32 | Ga0007429J51699_1004976 | 3300003579 | Bacteria | 754 |
| 33 | Ga0007429J51699_1026481 | 3300003579 | Bacteria | 696 |
| 34 | Ga0007429J51699_1028743 | 3300003579 | Bacteria | 733 |
| 35 | Ga0007429J51699_1147323 | 3300003579 | Bacteria | 555 |
| 36 | Ga0007411J51799_104538 | 3300003611 | Bacteria | 734 |
| 37 | Ga0032354_1003953 | 3300003693 | Bacteria | 642 |
| 38 | Ga0032354_1020597 | 3300003693 | Bacteria | 679 |
| 39 | Ga0032354_1021921 | 3300003693 | Bacteria | 807 |
| 40 | Ga0006780_1002679 | 3300003735 | Bacteria | 709 |
| 41 | Ga0006780_1018908 | 3300003735 | Bacteria | 646 |
| 42 | Ga0058858_1005265 | 3300004785 | Bacteria | 570 |
| 43 | Ga0058858_1008839 | 3300004785 | Bacteria | 723 |
| 44 | Ga0058859_10007251 | 3300004798 | Bacteria | 765 |
| 45 | Ga0058859_10031544 | 3300004798 | Bacteria | 617 |
| 46 | Ga0058861_10020666 | 3300004800 | Bacteria | 744 |
| 47 | Ga0058860_12069996 | 3300004801 | Bacteria | 1121 |
| 48 | Ga0070658_10845028 | 3300005327 | Bacteria | 796 |
| 49 | Ga0070658_11319472 | 3300005327 | Bacteria | 627 |
| 50 | Ga0070683_100013284 | 3300005329 | Bacteria | 7178 |
| 51 | Ga0070683_100094819 | 3300005329 | Bacteria | 2805 |
| 52 | Ga0070683_100760098 | 3300005329 | Bacteria | 929 |
| 53 | Ga0070683_100864030 | 3300005329 | Bacteria | 867 |
| 54 | Ga0070683_101329895 | 3300005329 | Bacteria | 691 |
| 55 | Ga0070683_101794826 | 3300005329 | Bacteria | 590 |
| 56 | Ga0070683_102190730 | 3300005329 | Bacteria | 531 |
| 57 | Ga0070670_100763874 | 3300005331 | Bacteria | 872 |
| 58 | Ga0070680_101902148 | 3300005336 | Bacteria | 516 |
| 59 | Ga0070682_100243391 | 3300005337 | Bacteria | 1292 |
| 60 | Ga0070682_100414100 | 3300005337 | Bacteria | 1022 |
| 61 | Ga0070682_100824630 | 3300005337 | Bacteria | 756 |
| 62 | Ga0068868_100352581 | 3300005338 | Bacteria | 1260 |
| 63 | Ga0068868_101943940 | 3300005338 | Bacteria | 558 |
| 64 | Ga0070660_100036431 | 3300005339 | Bacteria | 3727 |
| 65 | Ga0070660_101221018 | 3300005339 | Bacteria | 637 |
| 66 | Ga0070691_10295104 | 3300005341 | Bacteria | 884 |
| 67 | Ga0070687_101495327 | 3300005343 | Bacteria | 507 |
| 68 | Ga0070692_10458023 | 3300005345 | Bacteria | 818 |
| 69 | Ga0070692_10719656 | 3300005345 | Bacteria | 674 |
| 70 | Ga0070692_10786013 | 3300005345 | Bacteria | 648 |
| 71 | Ga0070668_100035938 | 3300005347 | Bacteria | 3780 |
| 72 | Ga0070668_100631463 | 3300005347 | Bacteria | 940 |
| 73 | Ga0070669_101938912 | 3300005353 | Bacteria | 515 |
| 74 | Ga0070671_101803509 | 3300005355 | Bacteria | 544 |
| 75 | Ga0070674_100754251 | 3300005356 | Bacteria | 837 |
| 76 | Ga0070674_101764301 | 3300005356 | Bacteria | 561 |
| 77 | Ga0070674_102056534 | 3300005356 | Bacteria | 521 |
| 78 | Ga0070673_100248121 | 3300005364 | Bacteria | 1551 |
| 79 | Ga0070673_100622564 | 3300005364 | Bacteria | 986 |
| 80 | Ga0070688_100241705 | 3300005365 | Bacteria | 1282 |
| 81 | Ga0070659_100030400 | 3300005366 | Bacteria | 4180 |
| 82 | Ga0070659_100155252 | 3300005366 | Bacteria | 1869 |
| 83 | Ga0070659_100628514 | 3300005366 | Bacteria | 924 |
| 84 | Ga0070667_100806611 | 3300005367 | Bacteria | 871 |
| 85 | Ga0070714_100536709 | 3300005435 | Bacteria | 1119 |
| 86 | Ga0070714_101692607 | 3300005435 | Bacteria | 618 |
| 87 | Ga0070713_100530506 | 3300005436 | Bacteria | 1113 |
| 88 | Ga0070710_11519626 | 3300005437 | Bacteria | 504 |
| 89 | Ga0070701_10001495 | 3300005438 | Bacteria | 8661 |
| 90 | Ga0070711_101157707 | 3300005439 | Bacteria | 668 |
| 91 | Ga0070711_101648264 | 3300005439 | Bacteria | 561 |
| 92 | Ga0070700_100541634 | 3300005441 | Bacteria | 903 |
| 93 | Ga0070700_101157639 | 3300005441 | Bacteria | 644 |
| 94 | Ga0070700_101361181 | 3300005441 | Bacteria | 599 |
| 95 | Ga0070694_100906884 | 3300005444 | Bacteria | 728 |
| 96 | Ga0070663_100101383 | 3300005455 | Bacteria | 2148 |
| 97 | Ga0070663_101045818 | 3300005455 | Bacteria | 712 |
| 98 | Ga0070663_101524739 | 3300005455 | Bacteria | 594 |
| 99 | Ga0070678_100193025 | 3300005456 | Bacteria | 1675 |
| 100 | Ga0070678_101010375 | 3300005456 | Bacteria | 765 |
| 101 | Ga0070678_101960762 | 3300005456 | Bacteria | 554 |
| 102 | Ga0070662_100466784 | 3300005457 | Bacteria | 1050 |
| 103 | Ga0070662_100784202 | 3300005457 | Bacteria | 810 |
| 104 | Ga0070662_101113450 | 3300005457 | Bacteria | 678 |
| 105 | Ga0070662_101417856 | 3300005457 | Bacteria | 599 |
| 106 | Ga0070662_101955886 | 3300005457 | Bacteria | 507 |
| 107 | Ga0068867_101061423 | 3300005459 | Bacteria | 737 |
| 108 | Ga0070685_10298080 | 3300005466 | Bacteria | 1086 |
| 109 | Ga0070706_100471117 | 3300005467 | Bacteria | 1168 |
| 110 | Ga0070707_101134928 | 3300005468 | Bacteria | 748 |
| 111 | Ga0070698_100020921 | 3300005471 | Bacteria | 6855 |
| 112 | Ga0070698_100069006 | 3300005471 | Bacteria | 3551 |
| 113 | Ga0070698_100183995 | 3300005471 | Bacteria | 2027 |
| 114 | Ga0070698_101941342 | 3300005471 | Bacteria | 542 |
| 115 | Ga0070699_100185071 | 3300005518 | Bacteria | 1849 |
| 116 | Ga0070684_100182637 | 3300005535 | Bacteria | 1908 |
| 117 | Ga0070684_100293314 | 3300005535 | Bacteria | 1491 |
| 118 | Ga0070684_100695765 | 3300005535 | Bacteria | 947 |
| 119 | Ga0070684_101450315 | 3300005535 | Bacteria | 647 |
| 120 | Ga0070697_100060437 | 3300005536 | Bacteria | 3089 |
| 121 | Ga0070697_100911186 | 3300005536 | Bacteria | 780 |
| 122 | Ga0068853_100286912 | 3300005539 | Bacteria | 1518 |
| 123 | Ga0068853_100912865 | 3300005539 | Bacteria | 844 |
| 124 | Ga0070672_100296536 | 3300005543 | Bacteria | 1370 |
| 125 | Ga0070672_100320053 | 3300005543 | Bacteria | 1318 |
| 126 | Ga0070695_101903205 | 3300005545 | Bacteria | 500 |
| 127 | Ga0070693_100205218 | 3300005547 | Bacteria | 1282 |
| 128 | Ga0070693_101035927 | 3300005547 | Bacteria | 623 |
| 129 | Ga0070665_100971977 | 3300005548 | Bacteria | 862 |
| 130 | Ga0070665_101939604 | 3300005548 | Bacteria | 594 |
| 131 | Ga0070704_101787462 | 3300005549 | Bacteria | 569 |
| 132 | Ga0068855_100630693 | 3300005563 | Bacteria | 1153 |
| 133 | Ga0070664_101452530 | 3300005564 | Bacteria | 649 |
| 134 | Ga0068857_100493991 | 3300005577 | Bacteria | 1148 |
| 135 | Ga0068857_101275372 | 3300005577 | Bacteria | 713 |
| 136 | Ga0068854_101599800 | 3300005578 | Bacteria | 594 |
| 137 | Ga0068856_100569818 | 3300005614 | Bacteria | 1153 |
| 138 | Ga0068856_102161422 | 3300005614 | Bacteria | 566 |
| 139 | Ga0070702_100156947 | 3300005615 | Bacteria | 1466 |
| 140 | Ga0070702_100201224 | 3300005615 | Bacteria | 1318 |
| 141 | Ga0070702_101367788 | 3300005615 | Bacteria | 578 |
| 142 | Ga0068852_100153229 | 3300005616 | Bacteria | 2145 |
| 143 | Ga0068852_100395299 | 3300005616 | Bacteria | 1359 |
| 144 | Ga0068852_100645393 | 3300005616 | Bacteria | 1066 |
| 145 | Ga0068852_100666133 | 3300005616 | Bacteria | 1049 |
| 146 | Ga0068852_100790617 | 3300005616 | Bacteria | 962 |
| 147 | Ga0068864_101609751 | 3300005618 | Bacteria | 653 |
| 148 | Ga0068864_102313612 | 3300005618 | Bacteria | 544 |
| 149 | Ga0068866_11125236 | 3300005718 | Bacteria | 563 |
| 150 | Ga0068861_100012521 | 3300005719 | Bacteria | 5917 |
| 151 | Ga0068861_100282735 | 3300005719 | Bacteria | 1429 |
| 152 | Ga0068861_100513312 | 3300005719 | Bacteria | 1086 |
| 153 | Ga0068861_101792514 | 3300005719 | Bacteria | 609 |
| 154 | Ga0068861_101811761 | 3300005719 | Bacteria | 606 |
| 155 | Ga0068851_10415460 | 3300005834 | Bacteria | 794 |
| 156 | Ga0068870_10197818 | 3300005840 | Bacteria | 1217 |
| 157 | Ga0068870_10606301 | 3300005840 | Bacteria | 744 |
| 158 | Ga0068863_100524148 | 3300005841 | Bacteria | 1168 |
| 159 | Ga0068858_100146607 | 3300005842 | Bacteria | 2217 |
| 160 | Ga0068858_100644044 | 3300005842 | Bacteria | 1030 |
| 161 | Ga0068860_101350529 | 3300005843 | Bacteria | 734 |
| 162 | Ga0068862_100231939 | 3300005844 | Bacteria | 1675 |
| 163 | Ga0081455_10060081 | 3300005937 | Bacteria | 3206 |
| 164 | Ga0081455_10060828 | 3300005937 | Bacteria | 3182 |
| 165 | Ga0070717_11239366 | 3300006028 | Bacteria | 679 |
| 166 | Ga0070717_11389491 | 3300006028 | Bacteria | 638 |
| 167 | Ga0075365_10020619 | 3300006038 | Bacteria | 4091 |
| 168 | Ga0075365_10050267 | 3300006038 | Bacteria | 2749 |
| 169 | Ga0075365_10059522 | 3300006038 | Bacteria | 2546 |
| 170 | Ga0075365_10065852 | 3300006038 | Bacteria | 2429 |
| 171 | Ga0075365_10075248 | 3300006038 | Bacteria | 2278 |
| 172 | Ga0075365_10393035 | 3300006038 | Bacteria | 978 |
| 173 | Ga0075365_10930423 | 3300006038 | Bacteria | 613 |
| 174 | Ga0075368_10044391 | 3300006042 | Bacteria | 1753 |
| 175 | Ga0075368_10079066 | 3300006042 | Bacteria | 1336 |
| 176 | Ga0075368_10260889 | 3300006042 | Bacteria | 742 |
| 177 | Ga0075363_100015057 | 3300006048 | Bacteria | 3793 |
| 178 | Ga0075363_100021527 | 3300006048 | Bacteria | 3249 |
| 179 | Ga0075363_100229529 | 3300006048 | Bacteria | 1065 |
| 180 | Ga0075363_100429537 | 3300006048 | Bacteria | 778 |
| 181 | Ga0075364_10087465 | 3300006051 | Bacteria | 2065 |
| 182 | Ga0075364_10148049 | 3300006051 | Bacteria | 1581 |
| 183 | Ga0075364_10647691 | 3300006051 | Bacteria | 721 |
| 184 | Ga0075432_10330601 | 3300006058 | Bacteria | 641 |
| 185 | Ga0075362_10451630 | 3300006177 | Bacteria | 653 |
| 186 | Ga0075367_10002048 | 3300006178 | Bacteria | 9020 |
| 187 | Ga0075367_10025702 | 3300006178 | Bacteria | 3332 |
| 188 | Ga0075367_10049721 | 3300006178 | Bacteria | 2472 |
| 189 | Ga0075367_10225041 | 3300006178 | Bacteria | 1174 |
| 190 | Ga0075367_10512255 | 3300006178 | Bacteria | 761 |
| 191 | Ga0075367_10744803 | 3300006178 | Bacteria | 623 |
| 192 | Ga0075366_10731231 | 3300006195 | Bacteria | 615 |
| 193 | Ga0075370_10014839 | 3300006353 | Bacteria | 4161 |
| 194 | Ga0075370_10180306 | 3300006353 | Bacteria | 1243 |
| 195 | Ga0068871_100317943 | 3300006358 | Bacteria | 1370 |
| 196 | Ga0068871_100584129 | 3300006358 | Bacteria | 1015 |
| 197 | Ga0068871_101375018 | 3300006358 | Bacteria | 665 |
| 198 | Ga0075428_100260935 | 3300006844 | Bacteria | 1865 |
| 199 | Ga0075428_100646516 | 3300006844 | Bacteria | 1128 |
| 200 | Ga0075428_101775237 | 3300006844 | Bacteria | 643 |
| 201 | Ga0075430_100502409 | 3300006846 | Bacteria | 1001 |
| 202 | Ga0075431_100033157 | 3300006847 | Bacteria | 5322 |
| 203 | Ga0075433_11545404 | 3300006852 | Bacteria | 573 |
| 204 | Ga0075434_100139910 | 3300006871 | Bacteria | 2440 |
| 205 | Ga0075429_101567449 | 3300006880 | Bacteria | 573 |
| 206 | Ga0068865_100004169 | 3300006881 | Bacteria | 8700 |
| 207 | Ga0068865_100297926 | 3300006881 | Bacteria | 1290 |
| 208 | Ga0068865_100579678 | 3300006881 | Bacteria | 946 |
| 209 | Ga0068865_101617696 | 3300006881 | Bacteria | 582 |
| 210 | Ga0105244_10419995 | 3300009036 | Bacteria | 615 |
| 211 | Ga0111539_10151003 | 3300009094 | Bacteria | 2719 |
| 212 | Ga0111539_10642356 | 3300009094 | Bacteria | 1236 |
| 213 | Ga0111539_10940256 | 3300009094 | Bacteria | 1005 |
| 214 | Ga0111539_11069108 | 3300009094 | Bacteria | 938 |
| 215 | Ga0105245_10249048 | 3300009098 | Bacteria | 1725 |
| 216 | Ga0105245_10531644 | 3300009098 | Bacteria | 1196 |
| 217 | Ga0105245_11425255 | 3300009098 | Bacteria | 743 |
| 218 | Ga0105245_12169899 | 3300009098 | Bacteria | 609 |
| 219 | Ga0105245_12398861 | 3300009098 | Bacteria | 581 |
| 220 | Ga0105245_13015450 | 3300009098 | Bacteria | 522 |
| 221 | Ga0105247_10524934 | 3300009101 | Bacteria | 866 |
| 222 | Ga0114129_10743879 | 3300009147 | Bacteria | 1256 |
| 223 | Ga0114129_10759352 | 3300009147 | Bacteria | 1241 |
| 224 | Ga0105243_10030084 | 3300009148 | Bacteria | 4179 |
| 225 | Ga0105243_10521358 | 3300009148 | Bacteria | 1130 |
| 226 | Ga0105243_12526635 | 3300009148 | Bacteria | 553 |
| 227 | Ga0105243_12982984 | 3300009148 | Bacteria | 513 |
| 228 | Ga0105242_10260974 | 3300009176 | Bacteria | 1565 |
| 229 | Ga0105242_10743478 | 3300009176 | Bacteria | 965 |
| 230 | Ga0105242_11006070 | 3300009176 | Bacteria | 842 |
| 231 | Ga0105242_11192736 | 3300009176 | Bacteria | 780 |
| 232 | Ga0105242_13318279 | 3300009176 | Bacteria | 500 |
| 233 | Ga0105248_13335018 | 3300009177 | Bacteria | 510 |
| 234 | Ga0105237_10412363 | 3300009545 | Bacteria | 1356 |
| 235 | Ga0105237_11209967 | 3300009545 | Bacteria | 762 |
| 236 | Ga0105238_10250200 | 3300009551 | Bacteria | 1750 |
| 237 | Ga0105238_11549406 | 3300009551 | Bacteria | 692 |
| 238 | Ga0105249_10305871 | 3300009553 | Bacteria | 1596 |
| 239 | Ga0105249_10329858 | 3300009553 | Bacteria | 1539 |
| 240 | Ga0105249_10547608 | 3300009553 | Bacteria | 1207 |
| 241 | Ga0105249_11183872 | 3300009553 | Bacteria | 835 |
| 242 | Ga0105239_10609564 | 3300010375 | Bacteria | 1245 |
| 243 | Ga0105239_11119887 | 3300010375 | Bacteria | 906 |
| 244 | Ga0105239_11164300 | 3300010375 | Bacteria | 888 |
| 245 | Ga0105239_12066599 | 3300010375 | Bacteria | 662 |
| 246 | Ga0105246_10323084 | 3300011119 | Bacteria | 1255 |
| 247 | Ga0105246_10479972 | 3300011119 | Bacteria | 1051 |
| 248 | Ga0105246_10669010 | 3300011119 | Bacteria | 906 |
| 249 | Ga0105246_11155406 | 3300011119 | Bacteria | 710 |
| 250 | Ga0157325_1003207 | 3300012485 | Bacteria | 887 |
| 251 | Ga0157329_1012523 | 3300012491 | Bacteria | 695 |
| 252 | Ga0157319_1051975 | 3300012497 | Bacteria | 511 |
| 253 | Ga0157347_1060874 | 3300012502 | Bacteria | 540 |
| 254 | Ga0157338_1005833 | 3300012515 | Bacteria | 1120 |
| 255 | Ga0154019_122374 | 3300013044 | Bacteria | 685 |
| 256 | Ga0157371_10585195 | 3300013102 | Bacteria | 829 |
| 257 | Ga0157371_10768523 | 3300013102 | Bacteria | 724 |
| 258 | Ga0157370_10628559 | 3300013104 | Bacteria | 982 |
| 259 | Ga0157370_11062013 | 3300013104 | Bacteria | 732 |
| 260 | Ga0157369_10894158 | 3300013105 | Bacteria | 911 |
| 261 | Ga0157369_12569122 | 3300013105 | Bacteria | 515 |
| 262 | Ga0157374_10273795 | 3300013296 | Bacteria | 1665 |
| 263 | Ga0157374_11876874 | 3300013296 | Bacteria | 625 |
| 264 | Ga0157378_12540985 | 3300013297 | Bacteria | 564 |
| 265 | Ga0163162_11484571 | 3300013306 | Bacteria | 772 |
| 266 | Ga0163162_12807463 | 3300013306 | Bacteria | 561 |
| 267 | Ga0157372_10059287 | 3300013307 | Bacteria | 4281 |
| 268 | Ga0157372_10172105 | 3300013307 | Bacteria | 2506 |
| 269 | Ga0157372_10503764 | 3300013307 | Bacteria | 1412 |
| 270 | Ga0157372_11027338 | 3300013307 | Bacteria | 954 |
| 271 | Ga0157372_11325455 | 3300013307 | Bacteria | 831 |
| 272 | Ga0157372_11600511 | 3300013307 | Bacteria | 750 |
| 273 | Ga0157372_12529321 | 3300013307 | Bacteria | 589 |
| 274 | Ga0157375_10117822 | 3300013308 | Bacteria | 2762 |
| 275 | Ga0157375_10207102 | 3300013308 | Bacteria | 2118 |
| 276 | Ga0157375_11302756 | 3300013308 | Bacteria | 854 |
| 277 | Ga0157375_11327476 | 3300013308 | Bacteria | 846 |
| 278 | Ga0157375_11441689 | 3300013308 | Bacteria | 812 |
| 279 | Ga0157375_11868773 | 3300013308 | Bacteria | 713 |
| 280 | Ga0157375_13114082 | 3300013308 | Bacteria | 553 |
| 281 | Ga0163163_10092876 | 3300014325 | Bacteria | 3033 |
| 282 | Ga0163163_10184171 | 3300014325 | Bacteria | 2136 |
| 283 | Ga0163163_11908767 | 3300014325 | Bacteria | 654 |
| 284 | Ga0157380_10390506 | 3300014326 | Bacteria | 1317 |
| 285 | Ga0157380_11114894 | 3300014326 | Bacteria | 829 |
| 286 | Ga0182008_10010166 | 3300014497 | Bacteria | 5042 |
| 287 | Ga0182008_10108171 | 3300014497 | Bacteria | 1377 |
| 288 | Ga0182008_10156609 | 3300014497 | Bacteria | 1144 |
| 289 | Ga0182008_10189306 | 3300014497 | Bacteria | 1044 |
| 290 | Ga0182008_10268822 | 3300014497 | Bacteria | 884 |
| 291 | Ga0157377_11327930 | 3300014745 | Bacteria | 563 |
| 292 | Ga0157379_10959986 | 3300014968 | Bacteria | 813 |
| 293 | Ga0157379_11596800 | 3300014968 | Bacteria | 637 |
| 294 | Ga0157376_10220883 | 3300014969 | Bacteria | 1755 |
| 295 | Ga0157376_10264018 | 3300014969 | Bacteria | 1614 |
| 296 | Ga0157376_11286300 | 3300014969 | Bacteria | 761 |
| 297 | Ga0157376_11928956 | 3300014969 | Bacteria | 628 |
| 298 | Ga0182006_1011838 | 3300015261 | Bacteria | 3823 |
| 299 | Ga0182006_1161826 | 3300015261 | Bacteria | 754 |
| 300 | Ga0182007_10000257 | 3300015262 | Bacteria | 35765 |
| 301 | Ga0182005_1049585 | 3300015265 | Bacteria | 1141 |
| 302 | Ga0183367_1006 | 3300015688 | Bacteria | 648044 |
| 303 | Ga0163161_10036002 | 3300017792 | Bacteria | 3544 |
| 304 | Ga0163161_10046953 | 3300017792 | Bacteria | 3117 |
| 305 | Ga0163161_10886545 | 3300017792 | Bacteria | 755 |
| 306 | Ga0163161_11009518 | 3300017792 | Bacteria | 711 |
| 307 | Ga0163161_11415791 | 3300017792 | Bacteria | 608 |
| 308 | Ga0197907_10010884 | 3300020069 | Bacteria | 910 |
| 309 | Ga0197907_10100526 | 3300020069 | Bacteria | 676 |
| 310 | Ga0197907_10162151 | 3300020069 | Bacteria | 859 |
| 311 | Ga0197907_10423704 | 3300020069 | Bacteria | 1133 |
| 312 | Ga0197907_10445121 | 3300020069 | Bacteria | 625 |
| 313 | Ga0197907_10580340 | 3300020069 | Bacteria | 504 |
| 314 | Ga0197907_10881272 | 3300020069 | Bacteria | 763 |
| 315 | Ga0197907_11016439 | 3300020069 | Bacteria | 738 |
| 316 | Ga0206356_10271762 | 3300020070 | Bacteria | 823 |
| 317 | Ga0206356_10339076 | 3300020070 | Bacteria | 742 |
| 318 | Ga0206356_10857575 | 3300020070 | Bacteria | 544 |
| 319 | Ga0206356_10936297 | 3300020070 | Bacteria | 589 |
| 320 | Ga0206356_11242763 | 3300020070 | Bacteria | 814 |
| 321 | Ga0206356_11403629 | 3300020070 | Bacteria | 548 |
| 322 | Ga0206356_11461478 | 3300020070 | Bacteria | 1088 |
| 323 | Ga0206356_11471271 | 3300020070 | Bacteria | 757 |
| 324 | Ga0206356_11747499 | 3300020070 | Bacteria | 689 |
| 325 | Ga0206356_11764094 | 3300020070 | Bacteria | 569 |
| 326 | Ga0206349_1064364 | 3300020075 | Bacteria | 702 |
| 327 | Ga0206349_1321983 | 3300020075 | Bacteria | 651 |
| 328 | Ga0206349_1598135 | 3300020075 | Bacteria | 860 |
| 329 | Ga0206349_1620869 | 3300020075 | Bacteria | 1072 |
| 330 | Ga0206349_1646901 | 3300020075 | Bacteria | 688 |
| 331 | Ga0206349_1726464 | 3300020075 | Bacteria | 606 |
| 332 | Ga0206349_1944080 | 3300020075 | Bacteria | 661 |
| 333 | Ga0206355_1004665 | 3300020076 | Bacteria | 1216 |
| 334 | Ga0206355_1045632 | 3300020076 | Bacteria | 533 |
| 335 | Ga0206355_1081111 | 3300020076 | Bacteria | 684 |
| 336 | Ga0206355_1085433 | 3300020076 | Bacteria | 1620 |
| 337 | Ga0206355_1165990 | 3300020076 | Bacteria | 776 |
| 338 | Ga0206355_1174712 | 3300020076 | Bacteria | 823 |
| 339 | Ga0206355_1185040 | 3300020076 | Bacteria | 811 |
| 340 | Ga0206355_1198663 | 3300020076 | Bacteria | 675 |
| 341 | Ga0206355_1203687 | 3300020076 | Bacteria | 720 |
| 342 | Ga0206355_1650912 | 3300020076 | Bacteria | 1245 |
| 343 | Ga0206351_10026933 | 3300020077 | Bacteria | 740 |
| 344 | Ga0206351_10121054 | 3300020077 | Bacteria | 827 |
| 345 | Ga0206351_10470376 | 3300020077 | Bacteria | 770 |
| 346 | Ga0206351_10495102 | 3300020077 | Bacteria | 819 |
| 347 | Ga0206352_10057118 | 3300020078 | Bacteria | 741 |
| 348 | Ga0206352_10160481 | 3300020078 | Bacteria | 717 |
| 349 | Ga0206352_10319419 | 3300020078 | Bacteria | 502 |
| 350 | Ga0206352_10701397 | 3300020078 | Bacteria | 660 |
| 351 | Ga0206352_11027925 | 3300020078 | Bacteria | 573 |
| 352 | Ga0206350_10120654 | 3300020080 | Bacteria | 747 |
| 353 | Ga0206350_10126363 | 3300020080 | Bacteria | 517 |
| 354 | Ga0206350_10593967 | 3300020080 | Bacteria | 636 |
| 355 | Ga0206350_10633254 | 3300020080 | Bacteria | 727 |
| 356 | Ga0206350_10703881 | 3300020080 | Bacteria | 618 |
| 357 | Ga0206354_10117707 | 3300020081 | Bacteria | 795 |
| 358 | Ga0206354_10150451 | 3300020081 | Bacteria | 1615 |
| 359 | Ga0206354_10188052 | 3300020081 | Bacteria | 666 |
| 360 | Ga0206354_10455429 | 3300020081 | Bacteria | 957 |
| 361 | Ga0206354_10514478 | 3300020081 | Bacteria | 645 |
| 362 | Ga0206354_10570582 | 3300020081 | Bacteria | 816 |
| 363 | Ga0206354_10685371 | 3300020081 | Bacteria | 735 |
| 364 | Ga0206354_10807495 | 3300020081 | Bacteria | 854 |
| 365 | Ga0206354_10823330 | 3300020081 | Bacteria | 708 |
| 366 | Ga0206354_10884654 | 3300020081 | Bacteria | 615 |
| 367 | Ga0206354_11030020 | 3300020081 | Bacteria | 1310 |
| 368 | Ga0206354_11280122 | 3300020081 | Bacteria | 517 |
| 369 | Ga0206354_11465456 | 3300020081 | Bacteria | 2695 |
| 370 | Ga0206354_11499587 | 3300020081 | Bacteria | 731 |
| 371 | Ga0206354_11571020 | 3300020081 | Bacteria | 862 |
| 372 | Ga0206353_10517557 | 3300020082 | Bacteria | 1025 |
| 373 | Ga0206353_10665903 | 3300020082 | Bacteria | 925 |
| 374 | Ga0206353_10902826 | 3300020082 | Bacteria | 505 |
| 375 | Ga0206353_11170554 | 3300020082 | Bacteria | 5234 |
| 376 | Ga0206353_11903580 | 3300020082 | Bacteria | 765 |
| 377 | Ga0154015_1405206 | 3300020610 | Bacteria | 758 |
| 378 | Ga0154015_1487719 | 3300020610 | Bacteria | 588 |
| 379 | Ga0154015_1567755 | 3300020610 | Bacteria | 836 |
| 380 | Ga0224712_10137350 | 3300022467 | Bacteria | 1073 |
| 381 | Ga0224712_10182418 | 3300022467 | Bacteria | 946 |
| 382 | Ga0224712_10249337 | 3300022467 | Bacteria | 820 |
| 383 | Ga0224712_10339589 | 3300022467 | Bacteria | 708 |
| 384 | Ga0224712_10357098 | 3300022467 | Bacteria | 691 |
| 385 | Ga0207656_10467683 | 3300025321 | Bacteria | 638 |
| 386 | Ga0207682_10334667 | 3300025893 | Bacteria | 712 |
| 387 | Ga0207642_10262575 | 3300025899 | Bacteria | 985 |
| 388 | Ga0207642_10973417 | 3300025899 | Bacteria | 546 |
| 389 | Ga0207710_10223626 | 3300025900 | Bacteria | 935 |
| 390 | Ga0207688_10025596 | 3300025901 | Bacteria | 3242 |
| 391 | Ga0207688_10311213 | 3300025901 | Bacteria | 964 |
| 392 | Ga0207688_10813352 | 3300025901 | Bacteria | 592 |
| 393 | Ga0207647_10489695 | 3300025904 | Bacteria | 686 |
| 394 | Ga0207647_10547097 | 3300025904 | Bacteria | 642 |
| 395 | Ga0207645_10797813 | 3300025907 | Bacteria | 642 |
| 396 | Ga0207643_10495500 | 3300025908 | Bacteria | 781 |
| 397 | Ga0207684_11153748 | 3300025910 | Bacteria | 643 |
| 398 | Ga0207654_10215980 | 3300025911 | Bacteria | 1269 |
| 399 | Ga0207671_10074558 | 3300025914 | Bacteria | 2536 |
| 400 | Ga0207662_10214551 | 3300025918 | Bacteria | 1251 |
| 401 | Ga0207662_10369830 | 3300025918 | Bacteria | 966 |
| 402 | Ga0207657_10019609 | 3300025919 | Bacteria | 6414 |
| 403 | Ga0207646_10272029 | 3300025922 | Bacteria | 1531 |
| 404 | Ga0207694_10835467 | 3300025924 | Bacteria | 778 |
| 405 | Ga0207650_10559646 | 3300025925 | Bacteria | 959 |
| 406 | Ga0207650_11223413 | 3300025925 | Bacteria | 639 |
| 407 | Ga0207687_10037459 | 3300025927 | Bacteria | 3309 |
| 408 | Ga0207687_11278374 | 3300025927 | Bacteria | 631 |
| 409 | Ga0207700_10390082 | 3300025928 | Bacteria | 1219 |
| 410 | Ga0207644_11775000 | 3300025931 | Bacteria | 516 |
| 411 | Ga0207690_10012467 | 3300025932 | Bacteria | 5084 |
| 412 | Ga0207690_10509924 | 3300025932 | Bacteria | 974 |
| 413 | Ga0207690_10576743 | 3300025932 | Bacteria | 916 |
| 414 | Ga0207690_11704268 | 3300025932 | Bacteria | 526 |
| 415 | Ga0207706_10503447 | 3300025933 | Bacteria | 1045 |
| 416 | Ga0207706_10685248 | 3300025933 | Bacteria | 876 |
| 417 | Ga0207706_11493515 | 3300025933 | Bacteria | 551 |
| 418 | Ga0207686_10742607 | 3300025934 | Bacteria | 783 |
| 419 | Ga0207709_10045382 | 3300025935 | Bacteria | 2661 |
| 420 | Ga0207709_10057256 | 3300025935 | Bacteria | 2416 |
| 421 | Ga0207709_10279604 | 3300025935 | Bacteria | 1232 |
| 422 | Ga0207670_10143275 | 3300025936 | Bacteria | 1764 |
| 423 | Ga0207669_10814544 | 3300025937 | Bacteria | 775 |
| 424 | Ga0207704_10013539 | 3300025938 | Bacteria | 4085 |
| 425 | Ga0207704_10890107 | 3300025938 | Bacteria | 748 |
| 426 | Ga0207691_10004838 | 3300025940 | Bacteria | 13020 |
| 427 | Ga0207691_10585265 | 3300025940 | Bacteria | 945 |
| 428 | Ga0207661_10005390 | 3300025944 | Bacteria | 9006 |
| 429 | Ga0207661_10134557 | 3300025944 | Bacteria | 2122 |
| 430 | Ga0207661_10147369 | 3300025944 | Bacteria | 2032 |
| 431 | Ga0207661_10152040 | 3300025944 | Bacteria | 2001 |
| 432 | Ga0207661_10816864 | 3300025944 | Bacteria | 858 |
| 433 | Ga0207679_10911350 | 3300025945 | Bacteria | 804 |
| 434 | Ga0207679_12078591 | 3300025945 | Bacteria | 516 |
| 435 | Ga0207667_10365360 | 3300025949 | Bacteria | 1471 |
| 436 | Ga0207712_10124511 | 3300025961 | Bacteria | 1955 |
| 437 | Ga0207712_10226840 | 3300025961 | Bacteria | 1497 |
| 438 | Ga0207712_10281262 | 3300025961 | Bacteria | 1358 |
| 439 | Ga0207712_10491982 | 3300025961 | Bacteria | 1047 |
| 440 | Ga0207712_10877630 | 3300025961 | Bacteria | 792 |
| 441 | Ga0207668_10242452 | 3300025972 | Bacteria | 1459 |
| 442 | Ga0207668_11046612 | 3300025972 | Bacteria | 731 |
| 443 | Ga0207658_10688307 | 3300025986 | Bacteria | 923 |
| 444 | Ga0207658_11391538 | 3300025986 | Bacteria | 642 |
| 445 | Ga0207677_10534068 | 3300026023 | Bacteria | 1019 |
| 446 | Ga0207677_11208663 | 3300026023 | Bacteria | 692 |
| 447 | Ga0207639_10362230 | 3300026041 | Bacteria | 1298 |
| 448 | Ga0207639_10698485 | 3300026041 | Bacteria | 941 |
| 449 | Ga0207639_10803461 | 3300026041 | Bacteria | 877 |
| 450 | Ga0207639_11880463 | 3300026041 | Bacteria | 559 |
| 451 | Ga0207639_12160881 | 3300026041 | Bacteria | 518 |
| 452 | Ga0207678_10083431 | 3300026067 | Bacteria | 2733 |
| 453 | Ga0207678_10337552 | 3300026067 | Bacteria | 1298 |
| 454 | Ga0207678_10407772 | 3300026067 | Bacteria | 1177 |
| 455 | Ga0207678_11061938 | 3300026067 | Bacteria | 717 |
| 456 | Ga0207708_10160824 | 3300026075 | Bacteria | 1773 |
| 457 | Ga0207708_10433952 | 3300026075 | Bacteria | 1091 |
| 458 | Ga0207702_11163541 | 3300026078 | Bacteria | 765 |
| 459 | Ga0207648_10648988 | 3300026089 | Bacteria | 975 |
| 460 | Ga0207648_10666245 | 3300026089 | Bacteria | 962 |
| 461 | Ga0207676_10637908 | 3300026095 | Bacteria | 1027 |
| 462 | Ga0207676_11279424 | 3300026095 | Bacteria | 728 |
| 463 | Ga0207676_12342142 | 3300026095 | Bacteria | 531 |
| 464 | Ga0207674_10346220 | 3300026116 | Bacteria | 1437 |
| 465 | Ga0207675_100005816 | 3300026118 | Bacteria | 11783 |
| 466 | Ga0207675_100334858 | 3300026118 | Bacteria | 1480 |
| 467 | Ga0207675_100574327 | 3300026118 | Bacteria | 1128 |
| 468 | Ga0207675_100873753 | 3300026118 | Bacteria | 915 |
| 469 | Ga0207675_101478482 | 3300026118 | Bacteria | 700 |
| 470 | Ga0207683_10133865 | 3300026121 | Bacteria | 2230 |
| 471 | Ga0207683_10262477 | 3300026121 | Bacteria | 1577 |
| 472 | Ga0207683_10707569 | 3300026121 | Bacteria | 934 |
| 473 | Ga0207683_11115472 | 3300026121 | Bacteria | 732 |
| 474 | Ga0207698_10165197 | 3300026142 | Bacteria | 1942 |
| 475 | Ga0207698_10595557 | 3300026142 | Bacteria | 1089 |
| 476 | Ga0207698_10633966 | 3300026142 | Bacteria | 1057 |
| 477 | Ga0207698_12399362 | 3300026142 | Bacteria | 538 |
| 478 | Ga0209371_1053740 | 3300027312 | Bacteria | 763 |
| 479 | Ga0209813_10048110 | 3300027866 | Bacteria | 1323 |
| 480 | Ga0209813_10182124 | 3300027866 | Bacteria | 769 |
| 481 | Ga0209974_10188801 | 3300027876 | Bacteria | 757 |
| 482 | Ga0207428_10021772 | 3300027907 | Bacteria | 5423 |
| 483 | Ga0207428_10812545 | 3300027907 | Bacteria | 664 |
| 484 | Ga0207428_11101326 | 3300027907 | Bacteria | 555 |
| 485 | Ga0268266_10724679 | 3300028379 | Bacteria | 959 |
| 486 | Ga0268266_10939358 | 3300028379 | Bacteria | 837 |
| 487 | Ga0268265_10077732 | 3300028380 | Bacteria | 2608 |
| 488 | Ga0268265_10603979 | 3300028380 | Bacteria | 1049 |
| 489 | Ga0268256_1033589 | 3300030500 | Bacteria | 1210 |
| 490 | Ga0316177_1045098 | 3300030731 | Bacteria | 876 |
| 491 | Ga0314311_1173936 | 3300030733 | Bacteria | 1864 |
| 492 | Ga0316178_1165051 | 3300030735 | Bacteria | 562 |
| 493 | Ga0316178_1179262 | 3300030735 | Bacteria | 656 |
| 494 | Ga0316181_1041643 | 3300030744 | Bacteria | 1009 |
| 495 | Ga0316182_1346959 | 3300030745 | Bacteria | 1290 |
| 496 | Ga0265767_113894 | 3300030836 | Bacteria | 569 |
| 497 | Ga0307408_100293410 | 3300031548 | Bacteria | 1359 |
| 498 | Ga0307408_100376247 | 3300031548 | Bacteria | 1213 |
| 499 | Ga0307408_100706609 | 3300031548 | Bacteria | 907 |
| 500 | Ga0307408_100964583 | 3300031548 | Bacteria | 784 |
| 501 | Ga0307408_102018325 | 3300031548 | Bacteria | 555 |
| 502 | Ga0307405_10340997 | 3300031731 | Bacteria | 1152 |
| 503 | Ga0307405_11249360 | 3300031731 | Bacteria | 644 |
| 504 | Ga0307413_10449709 | 3300031824 | Bacteria | 1022 |
| 505 | Ga0307413_10775499 | 3300031824 | Bacteria | 804 |
| 506 | Ga0307413_10848997 | 3300031824 | Bacteria | 771 |
| 507 | Ga0307413_11451754 | 3300031824 | Bacteria | 605 |
| 508 | Ga0307413_11621239 | 3300031824 | Bacteria | 575 |
| 509 | Ga0307413_12017882 | 3300031824 | Bacteria | 520 |
| 510 | Ga0307410_10009256 | 3300031852 | Bacteria | 5515 |
| 511 | Ga0307410_10042196 | 3300031852 | Bacteria | 3014 |
| 512 | Ga0307410_10781796 | 3300031852 | Bacteria | 810 |
| 513 | Ga0307410_11601633 | 3300031852 | Bacteria | 575 |
| 514 | Ga0326468_10039036 | 3300031889 | Bacteria | 669 |
| 515 | Ga0307406_10106069 | 3300031901 | Bacteria | 1924 |
| 516 | Ga0307406_10224293 | 3300031901 | Bacteria | 1399 |
| 517 | Ga0307407_10079818 | 3300031903 | Bacteria | 1975 |
| 518 | Ga0307407_10377044 | 3300031903 | Bacteria | 1012 |
| 519 | Ga0307407_10721502 | 3300031903 | Bacteria | 752 |
| 520 | Ga0307412_10012017 | 3300031911 | Bacteria | 5031 |
| 521 | Ga0307412_10135001 | 3300031911 | Bacteria | 1799 |
| 522 | Ga0307412_10232109 | 3300031911 | Bacteria | 1421 |
| 523 | Ga0307412_10257585 | 3300031911 | Bacteria | 1358 |
| 524 | Ga0307412_10615273 | 3300031911 | Bacteria | 922 |
| 525 | Ga0307412_11329918 | 3300031911 | Bacteria | 648 |
| 526 | Ga0307412_11724866 | 3300031911 | Bacteria | 574 |
| 527 | Ga0307409_100253434 | 3300031995 | Bacteria | 1610 |
| 528 | Ga0307409_100323991 | 3300031995 | Bacteria | 1443 |
| 529 | Ga0307409_100387487 | 3300031995 | Bacteria | 1331 |
| 530 | Ga0307409_100462385 | 3300031995 | Bacteria | 1227 |
| 531 | Ga0307409_100467320 | 3300031995 | Bacteria | 1221 |
| 532 | Ga0307409_100531778 | 3300031995 | Bacteria | 1150 |
| 533 | Ga0307409_100653745 | 3300031995 | Bacteria | 1045 |
| 534 | Ga0307409_100738501 | 3300031995 | Bacteria | 987 |
| 535 | Ga0307409_100760817 | 3300031995 | Bacteria | 973 |
| 536 | Ga0307409_101266058 | 3300031995 | Bacteria | 762 |
| 537 | Ga0307416_100023381 | 3300032002 | Bacteria | 4484 |
| 538 | Ga0307416_100051292 | 3300032002 | Bacteria | 3294 |
| 539 | Ga0307416_100274016 | 3300032002 | Bacteria | 1659 |
| 540 | Ga0307416_101119485 | 3300032002 | Bacteria | 892 |
| 541 | Ga0307416_101425278 | 3300032002 | Bacteria | 798 |
| 542 | Ga0307416_101833458 | 3300032002 | Bacteria | 710 |
| 543 | Ga0307416_102888590 | 3300032002 | Bacteria | 575 |
| 544 | Ga0307416_103412945 | 3300032002 | Bacteria | 532 |
| 545 | Ga0307414_10316611 | 3300032004 | Bacteria | 1326 |
| 546 | Ga0307414_10365454 | 3300032004 | Bacteria | 1243 |
| 547 | Ga0307414_10491897 | 3300032004 | Bacteria | 1084 |
| 548 | Ga0307414_10970337 | 3300032004 | Bacteria | 781 |
| 549 | Ga0307414_11686443 | 3300032004 | Bacteria | 591 |
| 550 | Ga0307411_10206703 | 3300032005 | Bacteria | 1512 |
| 551 | Ga0307411_10542227 | 3300032005 | Bacteria | 991 |
| 552 | Ga0307411_10546767 | 3300032005 | Bacteria | 987 |
| 553 | Ga0307411_11416603 | 3300032005 | Bacteria | 636 |
| 554 | Ga0307415_100025195 | 3300032126 | Bacteria | 3728 |
| 555 | Ga0307415_100107212 | 3300032126 | Bacteria | 2064 |
| 556 | Ga0307415_100139115 | 3300032126 | Bacteria | 1851 |
| 557 | Ga0307415_100139360 | 3300032126 | Bacteria | 1850 |
| 558 | Ga0307415_100391562 | 3300032126 | Bacteria | 1183 |
| 559 | Ga0307415_102032379 | 3300032126 | Bacteria | 560 |
| 560 | Ga0373948_0159127 | 3300034817 | Bacteria | 569 |
| 561 | Ga0373959_0073073 | 3300034820 | Bacteria | 778 |
| 562 | Ga0373938_0058549 | 3300034957 | Bacteria | 896 |
| 563 | Ga0373932_0215705 | 3300035112 | Bacteria | 688 |
| 564 | Ga0373941_0088401 | 3300035115 | Bacteria | 1059 |
| 565 | Ga0373961_0259592 | 3300035241 | Bacteria | 631 |
| 566 | Ga0373935_0420804 | 3300035692 | Bacteria | 962 |
| 567 | Ga0373927_0914518 | 3300035695 | Bacteria | 579 |
| 568 | Ga0395899_0080716 | 3300037312 | Bacteria | 2367 |
| 569 | Ga0395900_0234898 | 3300037418 | Bacteria | 1842 |
| 570 | Ga0395900_1006335 | 3300037418 | Bacteria | 753 |
| 571 | Ga0395898_0009689 | 3300037466 | Bacteria | 10101 |
| 572 | Ga0395898_1091356 | 3300037466 | Bacteria | 732 |
| 573 | Ga0395905_0522861 | 3300037471 | Bacteria | 1087 |
| 574 | Ga0436364_1007385 | 3300037853 | Bacteria | 16796 |
| 575 | Ga0395901_0017303 | 3300038443 | Bacteria | 7358 |
| 576 | Ga0395901_0171557 | 3300038443 | Bacteria | 2276 |
| 577 | Ga0395901_0252907 | 3300038443 | Bacteria | 1835 |
| 578 | Ga0395901_0903212 | 3300038443 | Bacteria | 865 |
| 579 | Ga0242420_089934 | 3300038996 | Bacteria | 643 |
| 580 | Ga0439438_036869 | 3300041405 | Bacteria | 1280 |
| 581 | Ga0439461_0013684 | 3300041410 | Bacteria | 1534 |
| 582 | Ga0439461_0049830 | 3300041410 | Bacteria | 926 |
| 583 | Ga0439466_0186302 | 3300041411 | Bacteria | 632 |
| 584 | Ga0439465_0212643 | 3300041413 | Bacteria | 707 |
| 585 | Ga0439465_0437567 | 3300041413 | Bacteria | 500 |
| 586 | Ga0451789_0153543 | 3300041443 | Bacteria | 779 |
| 587 | Ga0451791_1527912 | 3300041451 | Bacteria | 770 |
| 588 | Ga0451793_1573171 | 3300041452 | Bacteria | 507 |
| 589 | Ga0451797_0012973 | 3300041453 | Bacteria | 721 |
| 590 | Ga0451797_1419428 | 3300041453 | Bacteria | 712 |
| 591 | Ga0451795_1254865 | 3300041456 | Bacteria | 554 |
| 592 | Ga0451800_0914374 | 3300041459 | Bacteria | 644 |
| 593 | Ga0451800_1586772 | 3300041459 | Bacteria | 531 |
| 594 | Ga0451806_447833 | 3300041462 | Bacteria | 600 |
| 595 | Ga0451807_0661331 | 3300041486 | Bacteria | 769 |
| 596 | Ga0451835_0266313 | 3300041492 | Bacteria | 807 |
| 597 | Ga0451837_0825915 | 3300041494 | Bacteria | 881 |
| 598 | Ga0451837_1659218 | 3300041494 | Bacteria | 893 |
| 599 | Ga0451839_0489610 | 3300041496 | Bacteria | 748 |
| 600 | Ga0451841_0727502 | 3300041498 | Bacteria | 1497 |
| 601 | Ga0451841_1160484 | 3300041498 | Bacteria | 525 |
| 602 | Ga0451851_0096184 | 3300041507 | Bacteria | 679 |
| 603 | Ga0451843_0926354 | 3300041509 | Bacteria | 537 |
| 604 | Ga0451843_1549413 | 3300041509 | Bacteria | 1692 |
| 605 | Ga0451855_0881732 | 3300041511 | Bacteria | 718 |
| 606 | Ga0451853_0300070 | 3300041512 | Bacteria | 629 |
| 607 | Ga0451853_0980644 | 3300041512 | Bacteria | 604 |
| 608 | Ga0439431_0009865 | 3300041997 | Bacteria | 2161 |
| 609 | Ga0439445_0043816 | 3300042004 | Bacteria | 1195 |
| 610 | Ga0439452_126350 | 3300042010 | Bacteria | 543 |
| 611 | Ga0450920_060327 | 3300042122 | Bacteria | 766 |
| 612 | Ga0450907_004399 | 3300042146 | Bacteria | 2435 |
| 613 | Ga0450907_049964 | 3300042146 | Bacteria | 719 |
| 614 | Ga0439446_0023771 | 3300042156 | Bacteria | 1745 |
| 615 | Ga0450908_110271 | 3300042184 | Bacteria | 508 |
| 616 | Ga0439434_0007913 | 3300042435 | Bacteria | 3117 |
| 617 | Ga0466969_0008402 | 3300044656 | Bacteria | 5475 |
| 618 | Ga0466969_0020970 | 3300044656 | Bacteria | 3380 |
| 619 | Ga0466969_0117977 | 3300044656 | Bacteria | 1237 |
| 620 | Ga0466969_0480291 | 3300044656 | Bacteria | 566 |
| 621 | Ga0466972_0114456 | 3300044658 | Bacteria | 1274 |
| 622 | Ga0466972_0193084 | 3300044658 | Bacteria | 954 |
| 623 | Ga0466965_0023797 | 3300044683 | Bacteria | 2959 |
| 624 | Ga0466965_0024478 | 3300044683 | Bacteria | 2921 |
| 625 | Ga0466965_0128522 | 3300044683 | Bacteria | 1312 |
| 626 | Ga0466966_0001007 | 3300044684 | Bacteria | 17992 |
| 627 | Ga0466966_0026977 | 3300044684 | Bacteria | 3746 |
| 628 | Ga0466966_0243809 | 3300044684 | Bacteria | 1083 |
| 629 | Ga0466966_0433986 | 3300044684 | Bacteria | 790 |
| 630 | Ga0466966_0450983 | 3300044684 | Bacteria | 773 |
| 631 | Ga0466966_0622853 | 3300044684 | Bacteria | 650 |
| 632 | Ga0466966_0805136 | 3300044684 | Bacteria | 566 |
| 633 | Ga0466961_0006966 | 3300044693 | Bacteria | 7190 |
| 634 | Ga0466961_0025062 | 3300044693 | Bacteria | 3838 |
| 635 | Ga0466961_0102651 | 3300044693 | Bacteria | 1801 |
| 636 | Ga0466961_0205714 | 3300044693 | Bacteria | 1216 |
| 637 | Ga0466961_0285234 | 3300044693 | Bacteria | 1010 |
| 638 | Ga0466961_0349237 | 3300044693 | Bacteria | 900 |
| 639 | Ga0466961_0899765 | 3300044693 | Bacteria | 527 |
| 640 | Ga0466963_0023179 | 3300044694 | Bacteria | 3937 |
| 641 | Ga0466963_0059063 | 3300044694 | Bacteria | 2559 |
| 642 | Ga0466963_0130406 | 3300044694 | Bacteria | 1736 |
| 643 | Ga0466963_0133911 | 3300044694 | Bacteria | 1714 |
| 644 | Ga0466963_0228265 | 3300044694 | Bacteria | 1304 |
| 645 | Ga0466963_1245814 | 3300044694 | Bacteria | 522 |
| 646 | Ga0466963_1313944 | 3300044694 | Bacteria | 507 |
| 647 | Ga0466964_0006469 | 3300044706 | Bacteria | 4368 |
| 648 | Ga0466964_0049478 | 3300044706 | Bacteria | 1721 |
| 649 | Ga0466964_0306581 | 3300044706 | Bacteria | 802 |
| 650 | Ga0466971_0002183 | 3300044719 | Bacteria | 8272 |
| 651 | Ga0466971_0067901 | 3300044719 | Bacteria | 1616 |
| 652 | Ga0466971_0258605 | 3300044719 | Bacteria | 830 |
| 653 | Ga0466968_0134486 | 3300044735 | Bacteria | 1127 |
| 654 | Ga0466968_0276370 | 3300044735 | Bacteria | 803 |
| 655 | Ga0466968_0632702 | 3300044735 | Bacteria | 542 |
| 656 | Ga0466970_0013504 | 3300044765 | Bacteria | 4188 |
| 657 | Ga0466970_0037477 | 3300044765 | Bacteria | 2570 |
| 658 | Ga0466970_0276749 | 3300044765 | Bacteria | 943 |
| 659 | Ga0466970_0476848 | 3300044765 | Bacteria | 717 |
| 660 | Ga0466970_0601109 | 3300044765 | Bacteria | 638 |
| 661 | Ga0466957_0099778 | 3300044842 | Bacteria | 1829 |
| 662 | Ga0466957_0259216 | 3300044842 | Bacteria | 1158 |
| 663 | Ga0466957_0312129 | 3300044842 | Bacteria | 1059 |
| 664 | Ga0466957_0445139 | 3300044842 | Bacteria | 892 |
| 665 | Ga0466957_0693173 | 3300044842 | Bacteria | 718 |
| 666 | Ga0466957_0977386 | 3300044842 | Bacteria | 607 |
| 667 | Ga0466960_0055686 | 3300044901 | Bacteria | 1923 |
| 668 | Ga0466960_0084952 | 3300044901 | Bacteria | 1602 |
| 669 | Ga0466960_0284489 | 3300044901 | Bacteria | 927 |
| 670 | Ga0466960_0352295 | 3300044901 | Bacteria | 840 |
| 671 | Ga0466960_0436731 | 3300044901 | Bacteria | 759 |
| 672 | Ga0466960_0566361 | 3300044901 | Bacteria | 671 |
| 673 | Ga0466959_0007811 | 3300045049 | Bacteria | 7527 |
| 674 | Ga0466959_0037699 | 3300045049 | Bacteria | 3572 |
| 675 | Ga0466959_0162764 | 3300045049 | Bacteria | 1568 |
| 676 | Ga0466959_0264484 | 3300045049 | Bacteria | 1183 |
| 677 | Ga0466959_0368784 | 3300045049 | Bacteria | 978 |
| 678 | Ga0466959_1028123 | 3300045049 | Bacteria | 548 |
| 679 | Ga0466958_0312071 | 3300045836 | Bacteria | 1010 |
| 680 | Ga0466958_0430331 | 3300045836 | Bacteria | 853 |
| 681 | Ga0466958_0576461 | 3300045836 | Bacteria | 731 |
| 682 | Ga0466958_0989157 | 3300045836 | Bacteria | 549 |
| 683 | Ga0466967_0005383 | 3300045976 | Bacteria | 8861 |
| 684 | Ga0466967_0023415 | 3300045976 | Bacteria | 5060 |
| 685 | Ga0466967_0052461 | 3300045976 | Bacteria | 3579 |
| 686 | Ga0466967_0094127 | 3300045976 | Bacteria | 2727 |
| 687 | Ga0466967_0183131 | 3300045976 | Bacteria | 1976 |
| 688 | Ga0466967_0273860 | 3300045976 | Bacteria | 1618 |
| 689 | Ga0466967_0295415 | 3300045976 | Bacteria | 1557 |
| 690 | Ga0466967_0378891 | 3300045976 | Bacteria | 1373 |
| 691 | Ga0466967_0665346 | 3300045976 | Bacteria | 1030 |
| 692 | Ga0466967_0943155 | 3300045976 | Bacteria | 859 |
| 693 | Ga0466967_1589754 | 3300045976 | Bacteria | 651 |
| 694 | Ga0495627_076005 | 3300046453 | Bacteria | 977 |
| 695 | Ga0495603_0038876 | 3300046455 | Bacteria | 2852 |
| 696 | Ga0495603_0157309 | 3300046455 | Bacteria | 1319 |
| 697 | Ga0495629_0286904 | 3300046459 | Bacteria | 1129 |
| 698 | Ga0495629_0292279 | 3300046459 | Bacteria | 1117 |
| 699 | Ga0495641_0053880 | 3300046461 | Bacteria | 1829 |
| 700 | Ga0495641_0289754 | 3300046461 | Bacteria | 737 |
| 701 | Ga0495653_0164882 | 3300046463 | Bacteria | 1535 |
| 702 | Ga0495653_0653209 | 3300046463 | Bacteria | 642 |
| 703 | Ga0495582_0174195 | 3300046473 | Bacteria | 1225 |
| 704 | Ga0495582_0442341 | 3300046473 | Bacteria | 750 |
| 705 | Ga0495639_0296446 | 3300046475 | Bacteria | 806 |
| 706 | Ga0495664_0900376 | 3300046477 | Bacteria | 517 |
| 707 | Ga0495584_0040319 | 3300046491 | Bacteria | 2358 |
| 708 | Ga0495585_0479363 | 3300046492 | Bacteria | 593 |
| 709 | Ga0495594_0892398 | 3300046499 | Bacteria | 500 |
| 710 | Ga0495608_0646085 | 3300046511 | Bacteria | 632 |
| 711 | Ga0495644_0163773 | 3300046523 | Bacteria | 853 |
| 712 | Ga0495663_0098378 | 3300046525 | Bacteria | 961 |
| 713 | Ga0495666_0290213 | 3300046526 | Bacteria | 741 |
| 714 | Ga0495642_0091206 | 3300046528 | Bacteria | 1290 |
| 715 | Ga0495652_0477682 | 3300046529 | Bacteria | 868 |
| 716 | Ga0495652_0945846 | 3300046529 | Bacteria | 566 |
| 717 | Ga0495665_0286646 | 3300046531 | Bacteria | 844 |
| 718 | Ga0495640_0479897 | 3300046533 | Bacteria | 758 |
| 719 | Ga0495598_0345565 | 3300046537 | Bacteria | 572 |
| 720 | Ga0495609_0178380 | 3300046538 | Bacteria | 895 |
| 721 | Ga0495621_0193659 | 3300046539 | Bacteria | 816 |
| 722 | Ga0495667_0359825 | 3300046559 | Bacteria | 919 |
| 723 | Ga0495656_0123817 | 3300046615 | Bacteria | 1223 |
| 724 | Ga0495668_0587995 | 3300046616 | Bacteria | 615 |
| 725 | Ga0495635_0074159 | 3300046663 | Bacteria | 2331 |
| 726 | Ga0495661_0361097 | 3300046665 | Bacteria | 713 |
| 727 | Ga0495588_0021810 | 3300046674 | Bacteria | 3160 |
| 728 | Ga0495588_0034853 | 3300046674 | Bacteria | 2548 |
| 729 | Ga0495588_0387479 | 3300046674 | Bacteria | 734 |
| 730 | Ga0495657_0073773 | 3300046675 | Bacteria | 2221 |
| 731 | Ga0495647_0206755 | 3300046681 | Bacteria | 862 |
| 732 | Ga0495658_0317101 | 3300046683 | Bacteria | 988 |
| 733 | Ga0495669_0460494 | 3300046684 | Bacteria | 618 |
| 734 | Ga0495613_0352271 | 3300046689 | Bacteria | 1011 |
| 735 | Ga0495624_0222345 | 3300046690 | Bacteria | 1145 |
| 736 | Ga0495600_0157529 | 3300046809 | Bacteria | 1469 |
| 737 | Ga0495600_0310100 | 3300046809 | Bacteria | 994 |
| 738 | Ga0495581_0347457 | 3300047315 | Bacteria | 866 |
| 739 | Ga0495636_0211944 | 3300047318 | Bacteria | 887 |
| 740 | Ga0495636_0621869 | 3300047318 | Bacteria | 529 |
| 741 | Ga0495676_0019766 | 3300047321 | Bacteria | 5921 |
| 742 | Ga0495676_0348583 | 3300047321 | Bacteria | 990 |
| 743 | Ga0495676_0368058 | 3300047321 | Bacteria | 958 |
| 744 | Ga0495680_0828233 | 3300047322 | Bacteria | 603 |
| 745 | Ga0495675_0074917 | 3300047444 | Bacteria | 2133 |
| 746 | Ga0495677_0055559 | 3300047445 | Bacteria | 1462 |
| 747 | Ga0495679_190768 | 3300047446 | Bacteria | 541 |
| 748 | Ga0495685_048654 | 3300047447 | Bacteria | 1441 |
| 749 | Ga0495614_0643088 | 3300048089 | Bacteria | 511 |
| 750 | Ga0496100_0084513 | 3300048903 | Bacteria | 2151 |
| 751 | Ga0496100_0206070 | 3300048903 | Bacteria | 1436 |
| 752 | Ga0496100_0335971 | 3300048903 | Bacteria | 1138 |
| 753 | Ga0496100_0503393 | 3300048903 | Bacteria | 933 |
| 754 | Ga0496101_0069312 | 3300048904 | Bacteria | 2580 |
| 755 | Ga0496101_0315315 | 3300048904 | Bacteria | 1226 |
| 756 | Ga0496102_0244649 | 3300048905 | Bacteria | 1691 |
| 757 | Ga0496102_0280539 | 3300048905 | Bacteria | 1570 |
| 758 | Ga0496102_0829722 | 3300048905 | Bacteria | 847 |
| 759 | Ga0496103_0025062 | 3300048906 | Bacteria | 3602 |
| 760 | Ga0496103_0076288 | 3300048906 | Bacteria | 2103 |
| 761 | Ga0496103_0123938 | 3300048906 | Bacteria | 1647 |
| 762 | Ga0496103_1052964 | 3300048906 | Bacteria | 505 |
| 763 | Ga0496104_0286302 | 3300048907 | Bacteria | 1560 |
| 764 | Ga0496104_0538679 | 3300048907 | Bacteria | 1078 |
| 765 | Ga0496105_0004021 | 3300048908 | Bacteria | 10999 |
| 766 | Ga0496105_0319417 | 3300048908 | Bacteria | 1245 |
| 767 | Ga0496106_0011919 | 3300048909 | Bacteria | 6419 |
| 768 | Ga0496106_0054636 | 3300048909 | Bacteria | 3017 |
| 769 | Ga0496106_0534215 | 3300048909 | Bacteria | 941 |
| 770 | Ga0496106_0865133 | 3300048909 | Bacteria | 715 |
| 771 | Ga0496107_0004467 | 3300048910 | Bacteria | 9484 |
| 772 | Ga0496107_0044951 | 3300048910 | Bacteria | 3176 |
| 773 | Ga0496107_0243886 | 3300048910 | Bacteria | 1337 |
| 774 | Ga0496107_0777957 | 3300048910 | Bacteria | 701 |
| 775 | Ga0496107_0975642 | 3300048910 | Bacteria | 616 |
| 776 | Ga0496108_0082588 | 3300048911 | Bacteria | 2725 |
| 777 | Ga0496108_0174124 | 3300048911 | Bacteria | 1862 |
| 778 | Ga0496108_0252756 | 3300048911 | Bacteria | 1533 |
| 779 | Ga0496108_0302077 | 3300048911 | Bacteria | 1394 |
| 780 | Ga0496108_0306622 | 3300048911 | Bacteria | 1383 |
| 781 | Ga0496108_0610392 | 3300048911 | Bacteria | 950 |
| 782 | Ga0496108_0812070 | 3300048911 | Bacteria | 806 |
| 783 | Ga0496108_1262806 | 3300048911 | Bacteria | 622 |
| 784 | Ga0496109_0012536 | 3300048912 | Bacteria | 7318 |
| 785 | Ga0496109_0039506 | 3300048912 | Bacteria | 4271 |
| 786 | Ga0496109_0049936 | 3300048912 | Bacteria | 3810 |
| 787 | Ga0496109_0074843 | 3300048912 | Bacteria | 3113 |
| 788 | Ga0496109_0188724 | 3300048912 | Bacteria | 1936 |
| 789 | Ga0496109_0328612 | 3300048912 | Bacteria | 1443 |
| 790 | Ga0496109_0442065 | 3300048912 | Bacteria | 1228 |
| 791 | Ga0496109_0675222 | 3300048912 | Bacteria | 970 |
| 792 | Ga0496109_1279193 | 3300048912 | Bacteria | 670 |
| 793 | Ga0496110_0072144 | 3300048913 | Bacteria | 3063 |
| 794 | Ga0496110_0477572 | 3300048913 | Bacteria | 1136 |
| 795 | Ga0496110_0543247 | 3300048913 | Bacteria | 1056 |
| 796 | Ga0496110_0566733 | 3300048913 | Bacteria | 1031 |
| 797 | Ga0496110_0826452 | 3300048913 | Bacteria | 831 |
| 798 | Ga0496110_0887940 | 3300048913 | Bacteria | 797 |
| 799 | Ga0496110_1318934 | 3300048913 | Bacteria | 631 |
| 800 | Ga0496111_0082292 | 3300048914 | Bacteria | 2351 |
| 801 | Ga0496111_0098485 | 3300048914 | Bacteria | 2147 |
| 802 | Ga0496111_0816564 | 3300048914 | Bacteria | 674 |
| 803 | Ga0496112_0327452 | 3300048915 | Bacteria | 1476 |
| 804 | Ga0496112_0956987 | 3300048915 | Bacteria | 777 |
| 805 | Ga0496113_0134702 | 3300048916 | Bacteria | 1940 |
| 806 | Ga0496113_0553532 | 3300048916 | Bacteria | 923 |
| 807 | Ga0496113_0934413 | 3300048916 | Bacteria | 685 |
| 808 | Ga0496113_1302893 | 3300048916 | Bacteria | 565 |
| 809 | Ga0496113_1555388 | 3300048916 | Bacteria | 510 |
| 810 | Ga0496114_0001671 | 3300048917 | Bacteria | 16838 |
| 811 | Ga0496114_0006007 | 3300048917 | Bacteria | 9554 |
| 812 | Ga0496114_0068005 | 3300048917 | Bacteria | 2990 |
| 813 | Ga0496114_0076549 | 3300048917 | Bacteria | 2819 |
| 814 | Ga0496114_0443641 | 3300048917 | Bacteria | 1149 |
| 815 | Ga0496114_0815233 | 3300048917 | Bacteria | 812 |
| 816 | Ga0496115_0001227 | 3300048918 | Bacteria | 18411 |
| 817 | Ga0496115_0297740 | 3300048918 | Bacteria | 1322 |
| 818 | Ga0496124_0776053 | 3300048927 | Bacteria | 597 |
| 819 | Ga0501306_001808 | 3300049127 | Bacteria | 2084 |
| 820 | Ga0501306_013656 | 3300049127 | Bacteria | 1062 |
| 821 | Ga0501306_016836 | 3300049127 | Bacteria | 986 |
| 822 | Ga0501306_017358 | 3300049127 | Bacteria | 976 |
| 823 | Ga0501306_020215 | 3300049127 | Bacteria | 924 |
| 824 | Ga0501306_029031 | 3300049127 | Bacteria | 813 |
| 825 | Ga0501306_035807 | 3300049127 | Bacteria | 754 |
| 826 | Ga0501306_062970 | 3300049127 | Bacteria | 614 |
| 827 | Ga0501308_021624 | 3300049128 | Bacteria | 809 |
| 828 | Ga0501308_021633 | 3300049128 | Bacteria | 809 |
| 829 | Ga0501308_023877 | 3300049128 | Bacteria | 783 |
| 830 | Ga0501308_031288 | 3300049128 | Bacteria | 715 |
| 831 | Ga0501308_039849 | 3300049128 | Bacteria | 658 |
| 832 | Ga0501308_040120 | 3300049128 | Bacteria | 657 |
| 833 | Ga0501308_056385 | 3300049128 | Bacteria | 585 |
| 834 | Ga0501309_003424 | 3300049129 | Bacteria | 1795 |
| 835 | Ga0501309_015570 | 3300049129 | Bacteria | 1030 |
| 836 | Ga0501309_029953 | 3300049129 | Bacteria | 799 |
| 837 | Ga0501309_032265 | 3300049129 | Bacteria | 777 |
| 838 | Ga0501309_050103 | 3300049129 | Bacteria | 654 |
| 839 | Ga0501309_076735 | 3300049129 | Bacteria | 556 |
| 840 | Ga0501309_083299 | 3300049129 | Bacteria | 538 |
| 841 | Ga0501310_001945 | 3300049130 | Bacteria | 1922 |
| 842 | Ga0501310_011600 | 3300049130 | Bacteria | 999 |
| 843 | Ga0501310_013209 | 3300049130 | Bacteria | 956 |
| 844 | Ga0501310_030076 | 3300049130 | Bacteria | 718 |
| 845 | Ga0501310_035015 | 3300049130 | Bacteria | 680 |
| 846 | Ga0501310_050061 | 3300049130 | Bacteria | 602 |
| 847 | Ga0501304_007690 | 3300049160 | Bacteria | 895 |
| 848 | Ga0501304_007781 | 3300049160 | Bacteria | 891 |
| 849 | Ga0501304_010640 | 3300049160 | Bacteria | 807 |
| 850 | Ga0501304_018671 | 3300049160 | Bacteria | 672 |
| 851 | Ga0501305_026071 | 3300049161 | Bacteria | 889 |
| 852 | Ga0501305_031116 | 3300049161 | Bacteria | 832 |
| 853 | Ga0501305_041709 | 3300049161 | Bacteria | 748 |
| 854 | Ga0501305_042298 | 3300049161 | Bacteria | 744 |
| 855 | Ga0501305_046151 | 3300049161 | Bacteria | 721 |
| 856 | Ga0501305_046663 | 3300049161 | Bacteria | 718 |
| 857 | Ga0501305_065182 | 3300049161 | Bacteria | 633 |
| 858 | Ga0501305_067071 | 3300049161 | Bacteria | 626 |
| 859 | Ga0501307_023930 | 3300049162 | Bacteria | 812 |
| 860 | Ga0501307_030595 | 3300049162 | Bacteria | 744 |
| 861 | Ga0501307_033842 | 3300049162 | Bacteria | 719 |
| 862 | Ga0501307_075933 | 3300049162 | Bacteria | 542 |
| 863 | Ga0501307_092011 | 3300049162 | Bacteria | 507 |
| 864 | Ga0501307_095332 | 3300049162 | Bacteria | 501 |
| 865 | Ga0501311_008511 | 3300049527 | Bacteria | 1205 |
| 866 | Ga0501311_016036 | 3300049527 | Bacteria | 973 |
| 867 | Ga0501311_022794 | 3300049527 | Bacteria | 863 |
| 868 | Ga0501311_024651 | 3300049527 | Bacteria | 839 |
| 869 | Ga0501311_026435 | 3300049527 | Bacteria | 818 |
| 870 | Ga0501311_032471 | 3300049527 | Bacteria | 762 |
| 871 | Ga0501311_037685 | 3300049527 | Bacteria | 723 |
| 872 | Ga0501311_041851 | 3300049527 | Bacteria | 697 |
| 873 | Ga0501311_042658 | 3300049527 | Bacteria | 692 |
| 874 | Ga0501311_047757 | 3300049527 | Bacteria | 664 |
| 875 | Ga0501311_064427 | 3300049527 | Bacteria | 598 |
| 876 | Ga0501311_080307 | 3300049527 | Bacteria | 554 |
| 877 | Ga0501311_092970 | 3300049527 | Bacteria | 526 |
| 878 | Ga0501312_003439 | 3300049528 | Bacteria | 1797 |
| 879 | Ga0501312_013348 | 3300049528 | Bacteria | 1141 |
| 880 | Ga0501312_026366 | 3300049528 | Bacteria | 891 |
| 881 | Ga0501312_066940 | 3300049528 | Bacteria | 631 |
| 882 | Ga0501312_072770 | 3300049528 | Bacteria | 612 |
| 883 | Ga0501312_116380 | 3300049528 | Bacteria | 514 |
| 884 | Ga0501313_011819 | 3300049529 | Bacteria | 1011 |
| 885 | Ga0501313_025678 | 3300049529 | Bacteria | 746 |
| 886 | Ga0501313_034760 | 3300049529 | Bacteria | 663 |
| 887 | Ga0501313_045363 | 3300049529 | Bacteria | 599 |
| 888 | Ga0501314_012398 | 3300049530 | Bacteria | 817 |
| 889 | Ga0501315_014882 | 3300049531 | Bacteria | 991 |
| 890 | Ga0501315_032100 | 3300049531 | Bacteria | 762 |
| 891 | Ga0501315_033949 | 3300049531 | Bacteria | 747 |
| 892 | Ga0501315_047004 | 3300049531 | Bacteria | 669 |
| 893 | Ga0501315_053230 | 3300049531 | Bacteria | 640 |
| 894 | Ga0501316_001753 | 3300049532 | Bacteria | 1911 |
| 895 | Ga0501316_006908 | 3300049532 | Bacteria | 1221 |
| 896 | Ga0501316_009901 | 3300049532 | Bacteria | 1078 |
| 897 | Ga0501316_023202 | 3300049532 | Bacteria | 795 |
| 898 | Ga0501316_024413 | 3300049532 | Bacteria | 781 |
| 899 | Ga0501316_029644 | 3300049532 | Bacteria | 727 |
| 900 | Ga0501316_069325 | 3300049532 | Bacteria | 532 |
| 901 | Ga0501316_074464 | 3300049532 | Bacteria | 518 |
| 902 | Ga0501317_006833 | 3300049533 | Bacteria | 1269 |
| 903 | Ga0501317_010826 | 3300049533 | Bacteria | 1098 |
| 904 | Ga0501317_013603 | 3300049533 | Bacteria | 1020 |
| 905 | Ga0501317_019297 | 3300049533 | Bacteria | 909 |
| 906 | Ga0501317_019458 | 3300049533 | Bacteria | 907 |
| 907 | Ga0501317_022503 | 3300049533 | Bacteria | 864 |
| 908 | Ga0501317_036202 | 3300049533 | Bacteria | 737 |
| 909 | Ga0501317_052370 | 3300049533 | Bacteria | 652 |
| 910 | Ga0501317_057948 | 3300049533 | Bacteria | 630 |
| 911 | Ga0501317_066654 | 3300049533 | Bacteria | 600 |
| 912 | Ga0501317_075081 | 3300049533 | Bacteria | 576 |
| 913 | Ga0501317_104197 | 3300049533 | Bacteria | 515 |
| 914 | Ga0501317_112009 | 3300049533 | Bacteria | 502 |
| 915 | Ga0501318_000807 | 3300049534 | Bacteria | 2184 |
| 916 | Ga0501318_001117 | 3300049534 | Bacteria | 2007 |
| 917 | Ga0501318_002464 | 3300049534 | Bacteria | 1606 |
| 918 | Ga0501318_007220 | 3300049534 | Bacteria | 1155 |
| 919 | Ga0501318_011664 | 3300049534 | Bacteria | 997 |
| 920 | Ga0501318_016507 | 3300049534 | Bacteria | 893 |
| 921 | Ga0501318_019180 | 3300049534 | Bacteria | 851 |
| 922 | Ga0501318_026279 | 3300049534 | Bacteria | 767 |
| 923 | Ga0501318_034608 | 3300049534 | Bacteria | 701 |
| 924 | Ga0501318_048217 | 3300049534 | Bacteria | 627 |
| 925 | Ga0501318_089044 | 3300049534 | Bacteria | 509 |
| 926 | Ga0501319_001340 | 3300049535 | Bacteria | 1404 |
| 927 | Ga0501319_004671 | 3300049535 | Bacteria | 959 |
| 928 | Ga0501319_006144 | 3300049535 | Bacteria | 879 |
| 929 | Ga0501319_029295 | 3300049535 | Bacteria | 525 |
| 930 | Ga0501320_003000 | 3300049536 | Bacteria | 1398 |
| 931 | Ga0501320_009483 | 3300049536 | Bacteria | 975 |
| 932 | Ga0501320_013645 | 3300049536 | Bacteria | 869 |
| 933 | Ga0501320_014275 | 3300049536 | Bacteria | 857 |
| 934 | Ga0501320_022258 | 3300049536 | Bacteria | 742 |
| 935 | Ga0501320_033960 | 3300049536 | Bacteria | 646 |
| 936 | Ga0501321_001598 | 3300049537 | Bacteria | 1834 |
| 937 | Ga0501321_003025 | 3300049537 | Bacteria | 1510 |
| 938 | Ga0501321_014152 | 3300049537 | Bacteria | 925 |
| 939 | Ga0501321_015626 | 3300049537 | Bacteria | 895 |
| 940 | Ga0501321_023878 | 3300049537 | Bacteria | 779 |
| 941 | Ga0501321_025363 | 3300049537 | Bacteria | 764 |
| 942 | Ga0501321_028308 | 3300049537 | Bacteria | 736 |
| 943 | Ga0501321_037521 | 3300049537 | Bacteria | 671 |
| 944 | Ga0501321_039034 | 3300049537 | Bacteria | 662 |
| 945 | Ga0501321_040241 | 3300049537 | Bacteria | 655 |
| 946 | Ga0501321_061083 | 3300049537 | Bacteria | 569 |
| 947 | Ga0501321_062986 | 3300049537 | Bacteria | 564 |
| 948 | Ga0501322_017659 | 3300049538 | Bacteria | 606 |
| 949 | Ga0501323_000424 | 3300049539 | Bacteria | 3097 |
| 950 | Ga0501323_000806 | 3300049539 | Bacteria | 2511 |
| 951 | Ga0501323_006932 | 3300049539 | Bacteria | 1279 |
| 952 | Ga0501323_023204 | 3300049539 | Bacteria | 832 |
| 953 | Ga0501323_033560 | 3300049539 | Bacteria | 730 |
| 954 | Ga0501323_037637 | 3300049539 | Bacteria | 700 |
| 955 | Ga0501323_060551 | 3300049539 | Bacteria | 590 |
| 956 | Ga0501323_064690 | 3300049539 | Bacteria | 576 |
| 957 | Ga0501323_095189 | 3300049539 | Bacteria | 500 |
| 958 | Ga0501324_006356 | 3300049540 | Bacteria | 994 |
| 959 | Ga0501324_007590 | 3300049540 | Bacteria | 940 |
| 960 | Ga0501324_010250 | 3300049540 | Bacteria | 851 |
| 961 | Ga0501324_012919 | 3300049540 | Bacteria | 786 |
| 962 | Ga0501324_016833 | 3300049540 | Bacteria | 720 |
| 963 | Ga0501324_021918 | 3300049540 | Bacteria | 658 |
| 964 | Ga0501324_033373 | 3300049540 | Bacteria | 569 |
| 965 | Ga0501324_035899 | 3300049540 | Bacteria | 554 |
| 966 | Ga0501325_003146 | 3300049541 | Bacteria | 1183 |
| 967 | Ga0501325_009286 | 3300049541 | Bacteria | 870 |
| 968 | Ga0501325_019142 | 3300049541 | Bacteria | 707 |
| 969 | Ga0501325_023722 | 3300049541 | Bacteria | 664 |
| 970 | Ga0501329_01449 | 3300049545 | Bacteria | 1040 |
| 971 | Ga0501333_004646 | 3300049549 | Bacteria | 869 |
| 972 | Ga0501333_006364 | 3300049549 | Bacteria | 784 |
| 973 | Ga0501338_06517 | 3300049554 | Bacteria | 739 |
| 974 | Ga0501340_007576 | 3300049556 | Bacteria | 751 |
| 975 | Ga0501031_0062259 | 3300049568 | Bacteria | 2431 |
| 976 | Ga0501031_0155910 | 3300049568 | Bacteria | 1492 |
| 977 | Ga0501032_0017464 | 3300049569 | Bacteria | 5040 |
| 978 | Ga0501032_0159374 | 3300049569 | Bacteria | 1482 |
| 979 | Ga0501032_0526640 | 3300049569 | Bacteria | 754 |
| 980 | Ga0501032_0682780 | 3300049569 | Bacteria | 651 |
| 981 | Ga0501033_0107440 | 3300049570 | Bacteria | 2032 |
| 982 | Ga0501034_0011971 | 3300049571 | Bacteria | 8966 |
| 983 | Ga0501034_0159328 | 3300049571 | Bacteria | 2229 |
| 984 | Ga0501036_0037115 | 3300049572 | Bacteria | 4122 |
| 985 | Ga0501036_0041412 | 3300049572 | Bacteria | 3897 |
| 986 | Ga0501036_0290693 | 3300049572 | Bacteria | 1367 |
| 987 | Ga0501036_0675603 | 3300049572 | Bacteria | 854 |
| 988 | Ga0501036_1356736 | 3300049572 | Bacteria | 577 |
| 989 | Ga0501036_1483303 | 3300049572 | Bacteria | 549 |
| 990 | Ga0501037_0009850 | 3300049573 | Bacteria | 7014 |
| 991 | Ga0501038_0008979 | 3300049574 | Bacteria | 9172 |
| 992 | Ga0501038_0009072 | 3300049574 | Bacteria | 9132 |
| 993 | Ga0501038_0010481 | 3300049574 | Bacteria | 8479 |
| 994 | Ga0501038_0352243 | 3300049574 | Bacteria | 1146 |
| 995 | Ga0501039_0006825 | 3300049575 | Bacteria | 8685 |
| 996 | Ga0501039_0086264 | 3300049575 | Bacteria | 2445 |
| 997 | Ga0501039_0254242 | 3300049575 | Bacteria | 1381 |
| 998 | Ga0501039_0506053 | 3300049575 | Bacteria | 948 |
| 999 | Ga0501039_0839420 | 3300049575 | Bacteria | 716 |
| 1000 | Ga0501040_0005127 | 3300049576 | Bacteria | 8471 |
| 1001 | Ga0501040_0061519 | 3300049576 | Bacteria | 2582 |
| 1002 | Ga0501040_0329601 | 3300049576 | Bacteria | 1092 |
| 1003 | Ga0501040_0512914 | 3300049576 | Bacteria | 864 |
| 1004 | Ga0501041_0070654 | 3300049577 | Bacteria | 2143 |
| 1005 | Ga0501041_0284266 | 3300049577 | Bacteria | 1041 |
| 1006 | Ga0501041_0284827 | 3300049577 | Bacteria | 1040 |
| 1007 | Ga0501041_0377349 | 3300049577 | Bacteria | 897 |
| 1008 | Ga0501041_0891188 | 3300049577 | Bacteria | 571 |
| 1009 | Ga0501042_0024296 | 3300049578 | Bacteria | 4250 |
| 1010 | Ga0501042_0034695 | 3300049578 | Bacteria | 3578 |
| 1011 | Ga0501042_0040727 | 3300049578 | Bacteria | 3302 |
| 1012 | Ga0501042_0785296 | 3300049578 | Bacteria | 693 |
| 1013 | Ga0501042_0785463 | 3300049578 | Bacteria | 693 |
| 1014 | Ga0501042_1035756 | 3300049578 | Bacteria | 598 |
| 1015 | Ga0501043_0039304 | 3300049579 | Bacteria | 3718 |
| 1016 | Ga0501043_0086168 | 3300049579 | Bacteria | 2468 |
| 1017 | Ga0501043_0153971 | 3300049579 | Bacteria | 1798 |
| 1018 | Ga0501043_0297510 | 3300049579 | Bacteria | 1234 |
| 1019 | Ga0501043_0999871 | 3300049579 | Bacteria | 595 |
| 1020 | Ga0501046_0000184 | 3300049580 | Bacteria | 63497 |
| 1021 | Ga0501046_0014510 | 3300049580 | Bacteria | 6645 |
| 1022 | Ga0501046_0036642 | 3300049580 | Bacteria | 3947 |
| 1023 | Ga0501046_0102430 | 3300049580 | Bacteria | 2195 |
| 1024 | Ga0501047_0030501 | 3300049581 | Bacteria | 5197 |
| 1025 | Ga0501047_0091108 | 3300049581 | Bacteria | 2926 |
| 1026 | Ga0501048_0009925 | 3300049582 | Bacteria | 7132 |
| 1027 | Ga0501048_0068780 | 3300049582 | Bacteria | 2501 |
| 1028 | Ga0501048_0656887 | 3300049582 | Bacteria | 753 |
| 1029 | Ga0501067_0038315 | 3300049583 | Bacteria | 2662 |
| 1030 | Ga0501067_0098556 | 3300049583 | Bacteria | 1623 |
| 1031 | Ga0501067_0230796 | 3300049583 | Bacteria | 1030 |
| 1032 | Ga0501067_0492870 | 3300049583 | Bacteria | 685 |
| 1033 | Ga0501067_0794604 | 3300049583 | Bacteria | 533 |
| 1034 | Ga0501068_0088194 | 3300049584 | Bacteria | 1911 |
| 1035 | Ga0501068_0194588 | 3300049584 | Bacteria | 1285 |
| 1036 | Ga0501068_0226659 | 3300049584 | Bacteria | 1188 |
| 1037 | Ga0501068_0278538 | 3300049584 | Bacteria | 1069 |
| 1038 | Ga0501069_0023811 | 3300049585 | Bacteria | 3338 |
| 1039 | Ga0501069_0076909 | 3300049585 | Bacteria | 1877 |
| 1040 | Ga0501069_0580461 | 3300049585 | Bacteria | 672 |
| 1041 | Ga0501070_0014863 | 3300049586 | Bacteria | 6549 |
| 1042 | Ga0501070_0157098 | 3300049586 | Bacteria | 1875 |
| 1043 | Ga0501070_0157879 | 3300049586 | Bacteria | 1870 |
| 1044 | Ga0501070_0171686 | 3300049586 | Bacteria | 1786 |
| 1045 | Ga0501070_1076811 | 3300049586 | Bacteria | 621 |
| 1046 | Ga0501070_1344402 | 3300049586 | Bacteria | 544 |
| 1047 | Ga0501071_0055572 | 3300049587 | Bacteria | 2858 |
| 1048 | Ga0501071_0075525 | 3300049587 | Bacteria | 2460 |
| 1049 | Ga0501071_0988430 | 3300049587 | Bacteria | 650 |
| 1050 | Ga0501071_1122033 | 3300049587 | Bacteria | 607 |
| 1051 | Ga0501071_1166474 | 3300049587 | Bacteria | 595 |
| 1052 | Ga0501072_0248284 | 3300049588 | Bacteria | 1417 |
| 1053 | Ga0501072_0332595 | 3300049588 | Bacteria | 1207 |
| 1054 | Ga0501072_1174049 | 3300049588 | Bacteria | 597 |
| 1055 | Ga0501072_1450056 | 3300049588 | Bacteria | 530 |
| 1056 | Ga0501073_0076730 | 3300049589 | Bacteria | 2325 |
| 1057 | Ga0501073_0287670 | 3300049589 | Bacteria | 1134 |
| 1058 | Ga0501073_0962914 | 3300049589 | Bacteria | 587 |
| 1059 | Ga0501074_0013659 | 3300049590 | Bacteria | 5903 |
| 1060 | Ga0501074_0239633 | 3300049590 | Bacteria | 1290 |
| 1061 | Ga0501074_0439599 | 3300049590 | Bacteria | 925 |
| 1062 | Ga0501074_0510938 | 3300049590 | Bacteria | 851 |
| 1063 | Ga0501074_1111784 | 3300049590 | Bacteria | 555 |
| 1064 | Ga0501075_0068644 | 3300049591 | Bacteria | 2678 |
| 1065 | Ga0501076_1174490 | 3300049592 | Bacteria | 632 |
| 1066 | Ga0501076_1254812 | 3300049592 | Bacteria | 610 |
| 1067 | Ga0501077_0188376 | 3300049593 | Bacteria | 1311 |
| 1068 | Ga0501202_066601 | 3300049652 | Bacteria | 823 |
| 1069 | Ga0501208_153501 | 3300049655 | Bacteria | 523 |
| 1070 | Ga0501217_118011 | 3300049661 | Bacteria | 768 |
| 1071 | Ga0501224_047026 | 3300049664 | Bacteria | 657 |
| 1072 | Ga0501243_046446 | 3300049675 | Bacteria | 774 |
| 1073 | Ga0501243_077072 | 3300049675 | Bacteria | 643 |
| 1074 | Ga0501257_124927 | 3300049686 | Bacteria | 692 |
| 1075 | Ga0501257_260959 | 3300049686 | Bacteria | 516 |
| 1076 | Ga0501221_074062 | 3300049704 | Bacteria | 809 |
| 1077 | Ga0501225_0200766 | 3300049705 | Bacteria | 633 |
| 1078 | Ga0501080_0164141 | 3300049742 | Bacteria | 2050 |
| 1079 | Ga0501080_0361873 | 3300049742 | Bacteria | 1309 |
| 1080 | Ga0501080_1688910 | 3300049742 | Bacteria | 534 |
| 1081 | Ga0501081_0067962 | 3300049743 | Bacteria | 2480 |
| 1082 | Ga0501081_0414458 | 3300049743 | Bacteria | 998 |
| 1083 | Ga0501081_0481541 | 3300049743 | Bacteria | 924 |
| 1084 | Ga0501035_0007374 | 3300049822 | Bacteria | 10279 |
| 1085 | Ga0501035_0046149 | 3300049822 | Bacteria | 3918 |
| 1086 | Ga0501044_0010047 | 3300049823 | Bacteria | 10284 |
| 1087 | Ga0501044_0070278 | 3300049823 | Bacteria | 3561 |
| 1088 | Ga0501045_0000777 | 3300049824 | Bacteria | 20521 |
| 1089 | Ga0501045_0114781 | 3300049824 | Bacteria | 1998 |
| 1090 | Ga0501045_0248232 | 3300049824 | Bacteria | 1325 |
| 1091 | Ga0501045_0249796 | 3300049824 | Bacteria | 1320 |
| 1092 | Ga0501045_0489383 | 3300049824 | Bacteria | 914 |
| 1093 | Ga0501212_083475 | 3300049851 | Bacteria | 581 |
| 1094 | nmdc:mga03n38_183427_c1 | 3300050490 | Bacteria | 1074 |
| 1095 | nmdc:mga03n38_28651_c1 | 3300050490 | Bacteria | 2324 |
| 1096 | nmdc:mga03n38_59143_c1 | 3300050490 | Bacteria | 1739 |
| 1097 | nmdc:mga03n38_772347_c1 | 3300050490 | Bacteria | 558 |
| 1098 | nmdc:mga03n38_787875_c1 | 3300050490 | Bacteria | 553 |
| 1099 | nmdc:mga00v17_14491_c1 | 3300050491 | Bacteria | 4402 |
| 1100 | nmdc:mga00v17_21161_c1 | 3300050491 | Bacteria | 3737 |
| 1101 | nmdc:mga00v17_217682_c1 | 3300050491 | Bacteria | 1236 |
| 1102 | nmdc:mga0yw44_123191_c1 | 3300050492 | Bacteria | 1672 |
| 1103 | nmdc:mga0yw44_204303_c1 | 3300050492 | Bacteria | 1306 |
| 1104 | nmdc:mga0yw44_22344_c1 | 3300050492 | Bacteria | 3547 |
| 1105 | nmdc:mga0yw44_337032_c1 | 3300050492 | Bacteria | 1014 |
| 1106 | nmdc:mga0yw44_353012_c1 | 3300050492 | Bacteria | 990 |
| 1107 | nmdc:mga0yw44_357158_c1 | 3300050492 | Bacteria | 984 |
| 1108 | nmdc:mga0yw44_367219_c1 | 3300050492 | Bacteria | 970 |
| 1109 | nmdc:mga0yw44_374504_c1 | 3300050492 | Bacteria | 961 |
| 1110 | nmdc:mga0yw44_381190_c1 | 3300050492 | Bacteria | 952 |
| 1111 | nmdc:mga0yw44_45943_c1 | 3300050492 | Bacteria | 2620 |
| 1112 | nmdc:mga0yw44_551358_c1 | 3300050492 | Bacteria | 783 |
| 1113 | nmdc:mga0yw44_59761_c1 | 3300050492 | Bacteria | 2333 |
| 1114 | nmdc:mga0yw44_80998_c1 | 3300050492 | Bacteria | 2035 |
| 1115 | nmdc:mga06z11_144871_c1 | 3300050494 | Bacteria | 1346 |
| 1116 | nmdc:mga06z11_1605_c1 | 3300050494 | Bacteria | 8433 |
| 1117 | nmdc:mga06z11_178624_c1 | 3300050494 | Bacteria | 1223 |
| 1118 | nmdc:mga06z11_209757_c1 | 3300050494 | Bacteria | 1135 |
| 1119 | nmdc:mga06z11_924000_c1 | 3300050494 | Bacteria | 532 |
| 1120 | nmdc:mga04h51_226825_c1 | 3300050495 | Bacteria | 742 |
| 1121 | nmdc:mga04h51_303980_c1 | 3300050495 | Bacteria | 651 |
| 1122 | nmdc:mga04h51_74600_c1 | 3300050495 | Bacteria | 1192 |
| 1123 | nmdc:mga07m45_209218_c1 | 3300050496 | Bacteria | 1135 |
| 1124 | nmdc:mga05p37_712347_c1 | 3300050507 | Bacteria | 1113 |
| 1125 | nmdc:mga0qj67_1320512_c1 | 3300050509 | Bacteria | 558 |
| 1126 | nmdc:mga06r32_280_c4 | 3300050510 | Bacteria | 18036 |
| 1127 | nmdc:mga08y16_2141246_c1 | 3300050511 | Bacteria | 506 |
| 1128 | nmdc:mga08y16_602382_c1 | 3300050511 | Bacteria | 1107 |
| 1129 | nmdc:mga08y16_904192_c1 | 3300050511 | Bacteria | 869 |
| 1130 | nmdc:mga08y16_99916_c1 | 3300050511 | Bacteria | 3021 |
| 1131 | nmdc:mga0n895_1023800_c1 | 3300050512 | Bacteria | 806 |
| 1132 | nmdc:mga0a205_1473818_c1 | 3300050515 | Bacteria | 528 |
| 1133 | Ga0495601_0530620 | 3300053077 | Bacteria | 758 |
| 1134 | Ga0495612_0176920 | 3300053078 | Bacteria | 936 |
| 1135 | Ga0495612_0316891 | 3300053078 | Bacteria | 701 |
| 1136 | Ga0495655_0052079 | 3300053083 | Bacteria | 1087 |
| 1137 | Ga0495595_0207570 | 3300053084 | Bacteria | 976 |
| 1138 | Ga0495619_0026939 | 3300053085 | Bacteria | 3702 |
| 1139 | Ga0495619_0128753 | 3300053085 | Bacteria | 1739 |
| 1140 | Ga0495619_0463856 | 3300053085 | Bacteria | 873 |
| 1141 | Ga0495619_0766655 | 3300053085 | Bacteria | 654 |
| 1142 | Ga0500556_0000417 | 3300053104 | Bacteria | 30638 |
| 1143 | Ga0500593_001815 | 3300053117 | Bacteria | 7667 |
| 1144 | Ga0500655_020453 | 3300053133 | Bacteria | 1237 |
| 1145 | Ga0500573_0024690 | 3300053140 | Bacteria | 3455 |
| 1146 | Ga0500573_0442141 | 3300053140 | Bacteria | 603 |
| 1147 | Ga0500604_0194012 | 3300053151 | Bacteria | 698 |
| 1148 | Ga0501084_0003572 | 3300054114 | Bacteria | 12619 |
| 1149 | Ga0501084_1800560 | 3300054114 | Bacteria | 511 |
| 1150 | Ga0590075_040531 | 3300059424 | Bacteria | 1190 |
| 1151 | Ga0587084_004447 | 3300059477 | Bacteria | 1605 |
| 1152 | Ga0587066_111690 | 3300059490 | Bacteria | 634 |
| 1153 | Ga0587070_082332 | 3300059491 | Bacteria | 708 |
| 1154 | Ga0587070_092236 | 3300059491 | Bacteria | 683 |
| 1155 | Ga0587073_0233261 | 3300059492 | Bacteria | 568 |
| 1156 | Ga0587080_037179 | 3300059503 | Bacteria | 873 |
| 1157 | Ga0587082_045183 | 3300059504 | Bacteria | 822 |
| 1158 | Ga0587088_059670 | 3300059508 | Bacteria | 769 |
| 1159 | Ga0587088_069115 | 3300059508 | Bacteria | 732 |
| 1160 | Ga0587089_058620 | 3300059509 | Bacteria | 632 |
| 1161 | Ga0587090_040745 | 3300059510 | Bacteria | 817 |
| 1162 | Ga0587090_055418 | 3300059510 | Bacteria | 738 |
| 1163 | Ga0587090_061702 | 3300059510 | Bacteria | 713 |
| 1164 | Ga0587090_102896 | 3300059510 | Bacteria | 600 |
| 1165 | Ga0587091_120095 | 3300059511 | Bacteria | 637 |
| 1166 | Ga0587092_027209 | 3300059512 | Bacteria | 924 |
| 1167 | Ga0587092_057562 | 3300059512 | Bacteria | 720 |
| 1168 | Ga0587098_019778 | 3300059604 | Bacteria | 845 |
| 1169 | Ga0587106_007298 | 3300059605 | Bacteria | 1337 |
| 1170 | Ga0587106_035889 | 3300059605 | Bacteria | 819 |
| 1171 | Ga0587106_052337 | 3300059605 | Bacteria | 727 |
| 1172 | Ga0587121_05808 | 3300059606 | Bacteria | 717 |
| 1173 | Ga0587129_009787 | 3300059608 | Bacteria | 731 |
| 1174 | Ga0587099_013537 | 3300059622 | Bacteria | 851 |
| 1175 | Ga0587101_022425 | 3300059623 | Bacteria | 921 |
| 1176 | Ga0587115_041527 | 3300059626 | Bacteria | 720 |
| 1177 | Ga0587115_061526 | 3300059626 | Bacteria | 631 |
| 1178 | Ga0587128_039404 | 3300059630 | Bacteria | 820 |
| 1179 | Ga0587128_050313 | 3300059630 | Bacteria | 759 |
| 1180 | Ga0587062_045267 | 3300059639 | Bacteria | 728 |
| 1181 | Ga0587068_018484 | 3300059641 | Bacteria | 1123 |
| 1182 | Ga0587068_091541 | 3300059641 | Bacteria | 627 |
| 1183 | Ga0587069_044260 | 3300059642 | Bacteria | 771 |
| 1184 | Ga0587075_034598 | 3300059644 | Bacteria | 821 |
| 1185 | Ga0587075_043431 | 3300059644 | Bacteria | 762 |
| 1186 | Ga0587075_049328 | 3300059644 | Bacteria | 730 |
| 1187 | Ga0587078_042830 | 3300059646 | Bacteria | 644 |
| 1188 | Ga0587079_069729 | 3300059647 | Bacteria | 781 |
| 1189 | Ga0587102_045529 | 3300059649 | Bacteria | 578 |
| 1190 | Ga0587105_004205 | 3300059651 | Bacteria | 911 |
| 1191 | Ga0587114_024577 | 3300059655 | Bacteria | 878 |
| 1192 | Ga0587114_045626 | 3300059655 | Bacteria | 725 |
| 1193 | Ga0587118_14263 | 3300059657 | Bacteria | 629 |
| 1194 | Ga0587119_014442 | 3300059658 | Bacteria | 947 |
| 1195 | Ga0587071_068556 | 3300060344 | Bacteria | 768 |
| 1196 | Ga0587071_082121 | 3300060344 | Bacteria | 719 |
| 1197 | Ga0587111_0045587 | 3300060346 | Bacteria | 951 |
| 1198 | Ga0587111_0098702 | 3300060346 | Bacteria | 724 |
| 1199 | Ga0587111_0227970 | 3300060346 | Bacteria | 541 |
| 1200 | Ga0501082_0007916 | 3300060353 | Bacteria | 9180 |
| 1201 | Ga0501082_0724991 | 3300060353 | Bacteria | 870 |
| 1202 | Ga0501082_1447759 | 3300060353 | Bacteria | 600 |
| 1203 | Ga0466962_0002275 | 3300061719 | Bacteria | 9104 |
| 1204 | Ga0466962_0038742 | 3300061719 | Bacteria | 2283 |
| 1205 | Ga0466962_0130887 | 3300061719 | Bacteria | 1212 |
| 1206 | Ga0466962_0147740 | 3300061719 | Bacteria | 1140 |
| 1207 | Ga0530510_0165889 | 3300061734 | Bacteria | 1635 |
| 1208 | Ga0530510_0172128 | 3300061734 | Bacteria | 1604 |
| 1209 | Ga0530510_1127169 | 3300061734 | Bacteria | 601 |
| 1210 | 2585301890 | 2582581312 | Bacteria | 7308206 |
| 1211 | 2585304852 | 2582581313 | Bacteria | 10042643 |
| 1212 | 2616899875 | 2616644941 | Bacteria | 8510691 |
| 1213 | 2643828134 | 2643221561 | Bacteria | 4984412 |
| 1214 | 2643897863 | 2643221578 | Bacteria | 9213798 |
| 1215 | 2644018699 | 2643221601 | Bacteria | 7493239 |
| 1216 | 2644090068 | 2643221615 | Bacteria | 5487866 |
| 1217 | 2644179834 | 2643221631 | Bacteria | 8168043 |
| 1218 | 2644183216 | 2643221632 | Bacteria | 3406696 |
| 1219 | 2644319913 | 2643221657 | Bacteria | 5490246 |
| 1220 | 2644385381 | 2643221670 | Bacteria | 6497041 |
| 1221 | 2644409008 | 2643221673 | Bacteria | 9196637 |
| 1222 | 2644436358 | 2643221678 | Bacteria | 9540101 |
| 1223 | 2644531223 | 2643221696 | Bacteria | 5431823 |
| 1224 | 2729905770 | 2728369276 | Bacteria | 5610032 |
| 1225 | 2785344289 | 2784746763 | Bacteria | 9783172 |
| 1226 | 2785368568 | 2784746768 | Bacteria | 10036182 |
| 1227 | 2786669657 | 2786546132 | Bacteria | 10419719 |
| 1228 | 2793976154 | 2791355406 | Bacteria | 11364898 |
| 1229 | 2808841256 | 2808606359 | Bacteria | 9866990 |
| 1230 | 2819742873 | 2818991472 | Bacteria | 10089953 |
| 1231 | 2855387467 | 2855386786 | Bacteria | 4752232 |
| 1232 | 2857484884 | 2857481737 | Bacteria | 4761446 |
| 1233 | 2862184904 | 2862178590 | Bacteria | 8583590 |
| 1234 | 2862288159 | 2862281513 | Bacteria | 9621493 |
| 1235 | 2867431117 | 2867428634 | Bacteria | 9590268 |
| 1236 | 2867479659 | 2867475112 | Bacteria | 6909112 |
| 1237 | 2875393779 | 2875391855 | Bacteria | 7600475 |
| 1238 | 2877681968 | 2877676314 | Bacteria | 9512378 |
| 1239 | 2912720930 | 2912715099 | Bacteria | 9460473 |
| 1240 | 2919468657 | 2919468124 | Bacteria | 9133025 |
| 1241 | 2946050878 | 2946045630 | Bacteria | 8527308 |
| 1242 | 2954676082 | 2954673503 | Bacteria | 9685905 |
| 1243 | 2954688084 | 2954682443 | Bacteria | 9862841 |
| 1244 | 2954717034 | 2954711539 | Bacteria | 10867210 |
| 1245 | 2954726982 | 2954721474 | Bacteria | 10456478 |
| 1246 | 2954734799 | 2954731030 | Bacteria | 10243860 |
| 1247 | 2954745905 | 2954740390 | Bacteria | 10229294 |
| 1248 | 2954753685 | 2954749733 | Bacteria | 10366972 |
| 1249 | 2954764877 | 2954759201 | Bacteria | 9358192 |
| 1250 | 2990094188 | 2990088156 | Bacteria | 6657676 |
| 1251 | 2995471105 | 2995463766 | Bacteria | 8577691 |
| 1252 | 2997456539 | 2997451912 | Bacteria | 8492419 |
| 1253 | 8033690549 | 8033684223 | Bacteria | 6906479 |
| 1254 | 8047898955 | 8047893842 | Bacteria | 11723082 |
| 1255 | 8048127682 | 8048127548 | Bacteria | 11053136 |
| 1256 | 8048359964 | 8048356638 | Bacteria | 11044339 |
| 1257 | 8048375913 | 8048369669 | Bacteria | 11666822 |
| 1258 | 8048382294 | 8048379754 | Bacteria | 11877923 |
| 1259 | 8048408398 | 8048406513 | Bacteria | 8936924 |
| 1260 | 8054612376 | 8054609563 | Bacteria | 5170090 |
| 1261 | 8056453597 | 8056447290 | Bacteria | 7680491 |
| 1262 | LJQas_1002902 | |||
| 1263 | LJQas_1008780 | |||
| 1264 | JGI24735J21928_10094491 | |||
| 1265 | JGI24738J21930_10028799 | |||
| 1266 | JGI24744J21845_10098387 | |||
| 1267 | Ga0006762J43184_106160 | |||
| 1268 | Ga0006778J45830_1005237 | |||
| 1269 | Ga0006778J45830_1017350 | |||
| 1270 | Ga0006778J45830_1018865 | |||
| 1271 | Ga0006778J45830_1024217 | |||
| 1272 | Ga0006778J45830_1076135 | |||
| 1273 | Ga0006759J45824_1007731 | |||
| 1274 | Ga0006759J45824_1033594 | |||
| 1275 | Ga0006759J45824_1040332 | |||
| 1276 | Ga0006759J45824_1056525 | |||
| 1277 | Ga0006758J48902_1008537 | |||
| 1278 | Ga0006777J48905_1029661 | |||
| 1279 | Ga0006777J48905_1050436 | |||
| 1280 | Ga0006777J48905_1056291 | |||
| 1281 | rootL2_10084680 | |||
| 1282 | Ga0007417J51691_1034199 | |||
| 1283 | Ga0007417J51691_1045249 | |||
| 1284 | Ga0007427J51700_105542 | |||
| 1285 | Ga0007427J51700_112829 | |||
| 1286 | Ga0006781J51513_1004365 | |||
| 1287 | Ga0006781J51513_1012022 | |||
| 1288 | Ga0006781J51513_1017605 | |||
| 1289 | Ga0007409J51694_1007139 | |||
| 1290 | Ga0007409J51694_1055501 | |||
| 1291 | Ga0007416J51690_1008794 | |||
| 1292 | Ga0007416J51690_1032047 | |||
| 1293 | Ga0007429J51699_1004976 | |||
| 1294 | Ga0007429J51699_1026481 | |||
| 1295 | Ga0007429J51699_1028743 | |||
| 1296 | Ga0007429J51699_1147323 | |||
| 1297 | Ga0007411J51799_104538 | |||
| 1298 | Ga0032354_1003953 | |||
| 1299 | Ga0032354_1020597 | |||
| 1300 | Ga0032354_1021921 | |||
| 1301 | Ga0006780_1002679 | |||
| 1302 | Ga0006780_1018908 | |||
| 1303 | Ga0058858_1005265 | |||
| 1304 | Ga0058858_1008839 | |||
| 1305 | Ga0058859_10007251 | |||
| 1306 | Ga0058859_10031544 | |||
| 1307 | Ga0058861_10020666 | |||
| 1308 | Ga0058860_12069996 | |||
| 1309 | Ga0070658_10845028 | |||
| 1310 | Ga0070658_11319472 | |||
| 1311 | Ga0070683_100013284 | |||
| 1312 | Ga0070683_100094819 | |||
| 1313 | Ga0070683_100760098 | |||
| 1314 | Ga0070683_100864030 | |||
| 1315 | Ga0070683_101329895 | |||
| 1316 | Ga0070683_101794826 | |||
| 1317 | Ga0070683_102190730 | |||
| 1318 | Ga0070670_100763874 | |||
| 1319 | Ga0070680_101902148 | |||
| 1320 | Ga0070682_100243391 | |||
| 1321 | Ga0070682_100414100 | |||
| 1322 | Ga0070682_100824630 | |||
| 1323 | Ga0068868_100352581 | |||
| 1324 | Ga0068868_101943940 | |||
| 1325 | Ga0070660_100036431 | |||
| 1326 | Ga0070660_101221018 | |||
| 1327 | Ga0070691_10295104 | |||
| 1328 | Ga0070687_101495327 | |||
| 1329 | Ga0070692_10458023 | |||
| 1330 | Ga0070692_10719656 | |||
| 1331 | Ga0070692_10786013 | |||
| 1332 | Ga0070668_100035938 | |||
| 1333 | Ga0070668_100631463 | |||
| 1334 | Ga0070669_101938912 | |||
| 1335 | Ga0070671_101803509 | |||
| 1336 | Ga0070674_100754251 | |||
| 1337 | Ga0070674_101764301 | |||
| 1338 | Ga0070674_102056534 | |||
| 1339 | Ga0070673_100248121 | |||
| 1340 | Ga0070673_100622564 | |||
| 1341 | Ga0070688_100241705 | |||
| 1342 | Ga0070659_100030400 | |||
| 1343 | Ga0070659_100155252 | |||
| 1344 | Ga0070659_100628514 | |||
| 1345 | Ga0070667_100806611 | |||
| 1346 | Ga0070714_100536709 | |||
| 1347 | Ga0070714_101692607 | |||
| 1348 | Ga0070713_100530506 | |||
| 1349 | Ga0070710_11519626 | |||
| 1350 | Ga0070701_10001495 | |||
| 1351 | Ga0070711_101157707 | |||
| 1352 | Ga0070711_101648264 | |||
| 1353 | Ga0070700_100541634 | |||
| 1354 | Ga0070700_101157639 | |||
| 1355 | Ga0070700_101361181 | |||
| 1356 | Ga0070694_100906884 | |||
| 1357 | Ga0070663_100101383 | |||
| 1358 | Ga0070663_101045818 | |||
| 1359 | Ga0070663_101524739 | |||
| 1360 | Ga0070678_100193025 | |||
| 1361 | Ga0070678_101010375 | |||
| 1362 | Ga0070678_101960762 | |||
| 1363 | Ga0070662_100466784 | |||
| 1364 | Ga0070662_100784202 | |||
| 1365 | Ga0070662_101113450 | |||
| 1366 | Ga0070662_101417856 | |||
| 1367 | Ga0070662_101955886 | |||
| 1368 | Ga0068867_101061423 | |||
| 1369 | Ga0070685_10298080 | |||
| 1370 | Ga0070706_100471117 | |||
| 1371 | Ga0070707_101134928 | |||
| 1372 | Ga0070698_100020921 | |||
| 1373 | Ga0070698_100069006 | |||
| 1374 | Ga0070698_100183995 | |||
| 1375 | Ga0070698_101941342 | |||
| 1376 | Ga0070699_100185071 | |||
| 1377 | Ga0070684_100182637 | |||
| 1378 | Ga0070684_100293314 | |||
| 1379 | Ga0070684_100695765 | |||
| 1380 | Ga0070684_101450315 | |||
| 1381 | Ga0070697_100060437 | |||
| 1382 | Ga0070697_100911186 | |||
| 1383 | Ga0068853_100286912 | |||
| 1384 | Ga0068853_100912865 | |||
| 1385 | Ga0070672_100296536 | |||
| 1386 | Ga0070672_100320053 | |||
| 1387 | Ga0070695_101903205 | |||
| 1388 | Ga0070693_100205218 | |||
| 1389 | Ga0070693_101035927 | |||
| 1390 | Ga0070665_100971977 | |||
| 1391 | Ga0070665_101939604 | |||
| 1392 | Ga0070704_101787462 | |||
| 1393 | Ga0068855_100630693 | |||
| 1394 | Ga0070664_101452530 | |||
| 1395 | Ga0068857_100493991 | |||
| 1396 | Ga0068857_101275372 | |||
| 1397 | Ga0068854_101599800 | |||
| 1398 | Ga0068856_100569818 | |||
| 1399 | Ga0068856_102161422 | |||
| 1400 | Ga0070702_100156947 | |||
| 1401 | Ga0070702_100201224 | |||
| 1402 | Ga0070702_101367788 | |||
| 1403 | Ga0068852_100153229 | |||
| 1404 | Ga0068852_100395299 | |||
| 1405 | Ga0068852_100645393 | |||
| 1406 | Ga0068852_100666133 | |||
| 1407 | Ga0068852_100790617 | |||
| 1408 | Ga0068864_101609751 | |||
| 1409 | Ga0068864_102313612 | |||
| 1410 | Ga0068866_11125236 | |||
| 1411 | Ga0068861_100012521 | |||
| 1412 | Ga0068861_100282735 | |||
| 1413 | Ga0068861_100513312 | |||
| 1414 | Ga0068861_101792514 | |||
| 1415 | Ga0068861_101811761 | |||
| 1416 | Ga0068851_10415460 | |||
| 1417 | Ga0068870_10197818 | |||
| 1418 | Ga0068870_10606301 | |||
| 1419 | Ga0068863_100524148 | |||
| 1420 | Ga0068858_100146607 | |||
| 1421 | Ga0068858_100644044 | |||
| 1422 | Ga0068860_101350529 | |||
| 1423 | Ga0068862_100231939 | |||
| 1424 | Ga0081455_10060081 | |||
| 1425 | Ga0081455_10060828 | |||
| 1426 | Ga0070717_11239366 | |||
| 1427 | Ga0070717_11389491 | |||
| 1428 | Ga0075365_10020619 | |||
| 1429 | Ga0075365_10050267 | |||
| 1430 | Ga0075365_10059522 | |||
| 1431 | Ga0075365_10065852 | |||
| 1432 | Ga0075365_10075248 | |||
| 1433 | Ga0075365_10393035 | |||
| 1434 | Ga0075365_10930423 | |||
| 1435 | Ga0075368_10044391 | |||
| 1436 | Ga0075368_10079066 | |||
| 1437 | Ga0075368_10260889 | |||
| 1438 | Ga0075363_100015057 | |||
| 1439 | Ga0075363_100021527 | |||
| 1440 | Ga0075363_100229529 | |||
| 1441 | Ga0075363_100429537 | |||
| 1442 | Ga0075364_10087465 | |||
| 1443 | Ga0075364_10148049 | |||
| 1444 | Ga0075364_10647691 | |||
| 1445 | Ga0075432_10330601 | |||
| 1446 | Ga0075362_10451630 | |||
| 1447 | Ga0075367_10002048 | |||
| 1448 | Ga0075367_10025702 | |||
| 1449 | Ga0075367_10049721 | |||
| 1450 | Ga0075367_10225041 | |||
| 1451 | Ga0075367_10512255 | |||
| 1452 | Ga0075367_10744803 | |||
| 1453 | Ga0075366_10731231 | |||
| 1454 | Ga0075370_10014839 | |||
| 1455 | Ga0075370_10180306 | |||
| 1456 | Ga0068871_100317943 | |||
| 1457 | Ga0068871_100584129 | |||
| 1458 | Ga0068871_101375018 | |||
| 1459 | Ga0075428_100260935 | |||
| 1460 | Ga0075428_100646516 | |||
| 1461 | Ga0075428_101775237 | |||
| 1462 | Ga0075430_100502409 | |||
| 1463 | Ga0075431_100033157 | |||
| 1464 | Ga0075433_11545404 | |||
| 1465 | Ga0075434_100139910 | |||
| 1466 | Ga0075429_101567449 | |||
| 1467 | Ga0068865_100004169 | |||
| 1468 | Ga0068865_100297926 | |||
| 1469 | Ga0068865_100579678 | |||
| 1470 | Ga0068865_101617696 | |||
| 1471 | Ga0105244_10419995 | |||
| 1472 | Ga0111539_10151003 | |||
| 1473 | Ga0111539_10642356 | |||
| 1474 | Ga0111539_10940256 | |||
| 1475 | Ga0111539_11069108 | |||
| 1476 | Ga0105245_10249048 | |||
| 1477 | Ga0105245_10531644 | |||
| 1478 | Ga0105245_11425255 | |||
| 1479 | Ga0105245_12169899 | |||
| 1480 | Ga0105245_12398861 | |||
| 1481 | Ga0105245_13015450 | |||
| 1482 | Ga0105247_10524934 | |||
| 1483 | Ga0114129_10743879 | |||
| 1484 | Ga0114129_10759352 | |||
| 1485 | Ga0105243_10030084 | |||
| 1486 | Ga0105243_10521358 | |||
| 1487 | Ga0105243_12526635 | |||
| 1488 | Ga0105243_12982984 | |||
| 1489 | Ga0105242_10260974 | |||
| 1490 | Ga0105242_10743478 | |||
| 1491 | Ga0105242_11006070 | |||
| 1492 | Ga0105242_11192736 | |||
| 1493 | Ga0105242_13318279 | |||
| 1494 | Ga0105248_13335018 | |||
| 1495 | Ga0105237_10412363 | |||
| 1496 | Ga0105237_11209967 | |||
| 1497 | Ga0105238_10250200 | |||
| 1498 | Ga0105238_11549406 | |||
| 1499 | Ga0105249_10305871 | |||
| 1500 | Ga0105249_10329858 | |||
| 1501 | Ga0105249_10547608 | |||
| 1502 | Ga0105249_11183872 | |||
| 1503 | Ga0105239_10609564 | |||
| 1504 | Ga0105239_11119887 | |||
| 1505 | Ga0105239_11164300 | |||
| 1506 | Ga0105239_12066599 | |||
| 1507 | Ga0105246_10323084 | |||
| 1508 | Ga0105246_10479972 | |||
| 1509 | Ga0105246_10669010 | |||
| 1510 | Ga0105246_11155406 | |||
| 1511 | Ga0157325_1003207 | |||
| 1512 | Ga0157329_1012523 | |||
| 1513 | Ga0157319_1051975 | |||
| 1514 | Ga0157347_1060874 | |||
| 1515 | Ga0157338_1005833 | |||
| 1516 | Ga0154019_122374 | |||
| 1517 | Ga0157371_10585195 | |||
| 1518 | Ga0157371_10768523 | |||
| 1519 | Ga0157370_10628559 | |||
| 1520 | Ga0157370_11062013 | |||
| 1521 | Ga0157369_10894158 | |||
| 1522 | Ga0157369_12569122 | |||
| 1523 | Ga0157374_10273795 | |||
| 1524 | Ga0157374_11876874 | |||
| 1525 | Ga0157378_12540985 | |||
| 1526 | Ga0163162_11484571 | |||
| 1527 | Ga0163162_12807463 | |||
| 1528 | Ga0157372_10059287 | |||
| 1529 | Ga0157372_10172105 | |||
| 1530 | Ga0157372_10503764 | |||
| 1531 | Ga0157372_11027338 | |||
| 1532 | Ga0157372_11325455 | |||
| 1533 | Ga0157372_11600511 | |||
| 1534 | Ga0157372_12529321 | |||
| 1535 | Ga0157375_10117822 | |||
| 1536 | Ga0157375_10207102 | |||
| 1537 | Ga0157375_11302756 | |||
| 1538 | Ga0157375_11327476 | |||
| 1539 | Ga0157375_11441689 | |||
| 1540 | Ga0157375_11868773 | |||
| 1541 | Ga0157375_13114082 | |||
| 1542 | Ga0163163_10092876 | |||
| 1543 | Ga0163163_10184171 | |||
| 1544 | Ga0163163_11908767 | |||
| 1545 | Ga0157380_10390506 | |||
| 1546 | Ga0157380_11114894 | |||
| 1547 | Ga0182008_10010166 | |||
| 1548 | Ga0182008_10108171 | |||
| 1549 | Ga0182008_10156609 | |||
| 1550 | Ga0182008_10189306 | |||
| 1551 | Ga0182008_10268822 | |||
| 1552 | Ga0157377_11327930 | |||
| 1553 | Ga0157379_10959986 | |||
| 1554 | Ga0157379_11596800 | |||
| 1555 | Ga0157376_10220883 | |||
| 1556 | Ga0157376_10264018 | |||
| 1557 | Ga0157376_11286300 | |||
| 1558 | Ga0157376_11928956 | |||
| 1559 | Ga0182006_1011838 | |||
| 1560 | Ga0182006_1161826 | |||
| 1561 | Ga0182007_10000257 | |||
| 1562 | Ga0182005_1049585 | |||
| 1563 | Ga0183367_1006 | |||
| 1564 | Ga0163161_10036002 | |||
| 1565 | Ga0163161_10046953 | |||
| 1566 | Ga0163161_10886545 | |||
| 1567 | Ga0163161_11009518 | |||
| 1568 | Ga0163161_11415791 | |||
| 1569 | Ga0197907_10010884 | |||
| 1570 | Ga0197907_10100526 | |||
| 1571 | Ga0197907_10162151 | |||
| 1572 | Ga0197907_10423704 | |||
| 1573 | Ga0197907_10445121 | |||
| 1574 | Ga0197907_10580340 | |||
| 1575 | Ga0197907_10881272 | |||
| 1576 | Ga0197907_11016439 | |||
| 1577 | Ga0206356_10271762 | |||
| 1578 | Ga0206356_10339076 | |||
| 1579 | Ga0206356_10857575 | |||
| 1580 | Ga0206356_10936297 | |||
| 1581 | Ga0206356_11242763 | |||
| 1582 | Ga0206356_11403629 | |||
| 1583 | Ga0206356_11461478 | |||
| 1584 | Ga0206356_11471271 | |||
| 1585 | Ga0206356_11747499 | |||
| 1586 | Ga0206356_11764094 | |||
| 1587 | Ga0206349_1064364 | |||
| 1588 | Ga0206349_1321983 | |||
| 1589 | Ga0206349_1598135 | |||
| 1590 | Ga0206349_1620869 | |||
| 1591 | Ga0206349_1646901 | |||
| 1592 | Ga0206349_1726464 | |||
| 1593 | Ga0206349_1944080 | |||
| 1594 | Ga0206355_1004665 | |||
| 1595 | Ga0206355_1045632 | |||
| 1596 | Ga0206355_1081111 | |||
| 1597 | Ga0206355_1085433 | |||
| 1598 | Ga0206355_1165990 | |||
| 1599 | Ga0206355_1174712 | |||
| 1600 | Ga0206355_1185040 | |||
| 1601 | Ga0206355_1198663 | |||
| 1602 | Ga0206355_1203687 | |||
| 1603 | Ga0206355_1650912 | |||
| 1604 | Ga0206351_10026933 | |||
| 1605 | Ga0206351_10121054 | |||
| 1606 | Ga0206351_10470376 | |||
| 1607 | Ga0206351_10495102 | |||
| 1608 | Ga0206352_10057118 | |||
| 1609 | Ga0206352_10160481 | |||
| 1610 | Ga0206352_10319419 | |||
| 1611 | Ga0206352_10701397 | |||
| 1612 | Ga0206352_11027925 | |||
| 1613 | Ga0206350_10120654 | |||
| 1614 | Ga0206350_10126363 | |||
| 1615 | Ga0206350_10593967 | |||
| 1616 | Ga0206350_10633254 | |||
| 1617 | Ga0206350_10703881 | |||
| 1618 | Ga0206354_10117707 | |||
| 1619 | Ga0206354_10150451 | |||
| 1620 | Ga0206354_10188052 | |||
| 1621 | Ga0206354_10455429 | |||
| 1622 | Ga0206354_10514478 | |||
| 1623 | Ga0206354_10570582 | |||
| 1624 | Ga0206354_10685371 | |||
| 1625 | Ga0206354_10807495 | |||
| 1626 | Ga0206354_10823330 | |||
| 1627 | Ga0206354_10884654 | |||
| 1628 | Ga0206354_11030020 | |||
| 1629 | Ga0206354_11280122 | |||
| 1630 | Ga0206354_11465456 | |||
| 1631 | Ga0206354_11499587 | |||
| 1632 | Ga0206354_11571020 | |||
| 1633 | Ga0206353_10517557 | |||
| 1634 | Ga0206353_10665903 | |||
| 1635 | Ga0206353_10902826 | |||
| 1636 | Ga0206353_11170554 | |||
| 1637 | Ga0206353_11903580 | |||
| 1638 | Ga0154015_1405206 | |||
| 1639 | Ga0154015_1487719 | |||
| 1640 | Ga0154015_1567755 | |||
| 1641 | Ga0224712_10137350 | |||
| 1642 | Ga0224712_10182418 | |||
| 1643 | Ga0224712_10249337 | |||
| 1644 | Ga0224712_10339589 | |||
| 1645 | Ga0224712_10357098 | |||
| 1646 | Ga0207656_10467683 | |||
| 1647 | Ga0207682_10334667 | |||
| 1648 | Ga0207642_10262575 | |||
| 1649 | Ga0207642_10973417 | |||
| 1650 | Ga0207710_10223626 | |||
| 1651 | Ga0207688_10025596 | |||
| 1652 | Ga0207688_10311213 | |||
| 1653 | Ga0207688_10813352 | |||
| 1654 | Ga0207647_10489695 | |||
| 1655 | Ga0207647_10547097 | |||
| 1656 | Ga0207645_10797813 | |||
| 1657 | Ga0207643_10495500 | |||
| 1658 | Ga0207684_11153748 | |||
| 1659 | Ga0207654_10215980 | |||
| 1660 | Ga0207671_10074558 | |||
| 1661 | Ga0207662_10214551 | |||
| 1662 | Ga0207662_10369830 | |||
| 1663 | Ga0207657_10019609 | |||
| 1664 | Ga0207646_10272029 | |||
| 1665 | Ga0207694_10835467 | |||
| 1666 | Ga0207650_10559646 | |||
| 1667 | Ga0207650_11223413 | |||
| 1668 | Ga0207687_10037459 | |||
| 1669 | Ga0207687_11278374 | |||
| 1670 | Ga0207700_10390082 | |||
| 1671 | Ga0207644_11775000 | |||
| 1672 | Ga0207690_10012467 | |||
| 1673 | Ga0207690_10509924 | |||
| 1674 | Ga0207690_10576743 | |||
| 1675 | Ga0207690_11704268 | |||
| 1676 | Ga0207706_10503447 | |||
| 1677 | Ga0207706_10685248 | |||
| 1678 | Ga0207706_11493515 | |||
| 1679 | Ga0207686_10742607 | |||
| 1680 | Ga0207709_10045382 | |||
| 1681 | Ga0207709_10057256 | |||
| 1682 | Ga0207709_10279604 | |||
| 1683 | Ga0207670_10143275 | |||
| 1684 | Ga0207669_10814544 | |||
| 1685 | Ga0207704_10013539 | |||
| 1686 | Ga0207704_10890107 | |||
| 1687 | Ga0207691_10004838 | |||
| 1688 | Ga0207691_10585265 | |||
| 1689 | Ga0207661_10005390 | |||
| 1690 | Ga0207661_10134557 | |||
| 1691 | Ga0207661_10147369 | |||
| 1692 | Ga0207661_10152040 | |||
| 1693 | Ga0207661_10816864 | |||
| 1694 | Ga0207679_10911350 | |||
| 1695 | Ga0207679_12078591 | |||
| 1696 | Ga0207667_10365360 | |||
| 1697 | Ga0207712_10124511 | |||
| 1698 | Ga0207712_10226840 | |||
| 1699 | Ga0207712_10281262 | |||
| 1700 | Ga0207712_10491982 | |||
| 1701 | Ga0207712_10877630 | |||
| 1702 | Ga0207668_10242452 | |||
| 1703 | Ga0207668_11046612 | |||
| 1704 | Ga0207658_10688307 | |||
| 1705 | Ga0207658_11391538 | |||
| 1706 | Ga0207677_10534068 | |||
| 1707 | Ga0207677_11208663 | |||
| 1708 | Ga0207639_10362230 | |||
| 1709 | Ga0207639_10698485 | |||
| 1710 | Ga0207639_10803461 | |||
| 1711 | Ga0207639_11880463 | |||
| 1712 | Ga0207639_12160881 | |||
| 1713 | Ga0207678_10083431 | |||
| 1714 | Ga0207678_10337552 | |||
| 1715 | Ga0207678_10407772 | |||
| 1716 | Ga0207678_11061938 | |||
| 1717 | Ga0207708_10160824 | |||
| 1718 | Ga0207708_10433952 | |||
| 1719 | Ga0207702_11163541 | |||
| 1720 | Ga0207648_10648988 | |||
| 1721 | Ga0207648_10666245 | |||
| 1722 | Ga0207676_10637908 | |||
| 1723 | Ga0207676_11279424 | |||
| 1724 | Ga0207676_12342142 | |||
| 1725 | Ga0207674_10346220 | |||
| 1726 | Ga0207675_100005816 | |||
| 1727 | Ga0207675_100334858 | |||
| 1728 | Ga0207675_100574327 | |||
| 1729 | Ga0207675_100873753 | |||
| 1730 | Ga0207675_101478482 | |||
| 1731 | Ga0207683_10133865 | |||
| 1732 | Ga0207683_10262477 | |||
| 1733 | Ga0207683_10707569 | |||
| 1734 | Ga0207683_11115472 | |||
| 1735 | Ga0207698_10165197 | |||
| 1736 | Ga0207698_10595557 | |||
| 1737 | Ga0207698_10633966 | |||
| 1738 | Ga0207698_12399362 | |||
| 1739 | Ga0209371_1053740 | |||
| 1740 | Ga0209813_10048110 | |||
| 1741 | Ga0209813_10182124 | |||
| 1742 | Ga0209974_10188801 | |||
| 1743 | Ga0207428_10021772 | |||
| 1744 | Ga0207428_10812545 | |||
| 1745 | Ga0207428_11101326 | |||
| 1746 | Ga0268266_10724679 | |||
| 1747 | Ga0268266_10939358 | |||
| 1748 | Ga0268265_10077732 | |||
| 1749 | Ga0268265_10603979 | |||
| 1750 | Ga0268256_1033589 | |||
| 1751 | Ga0316177_1045098 | |||
| 1752 | Ga0314311_1173936 | |||
| 1753 | Ga0316178_1165051 | |||
| 1754 | Ga0316178_1179262 | |||
| 1755 | Ga0316181_1041643 | |||
| 1756 | Ga0316182_1346959 | |||
| 1757 | Ga0265767_113894 | |||
| 1758 | Ga0307408_100293410 | |||
| 1759 | Ga0307408_100376247 | |||
| 1760 | Ga0307408_100706609 | |||
| 1761 | Ga0307408_100964583 | |||
| 1762 | Ga0307408_102018325 | |||
| 1763 | Ga0307405_10340997 | |||
| 1764 | Ga0307405_11249360 | |||
| 1765 | Ga0307413_10449709 | |||
| 1766 | Ga0307413_10775499 | |||
| 1767 | Ga0307413_10848997 | |||
| 1768 | Ga0307413_11451754 | |||
| 1769 | Ga0307413_11621239 | |||
| 1770 | Ga0307413_12017882 | |||
| 1771 | Ga0307410_10009256 | |||
| 1772 | Ga0307410_10042196 | |||
| 1773 | Ga0307410_10781796 | |||
| 1774 | Ga0307410_11601633 | |||
| 1775 | Ga0326468_10039036 | |||
| 1776 | Ga0307406_10106069 | |||
| 1777 | Ga0307406_10224293 | |||
| 1778 | Ga0307407_10079818 | |||
| 1779 | Ga0307407_10377044 | |||
| 1780 | Ga0307407_10721502 | |||
| 1781 | Ga0307412_10012017 | |||
| 1782 | Ga0307412_10135001 | |||
| 1783 | Ga0307412_10232109 | |||
| 1784 | Ga0307412_10257585 | |||
| 1785 | Ga0307412_10615273 | |||
| 1786 | Ga0307412_11329918 | |||
| 1787 | Ga0307412_11724866 | |||
| 1788 | Ga0307409_100253434 | |||
| 1789 | Ga0307409_100323991 | |||
| 1790 | Ga0307409_100387487 | |||
| 1791 | Ga0307409_100462385 | |||
| 1792 | Ga0307409_100467320 | |||
| 1793 | Ga0307409_100531778 | |||
| 1794 | Ga0307409_100653745 | |||
| 1795 | Ga0307409_100738501 | |||
| 1796 | Ga0307409_100760817 | |||
| 1797 | Ga0307409_101266058 | |||
| 1798 | Ga0307416_100023381 | |||
| 1799 | Ga0307416_100051292 | |||
| 1800 | Ga0307416_100274016 | |||
| 1801 | Ga0307416_101119485 | |||
| 1802 | Ga0307416_101425278 | |||
| 1803 | Ga0307416_101833458 | |||
| 1804 | Ga0307416_102888590 | |||
| 1805 | Ga0307416_103412945 | |||
| 1806 | Ga0307414_10316611 | |||
| 1807 | Ga0307414_10365454 | |||
| 1808 | Ga0307414_10491897 | |||
| 1809 | Ga0307414_10970337 | |||
| 1810 | Ga0307414_11686443 | |||
| 1811 | Ga0307411_10206703 | |||
| 1812 | Ga0307411_10542227 | |||
| 1813 | Ga0307411_10546767 | |||
| 1814 | Ga0307411_11416603 | |||
| 1815 | Ga0307415_100025195 | |||
| 1816 | Ga0307415_100107212 | |||
| 1817 | Ga0307415_100139115 | |||
| 1818 | Ga0307415_100139360 | |||
| 1819 | Ga0307415_100391562 | |||
| 1820 | Ga0307415_102032379 | |||
| 1821 | Ga0373948_0159127 | |||
| 1822 | Ga0373959_0073073 | |||
| 1823 | Ga0373938_0058549 | |||
| 1824 | Ga0373932_0215705 | |||
| 1825 | Ga0373941_0088401 | |||
| 1826 | Ga0373961_0259592 | |||
| 1827 | Ga0373935_0420804 | |||
| 1828 | Ga0373927_0914518 | |||
| 1829 | Ga0395899_0080716 | |||
| 1830 | Ga0395900_0234898 | |||
| 1831 | Ga0395900_1006335 | |||
| 1832 | Ga0395898_0009689 | |||
| 1833 | Ga0395898_1091356 | |||
| 1834 | Ga0395905_0522861 | |||
| 1835 | Ga0436364_1007385 | |||
| 1836 | Ga0395901_0017303 | |||
| 1837 | Ga0395901_0171557 | |||
| 1838 | Ga0395901_0252907 | |||
| 1839 | Ga0395901_0903212 | |||
| 1840 | Ga0242420_089934 | |||
| 1841 | Ga0439438_036869 | |||
| 1842 | Ga0439461_0013684 | |||
| 1843 | Ga0439461_0049830 | |||
| 1844 | Ga0439466_0186302 | |||
| 1845 | Ga0439465_0212643 | |||
| 1846 | Ga0439465_0437567 | |||
| 1847 | Ga0451789_0153543 | |||
| 1848 | Ga0451791_1527912 | |||
| 1849 | Ga0451793_1573171 | |||
| 1850 | Ga0451797_0012973 | |||
| 1851 | Ga0451797_1419428 | |||
| 1852 | Ga0451795_1254865 | |||
| 1853 | Ga0451800_0914374 | |||
| 1854 | Ga0451800_1586772 | |||
| 1855 | Ga0451806_447833 | |||
| 1856 | Ga0451807_0661331 | |||
| 1857 | Ga0451835_0266313 | |||
| 1858 | Ga0451837_0825915 | |||
| 1859 | Ga0451837_1659218 | |||
| 1860 | Ga0451839_0489610 | |||
| 1861 | Ga0451841_0727502 | |||
| 1862 | Ga0451841_1160484 | |||
| 1863 | Ga0451851_0096184 | |||
| 1864 | Ga0451843_0926354 | |||
| 1865 | Ga0451843_1549413 | |||
| 1866 | Ga0451855_0881732 | |||
| 1867 | Ga0451853_0300070 | |||
| 1868 | Ga0451853_0980644 | |||
| 1869 | Ga0439431_0009865 | |||
| 1870 | Ga0439445_0043816 | |||
| 1871 | Ga0439452_126350 | |||
| 1872 | Ga0450920_060327 | |||
| 1873 | Ga0450907_004399 | |||
| 1874 | Ga0450907_049964 | |||
| 1875 | Ga0439446_0023771 | |||
| 1876 | Ga0450908_110271 | |||
| 1877 | Ga0439434_0007913 | |||
| 1878 | Ga0466969_0008402 | |||
| 1879 | Ga0466969_0020970 | |||
| 1880 | Ga0466969_0117977 | |||
| 1881 | Ga0466969_0480291 | |||
| 1882 | Ga0466972_0114456 | |||
| 1883 | Ga0466972_0193084 | |||
| 1884 | Ga0466965_0023797 | |||
| 1885 | Ga0466965_0024478 | |||
| 1886 | Ga0466965_0128522 | |||
| 1887 | Ga0466966_0001007 | |||
| 1888 | Ga0466966_0026977 | |||
| 1889 | Ga0466966_0243809 | |||
| 1890 | Ga0466966_0433986 | |||
| 1891 | Ga0466966_0450983 | |||
| 1892 | Ga0466966_0622853 | |||
| 1893 | Ga0466966_0805136 | |||
| 1894 | Ga0466961_0006966 | |||
| 1895 | Ga0466961_0025062 | |||
| 1896 | Ga0466961_0102651 | |||
| 1897 | Ga0466961_0205714 | |||
| 1898 | Ga0466961_0285234 | |||
| 1899 | Ga0466961_0349237 | |||
| 1900 | Ga0466961_0899765 | |||
| 1901 | Ga0466963_0023179 | |||
| 1902 | Ga0466963_0059063 | |||
| 1903 | Ga0466963_0130406 | |||
| 1904 | Ga0466963_0133911 | |||
| 1905 | Ga0466963_0228265 | |||
| 1906 | Ga0466963_1245814 | |||
| 1907 | Ga0466963_1313944 | |||
| 1908 | Ga0466964_0006469 | |||
| 1909 | Ga0466964_0049478 | |||
| 1910 | Ga0466964_0306581 | |||
| 1911 | Ga0466971_0002183 | |||
| 1912 | Ga0466971_0067901 | |||
| 1913 | Ga0466971_0258605 | |||
| 1914 | Ga0466968_0134486 | |||
| 1915 | Ga0466968_0276370 | |||
| 1916 | Ga0466968_0632702 | |||
| 1917 | Ga0466970_0013504 | |||
| 1918 | Ga0466970_0037477 | |||
| 1919 | Ga0466970_0276749 | |||
| 1920 | Ga0466970_0476848 | |||
| 1921 | Ga0466970_0601109 | |||
| 1922 | Ga0466957_0099778 | |||
| 1923 | Ga0466957_0259216 | |||
| 1924 | Ga0466957_0312129 | |||
| 1925 | Ga0466957_0445139 | |||
| 1926 | Ga0466957_0693173 | |||
| 1927 | Ga0466957_0977386 | |||
| 1928 | Ga0466960_0055686 | |||
| 1929 | Ga0466960_0084952 | |||
| 1930 | Ga0466960_0284489 | |||
| 1931 | Ga0466960_0352295 | |||
| 1932 | Ga0466960_0436731 | |||
| 1933 | Ga0466960_0566361 | |||
| 1934 | Ga0466959_0007811 | |||
| 1935 | Ga0466959_0037699 | |||
| 1936 | Ga0466959_0162764 | |||
| 1937 | Ga0466959_0264484 | |||
| 1938 | Ga0466959_0368784 | |||
| 1939 | Ga0466959_1028123 | |||
| 1940 | Ga0466958_0312071 | |||
| 1941 | Ga0466958_0430331 | |||
| 1942 | Ga0466958_0576461 | |||
| 1943 | Ga0466958_0989157 | |||
| 1944 | Ga0466967_0005383 | |||
| 1945 | Ga0466967_0023415 | |||
| 1946 | Ga0466967_0052461 | |||
| 1947 | Ga0466967_0094127 | |||
| 1948 | Ga0466967_0183131 | |||
| 1949 | Ga0466967_0273860 | |||
| 1950 | Ga0466967_0295415 | |||
| 1951 | Ga0466967_0378891 | |||
| 1952 | Ga0466967_0665346 | |||
| 1953 | Ga0466967_0943155 | |||
| 1954 | Ga0466967_1589754 | |||
| 1955 | Ga0495627_076005 | |||
| 1956 | Ga0495603_0038876 | |||
| 1957 | Ga0495603_0157309 | |||
| 1958 | Ga0495629_0286904 | |||
| 1959 | Ga0495629_0292279 | |||
| 1960 | Ga0495641_0053880 | |||
| 1961 | Ga0495641_0289754 | |||
| 1962 | Ga0495653_0164882 | |||
| 1963 | Ga0495653_0653209 | |||
| 1964 | Ga0495582_0174195 | |||
| 1965 | Ga0495582_0442341 | |||
| 1966 | Ga0495639_0296446 | |||
| 1967 | Ga0495664_0900376 | |||
| 1968 | Ga0495584_0040319 | |||
| 1969 | Ga0495585_0479363 | |||
| 1970 | Ga0495594_0892398 | |||
| 1971 | Ga0495608_0646085 | |||
| 1972 | Ga0495644_0163773 | |||
| 1973 | Ga0495663_0098378 | |||
| 1974 | Ga0495666_0290213 | |||
| 1975 | Ga0495642_0091206 | |||
| 1976 | Ga0495652_0477682 | |||
| 1977 | Ga0495652_0945846 | |||
| 1978 | Ga0495665_0286646 | |||
| 1979 | Ga0495640_0479897 | |||
| 1980 | Ga0495598_0345565 | |||
| 1981 | Ga0495609_0178380 | |||
| 1982 | Ga0495621_0193659 | |||
| 1983 | Ga0495667_0359825 | |||
| 1984 | Ga0495656_0123817 | |||
| 1985 | Ga0495668_0587995 | |||
| 1986 | Ga0495635_0074159 | |||
| 1987 | Ga0495661_0361097 | |||
| 1988 | Ga0495588_0021810 | |||
| 1989 | Ga0495588_0034853 | |||
| 1990 | Ga0495588_0387479 | |||
| 1991 | Ga0495657_0073773 | |||
| 1992 | Ga0495647_0206755 | |||
| 1993 | Ga0495658_0317101 | |||
| 1994 | Ga0495669_0460494 | |||
| 1995 | Ga0495613_0352271 | |||
| 1996 | Ga0495624_0222345 | |||
| 1997 | Ga0495600_0157529 | |||
| 1998 | Ga0495600_0310100 | |||
| 1999 | Ga0495581_0347457 | |||
| 2000 | Ga0495636_0211944 | |||
| 2001 | Ga0495636_0621869 | |||
| 2002 | Ga0495676_0019766 | |||
| 2003 | Ga0495676_0348583 | |||
| 2004 | Ga0495676_0368058 | |||
| 2005 | Ga0495680_0828233 | |||
| 2006 | Ga0495675_0074917 | |||
| 2007 | Ga0495677_0055559 | |||
| 2008 | Ga0495679_190768 | |||
| 2009 | Ga0495685_048654 | |||
| 2010 | Ga0495614_0643088 | |||
| 2011 | Ga0496100_0084513 | |||
| 2012 | Ga0496100_0206070 | |||
| 2013 | Ga0496100_0335971 | |||
| 2014 | Ga0496100_0503393 | |||
| 2015 | Ga0496101_0069312 | |||
| 2016 | Ga0496101_0315315 | |||
| 2017 | Ga0496102_0244649 | |||
| 2018 | Ga0496102_0280539 | |||
| 2019 | Ga0496102_0829722 | |||
| 2020 | Ga0496103_0025062 | |||
| 2021 | Ga0496103_0076288 | |||
| 2022 | Ga0496103_0123938 | |||
| 2023 | Ga0496103_1052964 | |||
| 2024 | Ga0496104_0286302 | |||
| 2025 | Ga0496104_0538679 | |||
| 2026 | Ga0496105_0004021 | |||
| 2027 | Ga0496105_0319417 | |||
| 2028 | Ga0496106_0011919 | |||
| 2029 | Ga0496106_0054636 | |||
| 2030 | Ga0496106_0534215 | |||
| 2031 | Ga0496106_0865133 | |||
| 2032 | Ga0496107_0004467 | |||
| 2033 | Ga0496107_0044951 | |||
| 2034 | Ga0496107_0243886 | |||
| 2035 | Ga0496107_0777957 | |||
| 2036 | Ga0496107_0975642 | |||
| 2037 | Ga0496108_0082588 | |||
| 2038 | Ga0496108_0174124 | |||
| 2039 | Ga0496108_0252756 | |||
| 2040 | Ga0496108_0302077 | |||
| 2041 | Ga0496108_0306622 | |||
| 2042 | Ga0496108_0610392 | |||
| 2043 | Ga0496108_0812070 | |||
| 2044 | Ga0496108_1262806 | |||
| 2045 | Ga0496109_0012536 | |||
| 2046 | Ga0496109_0039506 | |||
| 2047 | Ga0496109_0049936 | |||
| 2048 | Ga0496109_0074843 | |||
| 2049 | Ga0496109_0188724 | |||
| 2050 | Ga0496109_0328612 | |||
| 2051 | Ga0496109_0442065 | |||
| 2052 | Ga0496109_0675222 | |||
| 2053 | Ga0496109_1279193 | |||
| 2054 | Ga0496110_0072144 | |||
| 2055 | Ga0496110_0477572 | |||
| 2056 | Ga0496110_0543247 | |||
| 2057 | Ga0496110_0566733 | |||
| 2058 | Ga0496110_0826452 | |||
| 2059 | Ga0496110_0887940 | |||
| 2060 | Ga0496110_1318934 | |||
| 2061 | Ga0496111_0082292 | |||
| 2062 | Ga0496111_0098485 | |||
| 2063 | Ga0496111_0816564 | |||
| 2064 | Ga0496112_0327452 | |||
| 2065 | Ga0496112_0956987 | |||
| 2066 | Ga0496113_0134702 | |||
| 2067 | Ga0496113_0553532 | |||
| 2068 | Ga0496113_0934413 | |||
| 2069 | Ga0496113_1302893 | |||
| 2070 | Ga0496113_1555388 | |||
| 2071 | Ga0496114_0001671 | |||
| 2072 | Ga0496114_0006007 | |||
| 2073 | Ga0496114_0068005 | |||
| 2074 | Ga0496114_0076549 | |||
| 2075 | Ga0496114_0443641 | |||
| 2076 | Ga0496114_0815233 | |||
| 2077 | Ga0496115_0001227 | |||
| 2078 | Ga0496115_0297740 | |||
| 2079 | Ga0496124_0776053 | |||
| 2080 | Ga0501306_001808 | |||
| 2081 | Ga0501306_013656 | |||
| 2082 | Ga0501306_016836 | |||
| 2083 | Ga0501306_017358 | |||
| 2084 | Ga0501306_020215 | |||
| 2085 | Ga0501306_029031 | |||
| 2086 | Ga0501306_035807 | |||
| 2087 | Ga0501306_062970 | |||
| 2088 | Ga0501308_021624 | |||
| 2089 | Ga0501308_021633 | |||
| 2090 | Ga0501308_023877 | |||
| 2091 | Ga0501308_031288 | |||
| 2092 | Ga0501308_039849 | |||
| 2093 | Ga0501308_040120 | |||
| 2094 | Ga0501308_056385 | |||
| 2095 | Ga0501309_003424 | |||
| 2096 | Ga0501309_015570 | |||
| 2097 | Ga0501309_029953 | |||
| 2098 | Ga0501309_032265 | |||
| 2099 | Ga0501309_050103 | |||
| 2100 | Ga0501309_076735 | |||
| 2101 | Ga0501309_083299 | |||
| 2102 | Ga0501310_001945 | |||
| 2103 | Ga0501310_011600 | |||
| 2104 | Ga0501310_013209 | |||
| 2105 | Ga0501310_030076 | |||
| 2106 | Ga0501310_035015 | |||
| 2107 | Ga0501310_050061 | |||
| 2108 | Ga0501304_007690 | |||
| 2109 | Ga0501304_007781 | |||
| 2110 | Ga0501304_010640 | |||
| 2111 | Ga0501304_018671 | |||
| 2112 | Ga0501305_026071 | |||
| 2113 | Ga0501305_031116 | |||
| 2114 | Ga0501305_041709 | |||
| 2115 | Ga0501305_042298 | |||
| 2116 | Ga0501305_046151 | |||
| 2117 | Ga0501305_046663 | |||
| 2118 | Ga0501305_065182 | |||
| 2119 | Ga0501305_067071 | |||
| 2120 | Ga0501307_023930 | |||
| 2121 | Ga0501307_030595 | |||
| 2122 | Ga0501307_033842 | |||
| 2123 | Ga0501307_075933 | |||
| 2124 | Ga0501307_092011 | |||
| 2125 | Ga0501307_095332 | |||
| 2126 | Ga0501311_008511 | |||
| 2127 | Ga0501311_016036 | |||
| 2128 | Ga0501311_022794 | |||
| 2129 | Ga0501311_024651 | |||
| 2130 | Ga0501311_026435 | |||
| 2131 | Ga0501311_032471 | |||
| 2132 | Ga0501311_037685 | |||
| 2133 | Ga0501311_041851 | |||
| 2134 | Ga0501311_042658 | |||
| 2135 | Ga0501311_047757 | |||
| 2136 | Ga0501311_064427 | |||
| 2137 | Ga0501311_080307 | |||
| 2138 | Ga0501311_092970 | |||
| 2139 | Ga0501312_003439 | |||
| 2140 | Ga0501312_013348 | |||
| 2141 | Ga0501312_026366 | |||
| 2142 | Ga0501312_066940 | |||
| 2143 | Ga0501312_072770 | |||
| 2144 | Ga0501312_116380 | |||
| 2145 | Ga0501313_011819 | |||
| 2146 | Ga0501313_025678 | |||
| 2147 | Ga0501313_034760 | |||
| 2148 | Ga0501313_045363 | |||
| 2149 | Ga0501314_012398 | |||
| 2150 | Ga0501315_014882 | |||
| 2151 | Ga0501315_032100 | |||
| 2152 | Ga0501315_033949 | |||
| 2153 | Ga0501315_047004 | |||
| 2154 | Ga0501315_053230 | |||
| 2155 | Ga0501316_001753 | |||
| 2156 | Ga0501316_006908 | |||
| 2157 | Ga0501316_009901 | |||
| 2158 | Ga0501316_023202 | |||
| 2159 | Ga0501316_024413 | |||
| 2160 | Ga0501316_029644 | |||
| 2161 | Ga0501316_069325 | |||
| 2162 | Ga0501316_074464 | |||
| 2163 | Ga0501317_006833 | |||
| 2164 | Ga0501317_010826 | |||
| 2165 | Ga0501317_013603 | |||
| 2166 | Ga0501317_019297 | |||
| 2167 | Ga0501317_019458 | |||
| 2168 | Ga0501317_022503 | |||
| 2169 | Ga0501317_036202 | |||
| 2170 | Ga0501317_052370 | |||
| 2171 | Ga0501317_057948 | |||
| 2172 | Ga0501317_066654 | |||
| 2173 | Ga0501317_075081 | |||
| 2174 | Ga0501317_104197 | |||
| 2175 | Ga0501317_112009 | |||
| 2176 | Ga0501318_000807 | |||
| 2177 | Ga0501318_001117 | |||
| 2178 | Ga0501318_002464 | |||
| 2179 | Ga0501318_007220 | |||
| 2180 | Ga0501318_011664 | |||
| 2181 | Ga0501318_016507 | |||
| 2182 | Ga0501318_019180 | |||
| 2183 | Ga0501318_026279 | |||
| 2184 | Ga0501318_034608 | |||
| 2185 | Ga0501318_048217 | |||
| 2186 | Ga0501318_089044 | |||
| 2187 | Ga0501319_001340 | |||
| 2188 | Ga0501319_004671 | |||
| 2189 | Ga0501319_006144 | |||
| 2190 | Ga0501319_029295 | |||
| 2191 | Ga0501320_003000 | |||
| 2192 | Ga0501320_009483 | |||
| 2193 | Ga0501320_013645 | |||
| 2194 | Ga0501320_014275 | |||
| 2195 | Ga0501320_022258 | |||
| 2196 | Ga0501320_033960 | |||
| 2197 | Ga0501321_001598 | |||
| 2198 | Ga0501321_003025 | |||
| 2199 | Ga0501321_014152 | |||
| 2200 | Ga0501321_015626 | |||
| 2201 | Ga0501321_023878 | |||
| 2202 | Ga0501321_025363 | |||
| 2203 | Ga0501321_028308 | |||
| 2204 | Ga0501321_037521 | |||
| 2205 | Ga0501321_039034 | |||
| 2206 | Ga0501321_040241 | |||
| 2207 | Ga0501321_061083 | |||
| 2208 | Ga0501321_062986 | |||
| 2209 | Ga0501322_017659 | |||
| 2210 | Ga0501323_000424 | |||
| 2211 | Ga0501323_000806 | |||
| 2212 | Ga0501323_006932 | |||
| 2213 | Ga0501323_023204 | |||
| 2214 | Ga0501323_033560 | |||
| 2215 | Ga0501323_037637 | |||
| 2216 | Ga0501323_060551 | |||
| 2217 | Ga0501323_064690 | |||
| 2218 | Ga0501323_095189 | |||
| 2219 | Ga0501324_006356 | |||
| 2220 | Ga0501324_007590 | |||
| 2221 | Ga0501324_010250 | |||
| 2222 | Ga0501324_012919 | |||
| 2223 | Ga0501324_016833 | |||
| 2224 | Ga0501324_021918 | |||
| 2225 | Ga0501324_033373 | |||
| 2226 | Ga0501324_035899 | |||
| 2227 | Ga0501325_003146 | |||
| 2228 | Ga0501325_009286 | |||
| 2229 | Ga0501325_019142 | |||
| 2230 | Ga0501325_023722 | |||
| 2231 | Ga0501329_01449 | |||
| 2232 | Ga0501333_004646 | |||
| 2233 | Ga0501333_006364 | |||
| 2234 | Ga0501338_06517 | |||
| 2235 | Ga0501340_007576 | |||
| 2236 | Ga0501031_0062259 | |||
| 2237 | Ga0501031_0155910 | |||
| 2238 | Ga0501032_0017464 | |||
| 2239 | Ga0501032_0159374 | |||
| 2240 | Ga0501032_0526640 | |||
| 2241 | Ga0501032_0682780 | |||
| 2242 | Ga0501033_0107440 | |||
| 2243 | Ga0501034_0011971 | |||
| 2244 | Ga0501034_0159328 | |||
| 2245 | Ga0501036_0037115 | |||
| 2246 | Ga0501036_0041412 | |||
| 2247 | Ga0501036_0290693 | |||
| 2248 | Ga0501036_0675603 | |||
| 2249 | Ga0501036_1356736 | |||
| 2250 | Ga0501036_1483303 | |||
| 2251 | Ga0501037_0009850 | |||
| 2252 | Ga0501038_0008979 | |||
| 2253 | Ga0501038_0009072 | |||
| 2254 | Ga0501038_0010481 | |||
| 2255 | Ga0501038_0352243 | |||
| 2256 | Ga0501039_0006825 | |||
| 2257 | Ga0501039_0086264 | |||
| 2258 | Ga0501039_0254242 | |||
| 2259 | Ga0501039_0506053 | |||
| 2260 | Ga0501039_0839420 | |||
| 2261 | Ga0501040_0005127 | |||
| 2262 | Ga0501040_0061519 | |||
| 2263 | Ga0501040_0329601 | |||
| 2264 | Ga0501040_0512914 | |||
| 2265 | Ga0501041_0070654 | |||
| 2266 | Ga0501041_0284266 | |||
| 2267 | Ga0501041_0284827 | |||
| 2268 | Ga0501041_0377349 | |||
| 2269 | Ga0501041_0891188 | |||
| 2270 | Ga0501042_0024296 | |||
| 2271 | Ga0501042_0034695 | |||
| 2272 | Ga0501042_0040727 | |||
| 2273 | Ga0501042_0785296 | |||
| 2274 | Ga0501042_0785463 | |||
| 2275 | Ga0501042_1035756 | |||
| 2276 | Ga0501043_0039304 | |||
| 2277 | Ga0501043_0086168 | |||
| 2278 | Ga0501043_0153971 | |||
| 2279 | Ga0501043_0297510 | |||
| 2280 | Ga0501043_0999871 | |||
| 2281 | Ga0501046_0000184 | |||
| 2282 | Ga0501046_0014510 | |||
| 2283 | Ga0501046_0036642 | |||
| 2284 | Ga0501046_0102430 | |||
| 2285 | Ga0501047_0030501 | |||
| 2286 | Ga0501047_0091108 | |||
| 2287 | Ga0501048_0009925 | |||
| 2288 | Ga0501048_0068780 | |||
| 2289 | Ga0501048_0656887 | |||
| 2290 | Ga0501067_0038315 | |||
| 2291 | Ga0501067_0098556 | |||
| 2292 | Ga0501067_0230796 | |||
| 2293 | Ga0501067_0492870 | |||
| 2294 | Ga0501067_0794604 | |||
| 2295 | Ga0501068_0088194 | |||
| 2296 | Ga0501068_0194588 | |||
| 2297 | Ga0501068_0226659 | |||
| 2298 | Ga0501068_0278538 | |||
| 2299 | Ga0501069_0023811 | |||
| 2300 | Ga0501069_0076909 | |||
| 2301 | Ga0501069_0580461 | |||
| 2302 | Ga0501070_0014863 | |||
| 2303 | Ga0501070_0157098 | |||
| 2304 | Ga0501070_0157879 | |||
| 2305 | Ga0501070_0171686 | |||
| 2306 | Ga0501070_1076811 | |||
| 2307 | Ga0501070_1344402 | |||
| 2308 | Ga0501071_0055572 | |||
| 2309 | Ga0501071_0075525 | |||
| 2310 | Ga0501071_0988430 | |||
| 2311 | Ga0501071_1122033 | |||
| 2312 | Ga0501071_1166474 | |||
| 2313 | Ga0501072_0248284 | |||
| 2314 | Ga0501072_0332595 | |||
| 2315 | Ga0501072_1174049 | |||
| 2316 | Ga0501072_1450056 | |||
| 2317 | Ga0501073_0076730 | |||
| 2318 | Ga0501073_0287670 | |||
| 2319 | Ga0501073_0962914 | |||
| 2320 | Ga0501074_0013659 | |||
| 2321 | Ga0501074_0239633 | |||
| 2322 | Ga0501074_0439599 | |||
| 2323 | Ga0501074_0510938 | |||
| 2324 | Ga0501074_1111784 | |||
| 2325 | Ga0501075_0068644 | |||
| 2326 | Ga0501076_1174490 | |||
| 2327 | Ga0501076_1254812 | |||
| 2328 | Ga0501077_0188376 | |||
| 2329 | Ga0501202_066601 | |||
| 2330 | Ga0501208_153501 | |||
| 2331 | Ga0501217_118011 | |||
| 2332 | Ga0501224_047026 | |||
| 2333 | Ga0501243_046446 | |||
| 2334 | Ga0501243_077072 | |||
| 2335 | Ga0501257_124927 | |||
| 2336 | Ga0501257_260959 | |||
| 2337 | Ga0501221_074062 | |||
| 2338 | Ga0501225_0200766 | |||
| 2339 | Ga0501080_0164141 | |||
| 2340 | Ga0501080_0361873 | |||
| 2341 | Ga0501080_1688910 | |||
| 2342 | Ga0501081_0067962 | |||
| 2343 | Ga0501081_0414458 | |||
| 2344 | Ga0501081_0481541 | |||
| 2345 | Ga0501035_0007374 | |||
| 2346 | Ga0501035_0046149 | |||
| 2347 | Ga0501044_0010047 | |||
| 2348 | Ga0501044_0070278 | |||
| 2349 | Ga0501045_0000777 | |||
| 2350 | Ga0501045_0114781 | |||
| 2351 | Ga0501045_0248232 | |||
| 2352 | Ga0501045_0249796 | |||
| 2353 | Ga0501045_0489383 | |||
| 2354 | Ga0501212_083475 | |||
| 2355 | nmdc:mga03n38_183427_c1 | |||
| 2356 | nmdc:mga03n38_28651_c1 | |||
| 2357 | nmdc:mga03n38_59143_c1 | |||
| 2358 | nmdc:mga03n38_772347_c1 | |||
| 2359 | nmdc:mga03n38_787875_c1 | |||
| 2360 | nmdc:mga00v17_14491_c1 | |||
| 2361 | nmdc:mga00v17_21161_c1 | |||
| 2362 | nmdc:mga00v17_217682_c1 | |||
| 2363 | nmdc:mga0yw44_123191_c1 | |||
| 2364 | nmdc:mga0yw44_204303_c1 | |||
| 2365 | nmdc:mga0yw44_22344_c1 | |||
| 2366 | nmdc:mga0yw44_337032_c1 | |||
| 2367 | nmdc:mga0yw44_353012_c1 | |||
| 2368 | nmdc:mga0yw44_357158_c1 | |||
| 2369 | nmdc:mga0yw44_367219_c1 | |||
| 2370 | nmdc:mga0yw44_374504_c1 | |||
| 2371 | nmdc:mga0yw44_381190_c1 | |||
| 2372 | nmdc:mga0yw44_45943_c1 | |||
| 2373 | nmdc:mga0yw44_551358_c1 | |||
| 2374 | nmdc:mga0yw44_59761_c1 | |||
| 2375 | nmdc:mga0yw44_80998_c1 | |||
| 2376 | nmdc:mga06z11_144871_c1 | |||
| 2377 | nmdc:mga06z11_1605_c1 | |||
| 2378 | nmdc:mga06z11_178624_c1 | |||
| 2379 | nmdc:mga06z11_209757_c1 | |||
| 2380 | nmdc:mga06z11_924000_c1 | |||
| 2381 | nmdc:mga04h51_226825_c1 | |||
| 2382 | nmdc:mga04h51_303980_c1 | |||
| 2383 | nmdc:mga04h51_74600_c1 | |||
| 2384 | nmdc:mga07m45_209218_c1 | |||
| 2385 | nmdc:mga05p37_712347_c1 | |||
| 2386 | nmdc:mga0qj67_1320512_c1 | |||
| 2387 | nmdc:mga06r32_280_c4 | |||
| 2388 | nmdc:mga08y16_2141246_c1 | |||
| 2389 | nmdc:mga08y16_602382_c1 | |||
| 2390 | nmdc:mga08y16_904192_c1 | |||
| 2391 | nmdc:mga08y16_99916_c1 | |||
| 2392 | nmdc:mga0n895_1023800_c1 | |||
| 2393 | nmdc:mga0a205_1473818_c1 | |||
| 2394 | Ga0495601_0530620 | |||
| 2395 | Ga0495612_0176920 | |||
| 2396 | Ga0495612_0316891 | |||
| 2397 | Ga0495655_0052079 | |||
| 2398 | Ga0495595_0207570 | |||
| 2399 | Ga0495619_0026939 | |||
| 2400 | Ga0495619_0128753 | |||
| 2401 | Ga0495619_0463856 | |||
| 2402 | Ga0495619_0766655 | |||
| 2403 | Ga0500556_0000417 | |||
| 2404 | Ga0500593_001815 | |||
| 2405 | Ga0500655_020453 | |||
| 2406 | Ga0500573_0024690 | |||
| 2407 | Ga0500573_0442141 | |||
| 2408 | Ga0500604_0194012 | |||
| 2409 | Ga0501084_0003572 | |||
| 2410 | Ga0501084_1800560 | |||
| 2411 | Ga0590075_040531 | |||
| 2412 | Ga0587084_004447 | |||
| 2413 | Ga0587066_111690 | |||
| 2414 | Ga0587070_082332 | |||
| 2415 | Ga0587070_092236 | |||
| 2416 | Ga0587073_0233261 | |||
| 2417 | Ga0587080_037179 | |||
| 2418 | Ga0587082_045183 | |||
| 2419 | Ga0587088_059670 | |||
| 2420 | Ga0587088_069115 | |||
| 2421 | Ga0587089_058620 | |||
| 2422 | Ga0587090_040745 | |||
| 2423 | Ga0587090_055418 | |||
| 2424 | Ga0587090_061702 | |||
| 2425 | Ga0587090_102896 | |||
| 2426 | Ga0587091_120095 | |||
| 2427 | Ga0587092_027209 | |||
| 2428 | Ga0587092_057562 | |||
| 2429 | Ga0587098_019778 | |||
| 2430 | Ga0587106_007298 | |||
| 2431 | Ga0587106_035889 | |||
| 2432 | Ga0587106_052337 | |||
| 2433 | Ga0587121_05808 | |||
| 2434 | Ga0587129_009787 | |||
| 2435 | Ga0587099_013537 | |||
| 2436 | Ga0587101_022425 | |||
| 2437 | Ga0587115_041527 | |||
| 2438 | Ga0587115_061526 | |||
| 2439 | Ga0587128_039404 | |||
| 2440 | Ga0587128_050313 | |||
| 2441 | Ga0587062_045267 | |||
| 2442 | Ga0587068_018484 | |||
| 2443 | Ga0587068_091541 | |||
| 2444 | Ga0587069_044260 | |||
| 2445 | Ga0587075_034598 | |||
| 2446 | Ga0587075_043431 | |||
| 2447 | Ga0587075_049328 | |||
| 2448 | Ga0587078_042830 | |||
| 2449 | Ga0587079_069729 | |||
| 2450 | Ga0587102_045529 | |||
| 2451 | Ga0587105_004205 | |||
| 2452 | Ga0587114_024577 | |||
| 2453 | Ga0587114_045626 | |||
| 2454 | Ga0587118_14263 | |||
| 2455 | Ga0587119_014442 | |||
| 2456 | Ga0587071_068556 | |||
| 2457 | Ga0587071_082121 | |||
| 2458 | Ga0587111_0045587 | |||
| 2459 | Ga0587111_0098702 | |||
| 2460 | Ga0587111_0227970 | |||
| 2461 | Ga0501082_0007916 | |||
| 2462 | Ga0501082_0724991 | |||
| 2463 | Ga0501082_1447759 | |||
| 2464 | Ga0466962_0002275 | |||
| 2465 | Ga0466962_0038742 | |||
| 2466 | Ga0466962_0130887 | |||
| 2467 | Ga0466962_0147740 | |||
| 2468 | Ga0530510_0165889 | |||
| 2469 | Ga0530510_0172128 | |||
| 2470 | Ga0530510_1127169 | |||
| 2471 | 2585301890 | |||
| 2472 | 2585304852 | |||
| 2473 | 2616899875 | |||
| 2474 | 2643828134 | |||
| 2475 | 2643897863 | |||
| 2476 | 2644018699 | |||
| 2477 | 2644090068 | |||
| 2478 | 2644179834 | |||
| 2479 | 2644183216 | |||
| 2480 | 2644319913 | |||
| 2481 | 2644385381 | |||
| 2482 | 2644409008 | |||
| 2483 | 2644436358 | |||
| 2484 | 2644531223 | |||
| 2485 | 2729905770 | |||
| 2486 | 2785344289 | |||
| 2487 | 2785368568 | |||
| 2488 | 2786669657 | |||
| 2489 | 2793976154 | |||
| 2490 | 2808841256 | |||
| 2491 | 2819742873 | |||
| 2492 | 2855387467 | |||
| 2493 | 2857484884 | |||
| 2494 | 2862184904 | |||
| 2495 | 2862288159 | |||
| 2496 | 2867431117 | |||
| 2497 | 2867479659 | |||
| 2498 | 2875393779 | |||
| 2499 | 2877681968 | |||
| 2500 | 2912720930 | |||
| 2501 | 2919468657 | |||
| 2502 | 2946050878 | |||
| 2503 | 2954676082 | |||
| 2504 | 2954688084 | |||
| 2505 | 2954717034 | |||
| 2506 | 2954726982 | |||
| 2507 | 2954734799 | |||
| 2508 | 2954745905 | |||
| 2509 | 2954753685 | |||
| 2510 | 2954764877 | |||
| 2511 | 2990094188 | |||
| 2512 | 2995471105 | |||
| 2513 | 2997456539 | |||
| 2514 | 8033690549 | |||
| 2515 | 8047898955 | |||
| 2516 | 8048127682 | |||
| 2517 | 8048359964 | |||
| 2518 | 8048375913 | |||
| 2519 | 8048382294 | |||
| 2520 | 8048408398 | |||
| 2521 | 8054612376 | |||
| 2522 | 8056453597 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8c94-assembly1.cif.gz_W | cryo-em captures early ribosome assembly in action | 0.9114 | 20 | 89 |
| 4ce4-assembly1.cif.gz_0 | 39s large subunit of the porcine mitochondrial ribosome | 0.91 | 19 | 89 |
| 8c8z-assembly1.cif.gz_W | cryo-em captures early ribosome assembly in action | 0.8973 | 20 | 89 |
| 7pkt-assembly1.cif.gz_u | large subunit of the chlamydomonas reinhardtii mitoribosome | 0.8911 | 23 | 92 |
| 1v8q-assembly1.cif.gz_A | crystal structure of ribosomal protein l27 from thermus thermophilus hb8 | 0.8857 | 20 | 89 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1v8qA00 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.8857 | 20 | 89 | 2.40.50.100 |
| af_Q9XXD2_5_60_2.40.50.100 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.8444 | 29 | 89 | 2.40.50.100 |
| 1v8qA00 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.8368 | 20 | 89 | 2.40.50.100 |
| af_Q9XXD2_5_60_2.40.50.100 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.8314 | 29 | 89 | 2.40.50.100 |
| af_Q9Y3B2_6_56_2.40.50.100 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.8071 | 29 | 89 | 2.40.50.100 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-V6UNU0-F1-model_v4 | deleted | 0.9386 | 24 | 89 |
|
| AF-A0A7W7FST9-F1-model_v4 | Large ribosomal subunit protein bL27 (50S ribosomal protein L27) | 0.9165 | 24 | 93 |
GO:0003735
GO:0006412 GO:0022625 |
| AF-A0A2D3WHH1-F1-model_v4 | Uncharacterized protein | 0.9104 | 23 | 89 |
GO:0003735
GO:0005840 GO:0006412 |
| AF-A0A1V5VQS4-F1-model_v4 | Large ribosomal subunit protein bL27 (50S ribosomal protein L27) | 0.9099 | 19 | 89 |
GO:0003735
GO:0005840 GO:0006412 GO:1990904 |
| AF-A0A2S6T0A6-F1-model_v4 | Large ribosomal subunit protein bL27 (50S ribosomal protein L27) | 0.9086 | 20 | 91 |
GO:0003735
GO:0005840 GO:0006412 GO:1990904 |