F492152

General Info

Members Datasets Scaffolds Average Seq Length
1247 646 1095 203

Family's Representative Sequence

Representative Sequence 3300037471|Ga0395905_0207330|Ga0395905_0207330_483_1226
Length 247
Sequence LVAALKICSFERIDIHSSRQAAVIRTLQTRYTLVLSCILNQIEPMSRVRTRPTRDDTREKLYEAAARVFEEQGIGGASIEAIAAAAGFTRGAFYSNFKSKDELIIAMLEDHVEQSIRRNLDLLARHRNPAEFLDALRTMDRSRQDPLGRSPLLHMEMILFVARAEKRRPELAKRLRARRKLIADIVETTARHSRRNVVLNPAWTGAILLAMEDGFRLHRLIDPETTPADSFLRAIGDLQKAIGISST

Samples

Sample ID Description Type Environment
1 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
2 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
3 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
4 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
5 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
6 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
7 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
8 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
9 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
10 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
11 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
12 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
13 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
14 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
15 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
16 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
17 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
18 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
19 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
20 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
21 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
22 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
23 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
24 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
25 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
26 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
27 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
28 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
29 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
30 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
31 2791355199
32 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
33 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
34 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
35 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
36 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
37 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
38 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
39 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
40 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
41 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
42 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
43 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
44 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
45 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
46 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
47 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
48 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
49 2904699407
50 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
51 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
52 2906610324
53 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
54 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
55 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
56 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
57 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
58 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
59 2922368715
60 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
61 2922425934
62 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
63 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
64 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
65 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
66 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
67 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
68 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
69 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
70 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
71 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
72 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
73 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
74 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
75 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
76 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
77 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
78 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
79 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
80 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
81 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
82 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
83 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
84 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
85 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
86 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
87 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
88 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
89 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
90 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
91 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
92 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
93 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
94 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
95 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
96 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
97 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
98 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
99 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
100 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
101 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
102 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
103 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
104 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
105 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
106 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
107 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
108 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
109 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
110 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
111 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
112 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
113 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
114 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
115 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
116 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
117 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
118 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
119 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
120 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
121 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
122 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
123 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
124 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
125 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
126 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
127 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
128 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
129 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
130 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
131 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
132 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
133 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
134 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
135 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
136 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
137 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
138 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
139 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
140 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
141 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
142 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
143 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
144 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
145 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
146 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
147 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
148 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
149 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
150 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
151 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
152 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
153 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
154 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
155 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
156 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
157 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
158 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
159 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
160 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
161 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
162 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
163 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
164 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
165 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
166 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
167 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
168 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
169 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
170 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
171 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
172 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
173 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
174 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
175 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
176 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
177 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
178 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
179 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
180 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
181 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
182 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
183 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
184 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
185 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
186 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
187 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
188 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
189 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
190 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
191 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
192 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
193 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
194 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
195 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
196 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
197 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
198 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
199 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
200 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
201 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
202 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
203 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
204 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
205 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
206 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
207 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
208 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
209 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
210 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
211 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
212 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
213 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
214 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
215 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
216 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
217 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
218 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
219 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
220 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
221 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
222 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
223 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
224 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
225 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
226 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
227 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
228 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
229 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
230 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
231 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
232 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
233 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
234 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
235 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
236 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
237 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
238 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
239 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
240 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
241 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
242 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
243 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
244 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
245 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
246 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
247 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
248 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
249 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
250 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
251 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
252 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
253 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
254 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
255 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
256 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
257 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
258 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
259 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
260 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
261 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
262 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
263 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
264 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
265 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
266 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
267 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
268 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
269 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
270 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
271 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
272 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
273 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
274 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
275 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
276 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
277 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
278 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
279 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
280 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
281 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
282 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
283 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
284 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
285 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
286 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
287 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
288 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
289 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
290 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
291 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
292 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
293 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
294 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
295 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
296 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
297 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
298 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
299 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
300 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
301 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
302 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
303 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
304 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
305 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
306 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
307 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
308 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
309 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
310 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
311 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
312 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
313 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
314 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
315 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
316 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
317 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
318 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
319 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
320 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
321 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
322 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
323 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
324 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
325 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
326 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
327 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
328 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
329 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
330 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
331 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
332 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
333 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
334 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
335 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
336 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
337 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
338 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
339 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
340 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
341 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
342 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
343 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
344 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
345 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
346 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
347 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
348 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
349 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
350 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
351 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
352 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
353 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
354 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
355 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
356 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
357 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
358 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
359 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
360 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
361 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
362 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
363 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
364 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
365 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
366 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
367 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
368 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
369 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
370 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
371 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
372 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
373 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
374 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
375 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
376 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
377 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
378 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
379 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
380 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
381 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
382 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
383 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
384 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
385 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
386 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
387 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
388 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
389 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
390 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
391 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
392 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
393 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
394 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
395 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
396 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
397 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
398 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
399 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
400 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
401 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
402 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
403 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
404 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
405 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
406 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
407 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
408 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
409 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
410 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
411 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
412 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
413 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
414 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
415 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
416 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
417 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
418 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
419 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
420 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
421 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
422 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
423 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
424 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
425 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
426 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
427 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
428 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
429 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
430 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
431 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
432 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
433 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
434 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
435 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
436 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
437 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
438 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
439 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
440 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
441 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
442 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
443 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
444 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
445 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
446 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
447 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
448 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
449 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
450 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
451 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
452 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
453 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
454 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
455 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
456 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
457 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
458 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
459 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
460 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
461 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
462 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
463 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
464 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
465 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
466 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
467 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
468 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
469 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
470 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
471 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
472 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
473 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
474 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
475 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
476 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
477 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
478 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
479 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
480 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
481 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
482 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
483 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
484 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
485 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
486 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
487 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
488 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
489 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
490 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
491 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
492 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
493 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
494 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
495 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
496 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
497 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
498 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
499 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
500 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
501 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
502 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
503 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
504 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
505 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
506 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
507 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
508 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
509 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
510 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
511 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
512 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
513 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
514 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
515 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
516 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
517 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
518 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
519 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
520 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
521 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
522 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
523 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
524 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
525 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
526 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
527 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
528 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
529 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
530 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
531 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
532 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
533 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
534 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
535 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
536 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
537 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
538 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
539 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
540 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
541 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
542 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
543 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
544 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
545 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
546 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
547 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
548 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
549 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
550 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
551 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
552 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
553 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
554 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
555 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
556 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
557 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
558 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
559 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
560 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
561 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
562 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
563 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
564 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
565 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
566 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
567 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
568 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
569 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
570 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
571 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
572 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
573 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
574 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
575 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
576 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
577 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
578 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
579 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
580 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
581 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
582 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
583 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
584 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
585 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
586 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
587 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
588 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
589 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
590 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
591 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
592 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
593 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
594 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
595 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
596 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
597 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
598 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
599 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
600 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
601 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
602 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
603 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
604 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
605 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
606 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
607 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
608 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
609 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
610 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
611 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
612 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
613 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
614 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
615 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
616 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
617 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
618 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
619 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
620 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
621 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
622 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
623 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
624 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
625 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
626 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
627 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
628 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
629 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
630 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
631 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
632 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
633 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
634 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
635 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
636 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
637 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
638 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
639 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
640 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
641 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
642 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
643 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
644 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
645 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
646 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 88
Metatranscriptomes 0.16
Isolates 11.84

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.83
Nodule 11.31
Rhizoplane 5.13
Rhizosphere 63.43
Stem 0
Stem Tuber 0
Unclassified 7.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24744J21845_10017086 3300002077 Bacteria 1442
2 JGI24742J22300_10012181 3300002244 Bacteria 1431
3 JGI25406J46586_10002021 3300003203 Bacteria 9577
4 JGI25153J46596_10000432 3300003215 Bacteria 27003
5 JGI25153J46596_10002180 3300003215 Bacteria 11433
6 JGI25153J46596_10004682 3300003215 Bacteria 7313
7 JGI25153J46596_10006584 3300003215 Bacteria 5854
8 rootL2_10198724 3300003322 Bacteria 1263
9 rootH1_10140860 3300003323 Bacteria 2656
10 rootH1_10224479 3300003323 Bacteria 1134
11 JGI25160J50197_1000709 3300003354 Bacteria 18326
12 JGI25160J50197_1002513 3300003354 Bacteria 8511
13 JGI25160J50197_1043457 3300003354 Bacteria 1011
14 JGI25404J52841_10000868 3300003659 Bacteria 4886
15 JGI25404J52841_10007121 3300003659 Bacteria 2358
16 JGI25404J52841_10022763 3300003659 Bacteria 1353
17 JGI25404J52841_10062363 3300003659 Bacteria 781
18 Ga0055542_1005116 3300003762 Bacteria 3023
19 Ga0055526_1050218 3300003771 Bacteria 957
20 Ga0055531_10001452 3300003794 Bacteria 17483
21 Ga0065165_1001305 3300005262 Bacteria 27868
22 Ga0065165_1001628 3300005262 Bacteria 22844
23 Ga0065165_1011953 3300005262 Bacteria 3571
24 Ga0065165_1048550 3300005262 Bacteria 1218
25 Ga0070658_10154929 3300005327 Bacteria 1920
26 Ga0070658_10435416 3300005327 Bacteria 1129
27 Ga0070658_10636029 3300005327 Bacteria 925
28 Ga0070683_100012766 3300005329 Bacteria 7307
29 Ga0068869_100092774 3300005334 Bacteria 2273
30 Ga0070666_10065236 3300005335 Bacteria 2471
31 Ga0070680_100047681 3300005336 Bacteria 3488
32 Ga0070682_100426915 3300005337 Bacteria 1009
33 Ga0068868_100510741 3300005338 Bacteria 1054
34 Ga0068868_101073500 3300005338 Bacteria 740
35 Ga0070660_100004273 3300005339 Bacteria 9865
36 Ga0070661_100133759 3300005344 Bacteria 1864
37 Ga0070661_100166016 3300005344 Bacteria 1674
38 Ga0070668_100048206 3300005347 Bacteria 3276
39 Ga0070668_100077446 3300005347 Bacteria 2599
40 Ga0070668_100282659 3300005347 Bacteria 1386
41 Ga0070668_100298895 3300005347 Bacteria 1350
42 Ga0070669_100092335 3300005353 Bacteria 2272
43 Ga0070675_100985946 3300005354 Bacteria 773
44 Ga0070671_100249816 3300005355 Bacteria 1507
45 Ga0070674_100274672 3300005356 Bacteria 1333
46 Ga0070673_100257228 3300005364 Bacteria 1524
47 Ga0070673_100394246 3300005364 Bacteria 1237
48 Ga0070688_100062463 3300005365 Bacteria 2358
49 Ga0070688_100074393 3300005365 Bacteria 2182
50 Ga0070667_100235235 3300005367 Bacteria 1634
51 Ga0070667_100550328 3300005367 Bacteria 1061
52 Ga0070709_10000324 3300005434 Bacteria 30045
53 Ga0070709_10002143 3300005434 Bacteria 10686
54 Ga0070714_100039343 3300005435 Bacteria 3981
55 Ga0070714_100055285 3300005435 Bacteria 3392
56 Ga0070714_100158596 3300005435 Bacteria 2045
57 Ga0070713_100059037 3300005436 Bacteria 3202
58 Ga0070713_100072454 3300005436 Bacteria 2914
59 Ga0070713_100079742 3300005436 Bacteria 2790
60 Ga0070713_100133978 3300005436 Bacteria 2187
61 Ga0070713_100329922 3300005436 Bacteria 1411
62 Ga0070710_10004545 3300005437 Bacteria 6560
63 Ga0070710_10061500 3300005437 Bacteria 2139
64 Ga0070711_100005717 3300005439 Bacteria 7456
65 Ga0070711_100009594 3300005439 Bacteria 5966
66 Ga0070711_100013807 3300005439 Bacteria 5079
67 Ga0070711_100153320 3300005439 Bacteria 1739
68 Ga0070705_100260842 3300005440 Bacteria 1222
69 Ga0070663_100005116 3300005455 Bacteria 7763
70 Ga0070663_100011980 3300005455 Bacteria 5470
71 Ga0070663_100065337 3300005455 Bacteria 2633
72 Ga0070663_100100609 3300005455 Bacteria 2156
73 Ga0070663_100359676 3300005455 Bacteria 1180
74 Ga0070663_100392510 3300005455 Bacteria 1133
75 Ga0070663_100734552 3300005455 Bacteria 842
76 Ga0070678_100062747 3300005456 Bacteria 2745
77 Ga0070678_100235325 3300005456 Bacteria 1529
78 Ga0070678_100289109 3300005456 Bacteria 1389
79 Ga0070662_100065597 3300005457 Bacteria 2661
80 Ga0070662_100145189 3300005457 Bacteria 1843
81 Ga0070681_10044524 3300005458 Bacteria 4442
82 Ga0070681_10054107 3300005458 Bacteria 3999
83 Ga0070681_10105694 3300005458 Bacteria 2757
84 Ga0070681_10159140 3300005458 Bacteria 2182
85 Ga0068867_100047009 3300005459 Bacteria 3172
86 Ga0068867_100148110 3300005459 Bacteria 1841
87 Ga0070707_100725866 3300005468 Bacteria 957
88 Ga0070698_100026181 3300005471 Bacteria 6073
89 Ga0070699_100468596 3300005518 Bacteria 1143
90 Ga0070679_100041981 3300005530 Bacteria 4555
91 Ga0070679_100044114 3300005530 Bacteria 4442
92 Ga0070679_100078665 3300005530 Bacteria 3286
93 Ga0070679_100097758 3300005530 Bacteria 2923
94 Ga0070684_100002379 3300005535 Bacteria 13868
95 Ga0070684_100019513 3300005535 Bacteria 5609
96 Ga0070684_100051309 3300005535 Bacteria 3583
97 Ga0070684_100105307 3300005535 Bacteria 2524
98 Ga0068853_100119521 3300005539 Bacteria 2349
99 Ga0068853_100233155 3300005539 Bacteria 1684
100 Ga0068853_100269387 3300005539 Bacteria 1568
101 Ga0068853_100278145 3300005539 Bacteria 1543
102 Ga0068853_100364061 3300005539 Bacteria 1348
103 Ga0068853_100380218 3300005539 Bacteria 1318
104 Ga0068853_100405323 3300005539 Bacteria 1277
105 Ga0070672_100032454 3300005543 Bacteria 3940
106 Ga0070672_100193361 3300005543 Bacteria 1700
107 Ga0070693_100338802 3300005547 Bacteria 1026
108 Ga0070665_100049667 3300005548 Bacteria 4209
109 Ga0070665_100073653 3300005548 Bacteria 3421
110 Ga0070665_100075172 3300005548 Bacteria 3385
111 Ga0070704_100039644 3300005549 Bacteria 3236
112 Ga0068855_100011091 3300005563 Bacteria 10875
113 Ga0068855_100012351 3300005563 Bacteria 10317
114 Ga0068855_100046970 3300005563 Bacteria 5103
115 Ga0068855_100293910 3300005563 Bacteria 1800
116 Ga0068855_100327963 3300005563 Bacteria 1690
117 Ga0068855_100832987 3300005563 Bacteria 979
118 Ga0068855_100901861 3300005563 Bacteria 934
119 Ga0070664_100496340 3300005564 Bacteria 1125
120 Ga0068857_100021122 3300005577 Bacteria 5728
121 Ga0068857_100514516 3300005577 Bacteria 1124
122 Ga0068854_100066050 3300005578 Bacteria 2632
123 Ga0068854_100070200 3300005578 Bacteria 2560
124 Ga0068856_100000091 3300005614 Bacteria 85048
125 Ga0068856_100043323 3300005614 Bacteria 4428
126 Ga0068856_100202648 3300005614 Bacteria 1999
127 Ga0068856_100225707 3300005614 Bacteria 1888
128 Ga0068856_100348348 3300005614 Bacteria 1500
129 Ga0070702_100039568 3300005615 Bacteria 2631
130 Ga0068852_100215150 3300005616 Bacteria 1825
131 Ga0068852_100908109 3300005616 Bacteria 898
132 Ga0068859_100014165 3300005617 Bacteria 7997
133 Ga0068859_100089670 3300005617 Bacteria 3126
134 Ga0068859_100375335 3300005617 Bacteria 1518
135 Ga0068859_100593503 3300005617 Bacteria 1201
136 Ga0068864_100228267 3300005618 Bacteria 1721
137 Ga0068864_101067572 3300005618 Bacteria 803
138 Ga0068866_10259068 3300005718 Bacteria 1068
139 Ga0068861_100010097 3300005719 Bacteria 6546
140 Ga0068861_100331473 3300005719 Bacteria 1329
141 Ga0068851_10020652 3300005834 Bacteria 3191
142 Ga0068851_10165377 3300005834 Bacteria 1218
143 Ga0068870_10014005 3300005840 Bacteria 3779
144 Ga0068870_10431464 3300005840 Bacteria 864
145 Ga0068863_100499699 3300005841 Bacteria 1197
146 Ga0068858_100207127 3300005842 Bacteria 1855
147 Ga0068860_100229138 3300005843 Bacteria 1805
148 Ga0068862_100193040 3300005844 Bacteria 1833
149 Ga0068862_100599328 3300005844 Bacteria 1057
150 Ga0081455_10001565 3300005937 Bacteria 28095
151 Ga0081455_10011569 3300005937 Bacteria 8855
152 Ga0081455_10023918 3300005937 Bacteria 5674
153 Ga0081455_10048845 3300005937 Bacteria 3652
154 Ga0081455_10284251 3300005937 Bacteria 1194
155 Ga0081455_10627158 3300005937 Bacteria 696
156 Ga0081538_10018190 3300005981 Bacteria 5292
157 Ga0081540_1001316 3300005983 Bacteria 21684
158 Ga0081540_1002055 3300005983 Bacteria 16786
159 Ga0081540_1003177 3300005983 Bacteria 13110
160 Ga0081540_1003766 3300005983 Bacteria 11877
161 Ga0081540_1005220 3300005983 Bacteria 9723
162 Ga0081540_1035251 3300005983 Bacteria 2686
163 Ga0081540_1045180 3300005983 Bacteria 2241
164 Ga0081540_1062702 3300005983 Bacteria 1764
165 Ga0081540_1067617 3300005983 Bacteria 1669
166 Ga0081540_1212295 3300005983 Bacteria 695
167 Ga0081539_10002516 3300005985 Bacteria 25625
168 Ga0081539_10017368 3300005985 Bacteria 5056
169 Ga0081539_10043336 3300005985 Bacteria 2610
170 Ga0081539_10071980 3300005985 Bacteria 1850
171 Ga0070717_10040796 3300006028 Bacteria 3783
172 Ga0070717_10110584 3300006028 Bacteria 2343
173 Ga0070717_10151157 3300006028 Bacteria 2009
174 Ga0075365_10023148 3300006038 Bacteria 3903
175 Ga0075365_10036146 3300006038 Bacteria 3200
176 Ga0075365_10094148 3300006038 Bacteria 2044
177 Ga0075365_10125194 3300006038 Bacteria 1776
178 Ga0075368_10016671 3300006042 Bacteria 2740
179 Ga0075368_10023074 3300006042 Bacteria 2373
180 Ga0075368_10123748 3300006042 Bacteria 1072
181 Ga0075363_100011292 3300006048 Bacteria 4272
182 Ga0075363_100063181 3300006048 Bacteria 1998
183 Ga0075364_10120161 3300006051 Bacteria 1758
184 Ga0070716_100001795 3300006173 Bacteria 9720
185 Ga0070716_100094586 3300006173 Bacteria 1817
186 Ga0070712_100008170 3300006175 Bacteria 6570
187 Ga0070712_100028537 3300006175 Bacteria 3733
188 Ga0070712_100045139 3300006175 Bacteria 3041
189 Ga0070712_100147746 3300006175 Bacteria 1801
190 Ga0070712_100261990 3300006175 Bacteria 1386
191 Ga0070712_100388878 3300006175 Bacteria 1150
192 Ga0075362_10036149 3300006177 Bacteria 2159
193 Ga0075362_10065808 3300006177 Bacteria 1646
194 Ga0075362_10189600 3300006177 Bacteria 998
195 Ga0075367_10021204 3300006178 Bacteria 3628
196 Ga0075367_10026486 3300006178 Bacteria 3289
197 Ga0075367_10046559 3300006178 Bacteria 2548
198 Ga0075367_10138714 3300006178 Bacteria 1506
199 Ga0075367_10151449 3300006178 Bacteria 1439
200 Ga0075367_10446652 3300006178 Bacteria 819
201 Ga0075369_10029760 3300006186 Bacteria 2296
202 Ga0075369_10211141 3300006186 Bacteria 897
203 Ga0075366_10017172 3300006195 Bacteria 4163
204 Ga0075366_10056721 3300006195 Bacteria 2327
205 Ga0075366_10077813 3300006195 Bacteria 1979
206 Ga0075366_10090033 3300006195 Bacteria 1837
207 Ga0097621_100509455 3300006237 Bacteria 1091
208 Ga0075370_10028858 3300006353 Bacteria 3087
209 Ga0075370_10108112 3300006353 Bacteria 1613
210 Ga0075370_10193921 3300006353 Bacteria 1197
211 Ga0075370_10263366 3300006353 Bacteria 1022
212 Ga0075370_10488411 3300006353 Bacteria 743
213 Ga0068871_100065219 3300006358 Bacteria 2982
214 Ga0068871_100228886 3300006358 Bacteria 1613
215 Ga0075428_100352923 3300006844 Bacteria 1578
216 Ga0075428_100388241 3300006844 Bacteria 1497
217 Ga0075428_101376576 3300006844 Bacteria 741
218 Ga0075433_10112872 3300006852 Bacteria 2411
219 Ga0075434_100197637 3300006871 Bacteria 2031
220 Ga0075434_100234838 3300006871 Bacteria 1853
221 Ga0068865_100091839 3300006881 Bacteria 2204
222 Ga0068865_100622352 3300006881 Bacteria 915
223 Ga0075436_100607155 3300006914 Bacteria 806
224 Ga0097620_100014164 3300006931 Bacteria 7997
225 Ga0097620_100089668 3300006931 Bacteria 3126
226 Ga0097620_100375337 3300006931 Bacteria 1518
227 Ga0097620_100593500 3300006931 Bacteria 1201
228 Ga0099824_1003225 3300006942 Bacteria 23847
229 Ga0099824_1015288 3300006942 Bacteria 7319
230 Ga0099822_1025589 3300006943 Bacteria 5105
231 Ga0075435_100582548 3300007076 Bacteria 970
232 Ga0099794_10004324 3300007265 Bacteria 5560
233 Ga0099795_10006561 3300007788 Bacteria 3184
234 Ga0105240_10006270 3300009093 Bacteria 17499
235 Ga0105240_10332078 3300009093 Bacteria 1730
236 Ga0105240_10399540 3300009093 Bacteria 1548
237 Ga0105240_10530153 3300009093 Bacteria 1306
238 Ga0111539_10039518 3300009094 Bacteria 5685
239 Ga0111539_10663285 3300009094 Bacteria 1215
240 Ga0105245_10119877 3300009098 Bacteria 2456
241 Ga0105245_10580408 3300009098 Bacteria 1145
242 Ga0105245_11179746 3300009098 Bacteria 813
243 Ga0105247_10060832 3300009101 Bacteria 2341
244 Ga0105247_10485961 3300009101 Bacteria 897
245 Ga0114129_10045838 3300009147 Bacteria 6145
246 Ga0114129_11738208 3300009147 Bacteria 760
247 Ga0105243_10085596 3300009148 Bacteria 2584
248 Ga0105243_10289824 3300009148 Bacteria 1478
249 Ga0105241_10020501 3300009174 Bacteria 4884
250 Ga0105241_10039006 3300009174 Bacteria 3582
251 Ga0105241_10061907 3300009174 Bacteria 2883
252 Ga0105241_10231558 3300009174 Bacteria 1558
253 Ga0105242_10121787 3300009176 Bacteria 2240
254 Ga0105242_10713070 3300009176 Bacteria 983
255 Ga0105248_10051252 3300009177 Bacteria 4631
256 Ga0105248_10070301 3300009177 Bacteria 3931
257 Ga0105248_10269930 3300009177 Bacteria 1916
258 Ga0105248_10985866 3300009177 Bacteria 952
259 Ga0105237_10001391 3300009545 Bacteria 31961
260 Ga0105237_10003041 3300009545 Bacteria 20237
261 Ga0105237_10055891 3300009545 Bacteria 3952
262 Ga0105237_10283706 3300009545 Bacteria 1659
263 Ga0105237_10436943 3300009545 Bacteria 1314
264 Ga0105238_10007433 3300009551 Bacteria 10975
265 Ga0105238_10036806 3300009551 Bacteria 4976
266 Ga0105238_10101444 3300009551 Bacteria 2860
267 Ga0105238_10224266 3300009551 Bacteria 1856
268 Ga0105238_10330068 3300009551 Bacteria 1512
269 Ga0105238_10562419 3300009551 Bacteria 1145
270 Ga0105249_10151912 3300009553 Bacteria 2230
271 Ga0105249_10857413 3300009553 Bacteria 974
272 Ga0099796_10026232 3300010159 Bacteria 1849
273 Ga0099796_10156582 3300010159 Bacteria 900
274 Ga0105239_10005113 3300010375 Bacteria 15486
275 Ga0105239_10008417 3300010375 Bacteria 11742
276 Ga0105239_10564610 3300010375 Bacteria 1297
277 Ga0105239_10757708 3300010375 Bacteria 1111
278 Ga0105246_10011638 3300011119 Bacteria 5465
279 Ga0105246_10035501 3300011119 Bacteria 3333
280 Ga0105246_10205378 3300011119 Bacteria 1534
281 Ga0157370_10060883 3300013104 Bacteria 3583
282 Ga0157370_10137706 3300013104 Bacteria 2275
283 Ga0157370_11316179 3300013104 Bacteria 651
284 Ga0157369_10003636 3300013105 Bacteria 18291
285 Ga0157369_10007202 3300013105 Bacteria 12817
286 Ga0157369_10368991 3300013105 Bacteria 1490
287 Ga0157369_10469407 3300013105 Bacteria 1303
288 Ga0157374_10046894 3300013296 Bacteria 4004
289 Ga0157374_10141279 3300013296 Bacteria 2337
290 Ga0157374_10453594 3300013296 Bacteria 1284
291 Ga0157374_10800889 3300013296 Bacteria 958
292 Ga0157378_10099257 3300013297 Bacteria 2656
293 Ga0157378_10172702 3300013297 Bacteria 2028
294 Ga0157378_10280939 3300013297 Bacteria 1605
295 Ga0157378_10474105 3300013297 Bacteria 1246
296 Ga0157378_10476080 3300013297 Bacteria 1243
297 Ga0157378_11141698 3300013297 Bacteria 817
298 Ga0157378_11217780 3300013297 Bacteria 793
299 Ga0163162_10079922 3300013306 Bacteria 3336
300 Ga0163162_10102084 3300013306 Bacteria 2961
301 Ga0163162_10145155 3300013306 Bacteria 2489
302 Ga0163162_10234207 3300013306 Bacteria 1967
303 Ga0163162_10299735 3300013306 Bacteria 1739
304 Ga0157372_10044995 3300013307 Bacteria 4893
305 Ga0157372_10117449 3300013307 Bacteria 3051
306 Ga0157372_11107729 3300013307 Bacteria 916
307 Ga0157375_10028075 3300013308 Bacteria 5270
308 Ga0157375_10640633 3300013308 Bacteria 1220
309 Ga0163163_10048811 3300014325 Bacteria 4164
310 Ga0163163_10752537 3300014325 Bacteria 1038
311 Ga0163163_11043038 3300014325 Bacteria 881
312 Ga0157380_10052903 3300014326 Bacteria 3217
313 Ga0157380_10531269 3300014326 Bacteria 1149
314 Ga0157379_10854091 3300014968 Bacteria 861
315 Ga0157379_10946769 3300014968 Bacteria 819
316 Ga0157376_10083196 3300014969 Bacteria 2752
317 Ga0157376_10106270 3300014969 Bacteria 2462
318 Ga0157376_10414208 3300014969 Bacteria 1306
319 Ga0157376_11607915 3300014969 Bacteria 684
320 Ga0163161_10166568 3300017792 Bacteria 1683
321 Ga0163161_10190471 3300017792 Bacteria 1577
322 Ga0163161_10820547 3300017792 Bacteria 783
323 Ga0206353_10094903 3300020082 Bacteria 1284
324 Ga0214544_1000026 3300021320 Bacteria 161530
325 Ga0214544_1027092 3300021320 Bacteria 2441
326 Ga0214542_1000025 3300021321 Bacteria 183588
327 Ga0214542_1031522 3300021321 Bacteria 1961
328 Ga0214545_1000014 3300021324 Bacteria 183588
329 Ga0214543_1000034 3300021327 Bacteria 183712
330 Ga0213876_10016320 3300021384 Bacteria 3925
331 Ga0213875_10020469 3300021388 Bacteria 3175
332 Ga0213871_10013056 3300021441 Bacteria 1943
333 Ga0207425_1020389 3300025245 Bacteria 1418
334 Ga0209148_1000250 3300025254 Bacteria 85755
335 Ga0209233_1002562 3300025261 Bacteria 6620
336 Ga0209233_1004484 3300025261 Bacteria 4739
337 Ga0209233_1007321 3300025261 Bacteria 3502
338 Ga0209455_1001255 3300025272 Bacteria 11915
339 Ga0209564_1003732 3300025295 Bacteria 9966
340 Ga0209758_1000141 3300025297 Bacteria 172481
341 Ga0209758_1000324 3300025297 Bacteria 91475
342 Ga0209758_1000476 3300025297 Bacteria 66180
343 Ga0209758_1001151 3300025297 Bacteria 33844
344 Ga0209758_1037257 3300025297 Bacteria 1882
345 Ga0209256_1023807 3300025299 Bacteria 1817
346 Ga0209256_1044938 3300025299 Bacteria 1100
347 Ga0207426_1000523 3300025302 Bacteria 55736
348 Ga0207426_1000768 3300025302 Bacteria 35650
349 Ga0207426_1002739 3300025302 Bacteria 10682
350 Ga0207426_1095774 3300025302 Bacteria 776
351 Ga0209257_1001317 3300025304 Bacteria 30217
352 Ga0207697_10142440 3300025315 Bacteria 1040
353 Ga0207697_10219247 3300025315 Bacteria 839
354 Ga0207656_10051297 3300025321 Bacteria 1784
355 Ga0207696_1041155 3300025711 Bacteria 1351
356 Ga0207653_10038609 3300025885 Bacteria 1561
357 Ga0207692_10005899 3300025898 Bacteria 4939
358 Ga0207692_10006552 3300025898 Bacteria 4726
359 Ga0207692_10115659 3300025898 Bacteria 1495
360 Ga0207692_10123617 3300025898 Bacteria 1452
361 Ga0207642_10023275 3300025899 Bacteria 2472
362 Ga0207710_10043781 3300025900 Bacteria 1992
363 Ga0207688_10017927 3300025901 Bacteria 3853
364 Ga0207688_10119736 3300025901 Bacteria 1535
365 Ga0207688_10147702 3300025901 Bacteria 1387
366 Ga0207688_10201535 3300025901 Bacteria 1193
367 Ga0207680_10022446 3300025903 Bacteria 3433
368 Ga0207680_10065256 3300025903 Bacteria 2234
369 Ga0207647_10075009 3300025904 Bacteria 2036
370 Ga0207647_10165006 3300025904 Bacteria 1291
371 Ga0207647_10258870 3300025904 Bacteria 997
372 Ga0207647_10359981 3300025904 Bacteria 823
373 Ga0207699_10001062 3300025906 Bacteria 12978
374 Ga0207699_10049665 3300025906 Bacteria 2470
375 Ga0207699_10226048 3300025906 Bacteria 1280
376 Ga0207645_10014665 3300025907 Bacteria 5233
377 Ga0207645_10301602 3300025907 Bacteria 1067
378 Ga0207643_10399467 3300025908 Bacteria 869
379 Ga0207705_10688904 3300025909 Bacteria 795
380 Ga0207684_10184562 3300025910 Bacteria 1799
381 Ga0207684_10448655 3300025910 Bacteria 1107
382 Ga0207654_10016235 3300025911 Bacteria 3874
383 Ga0207707_10003996 3300025912 Bacteria 13095
384 Ga0207707_10008329 3300025912 Bacteria 8995
385 Ga0207707_10012694 3300025912 Bacteria 7322
386 Ga0207707_10025470 3300025912 Bacteria 5175
387 Ga0207707_10244387 3300025912 Bacteria 1560
388 Ga0207707_10345815 3300025912 Bacteria 1282
389 Ga0207707_10706916 3300025912 Bacteria 846
390 Ga0207695_10000062 3300025913 Bacteria 351979
391 Ga0207695_10073392 3300025913 Bacteria 3487
392 Ga0207695_10198040 3300025913 Bacteria 1924
393 Ga0207695_10415388 3300025913 Bacteria 1230
394 Ga0207695_10525286 3300025913 Bacteria 1065
395 Ga0207671_10001205 3300025914 Bacteria 30737
396 Ga0207671_10007037 3300025914 Bacteria 9856
397 Ga0207671_10196302 3300025914 Bacteria 1575
398 Ga0207671_10321425 3300025914 Bacteria 1225
399 Ga0207671_10367156 3300025914 Bacteria 1143
400 Ga0207671_10710762 3300025914 Bacteria 799
401 Ga0207693_10004791 3300025915 Bacteria 11378
402 Ga0207693_10008114 3300025915 Bacteria 8609
403 Ga0207693_10024069 3300025915 Bacteria 4834
404 Ga0207693_10048463 3300025915 Bacteria 3336
405 Ga0207693_10185455 3300025915 Bacteria 1638
406 Ga0207693_10506875 3300025915 Bacteria 942
407 Ga0207663_10007196 3300025916 Bacteria 5759
408 Ga0207663_10037455 3300025916 Bacteria 2924
409 Ga0207663_10063692 3300025916 Bacteria 2349
410 Ga0207663_10870846 3300025916 Bacteria 719
411 Ga0207660_10001063 3300025917 Bacteria 18218
412 Ga0207660_10046064 3300025917 Bacteria 3076
413 Ga0207660_10079957 3300025917 Bacteria 2399
414 Ga0207660_10129366 3300025917 Bacteria 1920
415 Ga0207662_10243912 3300025918 Bacteria 1177
416 Ga0207657_10001360 3300025919 Bacteria 26055
417 Ga0207657_10072567 3300025919 Bacteria 2912
418 Ga0207657_10240445 3300025919 Bacteria 1446
419 Ga0207657_10426039 3300025919 Bacteria 1042
420 Ga0207649_10511938 3300025920 Bacteria 914
421 Ga0207652_10003881 3300025921 Bacteria 12232
422 Ga0207652_10017473 3300025921 Bacteria 5870
423 Ga0207652_10081505 3300025921 Bacteria 2830
424 Ga0207646_10145117 3300025922 Bacteria 2138
425 Ga0207681_10493530 3300025923 Bacteria 1001
426 Ga0207681_10785618 3300025923 Bacteria 795
427 Ga0207694_10226680 3300025924 Bacteria 1525
428 Ga0207694_10351438 3300025924 Bacteria 1220
429 Ga0207650_10354975 3300025925 Bacteria 1207
430 Ga0207650_10473682 3300025925 Bacteria 1044
431 Ga0207687_10033271 3300025927 Bacteria 3496
432 Ga0207687_10493296 3300025927 Bacteria 1021
433 Ga0207700_10002104 3300025928 Bacteria 11368
434 Ga0207700_10033953 3300025928 Bacteria 3656
435 Ga0207700_10058030 3300025928 Bacteria 2922
436 Ga0207700_10190364 3300025928 Bacteria 1724
437 Ga0207700_10324779 3300025928 Bacteria 1334
438 Ga0207664_10004165 3300025929 Bacteria 9765
439 Ga0207664_10196138 3300025929 Bacteria 1740
440 Ga0207644_10160166 3300025931 Bacteria 1749
441 Ga0207644_10441707 3300025931 Bacteria 1068
442 Ga0207644_10742255 3300025931 Bacteria 820
443 Ga0207690_10229716 3300025932 Bacteria 1424
444 Ga0207690_10727933 3300025932 Bacteria 817
445 Ga0207706_10041999 3300025933 Bacteria 4052
446 Ga0207706_10141635 3300025933 Bacteria 2115
447 Ga0207686_10214684 3300025934 Bacteria 1385
448 Ga0207709_10004831 3300025935 Bacteria 7723
449 Ga0207709_10391658 3300025935 Bacteria 1060
450 Ga0207709_10477191 3300025935 Bacteria 969
451 Ga0207709_10640623 3300025935 Bacteria 845
452 Ga0207670_10256795 3300025936 Bacteria 1353
453 Ga0207669_10167590 3300025937 Bacteria 1559
454 Ga0207669_10560614 3300025937 Bacteria 923
455 Ga0207704_10205689 3300025938 Bacteria 1444
456 Ga0207665_10053611 3300025939 Bacteria 2719
457 Ga0207665_10123034 3300025939 Bacteria 1834
458 Ga0207665_10228528 3300025939 Bacteria 1366
459 Ga0207665_10381652 3300025939 Bacteria 1070
460 Ga0207665_10468350 3300025939 Bacteria 969
461 Ga0207665_10518702 3300025939 Bacteria 922
462 Ga0207691_10045318 3300025940 Bacteria 4043
463 Ga0207691_10492720 3300025940 Bacteria 1041
464 Ga0207711_10045167 3300025941 Bacteria 3764
465 Ga0207711_11187115 3300025941 Bacteria 705
466 Ga0207689_10066424 3300025942 Bacteria 2966
467 Ga0207661_10000337 3300025944 Bacteria 29905
468 Ga0207661_10018159 3300025944 Bacteria 5225
469 Ga0207661_10996896 3300025944 Bacteria 772
470 Ga0207679_10215161 3300025945 Bacteria 1614
471 Ga0207679_10618509 3300025945 Bacteria 977
472 Ga0207667_10003256 3300025949 Bacteria 20033
473 Ga0207667_10050410 3300025949 Bacteria 4392
474 Ga0207667_10140872 3300025949 Bacteria 2483
475 Ga0207667_10232460 3300025949 Bacteria 1887
476 Ga0207667_10278654 3300025949 Bacteria 1709
477 Ga0207667_10606710 3300025949 Bacteria 1103
478 Ga0207667_11036650 3300025949 Bacteria 806
479 Ga0207712_10345263 3300025961 Bacteria 1236
480 Ga0207712_10531696 3300025961 Bacteria 1009
481 Ga0207712_10591811 3300025961 Bacteria 959
482 Ga0207668_10135455 3300025972 Bacteria 1886
483 Ga0207668_10312606 3300025972 Bacteria 1301
484 Ga0207640_10063155 3300025981 Bacteria 2460
485 Ga0207640_10071663 3300025981 Bacteria 2335
486 Ga0207640_10143796 3300025981 Bacteria 1742
487 Ga0207658_10272065 3300025986 Bacteria 1448
488 Ga0207658_10297594 3300025986 Bacteria 1389
489 Ga0207658_10411315 3300025986 Bacteria 1191
490 Ga0207677_10237545 3300026023 Bacteria 1472
491 Ga0207677_10353441 3300026023 Bacteria 1232
492 Ga0207703_10088904 3300026035 Bacteria 2594
493 Ga0207703_10182019 3300026035 Bacteria 1855
494 Ga0207703_10302211 3300026035 Bacteria 1460
495 Ga0207703_10345310 3300026035 Bacteria 1369
496 Ga0207703_10446631 3300026035 Bacteria 1207
497 Ga0207703_10625757 3300026035 Bacteria 1019
498 Ga0207639_10025935 3300026041 Bacteria 4254
499 Ga0207639_10084602 3300026041 Bacteria 2520
500 Ga0207639_10085798 3300026041 Bacteria 2505
501 Ga0207639_10114439 3300026041 Bacteria 2205
502 Ga0207639_10263388 3300026041 Bacteria 1509
503 Ga0207639_10291337 3300026041 Bacteria 1439
504 Ga0207639_10390719 3300026041 Bacteria 1251
505 Ga0207639_10842190 3300026041 Bacteria 856
506 Ga0207639_10895630 3300026041 Bacteria 829
507 Ga0207639_10950287 3300026041 Bacteria 804
508 Ga0207678_10010382 3300026067 Bacteria 8176
509 Ga0207678_10066135 3300026067 Bacteria 3104
510 Ga0207678_10074427 3300026067 Bacteria 2910
511 Ga0207678_10104740 3300026067 Bacteria 2414
512 Ga0207678_10155438 3300026067 Bacteria 1953
513 Ga0207678_10214880 3300026067 Bacteria 1645
514 Ga0207678_10414327 3300026067 Bacteria 1168
515 Ga0207708_10150662 3300026075 Bacteria 1831
516 Ga0207708_10901275 3300026075 Bacteria 765
517 Ga0207702_10000041 3300026078 Bacteria 150754
518 Ga0207702_10038734 3300026078 Bacteria 3993
519 Ga0207702_10144995 3300026078 Bacteria 2153
520 Ga0207702_10195323 3300026078 Bacteria 1873
521 Ga0207702_10250553 3300026078 Bacteria 1663
522 Ga0207702_10588059 3300026078 Bacteria 1091
523 Ga0207702_10691826 3300026078 Bacteria 1005
524 Ga0207648_10041877 3300026089 Bacteria 4021
525 Ga0207676_10537052 3300026095 Bacteria 1115
526 Ga0207676_11086806 3300026095 Bacteria 790
527 Ga0207674_10020311 3300026116 Bacteria 7178
528 Ga0207674_10029226 3300026116 Bacteria 5805
529 Ga0207674_10074961 3300026116 Bacteria 3394
530 Ga0207674_10368732 3300026116 Bacteria 1388
531 Ga0207675_100039999 3300026118 Bacteria 4375
532 Ga0207675_100123217 3300026118 Bacteria 2454
533 Ga0207675_100328919 3300026118 Bacteria 1493
534 Ga0207675_100367634 3300026118 Bacteria 1412
535 Ga0207683_10033939 3300026121 Bacteria 4434
536 Ga0207683_10135303 3300026121 Bacteria 2219
537 Ga0207683_10232036 3300026121 Bacteria 1683
538 Ga0207683_10236025 3300026121 Bacteria 1668
539 Ga0207683_10398674 3300026121 Bacteria 1266
540 Ga0207683_10605963 3300026121 Bacteria 1014
541 Ga0207683_10757070 3300026121 Bacteria 901
542 Ga0207683_11033378 3300026121 Bacteria 763
543 Ga0207698_10479265 3300026142 Bacteria 1207
544 Ga0209389_1000004 3300027296 Bacteria 263759
545 Ga0209389_1000023 3300027296 Bacteria 150730
546 Ga0209589_1000006 3300027357 Bacteria 436292
547 Ga0209589_1000010 3300027357 Bacteria 237657
548 Ga0209489_100007 3300027361 Bacteria 436292
549 Ga0209489_100011 3300027361 Bacteria 244710
550 Ga0209489_100295 3300027361 Bacteria 87273
551 Ga0209700_100008 3300027363 Bacteria 436292
552 Ga0209700_100013 3300027363 Bacteria 341906
553 Ga0209588_1001349 3300027671 Bacteria 6391
554 Ga0209588_1058263 3300027671 Bacteria 1248
555 Ga0209813_10063594 3300027866 Bacteria 1184
556 Ga0268266_10035607 3300028379 Bacteria 4235
557 Ga0268266_10191046 3300028379 Bacteria 1869
558 Ga0268266_10197166 3300028379 Bacteria 1841
559 Ga0268265_10066596 3300028380 Bacteria 2785
560 Ga0268265_10397830 3300028380 Bacteria 1272
561 Ga0268265_11213566 3300028380 Bacteria 752
562 Ga0268264_10098887 3300028381 Bacteria 2531
563 Ga0268264_10456807 3300028381 Bacteria 1238
564 Ga0268264_10477128 3300028381 Bacteria 1213
565 Ga0307517_10000085 3300028786 Bacteria 131200
566 Ga0307517_10108504 3300028786 Bacteria 2130
567 Ga0307515_10022248 3300028794 Bacteria 11182
568 Ga0265330_10019495 3300031235 Bacteria 3108
569 Ga0265332_10098022 3300031238 Bacteria 1237
570 Ga0265325_10003289 3300031241 Bacteria 10627
571 Ga0265340_10071688 3300031247 Bacteria 1641
572 Ga0265316_10015335 3300031344 Bacteria 6704
573 Ga0307513_10058631 3300031456 Bacteria 4090
574 Ga0307408_100745257 3300031548 Bacteria 884
575 Ga0307408_101071979 3300031548 Bacteria 746
576 Ga0307408_101278836 3300031548 Bacteria 687
577 Ga0265313_10132253 3300031595 Bacteria 1080
578 Ga0307508_10133366 3300031616 Bacteria 2087
579 Ga0265314_10004541 3300031711 Bacteria 12819
580 Ga0265314_10141877 3300031711 Bacteria 1484
581 Ga0265342_10184532 3300031712 Bacteria 1141
582 Ga0307516_10195889 3300031730 Bacteria 1743
583 Ga0307413_10159836 3300031824 Bacteria 1581
584 Ga0307413_10224888 3300031824 Bacteria 1373
585 Ga0326468_10010087 3300031889 Bacteria 949
586 Ga0307406_10137638 3300031901 Bacteria 1724
587 Ga0307407_10602398 3300031903 Bacteria 818
588 Ga0307409_100404725 3300031995 Bacteria 1304
589 Ga0307416_100134078 3300032002 Bacteria 2236
590 Ga0307416_100617515 3300032002 Bacteria 1166
591 Ga0307414_10651802 3300032004 Bacteria 949
592 Ga0307414_11070450 3300032004 Bacteria 744
593 Ga0307411_10112784 3300032005 Bacteria 1949
594 Ga0307411_11001541 3300032005 Bacteria 748
595 Ga0307415_100330992 3300032126 Bacteria 1274
596 Ga0307415_100359851 3300032126 Bacteria 1228
597 Ga0307415_100394413 3300032126 Bacteria 1179
598 Ga0307510_10006173 3300033180 Bacteria 14287
599 Ga0307510_10007269 3300033180 Bacteria 13192
600 Ga0307510_10089756 3300033180 Bacteria 2924
601 Ga0307510_10168832 3300033180 Bacteria 1770
602 Ga0307510_10392312 3300033180 Bacteria 832
603 Ga0315911_1000010 3300033442 Bacteria 322197
604 Ga0373938_0054753 3300034957 Bacteria 920
605 Ga0373929_0015474 3300035085 Bacteria 1484
606 Ga0373934_0014490 3300035086 Bacteria 2988
607 Ga0373934_0044104 3300035086 Bacteria 1763
608 Ga0373923_0047683 3300035111 Bacteria 1787
609 Ga0373936_0029079 3300035113 Bacteria 2174
610 Ga0373936_0060858 3300035113 Bacteria 1541
611 Ga0373945_0001490 3300035116 Bacteria 7162
612 Ga0373953_0005417 3300035117 Bacteria 4141
613 Ga0373953_0009791 3300035117 Bacteria 3314
614 Ga0373953_0161298 3300035117 Bacteria 964
615 Ga0373954_0000761 3300035118 Bacteria 12424
616 Ga0373954_0017839 3300035118 Bacteria 3191
617 Ga0373956_0048232 3300035119 Bacteria 1907
618 Ga0373957_0001113 3300035120 Bacteria 7129
619 Ga0373943_0106955 3300035170 Bacteria 1470
620 Ga0373946_0008010 3300035171 Bacteria 3882
621 Ga0373955_0008271 3300035172 Bacteria 4826
622 Ga0373955_0172016 3300035172 Bacteria 1282
623 Ga0373924_0004508 3300035410 Bacteria 4872
624 Ga0373931_0009812 3300035691 Bacteria 4585
625 Ga0373935_0030424 3300035692 Bacteria 3346
626 Ga0373927_0022902 3300035695 Bacteria 4092
627 Ga0373927_0178619 3300035695 Bacteria 1392
628 Ga0373933_0001647 3300035724 Bacteria 12991
629 Ga0373933_0017996 3300035724 Bacteria 3968
630 Ga0373947_0043950 3300035725 Bacteria 2669
631 Ga0373947_0054943 3300035725 Bacteria 2404
632 Ga0373937_0029135 3300036401 Bacteria 4999
633 Ga0373937_0128172 3300036401 Bacteria 2368
634 Ga0372808_021957 3300036459 Bacteria 918
635 Ga0373925_0011894 3300037068 Bacteria 6298
636 Ga0373925_0056168 3300037068 Bacteria 2949
637 Ga0373925_0188082 3300037068 Bacteria 1637
638 Ga0395899_0010190 3300037312 Bacteria 7202
639 Ga0395900_0020421 3300037418 Bacteria 6762
640 Ga0395900_0266450 3300037418 Bacteria 1709
641 Ga0395900_0339366 3300037418 Bacteria 1478
642 Ga0395898_0002370 3300037466 Bacteria 22395
643 Ga0395898_0232191 3300037466 Bacteria 1759
644 Ga0395905_0002934 3300037471 Bacteria 18550
645 Ga0395905_0207330 3300037471 Bacteria 1837
646 Ga0395905_0715356 3300037471 Bacteria 904
647 Ga0436364_0342298 3300037853 Bacteria 4528
648 Ga0395901_0003499 3300038443 Bacteria 15834
649 Ga0395901_0091456 3300038443 Bacteria 3185
650 Ga0395901_0144865 3300038443 Bacteria 2497
651 Ga0395901_0200322 3300038443 Bacteria 2093
652 Ga0395901_0575906 3300038443 Bacteria 1138
653 Ga0436365_0182621 3300039437 Bacteria 1633
654 Ga0436365_0299844 3300039437 Bacteria 780
655 Ga0436365_0486541 3300039437 Bacteria 4409
656 Ga0436365_0605759 3300039437 Bacteria 6970
657 Ga0436365_1283571 3300039437 Bacteria 25666
658 Ga0436360_0872612 3300039438 Bacteria 3249
659 Ga0436360_0895214 3300039438 Bacteria 3917
660 Ga0436361_0216754 3300039447 Bacteria 1151
661 Ga0436361_0539604 3300039447 Bacteria 1359
662 Ga0436363_0029976 3300039450 Bacteria 1320
663 Ga0436363_0843641 3300039450 Bacteria 958
664 Ga0436362_0365003 3300039453 Bacteria 1027
665 Ga0436362_0529262 3300039453 Bacteria 1695
666 Ga0439465_0064550 3300041413 Bacteria 1218
667 Ga0451791_1847493 3300041451 Bacteria 1389
668 Ga0451793_1054860 3300041452 Bacteria 1249
669 Ga0451833_1207251 3300041491 Bacteria 1170
670 Ga0451835_0964677 3300041492 Bacteria 955
671 Ga0451841_0596662 3300041498 Bacteria 1329
672 Ga0439455_0024870 3300042012 Bacteria 1452
673 Ga0439463_040713 3300042016 Bacteria 1181
674 Ga0466969_0003503 3300044656 Bacteria 8333
675 Ga0466972_0000185 3300044658 Bacteria 48335
676 Ga0466965_0035908 3300044683 Bacteria 2430
677 Ga0466966_0000952 3300044684 Bacteria 18530
678 Ga0466961_0000737 3300044693 Bacteria 20495
679 Ga0466961_0295031 3300044693 Bacteria 991
680 Ga0466971_0246732 3300044719 Bacteria 850
681 Ga0466968_0291324 3300044735 Bacteria 783
682 Ga0466959_0028388 3300045049 Bacteria 4149
683 Ga0466959_0047575 3300045049 Bacteria 3154
684 Ga0466959_0070752 3300045049 Bacteria 2527
685 Ga0466958_0454706 3300045836 Bacteria 829
686 Ga0466967_0015901 3300045976 Bacteria 5914
687 Ga0466967_0749416 3300045976 Bacteria 968
688 Ga0495617_020436 3300046452 Bacteria 2238
689 Ga0495617_025717 3300046452 Bacteria 1984
690 Ga0495627_022541 3300046453 Bacteria 2072
691 Ga0495592_0019398 3300046454 Bacteria 5172
692 Ga0495592_0321425 3300046454 Bacteria 1000
693 Ga0495603_0117629 3300046455 Bacteria 1549
694 Ga0495603_0156343 3300046455 Bacteria 1323
695 Ga0495603_0274637 3300046455 Bacteria 969
696 Ga0495590_0027742 3300046457 Bacteria 1986
697 Ga0495629_0062401 3300046459 Bacteria 2603
698 Ga0495629_0079747 3300046459 Bacteria 2286
699 Ga0495629_0114972 3300046459 Bacteria 1875
700 Ga0495629_0238698 3300046459 Bacteria 1252
701 Ga0495638_0003540 3300046460 Bacteria 12240
702 Ga0495651_0025900 3300046462 Bacteria 4567
703 Ga0495651_0104445 3300046462 Bacteria 2103
704 Ga0495651_0119914 3300046462 Bacteria 1934
705 Ga0495653_0004690 3300046463 Bacteria 11064
706 Ga0495650_0174327 3300046471 Bacteria 760
707 Ga0495580_0005215 3300046472 Bacteria 10795
708 Ga0495580_0048262 3300046472 Bacteria 3016
709 Ga0495580_0359919 3300046472 Bacteria 985
710 Ga0495582_0054925 3300046473 Bacteria 2195
711 Ga0495605_0177445 3300046474 Bacteria 938
712 Ga0495639_0003015 3300046475 Bacteria 7335
713 Ga0495639_0073169 3300046475 Bacteria 1586
714 Ga0495639_0076899 3300046475 Bacteria 1549
715 Ga0495662_0044223 3300046476 Bacteria 2150
716 Ga0495664_0098627 3300046477 Bacteria 1759
717 Ga0495664_0514785 3300046477 Bacteria 714
718 Ga0495584_0076422 3300046491 Bacteria 1684
719 Ga0495584_0107053 3300046491 Bacteria 1414
720 Ga0495584_0173646 3300046491 Bacteria 1095
721 Ga0495585_0017623 3300046492 Bacteria 4124
722 Ga0495594_0016398 3300046499 Bacteria 3903
723 Ga0495594_0088498 3300046499 Bacteria 1734
724 Ga0495594_0491454 3300046499 Bacteria 697
725 Ga0495596_0014778 3300046500 Bacteria 3284
726 Ga0495607_0170161 3300046501 Bacteria 1101
727 Ga0495607_0191310 3300046501 Bacteria 1019
728 Ga0495583_0056740 3300046506 Bacteria 1764
729 Ga0495606_0024349 3300046507 Bacteria 4364
730 Ga0495606_0190609 3300046507 Bacteria 1175
731 Ga0495608_0001839 3300046511 Bacteria 15137
732 Ga0495610_0166524 3300046512 Bacteria 928
733 Ga0495616_0050935 3300046513 Bacteria 2068
734 Ga0495616_0100475 3300046513 Bacteria 1357
735 Ga0495618_0009386 3300046514 Bacteria 5907
736 Ga0495618_0113479 3300046514 Bacteria 1735
737 Ga0495620_0140692 3300046515 Bacteria 944
738 Ga0495628_0023039 3300046516 Bacteria 5112
739 Ga0495628_0028229 3300046516 Bacteria 4561
740 Ga0495630_0175168 3300046517 Bacteria 1635
741 Ga0495632_0153582 3300046519 Bacteria 1063
742 Ga0495643_0026574 3300046522 Bacteria 3264
743 Ga0495644_0025964 3300046523 Bacteria 2223
744 Ga0495644_0149016 3300046523 Bacteria 895
745 Ga0495648_0158805 3300046524 Bacteria 1171
746 Ga0495648_0201389 3300046524 Bacteria 996
747 Ga0495642_0258900 3300046528 Bacteria 761
748 Ga0495652_0193615 3300046529 Bacteria 1549
749 Ga0495652_0222807 3300046529 Bacteria 1416
750 Ga0495654_0270048 3300046530 Bacteria 703
751 Ga0495665_0308393 3300046531 Bacteria 809
752 Ga0495640_0011654 3300046533 Bacteria 6750
753 Ga0495586_0277101 3300046535 Bacteria 959
754 Ga0495598_0021060 3300046537 Bacteria 1729
755 Ga0495621_0015707 3300046539 Bacteria 2417
756 Ga0495645_0009481 3300046543 Bacteria 6803
757 Ga0495645_0017734 3300046543 Bacteria 5104
758 Ga0495645_0136803 3300046543 Bacteria 1713
759 Ga0495622_0055185 3300046557 Bacteria 1843
760 Ga0495633_0071338 3300046558 Bacteria 1620
761 Ga0495633_0177789 3300046558 Bacteria 980
762 Ga0495656_0001457 3300046615 Bacteria 7744
763 Ga0495656_0016098 3300046615 Bacteria 2834
764 Ga0495656_0027153 3300046615 Bacteria 2284
765 Ga0495656_0079876 3300046615 Bacteria 1473
766 Ga0495668_0101566 3300046616 Bacteria 1573
767 Ga0495668_0178692 3300046616 Bacteria 1163
768 Ga0495668_0534132 3300046616 Bacteria 647
769 Ga0495634_0004673 3300046642 Bacteria 10655
770 Ga0495634_0015562 3300046642 Bacteria 5460
771 Ga0495634_0110179 3300046642 Bacteria 1771
772 Ga0495611_0358414 3300046648 Bacteria 669
773 Ga0495625_0214830 3300046660 Bacteria 1263
774 Ga0495635_0009056 3300046663 Bacteria 6947
775 Ga0495635_0013629 3300046663 Bacteria 5690
776 Ga0495659_0037332 3300046664 Bacteria 1720
777 Ga0495659_0132521 3300046664 Bacteria 989
778 Ga0495659_0347327 3300046664 Bacteria 633
779 Ga0495661_0196480 3300046665 Bacteria 1059
780 Ga0495588_0002625 3300046674 Bacteria 7697
781 Ga0495588_0035958 3300046674 Bacteria 2511
782 Ga0495657_0001190 3300046675 Bacteria 22816
783 Ga0495657_0296704 3300046675 Bacteria 964
784 Ga0495599_0160049 3300046678 Bacteria 1392
785 Ga0495599_0208627 3300046678 Bacteria 1198
786 Ga0495623_0053830 3300046679 Bacteria 2540
787 Ga0495646_0024473 3300046680 Bacteria 3802
788 Ga0495646_0035486 3300046680 Bacteria 3093
789 Ga0495658_0046236 3300046683 Bacteria 2446
790 Ga0495669_0038625 3300046684 Bacteria 2114
791 Ga0495669_0084784 3300046684 Bacteria 1457
792 Ga0495613_0004933 3300046689 Bacteria 10027
793 Ga0495613_0026734 3300046689 Bacteria 4298
794 Ga0495613_0278177 3300046689 Bacteria 1163
795 Ga0495624_0039037 3300046690 Bacteria 3046
796 Ga0495624_0043034 3300046690 Bacteria 2882
797 Ga0495624_0146414 3300046690 Bacteria 1446
798 Ga0495624_0411718 3300046690 Bacteria 811
799 Ga0495670_0108571 3300046691 Bacteria 1434
800 Ga0495670_0277530 3300046691 Bacteria 896
801 Ga0495671_0261100 3300046692 Bacteria 835
802 Ga0495649_0013503 3300046694 Bacteria 4710
803 Ga0495600_0044036 3300046809 Bacteria 2912
804 Ga0495600_0125078 3300046809 Bacteria 1672
805 Ga0495660_0129615 3300046810 Bacteria 1267
806 Ga0495581_0108700 3300047315 Bacteria 1612
807 Ga0495581_0182847 3300047315 Bacteria 1226
808 Ga0495604_0040533 3300047317 Bacteria 3656
809 Ga0495604_0178776 3300047317 Bacteria 1485
810 Ga0495604_0185446 3300047317 Bacteria 1453
811 Ga0495636_0016540 3300047318 Bacteria 2948
812 Ga0495636_0045819 3300047318 Bacteria 1823
813 Ga0495674_0015364 3300047319 Bacteria 7160
814 Ga0495674_0114385 3300047319 Bacteria 2285
815 Ga0495674_0133798 3300047319 Bacteria 2088
816 Ga0495676_0095206 3300047321 Bacteria 2216
817 Ga0495676_0218471 3300047321 Bacteria 1315
818 Ga0495683_0058399 3300047323 Bacteria 1916
819 Ga0495683_0146386 3300047323 Bacteria 1103
820 Ga0495687_028429 3300047443 Bacteria 2601
821 Ga0495677_0044535 3300047445 Bacteria 1627
822 Ga0495685_071778 3300047447 Bacteria 1159
823 Ga0495673_0048293 3300047469 Bacteria 1877
824 Ga0495673_0064322 3300047469 Bacteria 1561
825 Ga0495684_0012073 3300047471 Bacteria 6664
826 Ga0495684_0092044 3300047471 Bacteria 2296
827 Ga0495684_0129746 3300047471 Bacteria 1894
828 Ga0495686_0030828 3300047472 Bacteria 3481
829 Ga0495686_0219641 3300047472 Bacteria 1082
830 Ga0495686_0233030 3300047472 Bacteria 1042
831 Ga0495686_0266130 3300047472 Bacteria 958
832 Ga0495593_0006291 3300047673 Bacteria 6967
833 Ga0495593_0013864 3300047673 Bacteria 4591
834 Ga0495593_0062689 3300047673 Bacteria 1942
835 Ga0495602_0108924 3300048088 Bacteria 2254
836 Ga0495602_0183488 3300048088 Bacteria 1611
837 Ga0496100_0029828 3300048903 Bacteria 3377
838 Ga0496100_0034063 3300048903 Bacteria 3192
839 Ga0496100_0177080 3300048903 Bacteria 1540
840 Ga0496101_0013278 3300048904 Bacteria 5516
841 Ga0496102_0005792 3300048905 Bacteria 10507
842 Ga0496102_0037882 3300048905 Bacteria 4349
843 Ga0496102_0066081 3300048905 Bacteria 3315
844 Ga0496102_0909752 3300048905 Bacteria 801
845 Ga0496103_0064463 3300048906 Bacteria 2284
846 Ga0496103_0089519 3300048906 Bacteria 1941
847 Ga0496103_0147041 3300048906 Bacteria 1509
848 Ga0496103_0195361 3300048906 Bacteria 1301
849 Ga0496104_0003629 3300048907 Bacteria 13335
850 Ga0496104_0009841 3300048907 Bacteria 8529
851 Ga0496105_0000532 3300048908 Bacteria 25166
852 Ga0496105_0017523 3300048908 Bacteria 5745
853 Ga0496105_0040985 3300048908 Bacteria 3816
854 Ga0496105_0065362 3300048908 Bacteria 3002
855 Ga0496105_0215109 3300048908 Bacteria 1565
856 Ga0496105_0272564 3300048908 Bacteria 1366
857 Ga0496105_0352779 3300048908 Bacteria 1175
858 Ga0496105_0947768 3300048908 Bacteria 646
859 Ga0496106_0004534 3300048909 Bacteria 10292
860 Ga0496106_0021741 3300048909 Bacteria 4764
861 Ga0496106_0090447 3300048909 Bacteria 2362
862 Ga0496107_0004981 3300048910 Bacteria 9041
863 Ga0496107_0021095 3300048910 Bacteria 4603
864 Ga0496107_0243758 3300048910 Bacteria 1337
865 Ga0496108_0031661 3300048911 Bacteria 4389
866 Ga0496108_0037694 3300048911 Bacteria 4028
867 Ga0496108_0185182 3300048911 Bacteria 1803
868 Ga0496108_0267706 3300048911 Bacteria 1487
869 Ga0496109_0043823 3300048912 Bacteria 4056
870 Ga0496109_0051626 3300048912 Bacteria 3746
871 Ga0496109_0094810 3300048912 Bacteria 2763
872 Ga0496109_0131481 3300048912 Bacteria 2336
873 Ga0496109_0259682 3300048912 Bacteria 1636
874 Ga0496109_0747928 3300048912 Bacteria 915
875 Ga0496110_0017079 3300048913 Bacteria 6066
876 Ga0496110_0067797 3300048913 Bacteria 3157
877 Ga0496110_0112123 3300048913 Bacteria 2452
878 Ga0496111_0019062 3300048914 Bacteria 4760
879 Ga0496111_0097002 3300048914 Bacteria 2164
880 Ga0496111_0328711 3300048914 Bacteria 1132
881 Ga0496112_0022085 3300048915 Bacteria 6060
882 Ga0496112_0038861 3300048915 Bacteria 4649
883 Ga0496112_0088235 3300048915 Bacteria 3069
884 Ga0496112_0096797 3300048915 Bacteria 2922
885 Ga0496112_0109369 3300048915 Bacteria 2734
886 Ga0496113_0004246 3300048916 Bacteria 8772
887 Ga0496113_0479279 3300048916 Bacteria 999
888 Ga0496114_0042370 3300048917 Bacteria 3773
889 Ga0496114_0052696 3300048917 Bacteria 3390
890 Ga0496114_0104830 3300048917 Bacteria 2418
891 Ga0496115_0002752 3300048918 Bacteria 12637
892 Ga0496115_0003734 3300048918 Bacteria 10954
893 Ga0496115_0049284 3300048918 Bacteria 3371
894 Ga0496115_0230125 3300048918 Bacteria 1529
895 Ga0496115_0276600 3300048918 Bacteria 1379
896 Ga0496115_0440419 3300048918 Bacteria 1054
897 Ga0496115_0737571 3300048918 Bacteria 771
898 Ga0496116_0195631 3300048919 Bacteria 1065
899 Ga0496117_0068971 3300048920 Bacteria 2384
900 Ga0496117_0099484 3300048920 Bacteria 1845
901 Ga0496118_0067040 3300048921 Bacteria 2617
902 Ga0496118_0118989 3300048921 Bacteria 1728
903 Ga0496118_0286140 3300048921 Bacteria 914
904 Ga0496119_0002440 3300048922 Bacteria 20413
905 Ga0496119_0025596 3300048922 Bacteria 4116
906 Ga0496121_0000379 3300048924 Bacteria 91131
907 Ga0496121_0002853 3300048924 Bacteria 25499
908 Ga0496121_0033344 3300048924 Bacteria 4661
909 Ga0496121_0058666 3300048924 Bacteria 3179
910 Ga0496121_0090597 3300048924 Bacteria 2390
911 Ga0496121_0094491 3300048924 Bacteria 2326
912 Ga0496123_0142619 3300048926 Bacteria 1307
913 Ga0496124_0054484 3300048927 Bacteria 3385
914 Ga0496124_0058250 3300048927 Bacteria 3250
915 Ga0496125_0012802 3300048928 Bacteria 8293
916 Ga0496125_0113929 3300048928 Bacteria 1949
917 Ga0496125_0270909 3300048928 Bacteria 1058
918 Ga0496126_0005562 3300048929 Bacteria 14331
919 Ga0496126_0024926 3300048929 Bacteria 5767
920 Ga0496126_0025106 3300048929 Bacteria 5740
921 Ga0496126_0036885 3300048929 Bacteria 4567
922 Ga0496126_0088228 3300048929 Bacteria 2732
923 Ga0496126_0099741 3300048929 Bacteria 2543
924 Ga0496126_0104128 3300048929 Bacteria 2479
925 Ga0496126_0105816 3300048929 Bacteria 2456
926 Ga0496126_0222243 3300048929 Bacteria 1586
927 Ga0496126_0245615 3300048929 Bacteria 1493
928 Ga0496126_0254787 3300048929 Bacteria 1461
929 Ga0496126_0292368 3300048929 Bacteria 1347
930 Ga0496126_0343951 3300048929 Bacteria 1221
931 Ga0496126_0570181 3300048929 Bacteria 896
932 Ga0496126_0618543 3300048929 Bacteria 851
933 Ga0495678_068821 3300049459 Bacteria 1304
934 Ga0495682_0033493 3300049460 Bacteria 1896
935 Ga0501031_0233022 3300049568 Bacteria 1198
936 Ga0501032_0000269 3300049569 Bacteria 43721
937 Ga0501033_0000399 3300049570 Bacteria 41761
938 Ga0501034_0000039 3300049571 Bacteria 237357
939 Ga0501036_0004794 3300049572 Bacteria 10934
940 Ga0501037_0000279 3300049573 Bacteria 43594
941 Ga0501038_0000727 3300049574 Bacteria 29411
942 Ga0501039_0007019 3300049575 Bacteria 8574
943 Ga0501042_0262144 3300049578 Bacteria 1248
944 Ga0501043_0000257 3300049579 Bacteria 48196
945 Ga0501046_0006020 3300049580 Bacteria 10788
946 Ga0501047_0002128 3300049581 Bacteria 18968
947 Ga0501047_0120453 3300049581 Bacteria 2506
948 Ga0501047_0163016 3300049581 Bacteria 2101
949 Ga0501048_0000677 3300049582 Bacteria 24715
950 Ga0501067_0000220 3300049583 Bacteria 31959
951 Ga0501067_0017563 3300049583 Bacteria 3960
952 Ga0501067_0088962 3300049583 Bacteria 1714
953 Ga0501068_0006651 3300049584 Bacteria 6381
954 Ga0501069_0020320 3300049585 Bacteria 3597
955 Ga0501070_0022913 3300049586 Bacteria 5227
956 Ga0501070_0051654 3300049586 Bacteria 3412
957 Ga0501070_0925857 3300049586 Bacteria 679
958 Ga0501071_0244725 3300049587 Bacteria 1353
959 Ga0501072_0411408 3300049588 Bacteria 1072
960 Ga0501073_0000103 3300049589 Bacteria 53962
961 Ga0501073_0131724 3300049589 Bacteria 1733
962 Ga0501073_0825548 3300049589 Bacteria 639
963 Ga0501074_0000203 3300049590 Bacteria 32417
964 Ga0501074_0367657 3300049590 Bacteria 1020
965 Ga0501075_0539491 3300049591 Bacteria 890
966 Ga0501076_0293053 3300049592 Bacteria 1333
967 Ga0501079_0005568 3300049741 Bacteria 9399
968 Ga0501080_0002271 3300049742 Bacteria 16721
969 Ga0501080_0025362 3300049742 Bacteria 5501
970 Ga0501081_0961887 3300049743 Bacteria 645
971 Ga0501083_0000213 3300049744 Bacteria 37485
972 Ga0501035_0000523 3300049822 Bacteria 43259
973 Ga0501044_0000435 3300049823 Bacteria 51516
974 Ga0501044_0091934 3300049823 Bacteria 3060
975 Ga0501044_0953539 3300049823 Bacteria 731
976 nmdc:mga03683_4322_c1 3300050489 Bacteria 4698
977 nmdc:mga03n38_101147_c1 3300050490 Bacteria 1390
978 nmdc:mga03n38_150290_c1 3300050490 Bacteria 1171
979 nmdc:mga03n38_16005_c1 3300050490 Bacteria 2909
980 nmdc:mga00v17_356220_c1 3300050491 Bacteria 951
981 nmdc:mga00v17_388605_c1 3300050491 Bacteria 907
982 nmdc:mga0yw44_125079_c1 3300050492 Bacteria 1660
983 nmdc:mga0yw44_190785_c1 3300050492 Bacteria 1352
984 nmdc:mga0yw44_19854_c1 3300050492 Bacteria 3715
985 nmdc:mga0yw44_5033_c1 3300050492 Bacteria 6175
986 nmdc:mga0yw44_75470_c1 3300050492 Bacteria 2102
987 nmdc:mga0yw44_90894_c1 3300050492 Bacteria 1929
988 nmdc:mga0k408_110148_c1 3300050493 Bacteria 1628
989 nmdc:mga0k408_33069_c1 3300050493 Bacteria 2956
990 nmdc:mga06z11_138670_c1 3300050494 Bacteria 1373
991 nmdc:mga06z11_270267_c1 3300050494 Bacteria 1005
992 nmdc:mga06z11_374_c1 3300050494 Bacteria 16845
993 nmdc:mga06z11_41002_c1 3300050494 Bacteria 2314
994 nmdc:mga06z11_527625_c1 3300050494 Bacteria 716
995 nmdc:mga06z11_81738_c1 3300050494 Bacteria 1735
996 nmdc:mga06z11_98945_c1 3300050494 Bacteria 1597
997 nmdc:mga07m45_20854_c1 3300050496 Bacteria 3563
998 nmdc:mga05p37_228831_c1 3300050507 Bacteria 2241
999 nmdc:mga09592_60003_c1 3300050508 Bacteria 3216
1000 nmdc:mga09592_784794_c1 3300050508 Bacteria 806
1001 nmdc:mga0qj67_171885_c1 3300050509 Bacteria 1760
1002 nmdc:mga0n895_227086_c1 3300050512 Bacteria 1895
1003 nmdc:mga0n895_95973_c1 3300050512 Bacteria 2970
1004 nmdc:mga0rr50_139437_c1 3300050513 Bacteria 1949
1005 nmdc:mga0rr50_433086_c1 3300050513 Bacteria 1113
1006 nmdc:mga08x19_576053_c1 3300050514 Bacteria 797
1007 nmdc:mga0a205_178743_c1 3300050515 Bacteria 2016
1008 nmdc:mga0a205_61269_c1 3300050515 Bacteria 3634
1009 nmdc:mga0sz30_22941_c1 3300050516 Bacteria 2536
1010 Ga0495601_0084096 3300053077 Bacteria 2044
1011 Ga0495601_0135232 3300053077 Bacteria 1607
1012 Ga0495601_0333462 3300053077 Bacteria 987
1013 Ga0495612_0007098 3300053078 Bacteria 4585
1014 Ga0495612_0009090 3300053078 Bacteria 4031
1015 Ga0495612_0080707 3300053078 Bacteria 1367
1016 Ga0500610_0305457 3300053079 Bacteria 699
1017 Ga0495655_0002836 3300053083 Bacteria 2791
1018 Ga0495595_0046672 3300053084 Bacteria 1996
1019 Ga0495619_0020964 3300053085 Bacteria 4168
1020 Ga0495619_0194064 3300053085 Bacteria 1406
1021 Ga0500578_0178869 3300053086 Bacteria 1308
1022 Ga0500578_0362817 3300053086 Bacteria 844
1023 Ga0500643_000197 3300053087 Bacteria 57531
1024 Ga0500581_062520 3300053089 Bacteria 1883
1025 Ga0500646_0015819 3300053090 Bacteria 1967
1026 Ga0500646_0080622 3300053090 Bacteria 992
1027 Ga0500647_0087469 3300053091 Bacteria 1493
1028 Ga0500583_0020859 3300053092 Bacteria 2713
1029 Ga0500651_0028346 3300053093 Bacteria 3522
1030 Ga0500651_0233440 3300053093 Bacteria 1075
1031 Ga0500651_0248833 3300053093 Bacteria 1034
1032 Ga0500566_0000008 3300053094 Bacteria 143641
1033 Ga0500566_0000102 3300053094 Bacteria 43512
1034 Ga0500566_0005439 3300053094 Bacteria 7576
1035 Ga0500640_000058 3300053095 Bacteria 17553
1036 Ga0500641_0000868 3300053096 Bacteria 10795
1037 Ga0500641_0002877 3300053096 Bacteria 6105
1038 Ga0500641_0005542 3300053096 Bacteria 4471
1039 Ga0500641_0253529 3300053096 Bacteria 737
1040 Ga0500555_000761 3300053103 Bacteria 11847
1041 Ga0500556_0005792 3300053104 Bacteria 3496
1042 Ga0500557_000029 3300053105 Bacteria 77152
1043 Ga0500562_004449 3300053108 Bacteria 3546
1044 Ga0500562_064385 3300053108 Bacteria 986
1045 Ga0500569_001944 3300053109 Bacteria 4002
1046 Ga0500569_043655 3300053109 Bacteria 1325
1047 Ga0500572_000050 3300053111 Bacteria 35855
1048 Ga0500594_0056242 3300053118 Bacteria 1122
1049 Ga0500595_000327 3300053119 Bacteria 31289
1050 Ga0500595_002045 3300053119 Bacteria 10305
1051 Ga0500595_021852 3300053119 Bacteria 2277
1052 Ga0500595_026464 3300053119 Bacteria 1998
1053 Ga0500614_001235 3300053123 Bacteria 6228
1054 Ga0500642_0000241 3300053130 Bacteria 21103
1055 Ga0500658_0059353 3300053134 Bacteria 1587
1056 Ga0500559_0012776 3300053136 Bacteria 3564
1057 Ga0500559_0065227 3300053136 Bacteria 1631
1058 Ga0500559_0077370 3300053136 Bacteria 1507
1059 Ga0500568_0007903 3300053139 Bacteria 5177
1060 Ga0500568_0022500 3300053139 Bacteria 2694
1061 Ga0500568_0064410 3300053139 Bacteria 1412
1062 Ga0500577_0020215 3300053142 Bacteria 2174
1063 Ga0500588_0031385 3300053146 Bacteria 1533
1064 Ga0500589_053434 3300053147 Bacteria 1869
1065 Ga0500590_077746 3300053148 Bacteria 1637
1066 Ga0500603_000040 3300053150 Bacteria 30803
1067 Ga0500603_000999 3300053150 Bacteria 6657
1068 Ga0500603_089254 3300053150 Bacteria 903
1069 Ga0500604_0062743 3300053151 Bacteria 1170
1070 Ga0500604_0082535 3300053151 Bacteria 1040
1071 Ga0500616_0015546 3300053153 Bacteria 4349
1072 Ga0500619_046631 3300053154 Bacteria 1390
1073 Ga0500622_0006790 3300053156 Bacteria 6584
1074 Ga0500630_002184 3300053159 Bacteria 9456
1075 Ga0500634_0084986 3300053161 Bacteria 1620
1076 Ga0500638_004687 3300053162 Bacteria 5324
1077 Ga0500638_215201 3300053162 Bacteria 801
1078 Ga0500639_000010 3300053163 Bacteria 136747
1079 Ga0500636_0025748 3300053177 Bacteria 3477
1080 Ga0500636_0126980 3300053177 Bacteria 1425
1081 Ga0500636_0368282 3300053177 Bacteria 679
1082 Ga0500637_0000084 3300053178 Bacteria 33745
1083 Ga0500637_0002664 3300053178 Bacteria 7997
1084 Ga0500637_0126638 3300053178 Bacteria 1481
1085 Ga0500625_017306 3300053729 Bacteria 3366
1086 Ga0500645_091333 3300053730 Bacteria 863
1087 Ga0500552_012288 3300053733 Bacteria 1092
1088 Ga0500596_000151 3300053735 Bacteria 10667
1089 Ga0500599_004187 3300053736 Bacteria 1781
1090 Ga0500601_000123 3300053737 Bacteria 15976
1091 Ga0500601_006858 3300053737 Bacteria 1259
1092 Ga0500661_000153 3300055283 Bacteria 11809
1093 Ga0501082_0029219 3300060353 Bacteria 4748
1094 Ga0501082_0186594 3300060353 Bacteria 1804
1095 Ga0466962_0029471 3300061719 Bacteria 2628

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046475 Ga0495639_0073169 Ga0495639_0073169_821_1384 185
2 3300047321 Ga0495676_0218471 Ga0495676_0218471_710_1273 186
3 3300046455 Ga0495603_0117629 Ga0495603_0117629_708_1448 187
4 3300013307 Ga0157372_10117449 Ga0157372_101174492 196
5 3300006177 Ga0075362_10189600 Ga0075362_101896001 197
6 3300048911 Ga0496108_0267706 Ga0496108_0267706_43_720 197
7 3300005937 Ga0081455_10627158 Ga0081455_106271581 198
8 iso_pu_bacteria 2508501128 2509147122 198
9 iso_pu_bacteria 2513237104 2513716855 198
10 iso_pu_bacteria 2513237141 2513894540 198
11 3300006038 Ga0075365_10036146 Ga0075365_100361463 199
12 3300006042 Ga0075368_10016671 Ga0075368_100166712 199
13 3300006048 Ga0075363_100063181 Ga0075363_1000631812 199
14 3300006177 Ga0075362_10065808 Ga0075362_100658082 199
15 3300006178 Ga0075367_10021204 Ga0075367_100212043 199
16 3300006195 Ga0075366_10017172 Ga0075366_100171724 199
17 3300027866 Ga0209813_10063594 Ga0209813_100635942 199
18 3300028381 Ga0268264_10477128 Ga0268264_104771282 199
19 3300049823 Ga0501044_0091934 Ga0501044_0091934_2200_2802 199
20 3300050489 nmdc:mga03683_4322_c1 nmdc:mga03683_4322_c1_3889_4488 199
21 3300050490 nmdc:mga03n38_101147_c1 nmdc:mga03n38_101147_c1_648_1247 199
22 3300050491 nmdc:mga00v17_356220_c1 nmdc:mga00v17_356220_c1_90_689 199
23 3300050492 nmdc:mga0yw44_190785_c1 nmdc:mga0yw44_190785_c1_290_889 199
24 3300050494 nmdc:mga06z11_98945_c1 nmdc:mga06z11_98945_c1_176_775 199
25 3300053096 Ga0500641_0000868 Ga0500641_0000868_9273_9872 199
26 iso_pu_bacteria 2507262055 2507510939 199
27 iso_pu_bacteria 2508501009 2508544758 199
28 iso_pu_bacteria 2508501042 2508697015 199
29 iso_pu_bacteria 2511231028 2511400441 199
30 iso_pu_bacteria 2513237094 2513637546 199
31 iso_pu_bacteria 2513237095 2513649614 199
32 iso_pu_bacteria 2513237096 2513654972 199
33 iso_pu_bacteria 2513237098 2513671109 199
34 iso_pu_bacteria 2513237101 2513697379 199
35 iso_pu_bacteria 2513237137 2513861231 199
36 iso_pu_bacteria 2513237139 2513874595 199
37 iso_pu_bacteria 2513237145 2513916005 199
38 iso_pu_bacteria 2513237161 2514015501 199
39 iso_pu_bacteria 2515154112 2515625515 199
40 iso_pu_bacteria 2517093001 2517100525 199
41 iso_pu_bacteria 2517572143 2517894692 199
42 iso_pu_bacteria 2524023205 2524437389 199
43 iso_pu_bacteria 2524023210 2524464032 199
44 iso_pu_bacteria 2524023228 2524534432 199
45 iso_pu_bacteria 2528768022 2528849891 199
46 iso_pu_bacteria 2617270741 2617377895 199
47 iso_pu_bacteria 2667528175 2671119114 199
48 iso_pu_bacteria 2721755755 2723843125 199
49 iso_pu_bacteria 2728368998 2728747651 199
50 iso_pu_bacteria 2744054633 2745076867 199
51 iso_pu_bacteria 2791355196 2793064604 199
52 iso_pu_bacteria 2791355197 2793071162 199
53 iso_pu_bacteria 2791355199 2793079471 199
54 iso_pu_bacteria 2802429603 2805916591 199
55 iso_pu_bacteria 2816332527 2818238085 199
56 iso_pu_bacteria 2824661429 2824667504 199
57 iso_pu_bacteria 2824696289 2824702345 199
58 iso_pu_bacteria 2824704595 2824709813 199
59 iso_pu_bacteria 2824746037 2824753064 199
60 iso_pu_bacteria 2824753945 2824760991 199
61 iso_pu_bacteria 2824763712 2824770580 199
62 iso_pu_bacteria 2844315083 2844316978 199
63 iso_pu_bacteria 2847939898 2847944296 199
64 iso_pu_bacteria 2879099564 2879102037 199
65 iso_pu_bacteria 2885374607 2885383352 199
66 iso_pu_bacteria 2885383462 2885385706 199
67 iso_pu_bacteria 2903727486 2903734025 199
68 iso_pu_bacteria 2903748898 2903757880 199
69 iso_pu_bacteria 2903768456 2903778046 199
70 iso_pu_bacteria 2904690495 2904696975 199
71 iso_pu_bacteria 2904699407 2904705726 199
72 iso_pu_bacteria 2904711408 2904719147 199
73 iso_pu_bacteria 2906602504 2906604641 199
74 iso_pu_bacteria 2906610324 2906611419 199
75 iso_pu_bacteria 2906635258 2906641017 199
76 iso_pu_bacteria 2906643746 2906650335 199
77 iso_pu_bacteria 2906660503 2906660850 199
78 iso_pu_bacteria 2908739725 2908745005 199
79 iso_pu_bacteria 2908756301 2908762757 199
80 iso_pu_bacteria 2908775508 2908782055 199
81 iso_pu_bacteria 2922368715 2922371266 199
82 iso_pu_bacteria 2922386360 2922390275 199
83 iso_pu_bacteria 2922425934 2922427948 199
84 iso_pu_bacteria 2929615660 2929619648 199
85 iso_pu_bacteria 2929624759 2929627881 199
86 iso_pu_bacteria 2932784394 2932785979 199
87 iso_pu_bacteria 2932794094 2932798249 199
88 iso_pu_bacteria 2932801729 2932804046 199
89 iso_pu_bacteria 2932809354 2932817074 199
90 iso_pu_bacteria 2932818245 2932822435 199
91 iso_pu_bacteria 2932828146 2932831023 199
92 iso_pu_bacteria 2933577622 2933581567 199
93 iso_pu_bacteria 2935608549 2935612831 199
94 iso_pu_bacteria 2935616580 2935624189 199
95 iso_pu_bacteria 2935630451 2935632133 199
96 iso_pu_bacteria 2935638405 2935640165 199
97 iso_pu_bacteria 2935648319 2935655378 199
98 iso_pu_bacteria 2935656913 2935664321 199
99 iso_pu_bacteria 2935665750 2935666997 199
100 iso_pu_bacteria 2935675223 2935680362 199
101 iso_pu_bacteria 2935684952 2935690128 199
102 iso_pu_bacteria 2935694250 2935699787 199
103 iso_pu_bacteria 2935703347 2935704752 199
104 iso_pu_bacteria 2935713505 2935722159 199
105 iso_pu_bacteria 2935722832 2935731469 199
106 iso_pu_bacteria 2935732158 2935735443 199
107 iso_pu_bacteria 2935741537 2935745286 199
108 iso_pu_bacteria 2935750917 2935755139 199
109 iso_pu_bacteria 2935760218 2935762344 199
110 iso_pu_bacteria 2935801545 2935803845 199
111 iso_pu_bacteria 2935810662 2935811761 199
112 iso_pu_bacteria 2935819856 2935824319 199
113 iso_pu_bacteria 2935827899 2935829648 199
114 iso_pu_bacteria 2935837841 2935843020 199
115 iso_pu_bacteria 2935847175 2935852536 199
116 iso_pu_bacteria 2935855204 2935862311 199
117 iso_pu_bacteria 2935864058 2935870446 199
118 iso_pu_bacteria 2935873716 2935881028 199
119 iso_pu_bacteria 2935883170 2935884150 199
120 iso_pu_bacteria 2935908558 2935912317 199
121 iso_pu_bacteria 2935916978 2935924009 199
122 iso_pu_bacteria 2935926038 2935929346 199
123 iso_pu_bacteria 2935934488 2935935977 199
124 iso_pu_bacteria 2935942939 2935949877 199
125 iso_pu_bacteria 2935951376 2935957357 199
126 iso_pu_bacteria 2935967501 2935968388 199
127 iso_pu_bacteria 2935975950 2935976572 199
128 iso_pu_bacteria 2935984226 2935987979 199
129 iso_pu_bacteria 2935992306 2935993525 199
130 iso_pu_bacteria 2936002035 2936004421 199
131 iso_pu_bacteria 2936011229 2936018391 199
132 iso_pu_bacteria 2936019824 2936026846 199
133 iso_pu_bacteria 2936028420 2936035790 199
134 iso_pu_bacteria 2936037263 2936038344 199
135 iso_pu_bacteria 2936046547 2936053869 199
136 iso_pu_bacteria 2936055302 2936058683 199
137 iso_pu_bacteria 2940556831 2940561581 199
138 iso_pu_bacteria 2941507105 2941508081 199
139 iso_pu_bacteria 2941515067 2941515414 199
140 iso_pu_bacteria 2941523033 2941524011 199
141 iso_pu_bacteria 2941531003 2941533759 199
142 iso_pu_bacteria 2941538514 2941544244 199
143 iso_pu_bacteria 3005474847 3005477656 199
144 iso_pu_bacteria 3005506211 3005507189 199
145 iso_pu_bacteria 3005594810 3005596618 199
146 iso_pu_bacteria 3005710791 3005712690 199
147 iso_pu_bacteria 3005718088 3005719735 199
148 iso_pu_bacteria 8006933436 8006933562 199
149 iso_pu_bacteria 8006964411 8006966480 199
150 iso_pu_bacteria 8006973647 8006983235 199
151 iso_pu_bacteria 8006984368 8006989308 199
152 iso_pu_bacteria 8006994254 8006997789 199
153 iso_pu_bacteria 8016511872 8016516361 199
154 iso_pu_bacteria 8016583857 8016589218 199
155 iso_pu_bacteria 8016630954 8016633768 199
156 iso_pu_bacteria 8017057580 8017060175 199
157 iso_pu_bacteria 8019555841 8019559489 199
158 iso_pu_bacteria 8019565922 8019569591 199
159 iso_pu_bacteria 8019576017 8019579692 199
160 iso_pu_bacteria 8019586578 8019587405 199
161 iso_pu_bacteria 8019597564 8019603939 199
162 iso_pu_bacteria 8019608314 8019614593 199
163 iso_pu_bacteria 8019619141 8019625224 199
164 iso_pu_bacteria 8019629233 8019636957 199
165 iso_pu_bacteria 8019638758 8019642652 199
166 iso_pu_bacteria 8019648815 8019649944 199
167 iso_pu_bacteria 8019659431 8019664787 199
168 iso_pu_bacteria 8019668869 8019674360 199
169 iso_pu_bacteria 8019687851 8019694028 199
170 iso_pu_bacteria 8055742211 8055749096 199
171 iso_pu_bacteria 8056673599 8056674824 199
172 iso_pu_bacteria 8056681323 8056682421 199
173 iso_pu_bacteria 8056689827 8056695119 199
174 iso_pu_bacteria 8056967851 8056969953 199
175 3300005468 Ga0070707_100725866 Ga0070707_1007258662 200
176 3300009177 Ga0105248_10051252 Ga0105248_100512522 200
177 3300009551 Ga0105238_10562419 Ga0105238_105624192 200
178 3300011119 Ga0105246_10035501 Ga0105246_100355014 200
179 3300013105 Ga0157369_10368991 Ga0157369_103689912 200
180 3300013297 Ga0157378_11217780 Ga0157378_112177801 200
181 3300037853 Ga0436364_0342298 Ga0436364_0342298_1841_2446 200
182 3300041413 Ga0439465_0064550 Ga0439465_0064550_573_1175 200
183 3300042016 Ga0439463_040713 Ga0439463_040713_127_729 200
184 3300044658 Ga0466972_0000185 Ga0466972_0000185_27375_27977 200
185 3300044683 Ga0466965_0035908 Ga0466965_0035908_1450_2052 200
186 3300044735 Ga0466968_0291324 Ga0466968_0291324_56_658 200
187 3300046459 Ga0495629_0079747 Ga0495629_0079747_207_809 200
188 3300046474 Ga0495605_0177445 Ga0495605_0177445_242_844 200
189 3300046491 Ga0495584_0107053 Ga0495584_0107053_148_750 200
190 3300046491 Ga0495584_0173646 Ga0495584_0173646_442_1047 200
191 3300046500 Ga0495596_0014778 Ga0495596_0014778_2433_3035 200
192 3300046501 Ga0495607_0170161 Ga0495607_0170161_418_1020 200
193 3300046507 Ga0495606_0190609 Ga0495606_0190609_303_905 200
194 3300046523 Ga0495644_0149016 Ga0495644_0149016_68_670 200
195 3300046524 Ga0495648_0201389 Ga0495648_0201389_62_664 200
196 3300046528 Ga0495642_0258900 Ga0495642_0258900_74_676 200
197 3300046615 Ga0495656_0027153 Ga0495656_0027153_1237_1839 200
198 3300046616 Ga0495668_0101566 Ga0495668_0101566_504_1106 200
199 3300046660 Ga0495625_0214830 Ga0495625_0214830_614_1216 200
200 3300046664 Ga0495659_0347327 Ga0495659_0347327_15_617 200
201 3300046684 Ga0495669_0084784 Ga0495669_0084784_440_1042 200
202 3300046691 Ga0495670_0277530 Ga0495670_0277530_67_672 200
203 3300047323 Ga0495683_0058399 Ga0495683_0058399_1249_1851 200
204 3300047445 Ga0495677_0044535 Ga0495677_0044535_812_1414 200
205 3300047472 Ga0495686_0030828 Ga0495686_0030828_600_1202 200
206 3300047472 Ga0495686_0233030 Ga0495686_0233030_379_981 200
207 3300048906 Ga0496103_0147041 Ga0496103_0147041_897_1499 200
208 3300048908 Ga0496105_0352779 Ga0496105_0352779_446_1048 200
209 3300048910 Ga0496107_0243758 Ga0496107_0243758_367_969 200
210 3300048911 Ga0496108_0185182 Ga0496108_0185182_876_1478 200
211 3300048912 Ga0496109_0259682 Ga0496109_0259682_52_660 200
212 3300048912 Ga0496109_0747928 Ga0496109_0747928_213_815 200
213 3300048919 Ga0496116_0195631 Ga0496116_0195631_438_1040 200
214 3300048920 Ga0496117_0068971 Ga0496117_0068971_672_1274 200
215 3300048924 Ga0496121_0033344 Ga0496121_0033344_3605_4207 200
216 3300048924 Ga0496121_0058666 Ga0496121_0058666_1049_1651 200
217 3300048927 Ga0496124_0058250 Ga0496124_0058250_1113_1715 200
218 3300048928 Ga0496125_0113929 Ga0496125_0113929_1018_1620 200
219 3300048929 Ga0496126_0025106 Ga0496126_0025106_2702_3304 200
220 3300048929 Ga0496126_0088228 Ga0496126_0088228_342_944 200
221 3300049459 Ga0495678_068821 Ga0495678_068821_251_853 200
222 3300050490 nmdc:mga03n38_16005_c1 nmdc:mga03n38_16005_c1_2230_2832 200
223 3300050491 nmdc:mga00v17_388605_c1 nmdc:mga00v17_388605_c1_192_794 200
224 3300050492 nmdc:mga0yw44_19854_c1 nmdc:mga0yw44_19854_c1_2081_2689 200
225 3300050492 nmdc:mga0yw44_75470_c1 nmdc:mga0yw44_75470_c1_1157_1759 200
226 3300050493 nmdc:mga0k408_110148_c1 nmdc:mga0k408_110148_c1_221_823 200
227 3300050493 nmdc:mga0k408_33069_c1 nmdc:mga0k408_33069_c1_1906_2508 200
228 3300050494 nmdc:mga06z11_138670_c1 nmdc:mga06z11_138670_c1_444_1046 200
229 3300050494 nmdc:mga06z11_81738_c1 nmdc:mga06z11_81738_c1_543_1145 200
230 3300050496 nmdc:mga07m45_20854_c1 nmdc:mga07m45_20854_c1_2328_2930 200
231 3300050508 nmdc:mga09592_784794_c1 nmdc:mga09592_784794_c1_174_776 200
232 3300050512 nmdc:mga0n895_227086_c1 nmdc:mga0n895_227086_c1_1221_1823 200
233 3300050516 nmdc:mga0sz30_22941_c1 nmdc:mga0sz30_22941_c1_809_1411 200
234 3300053086 Ga0500578_0362817 Ga0500578_0362817_214_816 200
235 3300053089 Ga0500581_062520 Ga0500581_062520_802_1404 200
236 3300053090 Ga0500646_0015819 Ga0500646_0015819_401_1003 200
237 3300053092 Ga0500583_0020859 Ga0500583_0020859_246_848 200
238 3300053093 Ga0500651_0233440 Ga0500651_0233440_112_714 200
239 3300053096 Ga0500641_0005542 Ga0500641_0005542_324_926 200
240 3300053103 Ga0500555_000761 Ga0500555_000761_3544_4146 200
241 3300053108 Ga0500562_064385 Ga0500562_064385_122_724 200
242 3300053109 Ga0500569_043655 Ga0500569_043655_46_648 200
243 3300053119 Ga0500595_021852 Ga0500595_021852_1392_1994 200
244 3300053119 Ga0500595_026464 Ga0500595_026464_134_736 200
245 3300053146 Ga0500588_0031385 Ga0500588_0031385_341_943 200
246 3300053150 Ga0500603_089254 Ga0500603_089254_265_867 200
247 3300053151 Ga0500604_0062743 Ga0500604_0062743_401_1003 200
248 3300053153 Ga0500616_0015546 Ga0500616_0015546_3124_3726 200
249 3300053161 Ga0500634_0084986 Ga0500634_0084986_969_1571 200
250 3300053178 Ga0500637_0126638 Ga0500637_0126638_205_807 200
251 3300053730 Ga0500645_091333 Ga0500645_091333_247_849 200
252 3300003203 JGI25406J46586_10002021 JGI25406J46586_100020213 201
253 3300003322 rootL2_10198724 rootL2_101987241 201
254 3300003323 rootH1_10224479 rootH1_102244792 201
255 3300003659 JGI25404J52841_10000868 JGI25404J52841_100008682 201
256 3300003659 JGI25404J52841_10062363 JGI25404J52841_100623631 201
257 3300005439 Ga0070711_100153320 Ga0070711_1001533202 201
258 3300005539 Ga0068853_100119521 Ga0068853_1001195212 201
259 3300005563 Ga0068855_100327963 Ga0068855_1003279631 201
260 3300005577 Ga0068857_100514516 Ga0068857_1005145161 201
261 3300005983 Ga0081540_1005220 Ga0081540_10052203 201
262 3300005983 Ga0081540_1212295 Ga0081540_12122951 201
263 3300005985 Ga0081539_10002516 Ga0081539_1000251623 201
264 3300005985 Ga0081539_10043336 Ga0081539_100433362 201
265 3300006175 Ga0070712_100261990 Ga0070712_1002619902 201
266 3300006844 Ga0075428_101376576 Ga0075428_1013765761 201
267 3300009545 Ga0105237_10283706 Ga0105237_102837062 201
268 3300009551 Ga0105238_10036806 Ga0105238_100368063 201
269 3300009551 Ga0105238_10330068 Ga0105238_103300682 201
270 3300010375 Ga0105239_10757708 Ga0105239_107577082 201
271 3300013296 Ga0157374_10800889 Ga0157374_108008891 201
272 3300025898 Ga0207692_10005899 Ga0207692_100058993 201
273 3300025906 Ga0207699_10049665 Ga0207699_100496653 201
274 3300025915 Ga0207693_10048463 Ga0207693_100484633 201
275 3300025924 Ga0207694_10351438 Ga0207694_103514382 201
276 3300025939 Ga0207665_10468350 Ga0207665_104683502 201
277 3300025949 Ga0207667_10606710 Ga0207667_106067102 201
278 3300026116 Ga0207674_10368732 Ga0207674_103687322 201
279 3300031616 Ga0307508_10133366 Ga0307508_101333662 201
280 3300045976 Ga0466967_0749416 Ga0466967_0749416_60_665 201
281 3300048929 Ga0496126_0024926 Ga0496126_0024926_1461_2069 201
282 3300003323 rootH1_10140860 rootH1_101408601 202
283 3300003659 JGI25404J52841_10007121 JGI25404J52841_100071212 202
284 3300005327 Ga0070658_10435416 Ga0070658_104354161 202
285 3300005329 Ga0070683_100012766 Ga0070683_1000127663 202
286 3300005336 Ga0070680_100047681 Ga0070680_1000476813 202
287 3300005434 Ga0070709_10000324 Ga0070709_1000032422 202
288 3300005435 Ga0070714_100055285 Ga0070714_1000552852 202
289 3300005436 Ga0070713_100059037 Ga0070713_1000590374 202
290 3300005437 Ga0070710_10004545 Ga0070710_100045452 202
291 3300005439 Ga0070711_100005717 Ga0070711_1000057174 202
292 3300005458 Ga0070681_10044524 Ga0070681_100445242 202
293 3300005458 Ga0070681_10105694 Ga0070681_101056943 202
294 3300005530 Ga0070679_100044114 Ga0070679_1000441142 202
295 3300005530 Ga0070679_100078665 Ga0070679_1000786653 202
296 3300005535 Ga0070684_100002379 Ga0070684_1000023793 202
297 3300005539 Ga0068853_100364061 Ga0068853_1003640612 202
298 3300005563 Ga0068855_100012351 Ga0068855_1000123514 202
299 3300005563 Ga0068855_100293910 Ga0068855_1002939102 202
300 3300005937 Ga0081455_10001565 Ga0081455_100015652 202
301 3300005937 Ga0081455_10011569 Ga0081455_100115694 202
302 3300005937 Ga0081455_10023918 Ga0081455_100239187 202
303 3300005937 Ga0081455_10284251 Ga0081455_102842511 202
304 3300005983 Ga0081540_1001316 Ga0081540_100131615 202
305 3300005983 Ga0081540_1002055 Ga0081540_10020557 202
306 3300005983 Ga0081540_1003766 Ga0081540_10037663 202
307 3300005985 Ga0081539_10071980 Ga0081539_100719803 202
308 3300006028 Ga0070717_10110584 Ga0070717_101105842 202
309 3300006173 Ga0070716_100001795 Ga0070716_1000017953 202
310 3300006175 Ga0070712_100028537 Ga0070712_1000285372 202
311 3300006175 Ga0070712_100388878 Ga0070712_1003888781 202
312 3300006237 Ga0097621_100509455 Ga0097621_1005094552 202
313 3300006358 Ga0068871_100228886 Ga0068871_1002288862 202
314 3300006914 Ga0075436_100607155 Ga0075436_1006071552 202
315 3300007076 Ga0075435_100582548 Ga0075435_1005825482 202
316 3300007788 Ga0099795_10006561 Ga0099795_100065612 202
317 3300009093 Ga0105240_10332078 Ga0105240_103320782 202
318 3300009174 Ga0105241_10231558 Ga0105241_102315582 202
319 3300010159 Ga0099796_10156582 Ga0099796_101565821 202
320 3300013104 Ga0157370_10137706 Ga0157370_101377062 202
321 3300013105 Ga0157369_10469407 Ga0157369_104694072 202
322 3300013297 Ga0157378_10476080 Ga0157378_104760802 202
323 3300013307 Ga0157372_10044995 Ga0157372_100449953 202
324 3300021384 Ga0213876_10016320 Ga0213876_100163202 202
325 3300021441 Ga0213871_10013056 Ga0213871_100130561 202
326 3300025898 Ga0207692_10006552 Ga0207692_100065522 202
327 3300025906 Ga0207699_10001062 Ga0207699_100010625 202
328 3300025909 Ga0207705_10688904 Ga0207705_106889041 202
329 3300025912 Ga0207707_10003996 Ga0207707_100039965 202
330 3300025912 Ga0207707_10012694 Ga0207707_100126942 202
331 3300025912 Ga0207707_10025470 Ga0207707_100254702 202
332 3300025912 Ga0207707_10706916 Ga0207707_107069161 202
333 3300025913 Ga0207695_10198040 Ga0207695_101980402 202
334 3300025915 Ga0207693_10008114 Ga0207693_100081142 202
335 3300025915 Ga0207693_10185455 Ga0207693_101854552 202
336 3300025916 Ga0207663_10007196 Ga0207663_100071963 202
337 3300025917 Ga0207660_10046064 Ga0207660_100460642 202
338 3300025917 Ga0207660_10129366 Ga0207660_101293662 202
339 3300025921 Ga0207652_10081505 Ga0207652_100815053 202
340 3300025928 Ga0207700_10033953 Ga0207700_100339534 202
341 3300025929 Ga0207664_10004165 Ga0207664_100041656 202
342 3300025939 Ga0207665_10053611 Ga0207665_100536112 202
343 3300025939 Ga0207665_10228528 Ga0207665_102285282 202
344 3300025944 Ga0207661_10018159 Ga0207661_100181594 202
345 3300025949 Ga0207667_10050410 Ga0207667_100504102 202
346 3300026041 Ga0207639_10084602 Ga0207639_100846022 202
347 3300026041 Ga0207639_10950287 Ga0207639_109502871 202
348 3300026121 Ga0207683_10605963 Ga0207683_106059631 202
349 3300026121 Ga0207683_10757070 Ga0207683_107570701 202
350 3300026121 Ga0207683_11033378 Ga0207683_110333781 202
351 3300031548 Ga0307408_101071979 Ga0307408_1010719791 202
352 3300031548 Ga0307408_101278836 Ga0307408_1012788361 202
353 3300032002 Ga0307416_100617515 Ga0307416_1006175152 202
354 3300035086 Ga0373934_0044104 Ga0373934_0044104_487_1098 202
355 3300035113 Ga0373936_0060858 Ga0373936_0060858_55_663 202
356 3300035116 Ga0373945_0001490 Ga0373945_0001490_2451_3062 202
357 3300035117 Ga0373953_0009791 Ga0373953_0009791_1702_2313 202
358 3300035118 Ga0373954_0017839 Ga0373954_0017839_2044_2655 202
359 3300035170 Ga0373943_0106955 Ga0373943_0106955_227_838 202
360 3300035171 Ga0373946_0008010 Ga0373946_0008010_34_645 202
361 3300035172 Ga0373955_0172016 Ga0373955_0172016_148_759 202
362 3300035410 Ga0373924_0004508 Ga0373924_0004508_416_1027 202
363 3300035692 Ga0373935_0030424 Ga0373935_0030424_270_881 202
364 3300035724 Ga0373933_0001647 Ga0373933_0001647_4469_5077 202
365 3300035725 Ga0373947_0043950 Ga0373947_0043950_306_917 202
366 3300036401 Ga0373937_0029135 Ga0373937_0029135_3534_4145 202
367 3300037068 Ga0373925_0011894 Ga0373925_0011894_2188_2799 202
368 3300037068 Ga0373925_0188082 Ga0373925_0188082_325_936 202
369 3300037312 Ga0395899_0010190 Ga0395899_0010190_5971_6624 202
370 3300037466 Ga0395898_0002370 Ga0395898_0002370_16378_17031 202
371 3300038443 Ga0395901_0003499 Ga0395901_0003499_4096_4749 202
372 3300039437 Ga0436365_1283571 Ga0436365_1283571_12831_13439 202
373 3300039438 Ga0436360_0872612 Ga0436360_0872612_1442_2062 202
374 3300039438 Ga0436360_0895214 Ga0436360_0895214_92_706 202
375 3300039447 Ga0436361_0216754 Ga0436361_0216754_85_705 202
376 3300039447 Ga0436361_0539604 Ga0436361_0539604_536_1156 202
377 3300039450 Ga0436363_0843641 Ga0436363_0843641_185_793 202
378 3300039453 Ga0436362_0365003 Ga0436362_0365003_178_786 202
379 3300039453 Ga0436362_0529262 Ga0436362_0529262_958_1578 202
380 3300045049 Ga0466959_0070752 Ga0466959_0070752_740_1351 202
381 3300046455 Ga0495603_0274637 Ga0495603_0274637_257_868 202
382 3300046459 Ga0495629_0114972 Ga0495629_0114972_846_1457 202
383 3300046471 Ga0495650_0174327 Ga0495650_0174327_115_729 202
384 3300046472 Ga0495580_0005215 Ga0495580_0005215_4875_5486 202
385 3300046473 Ga0495582_0054925 Ga0495582_0054925_1176_1787 202
386 3300046475 Ga0495639_0003015 Ga0495639_0003015_5076_5687 202
387 3300046475 Ga0495639_0076899 Ga0495639_0076899_591_1208 202
388 3300046476 Ga0495662_0044223 Ga0495662_0044223_536_1147 202
389 3300046477 Ga0495664_0098627 Ga0495664_0098627_823_1434 202
390 3300046513 Ga0495616_0050935 Ga0495616_0050935_95_718 202
391 3300046514 Ga0495618_0009386 Ga0495618_0009386_3261_3872 202
392 3300046515 Ga0495620_0140692 Ga0495620_0140692_72_686 202
393 3300046516 Ga0495628_0023039 Ga0495628_0023039_4172_4783 202
394 3300046531 Ga0495665_0308393 Ga0495665_0308393_93_704 202
395 3300046535 Ga0495586_0277101 Ga0495586_0277101_317_928 202
396 3300046543 Ga0495645_0136803 Ga0495645_0136803_25_636 202
397 3300046558 Ga0495633_0177789 Ga0495633_0177789_352_966 202
398 3300046642 Ga0495634_0004673 Ga0495634_0004673_5038_5649 202
399 3300046678 Ga0495599_0160049 Ga0495599_0160049_760_1371 202
400 3300046680 Ga0495646_0024473 Ga0495646_0024473_2647_3258 202
401 3300046683 Ga0495658_0046236 Ga0495658_0046236_1793_2404 202
402 3300046689 Ga0495613_0026734 Ga0495613_0026734_3382_3993 202
403 3300046690 Ga0495624_0039037 Ga0495624_0039037_683_1294 202
404 3300046809 Ga0495600_0044036 Ga0495600_0044036_1248_1859 202
405 3300047315 Ga0495581_0108700 Ga0495581_0108700_560_1171 202
406 3300047319 Ga0495674_0015364 Ga0495674_0015364_1313_1924 202
407 3300047471 Ga0495684_0092044 Ga0495684_0092044_1620_2231 202
408 3300047673 Ga0495593_0013864 Ga0495593_0013864_3363_3974 202
409 3300048926 Ga0496123_0142619 Ga0496123_0142619_686_1297 202
410 3300048929 Ga0496126_0005562 Ga0496126_0005562_3915_4544 202
411 3300048929 Ga0496126_0222243 Ga0496126_0222243_358_966 202
412 3300048929 Ga0496126_0254787 Ga0496126_0254787_512_1120 202
413 3300049583 Ga0501067_0017563 Ga0501067_0017563_2307_2927 202
414 3300049586 Ga0501070_0051654 Ga0501070_0051654_2222_2833 202
415 3300049589 Ga0501073_0131724 Ga0501073_0131724_550_1161 202
416 3300049590 Ga0501074_0367657 Ga0501074_0367657_56_667 202
417 3300049742 Ga0501080_0025362 Ga0501080_0025362_2975_3586 202
418 3300050494 nmdc:mga06z11_374_c1 nmdc:mga06z11_374_c1_5170_5778 202
419 3300050513 nmdc:mga0rr50_433086_c1 nmdc:mga0rr50_433086_c1_410_1024 202
420 3300050514 nmdc:mga08x19_576053_c1 nmdc:mga08x19_576053_c1_55_663 202
421 3300050515 nmdc:mga0a205_178743_c1 nmdc:mga0a205_178743_c1_1031_1684 202
422 3300053077 Ga0495601_0135232 Ga0495601_0135232_890_1501 202
423 3300053078 Ga0495612_0009090 Ga0495612_0009090_1440_2051 202
424 3300053085 Ga0495619_0194064 Ga0495619_0194064_147_758 202
425 3300053094 Ga0500566_0005439 Ga0500566_0005439_6423_7031 202
426 3300053119 Ga0500595_000327 Ga0500595_000327_10352_10960 202
427 3300053136 Ga0500559_0065227 Ga0500559_0065227_821_1429 202
428 3300053139 Ga0500568_0007903 Ga0500568_0007903_1810_2418 202
429 3300053162 Ga0500638_004687 Ga0500638_004687_1144_1752 202
430 3300053177 Ga0500636_0126980 Ga0500636_0126980_503_1111 202
431 3300053178 Ga0500637_0000084 Ga0500637_0000084_5939_6547 202
432 3300055283 Ga0500661_000153 Ga0500661_000153_117_725 202
433 3300002077 JGI24744J21845_10017086 JGI24744J21845_100170862 203
434 3300002244 JGI24742J22300_10012181 JGI24742J22300_100121812 203
435 3300003215 JGI25153J46596_10000432 JGI25153J46596_1000043224 203
436 3300003215 JGI25153J46596_10002180 JGI25153J46596_100021809 203
437 3300003215 JGI25153J46596_10004682 JGI25153J46596_1000468212 203
438 3300003215 JGI25153J46596_10006584 JGI25153J46596_100065847 203
439 3300003354 JGI25160J50197_1000709 JGI25160J50197_10007098 203
440 3300003354 JGI25160J50197_1002513 JGI25160J50197_10025134 203
441 3300003354 JGI25160J50197_1043457 JGI25160J50197_10434571 203
442 3300003659 JGI25404J52841_10022763 JGI25404J52841_100227632 203
443 3300003762 Ga0055542_1005116 Ga0055542_10051164 203
444 3300003771 Ga0055526_1050218 Ga0055526_10502182 203
445 3300003794 Ga0055531_10001452 Ga0055531_1000145215 203
446 3300005262 Ga0065165_1001305 Ga0065165_100130519 203
447 3300005262 Ga0065165_1001628 Ga0065165_10016287 203
448 3300005262 Ga0065165_1011953 Ga0065165_10119532 203
449 3300005262 Ga0065165_1048550 Ga0065165_10485502 203
450 3300005327 Ga0070658_10154929 Ga0070658_101549292 203
451 3300005327 Ga0070658_10636029 Ga0070658_106360291 203
452 3300005334 Ga0068869_100092774 Ga0068869_1000927743 203
453 3300005335 Ga0070666_10065236 Ga0070666_100652362 203
454 3300005337 Ga0070682_100426915 Ga0070682_1004269152 203
455 3300005338 Ga0068868_100510741 Ga0068868_1005107412 203
456 3300005338 Ga0068868_101073500 Ga0068868_1010735001 203
457 3300005339 Ga0070660_100004273 Ga0070660_1000042735 203
458 3300005344 Ga0070661_100133759 Ga0070661_1001337592 203
459 3300005344 Ga0070661_100166016 Ga0070661_1001660162 203
460 3300005347 Ga0070668_100048206 Ga0070668_1000482063 203
461 3300005347 Ga0070668_100077446 Ga0070668_1000774462 203
462 3300005347 Ga0070668_100282659 Ga0070668_1002826592 203
463 3300005347 Ga0070668_100298895 Ga0070668_1002988952 203
464 3300005353 Ga0070669_100092335 Ga0070669_1000923352 203
465 3300005354 Ga0070675_100985946 Ga0070675_1009859461 203
466 3300005355 Ga0070671_100249816 Ga0070671_1002498162 203
467 3300005356 Ga0070674_100274672 Ga0070674_1002746722 203
468 3300005364 Ga0070673_100257228 Ga0070673_1002572282 203
469 3300005364 Ga0070673_100394246 Ga0070673_1003942462 203
470 3300005365 Ga0070688_100062463 Ga0070688_1000624631 203
471 3300005365 Ga0070688_100074393 Ga0070688_1000743932 203
472 3300005367 Ga0070667_100235235 Ga0070667_1002352351 203
473 3300005367 Ga0070667_100550328 Ga0070667_1005503281 203
474 3300005434 Ga0070709_10002143 Ga0070709_100021436 203
475 3300005435 Ga0070714_100039343 Ga0070714_1000393434 203
476 3300005435 Ga0070714_100158596 Ga0070714_1001585962 203
477 3300005436 Ga0070713_100072454 Ga0070713_1000724542 203
478 3300005436 Ga0070713_100079742 Ga0070713_1000797422 203
479 3300005436 Ga0070713_100133978 Ga0070713_1001339782 203
480 3300005436 Ga0070713_100329922 Ga0070713_1003299221 203
481 3300005437 Ga0070710_10061500 Ga0070710_100615002 203
482 3300005439 Ga0070711_100009594 Ga0070711_1000095942 203
483 3300005439 Ga0070711_100013807 Ga0070711_1000138073 203
484 3300005440 Ga0070705_100260842 Ga0070705_1002608422 203
485 3300005455 Ga0070663_100005116 Ga0070663_1000051166 203
486 3300005455 Ga0070663_100011980 Ga0070663_1000119803 203
487 3300005455 Ga0070663_100065337 Ga0070663_1000653373 203
488 3300005455 Ga0070663_100100609 Ga0070663_1001006091 203
489 3300005455 Ga0070663_100359676 Ga0070663_1003596761 203
490 3300005455 Ga0070663_100392510 Ga0070663_1003925102 203
491 3300005455 Ga0070663_100734552 Ga0070663_1007345521 203
492 3300005456 Ga0070678_100062747 Ga0070678_1000627472 203
493 3300005456 Ga0070678_100235325 Ga0070678_1002353252 203
494 3300005456 Ga0070678_100289109 Ga0070678_1002891092 203
495 3300005457 Ga0070662_100065597 Ga0070662_1000655971 203
496 3300005457 Ga0070662_100145189 Ga0070662_1001451891 203
497 3300005458 Ga0070681_10054107 Ga0070681_100541074 203
498 3300005458 Ga0070681_10159140 Ga0070681_101591402 203
499 3300005459 Ga0068867_100047009 Ga0068867_1000470093 203
500 3300005459 Ga0068867_100148110 Ga0068867_1001481102 203
501 3300005471 Ga0070698_100026181 Ga0070698_1000261811 203
502 3300005518 Ga0070699_100468596 Ga0070699_1004685962 203
503 3300005530 Ga0070679_100041981 Ga0070679_1000419812 203
504 3300005530 Ga0070679_100097758 Ga0070679_1000977582 203
505 3300005535 Ga0070684_100019513 Ga0070684_1000195133 203
506 3300005535 Ga0070684_100051309 Ga0070684_1000513093 203
507 3300005535 Ga0070684_100105307 Ga0070684_1001053073 203
508 3300005539 Ga0068853_100233155 Ga0068853_1002331552 203
509 3300005539 Ga0068853_100269387 Ga0068853_1002693872 203
510 3300005539 Ga0068853_100278145 Ga0068853_1002781452 203
511 3300005539 Ga0068853_100380218 Ga0068853_1003802182 203
512 3300005539 Ga0068853_100405323 Ga0068853_1004053232 203
513 3300005543 Ga0070672_100032454 Ga0070672_1000324543 203
514 3300005543 Ga0070672_100193361 Ga0070672_1001933612 203
515 3300005547 Ga0070693_100338802 Ga0070693_1003388022 203
516 3300005548 Ga0070665_100049667 Ga0070665_1000496673 203
517 3300005548 Ga0070665_100073653 Ga0070665_1000736533 203
518 3300005548 Ga0070665_100075172 Ga0070665_1000751722 203
519 3300005549 Ga0070704_100039644 Ga0070704_1000396442 203
520 3300005563 Ga0068855_100011091 Ga0068855_1000110919 203
521 3300005563 Ga0068855_100046970 Ga0068855_1000469702 203
522 3300005563 Ga0068855_100832987 Ga0068855_1008329872 203
523 3300005563 Ga0068855_100901861 Ga0068855_1009018611 203
524 3300005564 Ga0070664_100496340 Ga0070664_1004963401 203
525 3300005577 Ga0068857_100021122 Ga0068857_1000211225 203
526 3300005578 Ga0068854_100066050 Ga0068854_1000660502 203
527 3300005578 Ga0068854_100070200 Ga0068854_1000702002 203
528 3300005614 Ga0068856_100000091 Ga0068856_10000009110 203
529 3300005614 Ga0068856_100043323 Ga0068856_1000433236 203
530 3300005614 Ga0068856_100202648 Ga0068856_1002026482 203
531 3300005614 Ga0068856_100225707 Ga0068856_1002257071 203
532 3300005614 Ga0068856_100348348 Ga0068856_1003483481 203
533 3300005615 Ga0070702_100039568 Ga0070702_1000395683 203
534 3300005616 Ga0068852_100215150 Ga0068852_1002151502 203
535 3300005616 Ga0068852_100908109 Ga0068852_1009081091 203
536 3300005617 Ga0068859_100014165 Ga0068859_1000141654 203
537 3300005617 Ga0068859_100089670 Ga0068859_1000896704 203
538 3300005617 Ga0068859_100375335 Ga0068859_1003753351 203
539 3300005617 Ga0068859_100593503 Ga0068859_1005935032 203
540 3300005618 Ga0068864_100228267 Ga0068864_1002282672 203
541 3300005618 Ga0068864_101067572 Ga0068864_1010675721 203
542 3300005718 Ga0068866_10259068 Ga0068866_102590682 203
543 3300005719 Ga0068861_100010097 Ga0068861_1000100973 203
544 3300005719 Ga0068861_100331473 Ga0068861_1003314732 203
545 3300005834 Ga0068851_10020652 Ga0068851_100206522 203
546 3300005834 Ga0068851_10165377 Ga0068851_101653772 203
547 3300005840 Ga0068870_10014005 Ga0068870_100140054 203
548 3300005840 Ga0068870_10431464 Ga0068870_104314642 203
549 3300005841 Ga0068863_100499699 Ga0068863_1004996991 203
550 3300005842 Ga0068858_100207127 Ga0068858_1002071272 203
551 3300005843 Ga0068860_100229138 Ga0068860_1002291382 203
552 3300005844 Ga0068862_100193040 Ga0068862_1001930402 203
553 3300005844 Ga0068862_100599328 Ga0068862_1005993282 203
554 3300005937 Ga0081455_10048845 Ga0081455_100488452 203
555 3300005981 Ga0081538_10018190 Ga0081538_100181904 203
556 3300005983 Ga0081540_1003177 Ga0081540_10031771 203
557 3300005983 Ga0081540_1035251 Ga0081540_10352513 203
558 3300005983 Ga0081540_1045180 Ga0081540_10451803 203
559 3300005983 Ga0081540_1062702 Ga0081540_10627022 203
560 3300005983 Ga0081540_1067617 Ga0081540_10676171 203
561 3300005985 Ga0081539_10017368 Ga0081539_100173682 203
562 3300006028 Ga0070717_10040796 Ga0070717_100407962 203
563 3300006028 Ga0070717_10151157 Ga0070717_101511572 203
564 3300006038 Ga0075365_10023148 Ga0075365_100231483 203
565 3300006038 Ga0075365_10094148 Ga0075365_100941482 203
566 3300006038 Ga0075365_10125194 Ga0075365_101251942 203
567 3300006042 Ga0075368_10023074 Ga0075368_100230742 203
568 3300006042 Ga0075368_10123748 Ga0075368_101237482 203
569 3300006048 Ga0075363_100011292 Ga0075363_1000112925 203
570 3300006051 Ga0075364_10120161 Ga0075364_101201612 203
571 3300006173 Ga0070716_100094586 Ga0070716_1000945862 203
572 3300006175 Ga0070712_100008170 Ga0070712_1000081703 203
573 3300006175 Ga0070712_100045139 Ga0070712_1000451392 203
574 3300006175 Ga0070712_100147746 Ga0070712_1001477462 203
575 3300006177 Ga0075362_10036149 Ga0075362_100361492 203
576 3300006178 Ga0075367_10026486 Ga0075367_100264861 203
577 3300006178 Ga0075367_10046559 Ga0075367_100465592 203
578 3300006178 Ga0075367_10138714 Ga0075367_101387141 203
579 3300006178 Ga0075367_10151449 Ga0075367_101514492 203
580 3300006178 Ga0075367_10446652 Ga0075367_104466522 203
581 3300006186 Ga0075369_10029760 Ga0075369_100297602 203
582 3300006186 Ga0075369_10211141 Ga0075369_102111411 203
583 3300006195 Ga0075366_10056721 Ga0075366_100567215 203
584 3300006195 Ga0075366_10077813 Ga0075366_100778132 203
585 3300006195 Ga0075366_10090033 Ga0075366_100900332 203
586 3300006353 Ga0075370_10028858 Ga0075370_100288586 203
587 3300006353 Ga0075370_10108112 Ga0075370_101081122 203
588 3300006353 Ga0075370_10193921 Ga0075370_101939211 203
589 3300006353 Ga0075370_10263366 Ga0075370_102633661 203
590 3300006353 Ga0075370_10488411 Ga0075370_104884111 203
591 3300006358 Ga0068871_100065219 Ga0068871_1000652192 203
592 3300006844 Ga0075428_100352923 Ga0075428_1003529232 203
593 3300006844 Ga0075428_100388241 Ga0075428_1003882412 203
594 3300006852 Ga0075433_10112872 Ga0075433_101128722 203
595 3300006871 Ga0075434_100197637 Ga0075434_1001976372 203
596 3300006871 Ga0075434_100234838 Ga0075434_1002348382 203
597 3300006881 Ga0068865_100091839 Ga0068865_1000918392 203
598 3300006881 Ga0068865_100622352 Ga0068865_1006223522 203
599 3300006931 Ga0097620_100014164 Ga0097620_1000141644 203
600 3300006931 Ga0097620_100089668 Ga0097620_1000896684 203
601 3300006931 Ga0097620_100375337 Ga0097620_1003753371 203
602 3300006931 Ga0097620_100593500 Ga0097620_1005935002 203
603 3300006942 Ga0099824_1003225 Ga0099824_10032253 203
604 3300006942 Ga0099824_1015288 Ga0099824_10152885 203
605 3300006943 Ga0099822_1025589 Ga0099822_10255893 203
606 3300007265 Ga0099794_10004324 Ga0099794_100043245 203
607 3300009093 Ga0105240_10006270 Ga0105240_100062703 203
608 3300009093 Ga0105240_10399540 Ga0105240_103995401 203
609 3300009093 Ga0105240_10530153 Ga0105240_105301532 203
610 3300009094 Ga0111539_10039518 Ga0111539_100395182 203
611 3300009094 Ga0111539_10663285 Ga0111539_106632851 203
612 3300009098 Ga0105245_10119877 Ga0105245_101198772 203
613 3300009098 Ga0105245_10580408 Ga0105245_105804082 203
614 3300009098 Ga0105245_11179746 Ga0105245_111797462 203
615 3300009101 Ga0105247_10060832 Ga0105247_100608322 203
616 3300009101 Ga0105247_10485961 Ga0105247_104859611 203
617 3300009147 Ga0114129_10045838 Ga0114129_100458381 203
618 3300009147 Ga0114129_11738208 Ga0114129_117382081 203
619 3300009148 Ga0105243_10085596 Ga0105243_100855962 203
620 3300009148 Ga0105243_10289824 Ga0105243_102898241 203
621 3300009174 Ga0105241_10020501 Ga0105241_100205015 203
622 3300009174 Ga0105241_10039006 Ga0105241_100390062 203
623 3300009174 Ga0105241_10061907 Ga0105241_100619073 203
624 3300009176 Ga0105242_10121787 Ga0105242_101217873 203
625 3300009176 Ga0105242_10713070 Ga0105242_107130701 203
626 3300009177 Ga0105248_10070301 Ga0105248_100703013 203
627 3300009177 Ga0105248_10269930 Ga0105248_102699302 203
628 3300009177 Ga0105248_10985866 Ga0105248_109858662 203
629 3300009545 Ga0105237_10001391 Ga0105237_1000139114 203
630 3300009545 Ga0105237_10003041 Ga0105237_1000304110 203
631 3300009545 Ga0105237_10055891 Ga0105237_100558913 203
632 3300009545 Ga0105237_10436943 Ga0105237_104369432 203
633 3300009551 Ga0105238_10007433 Ga0105238_100074332 203
634 3300009551 Ga0105238_10101444 Ga0105238_101014443 203
635 3300009551 Ga0105238_10224266 Ga0105238_102242662 203
636 3300009553 Ga0105249_10151912 Ga0105249_101519122 203
637 3300009553 Ga0105249_10857413 Ga0105249_108574132 203
638 3300010159 Ga0099796_10026232 Ga0099796_100262322 203
639 3300010375 Ga0105239_10005113 Ga0105239_100051134 203
640 3300010375 Ga0105239_10008417 Ga0105239_100084173 203
641 3300010375 Ga0105239_10564610 Ga0105239_105646102 203
642 3300011119 Ga0105246_10011638 Ga0105246_100116382 203
643 3300011119 Ga0105246_10205378 Ga0105246_102053782 203
644 3300013104 Ga0157370_10060883 Ga0157370_100608832 203
645 3300013104 Ga0157370_11316179 Ga0157370_113161791 203
646 3300013105 Ga0157369_10003636 Ga0157369_100036365 203
647 3300013105 Ga0157369_10007202 Ga0157369_100072025 203
648 3300013296 Ga0157374_10046894 Ga0157374_100468943 203
649 3300013296 Ga0157374_10141279 Ga0157374_101412792 203
650 3300013296 Ga0157374_10453594 Ga0157374_104535941 203
651 3300013297 Ga0157378_10099257 Ga0157378_100992573 203
652 3300013297 Ga0157378_10172702 Ga0157378_101727022 203
653 3300013297 Ga0157378_10280939 Ga0157378_102809392 203
654 3300013297 Ga0157378_10474105 Ga0157378_104741052 203
655 3300013297 Ga0157378_11141698 Ga0157378_111416981 203
656 3300013306 Ga0163162_10079922 Ga0163162_100799222 203
657 3300013306 Ga0163162_10102084 Ga0163162_101020841 203
658 3300013306 Ga0163162_10145155 Ga0163162_101451552 203
659 3300013306 Ga0163162_10234207 Ga0163162_102342072 203
660 3300013306 Ga0163162_10299735 Ga0163162_102997352 203
661 3300013307 Ga0157372_11107729 Ga0157372_111077292 203
662 3300013308 Ga0157375_10028075 Ga0157375_100280751 203
663 3300013308 Ga0157375_10640633 Ga0157375_106406332 203
664 3300014325 Ga0163163_10048811 Ga0163163_100488113 203
665 3300014325 Ga0163163_10752537 Ga0163163_107525371 203
666 3300014325 Ga0163163_11043038 Ga0163163_110430381 203
667 3300014326 Ga0157380_10052903 Ga0157380_100529032 203
668 3300014326 Ga0157380_10531269 Ga0157380_105312692 203
669 3300014968 Ga0157379_10854091 Ga0157379_108540911 203
670 3300014968 Ga0157379_10946769 Ga0157379_109467691 203
671 3300014969 Ga0157376_10083196 Ga0157376_100831963 203
672 3300014969 Ga0157376_10106270 Ga0157376_101062702 203
673 3300014969 Ga0157376_10414208 Ga0157376_104142082 203
674 3300014969 Ga0157376_11607915 Ga0157376_116079151 203
675 3300017792 Ga0163161_10166568 Ga0163161_101665682 203
676 3300017792 Ga0163161_10190471 Ga0163161_101904712 203
677 3300017792 Ga0163161_10820547 Ga0163161_108205471 203
678 3300020082 Ga0206353_10094903 Ga0206353_100949032 203
679 3300021320 Ga0214544_1000026 Ga0214544_100002676 203
680 3300021320 Ga0214544_1027092 Ga0214544_10270922 203
681 3300021321 Ga0214542_1000025 Ga0214542_100002585 203
682 3300021321 Ga0214542_1031522 Ga0214542_10315222 203
683 3300021324 Ga0214545_1000014 Ga0214545_100001493 203
684 3300021327 Ga0214543_1000034 Ga0214543_100003484 203
685 3300021388 Ga0213875_10020469 Ga0213875_100204692 203
686 3300025245 Ga0207425_1020389 Ga0207425_10203892 203
687 3300025254 Ga0209148_1000250 Ga0209148_100025027 203
688 3300025261 Ga0209233_1002562 Ga0209233_10025623 203
689 3300025261 Ga0209233_1004484 Ga0209233_10044843 203
690 3300025261 Ga0209233_1007321 Ga0209233_10073212 203
691 3300025272 Ga0209455_1001255 Ga0209455_10012552 203
692 3300025295 Ga0209564_1003732 Ga0209564_10037327 203
693 3300025297 Ga0209758_1000141 Ga0209758_100014189 203
694 3300025297 Ga0209758_1000324 Ga0209758_100032473 203
695 3300025297 Ga0209758_1000476 Ga0209758_100047646 203
696 3300025297 Ga0209758_1001151 Ga0209758_100115116 203
697 3300025297 Ga0209758_1037257 Ga0209758_10372572 203
698 3300025299 Ga0209256_1023807 Ga0209256_10238072 203
699 3300025299 Ga0209256_1044938 Ga0209256_10449381 203
700 3300025302 Ga0207426_1000523 Ga0207426_100052310 203
701 3300025302 Ga0207426_1000768 Ga0207426_100076811 203
702 3300025302 Ga0207426_1002739 Ga0207426_10027392 203
703 3300025302 Ga0207426_1095774 Ga0207426_10957741 203
704 3300025304 Ga0209257_1001317 Ga0209257_10013173 203
705 3300025315 Ga0207697_10142440 Ga0207697_101424401 203
706 3300025315 Ga0207697_10219247 Ga0207697_102192471 203
707 3300025321 Ga0207656_10051297 Ga0207656_100512972 203
708 3300025711 Ga0207696_1041155 Ga0207696_10411552 203
709 3300025885 Ga0207653_10038609 Ga0207653_100386091 203
710 3300025898 Ga0207692_10115659 Ga0207692_101156592 203
711 3300025898 Ga0207692_10123617 Ga0207692_101236172 203
712 3300025899 Ga0207642_10023275 Ga0207642_100232752 203
713 3300025900 Ga0207710_10043781 Ga0207710_100437812 203
714 3300025901 Ga0207688_10017927 Ga0207688_100179272 203
715 3300025901 Ga0207688_10119736 Ga0207688_101197362 203
716 3300025901 Ga0207688_10147702 Ga0207688_101477021 203
717 3300025901 Ga0207688_10201535 Ga0207688_102015352 203
718 3300025903 Ga0207680_10022446 Ga0207680_100224463 203
719 3300025903 Ga0207680_10065256 Ga0207680_100652562 203
720 3300025904 Ga0207647_10075009 Ga0207647_100750091 203
721 3300025904 Ga0207647_10165006 Ga0207647_101650062 203
722 3300025904 Ga0207647_10258870 Ga0207647_102588702 203
723 3300025904 Ga0207647_10359981 Ga0207647_103599811 203
724 3300025906 Ga0207699_10226048 Ga0207699_102260482 203
725 3300025907 Ga0207645_10014665 Ga0207645_100146652 203
726 3300025907 Ga0207645_10301602 Ga0207645_103016021 203
727 3300025908 Ga0207643_10399467 Ga0207643_103994671 203
728 3300025910 Ga0207684_10184562 Ga0207684_101845622 203
729 3300025910 Ga0207684_10448655 Ga0207684_104486551 203
730 3300025911 Ga0207654_10016235 Ga0207654_100162353 203
731 3300025912 Ga0207707_10008329 Ga0207707_100083297 203
732 3300025912 Ga0207707_10244387 Ga0207707_102443872 203
733 3300025912 Ga0207707_10345815 Ga0207707_103458152 203
734 3300025913 Ga0207695_10000062 Ga0207695_10000062205 203
735 3300025913 Ga0207695_10073392 Ga0207695_100733923 203
736 3300025913 Ga0207695_10415388 Ga0207695_104153882 203
737 3300025913 Ga0207695_10525286 Ga0207695_105252861 203
738 3300025914 Ga0207671_10001205 Ga0207671_1000120512 203
739 3300025914 Ga0207671_10007037 Ga0207671_100070373 203
740 3300025914 Ga0207671_10196302 Ga0207671_101963022 203
741 3300025914 Ga0207671_10321425 Ga0207671_103214252 203
742 3300025914 Ga0207671_10367156 Ga0207671_103671562 203
743 3300025914 Ga0207671_10710762 Ga0207671_107107622 203
744 3300025915 Ga0207693_10004791 Ga0207693_100047912 203
745 3300025915 Ga0207693_10024069 Ga0207693_100240693 203
746 3300025915 Ga0207693_10506875 Ga0207693_105068751 203
747 3300025916 Ga0207663_10037455 Ga0207663_100374552 203
748 3300025916 Ga0207663_10063692 Ga0207663_100636922 203
749 3300025916 Ga0207663_10870846 Ga0207663_108708461 203
750 3300025917 Ga0207660_10001063 Ga0207660_100010637 203
751 3300025917 Ga0207660_10079957 Ga0207660_100799573 203
752 3300025918 Ga0207662_10243912 Ga0207662_102439122 203
753 3300025919 Ga0207657_10001360 Ga0207657_1000136022 203
754 3300025919 Ga0207657_10072567 Ga0207657_100725672 203
755 3300025919 Ga0207657_10240445 Ga0207657_102404452 203
756 3300025919 Ga0207657_10426039 Ga0207657_104260391 203
757 3300025920 Ga0207649_10511938 Ga0207649_105119381 203
758 3300025921 Ga0207652_10003881 Ga0207652_100038813 203
759 3300025921 Ga0207652_10017473 Ga0207652_100174733 203
760 3300025922 Ga0207646_10145117 Ga0207646_101451174 203
761 3300025923 Ga0207681_10493530 Ga0207681_104935302 203
762 3300025923 Ga0207681_10785618 Ga0207681_107856182 203
763 3300025924 Ga0207694_10226680 Ga0207694_102266802 203
764 3300025925 Ga0207650_10354975 Ga0207650_103549751 203
765 3300025925 Ga0207650_10473682 Ga0207650_104736821 203
766 3300025927 Ga0207687_10033271 Ga0207687_100332712 203
767 3300025927 Ga0207687_10493296 Ga0207687_104932961 203
768 3300025928 Ga0207700_10002104 Ga0207700_100021042 203
769 3300025928 Ga0207700_10058030 Ga0207700_100580303 203
770 3300025928 Ga0207700_10190364 Ga0207700_101903642 203
771 3300025928 Ga0207700_10324779 Ga0207700_103247792 203
772 3300025929 Ga0207664_10196138 Ga0207664_101961382 203
773 3300025931 Ga0207644_10160166 Ga0207644_101601661 203
774 3300025931 Ga0207644_10441707 Ga0207644_104417072 203
775 3300025931 Ga0207644_10742255 Ga0207644_107422551 203
776 3300025932 Ga0207690_10229716 Ga0207690_102297162 203
777 3300025932 Ga0207690_10727933 Ga0207690_107279331 203
778 3300025933 Ga0207706_10041999 Ga0207706_100419992 203
779 3300025933 Ga0207706_10141635 Ga0207706_101416352 203
780 3300025934 Ga0207686_10214684 Ga0207686_102146842 203
781 3300025935 Ga0207709_10004831 Ga0207709_100048314 203
782 3300025935 Ga0207709_10391658 Ga0207709_103916582 203
783 3300025935 Ga0207709_10477191 Ga0207709_104771912 203
784 3300025935 Ga0207709_10640623 Ga0207709_106406232 203
785 3300025936 Ga0207670_10256795 Ga0207670_102567952 203
786 3300025937 Ga0207669_10167590 Ga0207669_101675902 203
787 3300025937 Ga0207669_10560614 Ga0207669_105606142 203
788 3300025938 Ga0207704_10205689 Ga0207704_102056892 203
789 3300025939 Ga0207665_10123034 Ga0207665_101230342 203
790 3300025939 Ga0207665_10381652 Ga0207665_103816522 203
791 3300025939 Ga0207665_10518702 Ga0207665_105187021 203
792 3300025940 Ga0207691_10045318 Ga0207691_100453183 203
793 3300025940 Ga0207691_10492720 Ga0207691_104927202 203
794 3300025941 Ga0207711_10045167 Ga0207711_100451673 203
795 3300025941 Ga0207711_11187115 Ga0207711_111871151 203
796 3300025942 Ga0207689_10066424 Ga0207689_100664242 203
797 3300025944 Ga0207661_10000337 Ga0207661_1000033724 203
798 3300025944 Ga0207661_10996896 Ga0207661_109968961 203
799 3300025945 Ga0207679_10215161 Ga0207679_102151612 203
800 3300025945 Ga0207679_10618509 Ga0207679_106185091 203
801 3300025949 Ga0207667_10003256 Ga0207667_1000325612 203
802 3300025949 Ga0207667_10140872 Ga0207667_101408722 203
803 3300025949 Ga0207667_10232460 Ga0207667_102324602 203
804 3300025949 Ga0207667_10278654 Ga0207667_102786541 203
805 3300025949 Ga0207667_11036650 Ga0207667_110366501 203
806 3300025961 Ga0207712_10345263 Ga0207712_103452632 203
807 3300025961 Ga0207712_10531696 Ga0207712_105316962 203
808 3300025961 Ga0207712_10591811 Ga0207712_105918111 203
809 3300025972 Ga0207668_10135455 Ga0207668_101354552 203
810 3300025972 Ga0207668_10312606 Ga0207668_103126062 203
811 3300025981 Ga0207640_10063155 Ga0207640_100631552 203
812 3300025981 Ga0207640_10071663 Ga0207640_100716632 203
813 3300025981 Ga0207640_10143796 Ga0207640_101437962 203
814 3300025986 Ga0207658_10272065 Ga0207658_102720652 203
815 3300025986 Ga0207658_10297594 Ga0207658_102975942 203
816 3300025986 Ga0207658_10411315 Ga0207658_104113152 203
817 3300026023 Ga0207677_10237545 Ga0207677_102375452 203
818 3300026023 Ga0207677_10353441 Ga0207677_103534411 203
819 3300026035 Ga0207703_10088904 Ga0207703_100889043 203
820 3300026035 Ga0207703_10182019 Ga0207703_101820192 203
821 3300026035 Ga0207703_10302211 Ga0207703_103022112 203
822 3300026035 Ga0207703_10345310 Ga0207703_103453102 203
823 3300026035 Ga0207703_10446631 Ga0207703_104466311 203
824 3300026035 Ga0207703_10625757 Ga0207703_106257571 203
825 3300026041 Ga0207639_10025935 Ga0207639_100259354 203
826 3300026041 Ga0207639_10085798 Ga0207639_100857982 203
827 3300026041 Ga0207639_10114439 Ga0207639_101144392 203
828 3300026041 Ga0207639_10263388 Ga0207639_102633882 203
829 3300026041 Ga0207639_10291337 Ga0207639_102913372 203
830 3300026041 Ga0207639_10390719 Ga0207639_103907192 203
831 3300026041 Ga0207639_10842190 Ga0207639_108421902 203
832 3300026041 Ga0207639_10895630 Ga0207639_108956301 203
833 3300026067 Ga0207678_10010382 Ga0207678_1001038210 203
834 3300026067 Ga0207678_10066135 Ga0207678_100661352 203
835 3300026067 Ga0207678_10074427 Ga0207678_100744272 203
836 3300026067 Ga0207678_10104740 Ga0207678_101047402 203
837 3300026067 Ga0207678_10155438 Ga0207678_101554382 203
838 3300026067 Ga0207678_10214880 Ga0207678_102148802 203
839 3300026067 Ga0207678_10414327 Ga0207678_104143272 203
840 3300026075 Ga0207708_10150662 Ga0207708_101506622 203
841 3300026075 Ga0207708_10901275 Ga0207708_109012752 203
842 3300026078 Ga0207702_10000041 Ga0207702_1000004124 203
843 3300026078 Ga0207702_10038734 Ga0207702_100387345 203
844 3300026078 Ga0207702_10144995 Ga0207702_101449952 203
845 3300026078 Ga0207702_10195323 Ga0207702_101953231 203
846 3300026078 Ga0207702_10250553 Ga0207702_102505531 203
847 3300026078 Ga0207702_10588059 Ga0207702_105880592 203
848 3300026078 Ga0207702_10691826 Ga0207702_106918261 203
849 3300026089 Ga0207648_10041877 Ga0207648_100418774 203
850 3300026095 Ga0207676_10537052 Ga0207676_105370522 203
851 3300026095 Ga0207676_11086806 Ga0207676_110868061 203
852 3300026116 Ga0207674_10020311 Ga0207674_100203113 203
853 3300026116 Ga0207674_10029226 Ga0207674_100292265 203
854 3300026116 Ga0207674_10074961 Ga0207674_100749612 203
855 3300026118 Ga0207675_100039999 Ga0207675_1000399993 203
856 3300026118 Ga0207675_100123217 Ga0207675_1001232172 203
857 3300026118 Ga0207675_100328919 Ga0207675_1003289192 203
858 3300026118 Ga0207675_100367634 Ga0207675_1003676342 203
859 3300026121 Ga0207683_10033939 Ga0207683_100339392 203
860 3300026121 Ga0207683_10135303 Ga0207683_101353032 203
861 3300026121 Ga0207683_10232036 Ga0207683_102320361 203
862 3300026121 Ga0207683_10236025 Ga0207683_102360251 203
863 3300026121 Ga0207683_10398674 Ga0207683_103986742 203
864 3300026142 Ga0207698_10479265 Ga0207698_104792652 203
865 3300027296 Ga0209389_1000004 Ga0209389_100000465 203
866 3300027296 Ga0209389_1000023 Ga0209389_100002359 203
867 3300027357 Ga0209589_1000006 Ga0209589_1000006328 203
868 3300027357 Ga0209589_1000010 Ga0209589_1000010100 203
869 3300027361 Ga0209489_100007 Ga0209489_100007328 203
870 3300027361 Ga0209489_100011 Ga0209489_100011136 203
871 3300027361 Ga0209489_100295 Ga0209489_10029564 203
872 3300027363 Ga0209700_100008 Ga0209700_100008328 203
873 3300027363 Ga0209700_100013 Ga0209700_100013151 203
874 3300027671 Ga0209588_1001349 Ga0209588_10013491 203
875 3300027671 Ga0209588_1058263 Ga0209588_10582632 203
876 3300028379 Ga0268266_10035607 Ga0268266_100356074 203
877 3300028379 Ga0268266_10191046 Ga0268266_101910462 203
878 3300028379 Ga0268266_10197166 Ga0268266_101971661 203
879 3300028380 Ga0268265_10066596 Ga0268265_100665962 203
880 3300028380 Ga0268265_10397830 Ga0268265_103978302 203
881 3300028380 Ga0268265_11213566 Ga0268265_112135661 203
882 3300028381 Ga0268264_10098887 Ga0268264_100988872 203
883 3300028381 Ga0268264_10456807 Ga0268264_104568071 203
884 3300028786 Ga0307517_10000085 Ga0307517_1000008556 203
885 3300028786 Ga0307517_10108504 Ga0307517_101085042 203
886 3300028794 Ga0307515_10022248 Ga0307515_100222484 203
887 3300031235 Ga0265330_10019495 Ga0265330_100194953 203
888 3300031238 Ga0265332_10098022 Ga0265332_100980222 203
889 3300031241 Ga0265325_10003289 Ga0265325_1000328910 203
890 3300031247 Ga0265340_10071688 Ga0265340_100716882 203
891 3300031344 Ga0265316_10015335 Ga0265316_100153352 203
892 3300031456 Ga0307513_10058631 Ga0307513_100586311 203
893 3300031548 Ga0307408_100745257 Ga0307408_1007452572 203
894 3300031595 Ga0265313_10132253 Ga0265313_101322532 203
895 3300031711 Ga0265314_10004541 Ga0265314_100045419 203
896 3300031711 Ga0265314_10141877 Ga0265314_101418771 203
897 3300031712 Ga0265342_10184532 Ga0265342_101845322 203
898 3300031730 Ga0307516_10195889 Ga0307516_101958892 203
899 3300031824 Ga0307413_10159836 Ga0307413_101598362 203
900 3300031824 Ga0307413_10224888 Ga0307413_102248881 203
901 3300031889 Ga0326468_10010087 Ga0326468_100100871 203
902 3300031901 Ga0307406_10137638 Ga0307406_101376382 203
903 3300031903 Ga0307407_10602398 Ga0307407_106023981 203
904 3300031995 Ga0307409_100404725 Ga0307409_1004047252 203
905 3300032002 Ga0307416_100134078 Ga0307416_1001340781 203
906 3300032004 Ga0307414_10651802 Ga0307414_106518021 203
907 3300032004 Ga0307414_11070450 Ga0307414_110704502 203
908 3300032005 Ga0307411_10112784 Ga0307411_101127842 203
909 3300032005 Ga0307411_11001541 Ga0307411_110015411 203
910 3300032126 Ga0307415_100330992 Ga0307415_1003309922 203
911 3300032126 Ga0307415_100359851 Ga0307415_1003598512 203
912 3300032126 Ga0307415_100394413 Ga0307415_1003944131 203
913 3300033180 Ga0307510_10006173 Ga0307510_100061739 203
914 3300033180 Ga0307510_10007269 Ga0307510_100072692 203
915 3300033180 Ga0307510_10089756 Ga0307510_100897561 203
916 3300033180 Ga0307510_10168832 Ga0307510_101688322 203
917 3300033180 Ga0307510_10392312 Ga0307510_103923121 203
918 3300033442 Ga0315911_1000010 Ga0315911_1000010214 203
919 3300034957 Ga0373938_0054753 Ga0373938_0054753_93_704 203
920 3300035085 Ga0373929_0015474 Ga0373929_0015474_704_1315 203
921 3300035086 Ga0373934_0014490 Ga0373934_0014490_2186_2797 203
922 3300035111 Ga0373923_0047683 Ga0373923_0047683_395_1006 203
923 3300035113 Ga0373936_0029079 Ga0373936_0029079_67_678 203
924 3300035117 Ga0373953_0005417 Ga0373953_0005417_924_1535 203
925 3300035117 Ga0373953_0161298 Ga0373953_0161298_338_949 203
926 3300035118 Ga0373954_0000761 Ga0373954_0000761_2944_3555 203
927 3300035119 Ga0373956_0048232 Ga0373956_0048232_925_1536 203
928 3300035120 Ga0373957_0001113 Ga0373957_0001113_5718_6329 203
929 3300035172 Ga0373955_0008271 Ga0373955_0008271_413_1024 203
930 3300035691 Ga0373931_0009812 Ga0373931_0009812_526_1137 203
931 3300035695 Ga0373927_0022902 Ga0373927_0022902_2837_3460 203
932 3300035695 Ga0373927_0178619 Ga0373927_0178619_182_802 203
933 3300035724 Ga0373933_0017996 Ga0373933_0017996_3027_3638 203
934 3300035725 Ga0373947_0054943 Ga0373947_0054943_476_1099 203
935 3300036401 Ga0373937_0128172 Ga0373937_0128172_1328_1939 203
936 3300036459 Ga0372808_021957 Ga0372808_021957_45_656 203
937 3300037068 Ga0373925_0056168 Ga0373925_0056168_33_644 203
938 3300037418 Ga0395900_0020421 Ga0395900_0020421_1369_1983 203
939 3300037418 Ga0395900_0266450 Ga0395900_0266450_616_1239 203
940 3300037418 Ga0395900_0339366 Ga0395900_0339366_392_1003 203
941 3300037466 Ga0395898_0232191 Ga0395898_0232191_939_1550 203
942 3300037471 Ga0395905_0002934 Ga0395905_0002934_1685_2311 203
943 3300037471 Ga0395905_0207330 Ga0395905_0207330_483_1226 203
944 3300037471 Ga0395905_0715356 Ga0395905_0715356_218_829 203
945 3300038443 Ga0395901_0091456 Ga0395901_0091456_1021_1632 203
946 3300038443 Ga0395901_0144865 Ga0395901_0144865_256_867 203
947 3300038443 Ga0395901_0200322 Ga0395901_0200322_17_760 203
948 3300038443 Ga0395901_0575906 Ga0395901_0575906_233_859 203
949 3300039437 Ga0436365_0182621 Ga0436365_0182621_734_1345 203
950 3300039437 Ga0436365_0299844 Ga0436365_0299844_55_666 203
951 3300039437 Ga0436365_0486541 Ga0436365_0486541_2943_3572 203
952 3300039437 Ga0436365_0605759 Ga0436365_0605759_1528_2142 203
953 3300039450 Ga0436363_0029976 Ga0436363_0029976_254_883 203
954 3300041451 Ga0451791_1847493 Ga0451791_1847493_500_1153 203
955 3300041452 Ga0451793_1054860 Ga0451793_1054860_266_877 203
956 3300041491 Ga0451833_1207251 Ga0451833_1207251_80_691 203
957 3300041492 Ga0451835_0964677 Ga0451835_0964677_240_851 203
958 3300041498 Ga0451841_0596662 Ga0451841_0596662_150_761 203
959 3300042012 Ga0439455_0024870 Ga0439455_0024870_223_834 203
960 3300044656 Ga0466969_0003503 Ga0466969_0003503_1529_2140 203
961 3300044684 Ga0466966_0000952 Ga0466966_0000952_2851_3462 203
962 3300044693 Ga0466961_0000737 Ga0466961_0000737_18612_19223 203
963 3300044693 Ga0466961_0295031 Ga0466961_0295031_256_867 203
964 3300044719 Ga0466971_0246732 Ga0466971_0246732_133_747 203
965 3300045049 Ga0466959_0028388 Ga0466959_0028388_2611_3225 203
966 3300045049 Ga0466959_0047575 Ga0466959_0047575_412_1023 203
967 3300045836 Ga0466958_0454706 Ga0466958_0454706_172_786 203
968 3300045976 Ga0466967_0015901 Ga0466967_0015901_176_787 203
969 3300046452 Ga0495617_020436 Ga0495617_020436_1056_1667 203
970 3300046452 Ga0495617_025717 Ga0495617_025717_398_1009 203
971 3300046453 Ga0495627_022541 Ga0495627_022541_805_1416 203
972 3300046454 Ga0495592_0019398 Ga0495592_0019398_2406_3017 203
973 3300046454 Ga0495592_0321425 Ga0495592_0321425_222_842 203
974 3300046455 Ga0495603_0156343 Ga0495603_0156343_287_898 203
975 3300046457 Ga0495590_0027742 Ga0495590_0027742_76_687 203
976 3300046459 Ga0495629_0062401 Ga0495629_0062401_68_688 203
977 3300046459 Ga0495629_0238698 Ga0495629_0238698_505_1116 203
978 3300046460 Ga0495638_0003540 Ga0495638_0003540_6261_6872 203
979 3300046462 Ga0495651_0025900 Ga0495651_0025900_3890_4501 203
980 3300046462 Ga0495651_0104445 Ga0495651_0104445_37_648 203
981 3300046462 Ga0495651_0119914 Ga0495651_0119914_472_1092 203
982 3300046463 Ga0495653_0004690 Ga0495653_0004690_2056_2667 203
983 3300046472 Ga0495580_0048262 Ga0495580_0048262_2088_2711 203
984 3300046472 Ga0495580_0359919 Ga0495580_0359919_350_961 203
985 3300046477 Ga0495664_0514785 Ga0495664_0514785_44_655 203
986 3300046491 Ga0495584_0076422 Ga0495584_0076422_685_1296 203
987 3300046492 Ga0495585_0017623 Ga0495585_0017623_2541_3152 203
988 3300046499 Ga0495594_0016398 Ga0495594_0016398_1423_2034 203
989 3300046499 Ga0495594_0088498 Ga0495594_0088498_1011_1631 203
990 3300046499 Ga0495594_0491454 Ga0495594_0491454_40_651 203
991 3300046501 Ga0495607_0191310 Ga0495607_0191310_24_635 203
992 3300046506 Ga0495583_0056740 Ga0495583_0056740_389_1009 203
993 3300046507 Ga0495606_0024349 Ga0495606_0024349_3346_3966 203
994 3300046511 Ga0495608_0001839 Ga0495608_0001839_8912_9523 203
995 3300046512 Ga0495610_0166524 Ga0495610_0166524_212_823 203
996 3300046513 Ga0495616_0100475 Ga0495616_0100475_553_1164 203
997 3300046514 Ga0495618_0113479 Ga0495618_0113479_122_733 203
998 3300046516 Ga0495628_0028229 Ga0495628_0028229_3248_3859 203
999 3300046517 Ga0495630_0175168 Ga0495630_0175168_422_1033 203
1000 3300046519 Ga0495632_0153582 Ga0495632_0153582_430_1041 203
1001 3300046522 Ga0495643_0026574 Ga0495643_0026574_561_1172 203
1002 3300046523 Ga0495644_0025964 Ga0495644_0025964_1016_1627 203
1003 3300046524 Ga0495648_0158805 Ga0495648_0158805_116_736 203
1004 3300046529 Ga0495652_0193615 Ga0495652_0193615_203_814 203
1005 3300046529 Ga0495652_0222807 Ga0495652_0222807_760_1380 203
1006 3300046530 Ga0495654_0270048 Ga0495654_0270048_32_643 203
1007 3300046533 Ga0495640_0011654 Ga0495640_0011654_1496_2107 203
1008 3300046537 Ga0495598_0021060 Ga0495598_0021060_273_884 203
1009 3300046539 Ga0495621_0015707 Ga0495621_0015707_985_1596 203
1010 3300046543 Ga0495645_0009481 Ga0495645_0009481_2935_3549 203
1011 3300046543 Ga0495645_0017734 Ga0495645_0017734_354_965 203
1012 3300046557 Ga0495622_0055185 Ga0495622_0055185_468_1079 203
1013 3300046558 Ga0495633_0071338 Ga0495633_0071338_580_1191 203
1014 3300046615 Ga0495656_0001457 Ga0495656_0001457_1506_2117 203
1015 3300046615 Ga0495656_0016098 Ga0495656_0016098_147_758 203
1016 3300046615 Ga0495656_0079876 Ga0495656_0079876_197_808 203
1017 3300046616 Ga0495668_0178692 Ga0495668_0178692_44_655 203
1018 3300046616 Ga0495668_0534132 Ga0495668_0534132_15_626 203
1019 3300046642 Ga0495634_0015562 Ga0495634_0015562_2121_2732 203
1020 3300046642 Ga0495634_0110179 Ga0495634_0110179_410_1021 203
1021 3300046648 Ga0495611_0358414 Ga0495611_0358414_11_622 203
1022 3300046663 Ga0495635_0009056 Ga0495635_0009056_2856_3467 203
1023 3300046663 Ga0495635_0013629 Ga0495635_0013629_472_1092 203
1024 3300046664 Ga0495659_0037332 Ga0495659_0037332_354_965 203
1025 3300046664 Ga0495659_0132521 Ga0495659_0132521_79_699 203
1026 3300046665 Ga0495661_0196480 Ga0495661_0196480_348_959 203
1027 3300046674 Ga0495588_0002625 Ga0495588_0002625_1823_2434 203
1028 3300046674 Ga0495588_0035958 Ga0495588_0035958_1859_2470 203
1029 3300046675 Ga0495657_0001190 Ga0495657_0001190_16195_16815 203
1030 3300046675 Ga0495657_0296704 Ga0495657_0296704_23_634 203
1031 3300046678 Ga0495599_0208627 Ga0495599_0208627_331_942 203
1032 3300046679 Ga0495623_0053830 Ga0495623_0053830_1005_1616 203
1033 3300046680 Ga0495646_0035486 Ga0495646_0035486_166_777 203
1034 3300046684 Ga0495669_0038625 Ga0495669_0038625_342_953 203
1035 3300046689 Ga0495613_0004933 Ga0495613_0004933_9247_9867 203
1036 3300046689 Ga0495613_0278177 Ga0495613_0278177_456_1079 203
1037 3300046690 Ga0495624_0043034 Ga0495624_0043034_2252_2872 203
1038 3300046690 Ga0495624_0146414 Ga0495624_0146414_328_939 203
1039 3300046690 Ga0495624_0411718 Ga0495624_0411718_138_761 203
1040 3300046691 Ga0495670_0108571 Ga0495670_0108571_38_649 203
1041 3300046692 Ga0495671_0261100 Ga0495671_0261100_177_788 203
1042 3300046694 Ga0495649_0013503 Ga0495649_0013503_3211_3831 203
1043 3300046809 Ga0495600_0125078 Ga0495600_0125078_1041_1661 203
1044 3300046810 Ga0495660_0129615 Ga0495660_0129615_335_946 203
1045 3300047315 Ga0495581_0182847 Ga0495581_0182847_42_662 203
1046 3300047317 Ga0495604_0040533 Ga0495604_0040533_445_1065 203
1047 3300047317 Ga0495604_0178776 Ga0495604_0178776_331_942 203
1048 3300047317 Ga0495604_0185446 Ga0495604_0185446_490_1101 203
1049 3300047318 Ga0495636_0016540 Ga0495636_0016540_59_679 203
1050 3300047318 Ga0495636_0045819 Ga0495636_0045819_1133_1744 203
1051 3300047319 Ga0495674_0114385 Ga0495674_0114385_175_786 203
1052 3300047319 Ga0495674_0133798 Ga0495674_0133798_483_1094 203
1053 3300047321 Ga0495676_0095206 Ga0495676_0095206_1558_2178 203
1054 3300047323 Ga0495683_0146386 Ga0495683_0146386_442_1053 203
1055 3300047443 Ga0495687_028429 Ga0495687_028429_1809_2420 203
1056 3300047447 Ga0495685_071778 Ga0495685_071778_408_1019 203
1057 3300047469 Ga0495673_0048293 Ga0495673_0048293_296_907 203
1058 3300047469 Ga0495673_0064322 Ga0495673_0064322_421_1032 203
1059 3300047471 Ga0495684_0012073 Ga0495684_0012073_2806_3417 203
1060 3300047471 Ga0495684_0129746 Ga0495684_0129746_1249_1869 203
1061 3300047472 Ga0495686_0219641 Ga0495686_0219641_62_673 203
1062 3300047472 Ga0495686_0266130 Ga0495686_0266130_219_830 203
1063 3300047673 Ga0495593_0006291 Ga0495593_0006291_2117_2728 203
1064 3300047673 Ga0495593_0062689 Ga0495593_0062689_391_1011 203
1065 3300048088 Ga0495602_0108924 Ga0495602_0108924_544_1155 203
1066 3300048088 Ga0495602_0183488 Ga0495602_0183488_965_1585 203
1067 3300048903 Ga0496100_0029828 Ga0496100_0029828_2201_2821 203
1068 3300048903 Ga0496100_0034063 Ga0496100_0034063_915_1526 203
1069 3300048903 Ga0496100_0177080 Ga0496100_0177080_809_1420 203
1070 3300048904 Ga0496101_0013278 Ga0496101_0013278_1260_1880 203
1071 3300048905 Ga0496102_0005792 Ga0496102_0005792_7350_7970 203
1072 3300048905 Ga0496102_0037882 Ga0496102_0037882_48_659 203
1073 3300048905 Ga0496102_0066081 Ga0496102_0066081_2657_3268 203
1074 3300048905 Ga0496102_0909752 Ga0496102_0909752_133_753 203
1075 3300048906 Ga0496103_0064463 Ga0496103_0064463_1591_2202 203
1076 3300048906 Ga0496103_0089519 Ga0496103_0089519_280_900 203
1077 3300048906 Ga0496103_0195361 Ga0496103_0195361_233_844 203
1078 3300048907 Ga0496104_0003629 Ga0496104_0003629_2780_3391 203
1079 3300048907 Ga0496104_0009841 Ga0496104_0009841_61_681 203
1080 3300048908 Ga0496105_0000532 Ga0496105_0000532_18192_18812 203
1081 3300048908 Ga0496105_0017523 Ga0496105_0017523_3120_3731 203
1082 3300048908 Ga0496105_0040985 Ga0496105_0040985_2279_2899 203
1083 3300048908 Ga0496105_0065362 Ga0496105_0065362_1074_1685 203
1084 3300048908 Ga0496105_0215109 Ga0496105_0215109_54_665 203
1085 3300048908 Ga0496105_0272564 Ga0496105_0272564_696_1307 203
1086 3300048908 Ga0496105_0947768 Ga0496105_0947768_21_632 203
1087 3300048909 Ga0496106_0004534 Ga0496106_0004534_2859_3470 203
1088 3300048909 Ga0496106_0021741 Ga0496106_0021741_3238_3858 203
1089 3300048909 Ga0496106_0090447 Ga0496106_0090447_918_1529 203
1090 3300048910 Ga0496107_0004981 Ga0496107_0004981_621_1232 203
1091 3300048910 Ga0496107_0021095 Ga0496107_0021095_47_658 203
1092 3300048911 Ga0496108_0031661 Ga0496108_0031661_1232_1852 203
1093 3300048911 Ga0496108_0037694 Ga0496108_0037694_2798_3409 203
1094 3300048912 Ga0496109_0043823 Ga0496109_0043823_2721_3341 203
1095 3300048912 Ga0496109_0051626 Ga0496109_0051626_607_1218 203
1096 3300048912 Ga0496109_0094810 Ga0496109_0094810_2117_2728 203
1097 3300048912 Ga0496109_0131481 Ga0496109_0131481_82_693 203
1098 3300048913 Ga0496110_0017079 Ga0496110_0017079_2710_3321 203
1099 3300048913 Ga0496110_0067797 Ga0496110_0067797_1888_2499 203
1100 3300048913 Ga0496110_0112123 Ga0496110_0112123_555_1166 203
1101 3300048914 Ga0496111_0019062 Ga0496111_0019062_3574_4194 203
1102 3300048914 Ga0496111_0097002 Ga0496111_0097002_1179_1790 203
1103 3300048914 Ga0496111_0328711 Ga0496111_0328711_509_1120 203
1104 3300048915 Ga0496112_0022085 Ga0496112_0022085_1401_2012 203
1105 3300048915 Ga0496112_0038861 Ga0496112_0038861_2642_3253 203
1106 3300048915 Ga0496112_0088235 Ga0496112_0088235_2290_2910 203
1107 3300048915 Ga0496112_0096797 Ga0496112_0096797_1565_2176 203
1108 3300048915 Ga0496112_0109369 Ga0496112_0109369_369_980 203
1109 3300048916 Ga0496113_0004246 Ga0496113_0004246_1274_1885 203
1110 3300048916 Ga0496113_0479279 Ga0496113_0479279_374_985 203
1111 3300048917 Ga0496114_0042370 Ga0496114_0042370_1888_2499 203
1112 3300048917 Ga0496114_0052696 Ga0496114_0052696_164_775 203
1113 3300048917 Ga0496114_0104830 Ga0496114_0104830_1032_1652 203
1114 3300048918 Ga0496115_0002752 Ga0496115_0002752_10904_11524 203
1115 3300048918 Ga0496115_0003734 Ga0496115_0003734_3445_4056 203
1116 3300048918 Ga0496115_0049284 Ga0496115_0049284_875_1489 203
1117 3300048918 Ga0496115_0230125 Ga0496115_0230125_48_668 203
1118 3300048918 Ga0496115_0276600 Ga0496115_0276600_655_1293 203
1119 3300048918 Ga0496115_0440419 Ga0496115_0440419_421_1032 203
1120 3300048918 Ga0496115_0737571 Ga0496115_0737571_141_752 203
1121 3300048920 Ga0496117_0099484 Ga0496117_0099484_298_909 203
1122 3300048921 Ga0496118_0067040 Ga0496118_0067040_128_739 203
1123 3300048921 Ga0496118_0118989 Ga0496118_0118989_73_684 203
1124 3300048921 Ga0496118_0286140 Ga0496118_0286140_269_889 203
1125 3300048922 Ga0496119_0002440 Ga0496119_0002440_16786_17406 203
1126 3300048922 Ga0496119_0025596 Ga0496119_0025596_2946_3557 203
1127 3300048924 Ga0496121_0000379 Ga0496121_0000379_25715_26326 203
1128 3300048924 Ga0496121_0002853 Ga0496121_0002853_23565_24176 203
1129 3300048924 Ga0496121_0090597 Ga0496121_0090597_700_1314 203
1130 3300048924 Ga0496121_0094491 Ga0496121_0094491_1384_2004 203
1131 3300048927 Ga0496124_0054484 Ga0496124_0054484_133_744 203
1132 3300048928 Ga0496125_0012802 Ga0496125_0012802_6628_7239 203
1133 3300048928 Ga0496125_0270909 Ga0496125_0270909_77_688 203
1134 3300048929 Ga0496126_0036885 Ga0496126_0036885_3736_4356 203
1135 3300048929 Ga0496126_0099741 Ga0496126_0099741_780_1391 203
1136 3300048929 Ga0496126_0104128 Ga0496126_0104128_1613_2236 203
1137 3300048929 Ga0496126_0105816 Ga0496126_0105816_41_652 203
1138 3300048929 Ga0496126_0245615 Ga0496126_0245615_744_1355 203
1139 3300048929 Ga0496126_0292368 Ga0496126_0292368_389_1000 203
1140 3300048929 Ga0496126_0343951 Ga0496126_0343951_598_1209 203
1141 3300048929 Ga0496126_0570181 Ga0496126_0570181_40_651 203
1142 3300048929 Ga0496126_0618543 Ga0496126_0618543_175_786 203
1143 3300049460 Ga0495682_0033493 Ga0495682_0033493_520_1140 203
1144 3300049568 Ga0501031_0233022 Ga0501031_0233022_544_1164 203
1145 3300049569 Ga0501032_0000269 Ga0501032_0000269_27544_28155 203
1146 3300049570 Ga0501033_0000399 Ga0501033_0000399_5101_5712 203
1147 3300049571 Ga0501034_0000039 Ga0501034_0000039_11589_12200 203
1148 3300049572 Ga0501036_0004794 Ga0501036_0004794_5024_5635 203
1149 3300049573 Ga0501037_0000279 Ga0501037_0000279_4899_5510 203
1150 3300049574 Ga0501038_0000727 Ga0501038_0000727_14184_14795 203
1151 3300049575 Ga0501039_0007019 Ga0501039_0007019_2982_3593 203
1152 3300049578 Ga0501042_0262144 Ga0501042_0262144_146_757 203
1153 3300049579 Ga0501043_0000257 Ga0501043_0000257_5027_5638 203
1154 3300049580 Ga0501046_0006020 Ga0501046_0006020_1264_1875 203
1155 3300049581 Ga0501047_0002128 Ga0501047_0002128_9103_9714 203
1156 3300049581 Ga0501047_0120453 Ga0501047_0120453_125_736 203
1157 3300049581 Ga0501047_0163016 Ga0501047_0163016_639_1262 203
1158 3300049582 Ga0501048_0000677 Ga0501048_0000677_11044_11655 203
1159 3300049583 Ga0501067_0000220 Ga0501067_0000220_29782_30393 203
1160 3300049583 Ga0501067_0088962 Ga0501067_0088962_521_1132 203
1161 3300049584 Ga0501068_0006651 Ga0501068_0006651_2355_2966 203
1162 3300049585 Ga0501069_0020320 Ga0501069_0020320_2751_3362 203
1163 3300049586 Ga0501070_0022913 Ga0501070_0022913_2959_3570 203
1164 3300049586 Ga0501070_0925857 Ga0501070_0925857_47_658 203
1165 3300049587 Ga0501071_0244725 Ga0501071_0244725_97_708 203
1166 3300049588 Ga0501072_0411408 Ga0501072_0411408_83_694 203
1167 3300049589 Ga0501073_0000103 Ga0501073_0000103_52884_53495 203
1168 3300049589 Ga0501073_0825548 Ga0501073_0825548_18_629 203
1169 3300049590 Ga0501074_0000203 Ga0501074_0000203_596_1207 203
1170 3300049591 Ga0501075_0539491 Ga0501075_0539491_239_850 203
1171 3300049592 Ga0501076_0293053 Ga0501076_0293053_139_759 203
1172 3300049741 Ga0501079_0005568 Ga0501079_0005568_5060_5671 203
1173 3300049742 Ga0501080_0002271 Ga0501080_0002271_416_1027 203
1174 3300049743 Ga0501081_0961887 Ga0501081_0961887_21_632 203
1175 3300049744 Ga0501083_0000213 Ga0501083_0000213_3087_3698 203
1176 3300049822 Ga0501035_0000523 Ga0501035_0000523_18331_18942 203
1177 3300049823 Ga0501044_0000435 Ga0501044_0000435_26461_27072 203
1178 3300049823 Ga0501044_0953539 Ga0501044_0953539_71_691 203
1179 3300050490 nmdc:mga03n38_150290_c1 nmdc:mga03n38_150290_c1_43_663 203
1180 3300050492 nmdc:mga0yw44_125079_c1 nmdc:mga0yw44_125079_c1_500_1111 203
1181 3300050492 nmdc:mga0yw44_5033_c1 nmdc:mga0yw44_5033_c1_4806_5417 203
1182 3300050492 nmdc:mga0yw44_90894_c1 nmdc:mga0yw44_90894_c1_784_1395 203
1183 3300050494 nmdc:mga06z11_270267_c1 nmdc:mga06z11_270267_c1_183_794 203
1184 3300050494 nmdc:mga06z11_41002_c1 nmdc:mga06z11_41002_c1_1667_2278 203
1185 3300050494 nmdc:mga06z11_527625_c1 nmdc:mga06z11_527625_c1_11_622 203
1186 3300050507 nmdc:mga05p37_228831_c1 nmdc:mga05p37_228831_c1_121_732 203
1187 3300050508 nmdc:mga09592_60003_c1 nmdc:mga09592_60003_c1_155_826 203
1188 3300050509 nmdc:mga0qj67_171885_c1 nmdc:mga0qj67_171885_c1_85_756 203
1189 3300050512 nmdc:mga0n895_95973_c1 nmdc:mga0n895_95973_c1_1505_2116 203
1190 3300050513 nmdc:mga0rr50_139437_c1 nmdc:mga0rr50_139437_c1_1079_1690 203
1191 3300050515 nmdc:mga0a205_61269_c1 nmdc:mga0a205_61269_c1_1742_2353 203
1192 3300053077 Ga0495601_0084096 Ga0495601_0084096_138_752 203
1193 3300053077 Ga0495601_0333462 Ga0495601_0333462_61_672 203
1194 3300053078 Ga0495612_0007098 Ga0495612_0007098_2083_2697 203
1195 3300053078 Ga0495612_0080707 Ga0495612_0080707_124_735 203
1196 3300053079 Ga0500610_0305457 Ga0500610_0305457_46_657 203
1197 3300053083 Ga0495655_0002836 Ga0495655_0002836_1724_2344 203
1198 3300053084 Ga0495595_0046672 Ga0495595_0046672_1227_1838 203
1199 3300053085 Ga0495619_0020964 Ga0495619_0020964_1456_2067 203
1200 3300053086 Ga0500578_0178869 Ga0500578_0178869_130_750 203
1201 3300053087 Ga0500643_000197 Ga0500643_000197_17065_17676 203
1202 3300053090 Ga0500646_0080622 Ga0500646_0080622_225_836 203
1203 3300053091 Ga0500647_0087469 Ga0500647_0087469_835_1446 203
1204 3300053093 Ga0500651_0028346 Ga0500651_0028346_2568_3188 203
1205 3300053093 Ga0500651_0248833 Ga0500651_0248833_338_949 203
1206 3300053094 Ga0500566_0000008 Ga0500566_0000008_32582_33193 203
1207 3300053094 Ga0500566_0000102 Ga0500566_0000102_19286_19897 203
1208 3300053095 Ga0500640_000058 Ga0500640_000058_4657_5268 203
1209 3300053096 Ga0500641_0002877 Ga0500641_0002877_798_1409 203
1210 3300053096 Ga0500641_0253529 Ga0500641_0253529_35_646 203
1211 3300053104 Ga0500556_0005792 Ga0500556_0005792_353_964 203
1212 3300053105 Ga0500557_000029 Ga0500557_000029_65014_65625 203
1213 3300053108 Ga0500562_004449 Ga0500562_004449_2630_3241 203
1214 3300053109 Ga0500569_001944 Ga0500569_001944_3280_3900 203
1215 3300053111 Ga0500572_000050 Ga0500572_000050_26464_27075 203
1216 3300053118 Ga0500594_0056242 Ga0500594_0056242_65_676 203
1217 3300053119 Ga0500595_002045 Ga0500595_002045_1139_1750 203
1218 3300053123 Ga0500614_001235 Ga0500614_001235_3974_4585 203
1219 3300053130 Ga0500642_0000241 Ga0500642_0000241_1325_1936 203
1220 3300053134 Ga0500658_0059353 Ga0500658_0059353_948_1559 203
1221 3300053136 Ga0500559_0012776 Ga0500559_0012776_836_1447 203
1222 3300053136 Ga0500559_0077370 Ga0500559_0077370_646_1266 203
1223 3300053139 Ga0500568_0022500 Ga0500568_0022500_1115_1726 203
1224 3300053139 Ga0500568_0064410 Ga0500568_0064410_789_1400 203
1225 3300053142 Ga0500577_0020215 Ga0500577_0020215_363_983 203
1226 3300053147 Ga0500589_053434 Ga0500589_053434_278_889 203
1227 3300053148 Ga0500590_077746 Ga0500590_077746_192_803 203
1228 3300053150 Ga0500603_000040 Ga0500603_000040_17575_18186 203
1229 3300053150 Ga0500603_000999 Ga0500603_000999_4884_5495 203
1230 3300053151 Ga0500604_0082535 Ga0500604_0082535_87_698 203
1231 3300053154 Ga0500619_046631 Ga0500619_046631_273_884 203
1232 3300053156 Ga0500622_0006790 Ga0500622_0006790_1110_1721 203
1233 3300053159 Ga0500630_002184 Ga0500630_002184_4242_4853 203
1234 3300053162 Ga0500638_215201 Ga0500638_215201_136_747 203
1235 3300053163 Ga0500639_000010 Ga0500639_000010_59294_59905 203
1236 3300053177 Ga0500636_0025748 Ga0500636_0025748_2376_2987 203
1237 3300053177 Ga0500636_0368282 Ga0500636_0368282_32_643 203
1238 3300053178 Ga0500637_0002664 Ga0500637_0002664_2657_3268 203
1239 3300053729 Ga0500625_017306 Ga0500625_017306_1616_2227 203
1240 3300053733 Ga0500552_012288 Ga0500552_012288_170_790 203
1241 3300053735 Ga0500596_000151 Ga0500596_000151_8337_8948 203
1242 3300053736 Ga0500599_004187 Ga0500599_004187_270_881 203
1243 3300053737 Ga0500601_000123 Ga0500601_000123_6823_7434 203
1244 3300053737 Ga0500601_006858 Ga0500601_006858_289_900 203
1245 3300060353 Ga0501082_0029219 Ga0501082_0029219_3876_4487 203
1246 3300060353 Ga0501082_0186594 Ga0501082_0186594_1067_1678 203
1247 3300061719 Ga0466962_0029471 Ga0466962_0029471_1462_2076 203

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00440

TetR_N

Bacterial regulatory proteins, tetR family

61

107

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
1rkt-assembly1.cif.gz_B crystal structure of yfir, a putative transcriptional regulator from bacillus subtilis 0.7932 11 192
6zui-assembly1.cif.gz_A crystal structure of the cys-ser mutant of the cpyfp-based biosensor for hypochlorous acid 0.7832 12 89
3bti-assembly2.cif.gz_D crystal structure of qacr(e58q) bound to berberine 0.7728 13 171
5gpa-assembly1.cif.gz_A structural analysis of fatty acid degradation regulator fadr from bacillus halodurans 0.7725 13 179
2g3b-assembly1.cif.gz_A crystal structure of putative tetr-family transcriptional regulator from rhodococcus sp. 0.7691 13 192
ID Description Score Start End Superfamily
3whcC01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9982 13 55 1.10.10.60
5gp9B01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9942 16 55 1.10.10.60
3whbA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9942 13 55 1.10.10.60
5gpaA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9937 13 55 1.10.10.60
5gpaB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9931 16 55 1.10.10.60
ID Description Score Start End GO Terms
AF-A0A1Q3KUL1-F1-model_v4 TetR family transcriptional regulator 0.952 1 197 GO:0000976
GO:0003700
AF-A0A1Q3KUL1-F1-model_v4 TetR family transcriptional regulator 0.9425 1 197 GO:0000976
GO:0003700
AF-A0A5H2YQ45-F1-model_v4 deleted 0.9187 18 203
AF-A0A5H2YQ45-F1-model_v4 deleted 0.9094 18 203
AF-A0A537MLB6-F1-model_v4 TetR/AcrR family transcriptional regulator 0.9039 1 125 GO:0000976
GO:0003700

Feature Viewer

pLDDT pTM Quality
84.43 0.77 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map