F492152
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1247 | 646 | 1095 | 203 |
Family's Representative Sequence
| Representative Sequence | 3300037471|Ga0395905_0207330|Ga0395905_0207330_483_1226 |
| Length | 247 |
| Sequence | LVAALKICSFERIDIHSSRQAAVIRTLQTRYTLVLSCILNQIEPMSRVRTRPTRDDTREKLYEAAARVFEEQGIGGASIEAIAAAAGFTRGAFYSNFKSKDELIIAMLEDHVEQSIRRNLDLLARHRNPAEFLDALRTMDRSRQDPLGRSPLLHMEMILFVARAEKRRPELAKRLRARRKLIADIVETTARHSRRNVVLNPAWTGAILLAMEDGFRLHRLIDPETTPADSFLRAIGDLQKAIGISST |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 2 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 3 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 4 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 5 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 6 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 7 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 8 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 9 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 10 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 11 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 12 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 13 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 14 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 15 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 16 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 17 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 18 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 19 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 20 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 21 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 22 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 23 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 24 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 25 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 26 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 27 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 28 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 29 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 30 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 31 | 2791355199 | |||
| 32 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 33 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 34 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 35 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 36 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 37 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 38 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 39 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 40 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 41 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 42 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 43 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 44 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 45 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 46 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 47 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 48 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 49 | 2904699407 | |||
| 50 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 51 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 52 | 2906610324 | |||
| 53 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 54 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 55 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 56 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 57 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 58 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 59 | 2922368715 | |||
| 60 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 61 | 2922425934 | |||
| 62 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 63 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 64 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 65 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 66 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 67 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 68 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 69 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 70 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 71 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 72 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 73 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 74 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 75 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 76 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 77 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 78 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 79 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 80 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 81 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 82 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 83 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 84 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 85 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 86 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 87 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 88 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 89 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 90 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 91 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 92 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 93 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 94 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 95 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 96 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 97 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 98 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 99 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 100 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 101 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 102 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 103 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 104 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 105 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 106 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 107 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 108 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 109 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 110 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 111 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 112 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 113 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 114 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 115 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 116 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 117 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 118 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 119 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 120 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 121 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 122 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 123 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 124 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 125 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 126 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 127 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 128 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 129 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 130 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 131 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 132 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 133 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 134 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 135 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 136 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 137 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 138 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 139 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 140 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 141 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 142 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 143 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 144 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 145 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 146 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 147 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 148 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 149 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 150 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 151 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 152 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 153 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 154 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 155 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 156 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 157 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 158 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 159 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 160 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 161 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 162 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 163 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 164 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 165 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 166 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 167 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 168 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 169 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 170 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 171 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 172 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 173 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 174 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 175 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 176 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 177 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 178 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 179 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 180 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 181 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 182 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 183 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 184 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 185 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 186 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 187 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 188 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 189 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 190 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 191 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 192 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 193 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 194 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 195 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 196 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 197 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 198 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 199 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 200 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 201 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 202 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 203 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 204 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 205 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 206 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 207 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 208 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 210 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 211 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 212 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 213 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 214 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 215 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 216 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 218 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 219 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 220 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 221 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 222 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 223 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 225 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 226 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 228 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 229 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 230 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 231 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 232 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 233 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 234 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 235 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 236 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 237 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 238 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 239 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 240 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 241 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 242 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 243 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 244 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 245 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 246 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 247 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 248 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 249 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 250 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 251 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 252 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 253 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 254 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 255 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 256 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 257 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 258 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 259 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 260 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 261 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 262 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 263 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 264 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 265 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 266 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 267 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 268 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 269 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 270 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 271 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 272 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 273 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 274 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 275 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 276 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 277 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 278 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 279 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 280 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 281 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 282 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 283 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 284 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 285 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 286 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 287 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 288 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 289 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 290 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 291 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 292 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 293 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 294 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 295 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 296 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 297 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 298 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 299 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 300 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 301 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 302 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 303 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 304 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 305 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 306 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 307 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 308 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 309 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 310 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 311 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 312 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 313 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 314 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 315 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 316 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 317 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 318 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 319 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 320 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 321 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 322 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 323 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 324 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 325 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 326 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 327 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 328 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 329 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 330 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 331 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 332 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 333 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 334 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 335 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 336 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 337 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 338 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 339 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 340 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 341 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 342 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 343 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 344 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 345 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 346 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 347 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 348 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 349 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 350 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 351 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 352 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 353 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 354 | 3300031889 | Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO | Metagenome | Rhizosphere |
| 355 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 356 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 357 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 358 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 359 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 360 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 361 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 362 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 363 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 364 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 365 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 366 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 367 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 368 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 369 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 370 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 371 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 372 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 373 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 374 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 375 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 376 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 377 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 378 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 379 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 380 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 381 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 382 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 383 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 384 | 3300036459 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 385 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 386 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 387 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 388 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 389 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 390 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 391 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 392 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 393 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 394 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 395 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 396 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 397 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 398 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 399 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 400 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 401 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 402 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 403 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 404 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 405 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 406 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 407 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 408 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 409 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 410 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 411 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 412 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 413 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 414 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 415 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 422 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 423 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 424 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 425 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 426 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 427 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 428 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 429 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 430 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 431 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 432 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 433 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 434 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 435 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 436 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 437 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 438 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 439 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 440 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 441 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 442 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 443 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 444 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 445 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 446 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 447 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 448 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 449 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 450 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 451 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 452 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 453 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 454 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 455 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 456 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 457 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 458 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 459 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 460 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 461 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 462 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 463 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 464 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 465 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 466 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 467 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 468 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 469 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 470 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 471 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 472 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 473 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 474 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 475 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 476 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 477 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 478 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 479 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 480 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 481 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 482 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 483 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 484 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 485 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 486 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 487 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 488 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 489 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 490 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 491 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 492 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 493 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 494 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 495 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 496 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 497 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 498 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 499 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 500 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 501 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 502 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 503 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 504 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 505 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 506 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 507 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 508 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 509 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 510 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 511 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 512 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 513 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 514 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 515 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 516 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 517 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 518 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 519 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 520 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 521 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 522 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 523 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 524 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 525 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 526 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 527 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 528 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 529 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 530 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 531 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 532 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 533 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 534 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 535 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 536 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 537 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 538 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 539 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 540 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 541 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 542 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 543 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 544 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 545 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 546 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 547 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 548 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 549 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 550 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 551 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 552 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 553 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 554 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 555 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 556 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 557 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 558 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 559 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 560 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 561 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 562 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 563 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 564 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 565 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 566 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 567 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 568 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 569 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 570 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 571 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 572 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 573 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 574 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 575 | 3300053089 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere | Metagenome | Endosphere |
| 576 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 577 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 578 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 579 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 580 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 581 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 582 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 583 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 584 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 585 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 586 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 587 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 588 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 589 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 590 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 591 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 592 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 593 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 594 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 595 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 596 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 597 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 598 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 599 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 600 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 601 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 602 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 603 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 604 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 605 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 606 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 607 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 608 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 609 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 610 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 611 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 612 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 613 | 3300053733 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere | Metagenome | Endosphere |
| 614 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 615 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 616 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 617 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 618 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 619 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 620 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 621 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 622 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 623 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 624 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 625 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 626 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 627 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 628 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 629 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 630 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 631 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 632 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 633 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 634 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 635 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 636 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 637 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 638 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 639 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 640 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 641 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 642 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 643 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 644 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
| 645 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
| 646 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 88 |
| Metatranscriptomes | 0.16 |
| Isolates | 11.84 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 12.83 |
| Nodule | 11.31 |
| Rhizoplane | 5.13 |
| Rhizosphere | 63.43 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.3 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24744J21845_10017086 | 3300002077 | Bacteria | 1442 |
| 2 | JGI24742J22300_10012181 | 3300002244 | Bacteria | 1431 |
| 3 | JGI25406J46586_10002021 | 3300003203 | Bacteria | 9577 |
| 4 | JGI25153J46596_10000432 | 3300003215 | Bacteria | 27003 |
| 5 | JGI25153J46596_10002180 | 3300003215 | Bacteria | 11433 |
| 6 | JGI25153J46596_10004682 | 3300003215 | Bacteria | 7313 |
| 7 | JGI25153J46596_10006584 | 3300003215 | Bacteria | 5854 |
| 8 | rootL2_10198724 | 3300003322 | Bacteria | 1263 |
| 9 | rootH1_10140860 | 3300003323 | Bacteria | 2656 |
| 10 | rootH1_10224479 | 3300003323 | Bacteria | 1134 |
| 11 | JGI25160J50197_1000709 | 3300003354 | Bacteria | 18326 |
| 12 | JGI25160J50197_1002513 | 3300003354 | Bacteria | 8511 |
| 13 | JGI25160J50197_1043457 | 3300003354 | Bacteria | 1011 |
| 14 | JGI25404J52841_10000868 | 3300003659 | Bacteria | 4886 |
| 15 | JGI25404J52841_10007121 | 3300003659 | Bacteria | 2358 |
| 16 | JGI25404J52841_10022763 | 3300003659 | Bacteria | 1353 |
| 17 | JGI25404J52841_10062363 | 3300003659 | Bacteria | 781 |
| 18 | Ga0055542_1005116 | 3300003762 | Bacteria | 3023 |
| 19 | Ga0055526_1050218 | 3300003771 | Bacteria | 957 |
| 20 | Ga0055531_10001452 | 3300003794 | Bacteria | 17483 |
| 21 | Ga0065165_1001305 | 3300005262 | Bacteria | 27868 |
| 22 | Ga0065165_1001628 | 3300005262 | Bacteria | 22844 |
| 23 | Ga0065165_1011953 | 3300005262 | Bacteria | 3571 |
| 24 | Ga0065165_1048550 | 3300005262 | Bacteria | 1218 |
| 25 | Ga0070658_10154929 | 3300005327 | Bacteria | 1920 |
| 26 | Ga0070658_10435416 | 3300005327 | Bacteria | 1129 |
| 27 | Ga0070658_10636029 | 3300005327 | Bacteria | 925 |
| 28 | Ga0070683_100012766 | 3300005329 | Bacteria | 7307 |
| 29 | Ga0068869_100092774 | 3300005334 | Bacteria | 2273 |
| 30 | Ga0070666_10065236 | 3300005335 | Bacteria | 2471 |
| 31 | Ga0070680_100047681 | 3300005336 | Bacteria | 3488 |
| 32 | Ga0070682_100426915 | 3300005337 | Bacteria | 1009 |
| 33 | Ga0068868_100510741 | 3300005338 | Bacteria | 1054 |
| 34 | Ga0068868_101073500 | 3300005338 | Bacteria | 740 |
| 35 | Ga0070660_100004273 | 3300005339 | Bacteria | 9865 |
| 36 | Ga0070661_100133759 | 3300005344 | Bacteria | 1864 |
| 37 | Ga0070661_100166016 | 3300005344 | Bacteria | 1674 |
| 38 | Ga0070668_100048206 | 3300005347 | Bacteria | 3276 |
| 39 | Ga0070668_100077446 | 3300005347 | Bacteria | 2599 |
| 40 | Ga0070668_100282659 | 3300005347 | Bacteria | 1386 |
| 41 | Ga0070668_100298895 | 3300005347 | Bacteria | 1350 |
| 42 | Ga0070669_100092335 | 3300005353 | Bacteria | 2272 |
| 43 | Ga0070675_100985946 | 3300005354 | Bacteria | 773 |
| 44 | Ga0070671_100249816 | 3300005355 | Bacteria | 1507 |
| 45 | Ga0070674_100274672 | 3300005356 | Bacteria | 1333 |
| 46 | Ga0070673_100257228 | 3300005364 | Bacteria | 1524 |
| 47 | Ga0070673_100394246 | 3300005364 | Bacteria | 1237 |
| 48 | Ga0070688_100062463 | 3300005365 | Bacteria | 2358 |
| 49 | Ga0070688_100074393 | 3300005365 | Bacteria | 2182 |
| 50 | Ga0070667_100235235 | 3300005367 | Bacteria | 1634 |
| 51 | Ga0070667_100550328 | 3300005367 | Bacteria | 1061 |
| 52 | Ga0070709_10000324 | 3300005434 | Bacteria | 30045 |
| 53 | Ga0070709_10002143 | 3300005434 | Bacteria | 10686 |
| 54 | Ga0070714_100039343 | 3300005435 | Bacteria | 3981 |
| 55 | Ga0070714_100055285 | 3300005435 | Bacteria | 3392 |
| 56 | Ga0070714_100158596 | 3300005435 | Bacteria | 2045 |
| 57 | Ga0070713_100059037 | 3300005436 | Bacteria | 3202 |
| 58 | Ga0070713_100072454 | 3300005436 | Bacteria | 2914 |
| 59 | Ga0070713_100079742 | 3300005436 | Bacteria | 2790 |
| 60 | Ga0070713_100133978 | 3300005436 | Bacteria | 2187 |
| 61 | Ga0070713_100329922 | 3300005436 | Bacteria | 1411 |
| 62 | Ga0070710_10004545 | 3300005437 | Bacteria | 6560 |
| 63 | Ga0070710_10061500 | 3300005437 | Bacteria | 2139 |
| 64 | Ga0070711_100005717 | 3300005439 | Bacteria | 7456 |
| 65 | Ga0070711_100009594 | 3300005439 | Bacteria | 5966 |
| 66 | Ga0070711_100013807 | 3300005439 | Bacteria | 5079 |
| 67 | Ga0070711_100153320 | 3300005439 | Bacteria | 1739 |
| 68 | Ga0070705_100260842 | 3300005440 | Bacteria | 1222 |
| 69 | Ga0070663_100005116 | 3300005455 | Bacteria | 7763 |
| 70 | Ga0070663_100011980 | 3300005455 | Bacteria | 5470 |
| 71 | Ga0070663_100065337 | 3300005455 | Bacteria | 2633 |
| 72 | Ga0070663_100100609 | 3300005455 | Bacteria | 2156 |
| 73 | Ga0070663_100359676 | 3300005455 | Bacteria | 1180 |
| 74 | Ga0070663_100392510 | 3300005455 | Bacteria | 1133 |
| 75 | Ga0070663_100734552 | 3300005455 | Bacteria | 842 |
| 76 | Ga0070678_100062747 | 3300005456 | Bacteria | 2745 |
| 77 | Ga0070678_100235325 | 3300005456 | Bacteria | 1529 |
| 78 | Ga0070678_100289109 | 3300005456 | Bacteria | 1389 |
| 79 | Ga0070662_100065597 | 3300005457 | Bacteria | 2661 |
| 80 | Ga0070662_100145189 | 3300005457 | Bacteria | 1843 |
| 81 | Ga0070681_10044524 | 3300005458 | Bacteria | 4442 |
| 82 | Ga0070681_10054107 | 3300005458 | Bacteria | 3999 |
| 83 | Ga0070681_10105694 | 3300005458 | Bacteria | 2757 |
| 84 | Ga0070681_10159140 | 3300005458 | Bacteria | 2182 |
| 85 | Ga0068867_100047009 | 3300005459 | Bacteria | 3172 |
| 86 | Ga0068867_100148110 | 3300005459 | Bacteria | 1841 |
| 87 | Ga0070707_100725866 | 3300005468 | Bacteria | 957 |
| 88 | Ga0070698_100026181 | 3300005471 | Bacteria | 6073 |
| 89 | Ga0070699_100468596 | 3300005518 | Bacteria | 1143 |
| 90 | Ga0070679_100041981 | 3300005530 | Bacteria | 4555 |
| 91 | Ga0070679_100044114 | 3300005530 | Bacteria | 4442 |
| 92 | Ga0070679_100078665 | 3300005530 | Bacteria | 3286 |
| 93 | Ga0070679_100097758 | 3300005530 | Bacteria | 2923 |
| 94 | Ga0070684_100002379 | 3300005535 | Bacteria | 13868 |
| 95 | Ga0070684_100019513 | 3300005535 | Bacteria | 5609 |
| 96 | Ga0070684_100051309 | 3300005535 | Bacteria | 3583 |
| 97 | Ga0070684_100105307 | 3300005535 | Bacteria | 2524 |
| 98 | Ga0068853_100119521 | 3300005539 | Bacteria | 2349 |
| 99 | Ga0068853_100233155 | 3300005539 | Bacteria | 1684 |
| 100 | Ga0068853_100269387 | 3300005539 | Bacteria | 1568 |
| 101 | Ga0068853_100278145 | 3300005539 | Bacteria | 1543 |
| 102 | Ga0068853_100364061 | 3300005539 | Bacteria | 1348 |
| 103 | Ga0068853_100380218 | 3300005539 | Bacteria | 1318 |
| 104 | Ga0068853_100405323 | 3300005539 | Bacteria | 1277 |
| 105 | Ga0070672_100032454 | 3300005543 | Bacteria | 3940 |
| 106 | Ga0070672_100193361 | 3300005543 | Bacteria | 1700 |
| 107 | Ga0070693_100338802 | 3300005547 | Bacteria | 1026 |
| 108 | Ga0070665_100049667 | 3300005548 | Bacteria | 4209 |
| 109 | Ga0070665_100073653 | 3300005548 | Bacteria | 3421 |
| 110 | Ga0070665_100075172 | 3300005548 | Bacteria | 3385 |
| 111 | Ga0070704_100039644 | 3300005549 | Bacteria | 3236 |
| 112 | Ga0068855_100011091 | 3300005563 | Bacteria | 10875 |
| 113 | Ga0068855_100012351 | 3300005563 | Bacteria | 10317 |
| 114 | Ga0068855_100046970 | 3300005563 | Bacteria | 5103 |
| 115 | Ga0068855_100293910 | 3300005563 | Bacteria | 1800 |
| 116 | Ga0068855_100327963 | 3300005563 | Bacteria | 1690 |
| 117 | Ga0068855_100832987 | 3300005563 | Bacteria | 979 |
| 118 | Ga0068855_100901861 | 3300005563 | Bacteria | 934 |
| 119 | Ga0070664_100496340 | 3300005564 | Bacteria | 1125 |
| 120 | Ga0068857_100021122 | 3300005577 | Bacteria | 5728 |
| 121 | Ga0068857_100514516 | 3300005577 | Bacteria | 1124 |
| 122 | Ga0068854_100066050 | 3300005578 | Bacteria | 2632 |
| 123 | Ga0068854_100070200 | 3300005578 | Bacteria | 2560 |
| 124 | Ga0068856_100000091 | 3300005614 | Bacteria | 85048 |
| 125 | Ga0068856_100043323 | 3300005614 | Bacteria | 4428 |
| 126 | Ga0068856_100202648 | 3300005614 | Bacteria | 1999 |
| 127 | Ga0068856_100225707 | 3300005614 | Bacteria | 1888 |
| 128 | Ga0068856_100348348 | 3300005614 | Bacteria | 1500 |
| 129 | Ga0070702_100039568 | 3300005615 | Bacteria | 2631 |
| 130 | Ga0068852_100215150 | 3300005616 | Bacteria | 1825 |
| 131 | Ga0068852_100908109 | 3300005616 | Bacteria | 898 |
| 132 | Ga0068859_100014165 | 3300005617 | Bacteria | 7997 |
| 133 | Ga0068859_100089670 | 3300005617 | Bacteria | 3126 |
| 134 | Ga0068859_100375335 | 3300005617 | Bacteria | 1518 |
| 135 | Ga0068859_100593503 | 3300005617 | Bacteria | 1201 |
| 136 | Ga0068864_100228267 | 3300005618 | Bacteria | 1721 |
| 137 | Ga0068864_101067572 | 3300005618 | Bacteria | 803 |
| 138 | Ga0068866_10259068 | 3300005718 | Bacteria | 1068 |
| 139 | Ga0068861_100010097 | 3300005719 | Bacteria | 6546 |
| 140 | Ga0068861_100331473 | 3300005719 | Bacteria | 1329 |
| 141 | Ga0068851_10020652 | 3300005834 | Bacteria | 3191 |
| 142 | Ga0068851_10165377 | 3300005834 | Bacteria | 1218 |
| 143 | Ga0068870_10014005 | 3300005840 | Bacteria | 3779 |
| 144 | Ga0068870_10431464 | 3300005840 | Bacteria | 864 |
| 145 | Ga0068863_100499699 | 3300005841 | Bacteria | 1197 |
| 146 | Ga0068858_100207127 | 3300005842 | Bacteria | 1855 |
| 147 | Ga0068860_100229138 | 3300005843 | Bacteria | 1805 |
| 148 | Ga0068862_100193040 | 3300005844 | Bacteria | 1833 |
| 149 | Ga0068862_100599328 | 3300005844 | Bacteria | 1057 |
| 150 | Ga0081455_10001565 | 3300005937 | Bacteria | 28095 |
| 151 | Ga0081455_10011569 | 3300005937 | Bacteria | 8855 |
| 152 | Ga0081455_10023918 | 3300005937 | Bacteria | 5674 |
| 153 | Ga0081455_10048845 | 3300005937 | Bacteria | 3652 |
| 154 | Ga0081455_10284251 | 3300005937 | Bacteria | 1194 |
| 155 | Ga0081455_10627158 | 3300005937 | Bacteria | 696 |
| 156 | Ga0081538_10018190 | 3300005981 | Bacteria | 5292 |
| 157 | Ga0081540_1001316 | 3300005983 | Bacteria | 21684 |
| 158 | Ga0081540_1002055 | 3300005983 | Bacteria | 16786 |
| 159 | Ga0081540_1003177 | 3300005983 | Bacteria | 13110 |
| 160 | Ga0081540_1003766 | 3300005983 | Bacteria | 11877 |
| 161 | Ga0081540_1005220 | 3300005983 | Bacteria | 9723 |
| 162 | Ga0081540_1035251 | 3300005983 | Bacteria | 2686 |
| 163 | Ga0081540_1045180 | 3300005983 | Bacteria | 2241 |
| 164 | Ga0081540_1062702 | 3300005983 | Bacteria | 1764 |
| 165 | Ga0081540_1067617 | 3300005983 | Bacteria | 1669 |
| 166 | Ga0081540_1212295 | 3300005983 | Bacteria | 695 |
| 167 | Ga0081539_10002516 | 3300005985 | Bacteria | 25625 |
| 168 | Ga0081539_10017368 | 3300005985 | Bacteria | 5056 |
| 169 | Ga0081539_10043336 | 3300005985 | Bacteria | 2610 |
| 170 | Ga0081539_10071980 | 3300005985 | Bacteria | 1850 |
| 171 | Ga0070717_10040796 | 3300006028 | Bacteria | 3783 |
| 172 | Ga0070717_10110584 | 3300006028 | Bacteria | 2343 |
| 173 | Ga0070717_10151157 | 3300006028 | Bacteria | 2009 |
| 174 | Ga0075365_10023148 | 3300006038 | Bacteria | 3903 |
| 175 | Ga0075365_10036146 | 3300006038 | Bacteria | 3200 |
| 176 | Ga0075365_10094148 | 3300006038 | Bacteria | 2044 |
| 177 | Ga0075365_10125194 | 3300006038 | Bacteria | 1776 |
| 178 | Ga0075368_10016671 | 3300006042 | Bacteria | 2740 |
| 179 | Ga0075368_10023074 | 3300006042 | Bacteria | 2373 |
| 180 | Ga0075368_10123748 | 3300006042 | Bacteria | 1072 |
| 181 | Ga0075363_100011292 | 3300006048 | Bacteria | 4272 |
| 182 | Ga0075363_100063181 | 3300006048 | Bacteria | 1998 |
| 183 | Ga0075364_10120161 | 3300006051 | Bacteria | 1758 |
| 184 | Ga0070716_100001795 | 3300006173 | Bacteria | 9720 |
| 185 | Ga0070716_100094586 | 3300006173 | Bacteria | 1817 |
| 186 | Ga0070712_100008170 | 3300006175 | Bacteria | 6570 |
| 187 | Ga0070712_100028537 | 3300006175 | Bacteria | 3733 |
| 188 | Ga0070712_100045139 | 3300006175 | Bacteria | 3041 |
| 189 | Ga0070712_100147746 | 3300006175 | Bacteria | 1801 |
| 190 | Ga0070712_100261990 | 3300006175 | Bacteria | 1386 |
| 191 | Ga0070712_100388878 | 3300006175 | Bacteria | 1150 |
| 192 | Ga0075362_10036149 | 3300006177 | Bacteria | 2159 |
| 193 | Ga0075362_10065808 | 3300006177 | Bacteria | 1646 |
| 194 | Ga0075362_10189600 | 3300006177 | Bacteria | 998 |
| 195 | Ga0075367_10021204 | 3300006178 | Bacteria | 3628 |
| 196 | Ga0075367_10026486 | 3300006178 | Bacteria | 3289 |
| 197 | Ga0075367_10046559 | 3300006178 | Bacteria | 2548 |
| 198 | Ga0075367_10138714 | 3300006178 | Bacteria | 1506 |
| 199 | Ga0075367_10151449 | 3300006178 | Bacteria | 1439 |
| 200 | Ga0075367_10446652 | 3300006178 | Bacteria | 819 |
| 201 | Ga0075369_10029760 | 3300006186 | Bacteria | 2296 |
| 202 | Ga0075369_10211141 | 3300006186 | Bacteria | 897 |
| 203 | Ga0075366_10017172 | 3300006195 | Bacteria | 4163 |
| 204 | Ga0075366_10056721 | 3300006195 | Bacteria | 2327 |
| 205 | Ga0075366_10077813 | 3300006195 | Bacteria | 1979 |
| 206 | Ga0075366_10090033 | 3300006195 | Bacteria | 1837 |
| 207 | Ga0097621_100509455 | 3300006237 | Bacteria | 1091 |
| 208 | Ga0075370_10028858 | 3300006353 | Bacteria | 3087 |
| 209 | Ga0075370_10108112 | 3300006353 | Bacteria | 1613 |
| 210 | Ga0075370_10193921 | 3300006353 | Bacteria | 1197 |
| 211 | Ga0075370_10263366 | 3300006353 | Bacteria | 1022 |
| 212 | Ga0075370_10488411 | 3300006353 | Bacteria | 743 |
| 213 | Ga0068871_100065219 | 3300006358 | Bacteria | 2982 |
| 214 | Ga0068871_100228886 | 3300006358 | Bacteria | 1613 |
| 215 | Ga0075428_100352923 | 3300006844 | Bacteria | 1578 |
| 216 | Ga0075428_100388241 | 3300006844 | Bacteria | 1497 |
| 217 | Ga0075428_101376576 | 3300006844 | Bacteria | 741 |
| 218 | Ga0075433_10112872 | 3300006852 | Bacteria | 2411 |
| 219 | Ga0075434_100197637 | 3300006871 | Bacteria | 2031 |
| 220 | Ga0075434_100234838 | 3300006871 | Bacteria | 1853 |
| 221 | Ga0068865_100091839 | 3300006881 | Bacteria | 2204 |
| 222 | Ga0068865_100622352 | 3300006881 | Bacteria | 915 |
| 223 | Ga0075436_100607155 | 3300006914 | Bacteria | 806 |
| 224 | Ga0097620_100014164 | 3300006931 | Bacteria | 7997 |
| 225 | Ga0097620_100089668 | 3300006931 | Bacteria | 3126 |
| 226 | Ga0097620_100375337 | 3300006931 | Bacteria | 1518 |
| 227 | Ga0097620_100593500 | 3300006931 | Bacteria | 1201 |
| 228 | Ga0099824_1003225 | 3300006942 | Bacteria | 23847 |
| 229 | Ga0099824_1015288 | 3300006942 | Bacteria | 7319 |
| 230 | Ga0099822_1025589 | 3300006943 | Bacteria | 5105 |
| 231 | Ga0075435_100582548 | 3300007076 | Bacteria | 970 |
| 232 | Ga0099794_10004324 | 3300007265 | Bacteria | 5560 |
| 233 | Ga0099795_10006561 | 3300007788 | Bacteria | 3184 |
| 234 | Ga0105240_10006270 | 3300009093 | Bacteria | 17499 |
| 235 | Ga0105240_10332078 | 3300009093 | Bacteria | 1730 |
| 236 | Ga0105240_10399540 | 3300009093 | Bacteria | 1548 |
| 237 | Ga0105240_10530153 | 3300009093 | Bacteria | 1306 |
| 238 | Ga0111539_10039518 | 3300009094 | Bacteria | 5685 |
| 239 | Ga0111539_10663285 | 3300009094 | Bacteria | 1215 |
| 240 | Ga0105245_10119877 | 3300009098 | Bacteria | 2456 |
| 241 | Ga0105245_10580408 | 3300009098 | Bacteria | 1145 |
| 242 | Ga0105245_11179746 | 3300009098 | Bacteria | 813 |
| 243 | Ga0105247_10060832 | 3300009101 | Bacteria | 2341 |
| 244 | Ga0105247_10485961 | 3300009101 | Bacteria | 897 |
| 245 | Ga0114129_10045838 | 3300009147 | Bacteria | 6145 |
| 246 | Ga0114129_11738208 | 3300009147 | Bacteria | 760 |
| 247 | Ga0105243_10085596 | 3300009148 | Bacteria | 2584 |
| 248 | Ga0105243_10289824 | 3300009148 | Bacteria | 1478 |
| 249 | Ga0105241_10020501 | 3300009174 | Bacteria | 4884 |
| 250 | Ga0105241_10039006 | 3300009174 | Bacteria | 3582 |
| 251 | Ga0105241_10061907 | 3300009174 | Bacteria | 2883 |
| 252 | Ga0105241_10231558 | 3300009174 | Bacteria | 1558 |
| 253 | Ga0105242_10121787 | 3300009176 | Bacteria | 2240 |
| 254 | Ga0105242_10713070 | 3300009176 | Bacteria | 983 |
| 255 | Ga0105248_10051252 | 3300009177 | Bacteria | 4631 |
| 256 | Ga0105248_10070301 | 3300009177 | Bacteria | 3931 |
| 257 | Ga0105248_10269930 | 3300009177 | Bacteria | 1916 |
| 258 | Ga0105248_10985866 | 3300009177 | Bacteria | 952 |
| 259 | Ga0105237_10001391 | 3300009545 | Bacteria | 31961 |
| 260 | Ga0105237_10003041 | 3300009545 | Bacteria | 20237 |
| 261 | Ga0105237_10055891 | 3300009545 | Bacteria | 3952 |
| 262 | Ga0105237_10283706 | 3300009545 | Bacteria | 1659 |
| 263 | Ga0105237_10436943 | 3300009545 | Bacteria | 1314 |
| 264 | Ga0105238_10007433 | 3300009551 | Bacteria | 10975 |
| 265 | Ga0105238_10036806 | 3300009551 | Bacteria | 4976 |
| 266 | Ga0105238_10101444 | 3300009551 | Bacteria | 2860 |
| 267 | Ga0105238_10224266 | 3300009551 | Bacteria | 1856 |
| 268 | Ga0105238_10330068 | 3300009551 | Bacteria | 1512 |
| 269 | Ga0105238_10562419 | 3300009551 | Bacteria | 1145 |
| 270 | Ga0105249_10151912 | 3300009553 | Bacteria | 2230 |
| 271 | Ga0105249_10857413 | 3300009553 | Bacteria | 974 |
| 272 | Ga0099796_10026232 | 3300010159 | Bacteria | 1849 |
| 273 | Ga0099796_10156582 | 3300010159 | Bacteria | 900 |
| 274 | Ga0105239_10005113 | 3300010375 | Bacteria | 15486 |
| 275 | Ga0105239_10008417 | 3300010375 | Bacteria | 11742 |
| 276 | Ga0105239_10564610 | 3300010375 | Bacteria | 1297 |
| 277 | Ga0105239_10757708 | 3300010375 | Bacteria | 1111 |
| 278 | Ga0105246_10011638 | 3300011119 | Bacteria | 5465 |
| 279 | Ga0105246_10035501 | 3300011119 | Bacteria | 3333 |
| 280 | Ga0105246_10205378 | 3300011119 | Bacteria | 1534 |
| 281 | Ga0157370_10060883 | 3300013104 | Bacteria | 3583 |
| 282 | Ga0157370_10137706 | 3300013104 | Bacteria | 2275 |
| 283 | Ga0157370_11316179 | 3300013104 | Bacteria | 651 |
| 284 | Ga0157369_10003636 | 3300013105 | Bacteria | 18291 |
| 285 | Ga0157369_10007202 | 3300013105 | Bacteria | 12817 |
| 286 | Ga0157369_10368991 | 3300013105 | Bacteria | 1490 |
| 287 | Ga0157369_10469407 | 3300013105 | Bacteria | 1303 |
| 288 | Ga0157374_10046894 | 3300013296 | Bacteria | 4004 |
| 289 | Ga0157374_10141279 | 3300013296 | Bacteria | 2337 |
| 290 | Ga0157374_10453594 | 3300013296 | Bacteria | 1284 |
| 291 | Ga0157374_10800889 | 3300013296 | Bacteria | 958 |
| 292 | Ga0157378_10099257 | 3300013297 | Bacteria | 2656 |
| 293 | Ga0157378_10172702 | 3300013297 | Bacteria | 2028 |
| 294 | Ga0157378_10280939 | 3300013297 | Bacteria | 1605 |
| 295 | Ga0157378_10474105 | 3300013297 | Bacteria | 1246 |
| 296 | Ga0157378_10476080 | 3300013297 | Bacteria | 1243 |
| 297 | Ga0157378_11141698 | 3300013297 | Bacteria | 817 |
| 298 | Ga0157378_11217780 | 3300013297 | Bacteria | 793 |
| 299 | Ga0163162_10079922 | 3300013306 | Bacteria | 3336 |
| 300 | Ga0163162_10102084 | 3300013306 | Bacteria | 2961 |
| 301 | Ga0163162_10145155 | 3300013306 | Bacteria | 2489 |
| 302 | Ga0163162_10234207 | 3300013306 | Bacteria | 1967 |
| 303 | Ga0163162_10299735 | 3300013306 | Bacteria | 1739 |
| 304 | Ga0157372_10044995 | 3300013307 | Bacteria | 4893 |
| 305 | Ga0157372_10117449 | 3300013307 | Bacteria | 3051 |
| 306 | Ga0157372_11107729 | 3300013307 | Bacteria | 916 |
| 307 | Ga0157375_10028075 | 3300013308 | Bacteria | 5270 |
| 308 | Ga0157375_10640633 | 3300013308 | Bacteria | 1220 |
| 309 | Ga0163163_10048811 | 3300014325 | Bacteria | 4164 |
| 310 | Ga0163163_10752537 | 3300014325 | Bacteria | 1038 |
| 311 | Ga0163163_11043038 | 3300014325 | Bacteria | 881 |
| 312 | Ga0157380_10052903 | 3300014326 | Bacteria | 3217 |
| 313 | Ga0157380_10531269 | 3300014326 | Bacteria | 1149 |
| 314 | Ga0157379_10854091 | 3300014968 | Bacteria | 861 |
| 315 | Ga0157379_10946769 | 3300014968 | Bacteria | 819 |
| 316 | Ga0157376_10083196 | 3300014969 | Bacteria | 2752 |
| 317 | Ga0157376_10106270 | 3300014969 | Bacteria | 2462 |
| 318 | Ga0157376_10414208 | 3300014969 | Bacteria | 1306 |
| 319 | Ga0157376_11607915 | 3300014969 | Bacteria | 684 |
| 320 | Ga0163161_10166568 | 3300017792 | Bacteria | 1683 |
| 321 | Ga0163161_10190471 | 3300017792 | Bacteria | 1577 |
| 322 | Ga0163161_10820547 | 3300017792 | Bacteria | 783 |
| 323 | Ga0206353_10094903 | 3300020082 | Bacteria | 1284 |
| 324 | Ga0214544_1000026 | 3300021320 | Bacteria | 161530 |
| 325 | Ga0214544_1027092 | 3300021320 | Bacteria | 2441 |
| 326 | Ga0214542_1000025 | 3300021321 | Bacteria | 183588 |
| 327 | Ga0214542_1031522 | 3300021321 | Bacteria | 1961 |
| 328 | Ga0214545_1000014 | 3300021324 | Bacteria | 183588 |
| 329 | Ga0214543_1000034 | 3300021327 | Bacteria | 183712 |
| 330 | Ga0213876_10016320 | 3300021384 | Bacteria | 3925 |
| 331 | Ga0213875_10020469 | 3300021388 | Bacteria | 3175 |
| 332 | Ga0213871_10013056 | 3300021441 | Bacteria | 1943 |
| 333 | Ga0207425_1020389 | 3300025245 | Bacteria | 1418 |
| 334 | Ga0209148_1000250 | 3300025254 | Bacteria | 85755 |
| 335 | Ga0209233_1002562 | 3300025261 | Bacteria | 6620 |
| 336 | Ga0209233_1004484 | 3300025261 | Bacteria | 4739 |
| 337 | Ga0209233_1007321 | 3300025261 | Bacteria | 3502 |
| 338 | Ga0209455_1001255 | 3300025272 | Bacteria | 11915 |
| 339 | Ga0209564_1003732 | 3300025295 | Bacteria | 9966 |
| 340 | Ga0209758_1000141 | 3300025297 | Bacteria | 172481 |
| 341 | Ga0209758_1000324 | 3300025297 | Bacteria | 91475 |
| 342 | Ga0209758_1000476 | 3300025297 | Bacteria | 66180 |
| 343 | Ga0209758_1001151 | 3300025297 | Bacteria | 33844 |
| 344 | Ga0209758_1037257 | 3300025297 | Bacteria | 1882 |
| 345 | Ga0209256_1023807 | 3300025299 | Bacteria | 1817 |
| 346 | Ga0209256_1044938 | 3300025299 | Bacteria | 1100 |
| 347 | Ga0207426_1000523 | 3300025302 | Bacteria | 55736 |
| 348 | Ga0207426_1000768 | 3300025302 | Bacteria | 35650 |
| 349 | Ga0207426_1002739 | 3300025302 | Bacteria | 10682 |
| 350 | Ga0207426_1095774 | 3300025302 | Bacteria | 776 |
| 351 | Ga0209257_1001317 | 3300025304 | Bacteria | 30217 |
| 352 | Ga0207697_10142440 | 3300025315 | Bacteria | 1040 |
| 353 | Ga0207697_10219247 | 3300025315 | Bacteria | 839 |
| 354 | Ga0207656_10051297 | 3300025321 | Bacteria | 1784 |
| 355 | Ga0207696_1041155 | 3300025711 | Bacteria | 1351 |
| 356 | Ga0207653_10038609 | 3300025885 | Bacteria | 1561 |
| 357 | Ga0207692_10005899 | 3300025898 | Bacteria | 4939 |
| 358 | Ga0207692_10006552 | 3300025898 | Bacteria | 4726 |
| 359 | Ga0207692_10115659 | 3300025898 | Bacteria | 1495 |
| 360 | Ga0207692_10123617 | 3300025898 | Bacteria | 1452 |
| 361 | Ga0207642_10023275 | 3300025899 | Bacteria | 2472 |
| 362 | Ga0207710_10043781 | 3300025900 | Bacteria | 1992 |
| 363 | Ga0207688_10017927 | 3300025901 | Bacteria | 3853 |
| 364 | Ga0207688_10119736 | 3300025901 | Bacteria | 1535 |
| 365 | Ga0207688_10147702 | 3300025901 | Bacteria | 1387 |
| 366 | Ga0207688_10201535 | 3300025901 | Bacteria | 1193 |
| 367 | Ga0207680_10022446 | 3300025903 | Bacteria | 3433 |
| 368 | Ga0207680_10065256 | 3300025903 | Bacteria | 2234 |
| 369 | Ga0207647_10075009 | 3300025904 | Bacteria | 2036 |
| 370 | Ga0207647_10165006 | 3300025904 | Bacteria | 1291 |
| 371 | Ga0207647_10258870 | 3300025904 | Bacteria | 997 |
| 372 | Ga0207647_10359981 | 3300025904 | Bacteria | 823 |
| 373 | Ga0207699_10001062 | 3300025906 | Bacteria | 12978 |
| 374 | Ga0207699_10049665 | 3300025906 | Bacteria | 2470 |
| 375 | Ga0207699_10226048 | 3300025906 | Bacteria | 1280 |
| 376 | Ga0207645_10014665 | 3300025907 | Bacteria | 5233 |
| 377 | Ga0207645_10301602 | 3300025907 | Bacteria | 1067 |
| 378 | Ga0207643_10399467 | 3300025908 | Bacteria | 869 |
| 379 | Ga0207705_10688904 | 3300025909 | Bacteria | 795 |
| 380 | Ga0207684_10184562 | 3300025910 | Bacteria | 1799 |
| 381 | Ga0207684_10448655 | 3300025910 | Bacteria | 1107 |
| 382 | Ga0207654_10016235 | 3300025911 | Bacteria | 3874 |
| 383 | Ga0207707_10003996 | 3300025912 | Bacteria | 13095 |
| 384 | Ga0207707_10008329 | 3300025912 | Bacteria | 8995 |
| 385 | Ga0207707_10012694 | 3300025912 | Bacteria | 7322 |
| 386 | Ga0207707_10025470 | 3300025912 | Bacteria | 5175 |
| 387 | Ga0207707_10244387 | 3300025912 | Bacteria | 1560 |
| 388 | Ga0207707_10345815 | 3300025912 | Bacteria | 1282 |
| 389 | Ga0207707_10706916 | 3300025912 | Bacteria | 846 |
| 390 | Ga0207695_10000062 | 3300025913 | Bacteria | 351979 |
| 391 | Ga0207695_10073392 | 3300025913 | Bacteria | 3487 |
| 392 | Ga0207695_10198040 | 3300025913 | Bacteria | 1924 |
| 393 | Ga0207695_10415388 | 3300025913 | Bacteria | 1230 |
| 394 | Ga0207695_10525286 | 3300025913 | Bacteria | 1065 |
| 395 | Ga0207671_10001205 | 3300025914 | Bacteria | 30737 |
| 396 | Ga0207671_10007037 | 3300025914 | Bacteria | 9856 |
| 397 | Ga0207671_10196302 | 3300025914 | Bacteria | 1575 |
| 398 | Ga0207671_10321425 | 3300025914 | Bacteria | 1225 |
| 399 | Ga0207671_10367156 | 3300025914 | Bacteria | 1143 |
| 400 | Ga0207671_10710762 | 3300025914 | Bacteria | 799 |
| 401 | Ga0207693_10004791 | 3300025915 | Bacteria | 11378 |
| 402 | Ga0207693_10008114 | 3300025915 | Bacteria | 8609 |
| 403 | Ga0207693_10024069 | 3300025915 | Bacteria | 4834 |
| 404 | Ga0207693_10048463 | 3300025915 | Bacteria | 3336 |
| 405 | Ga0207693_10185455 | 3300025915 | Bacteria | 1638 |
| 406 | Ga0207693_10506875 | 3300025915 | Bacteria | 942 |
| 407 | Ga0207663_10007196 | 3300025916 | Bacteria | 5759 |
| 408 | Ga0207663_10037455 | 3300025916 | Bacteria | 2924 |
| 409 | Ga0207663_10063692 | 3300025916 | Bacteria | 2349 |
| 410 | Ga0207663_10870846 | 3300025916 | Bacteria | 719 |
| 411 | Ga0207660_10001063 | 3300025917 | Bacteria | 18218 |
| 412 | Ga0207660_10046064 | 3300025917 | Bacteria | 3076 |
| 413 | Ga0207660_10079957 | 3300025917 | Bacteria | 2399 |
| 414 | Ga0207660_10129366 | 3300025917 | Bacteria | 1920 |
| 415 | Ga0207662_10243912 | 3300025918 | Bacteria | 1177 |
| 416 | Ga0207657_10001360 | 3300025919 | Bacteria | 26055 |
| 417 | Ga0207657_10072567 | 3300025919 | Bacteria | 2912 |
| 418 | Ga0207657_10240445 | 3300025919 | Bacteria | 1446 |
| 419 | Ga0207657_10426039 | 3300025919 | Bacteria | 1042 |
| 420 | Ga0207649_10511938 | 3300025920 | Bacteria | 914 |
| 421 | Ga0207652_10003881 | 3300025921 | Bacteria | 12232 |
| 422 | Ga0207652_10017473 | 3300025921 | Bacteria | 5870 |
| 423 | Ga0207652_10081505 | 3300025921 | Bacteria | 2830 |
| 424 | Ga0207646_10145117 | 3300025922 | Bacteria | 2138 |
| 425 | Ga0207681_10493530 | 3300025923 | Bacteria | 1001 |
| 426 | Ga0207681_10785618 | 3300025923 | Bacteria | 795 |
| 427 | Ga0207694_10226680 | 3300025924 | Bacteria | 1525 |
| 428 | Ga0207694_10351438 | 3300025924 | Bacteria | 1220 |
| 429 | Ga0207650_10354975 | 3300025925 | Bacteria | 1207 |
| 430 | Ga0207650_10473682 | 3300025925 | Bacteria | 1044 |
| 431 | Ga0207687_10033271 | 3300025927 | Bacteria | 3496 |
| 432 | Ga0207687_10493296 | 3300025927 | Bacteria | 1021 |
| 433 | Ga0207700_10002104 | 3300025928 | Bacteria | 11368 |
| 434 | Ga0207700_10033953 | 3300025928 | Bacteria | 3656 |
| 435 | Ga0207700_10058030 | 3300025928 | Bacteria | 2922 |
| 436 | Ga0207700_10190364 | 3300025928 | Bacteria | 1724 |
| 437 | Ga0207700_10324779 | 3300025928 | Bacteria | 1334 |
| 438 | Ga0207664_10004165 | 3300025929 | Bacteria | 9765 |
| 439 | Ga0207664_10196138 | 3300025929 | Bacteria | 1740 |
| 440 | Ga0207644_10160166 | 3300025931 | Bacteria | 1749 |
| 441 | Ga0207644_10441707 | 3300025931 | Bacteria | 1068 |
| 442 | Ga0207644_10742255 | 3300025931 | Bacteria | 820 |
| 443 | Ga0207690_10229716 | 3300025932 | Bacteria | 1424 |
| 444 | Ga0207690_10727933 | 3300025932 | Bacteria | 817 |
| 445 | Ga0207706_10041999 | 3300025933 | Bacteria | 4052 |
| 446 | Ga0207706_10141635 | 3300025933 | Bacteria | 2115 |
| 447 | Ga0207686_10214684 | 3300025934 | Bacteria | 1385 |
| 448 | Ga0207709_10004831 | 3300025935 | Bacteria | 7723 |
| 449 | Ga0207709_10391658 | 3300025935 | Bacteria | 1060 |
| 450 | Ga0207709_10477191 | 3300025935 | Bacteria | 969 |
| 451 | Ga0207709_10640623 | 3300025935 | Bacteria | 845 |
| 452 | Ga0207670_10256795 | 3300025936 | Bacteria | 1353 |
| 453 | Ga0207669_10167590 | 3300025937 | Bacteria | 1559 |
| 454 | Ga0207669_10560614 | 3300025937 | Bacteria | 923 |
| 455 | Ga0207704_10205689 | 3300025938 | Bacteria | 1444 |
| 456 | Ga0207665_10053611 | 3300025939 | Bacteria | 2719 |
| 457 | Ga0207665_10123034 | 3300025939 | Bacteria | 1834 |
| 458 | Ga0207665_10228528 | 3300025939 | Bacteria | 1366 |
| 459 | Ga0207665_10381652 | 3300025939 | Bacteria | 1070 |
| 460 | Ga0207665_10468350 | 3300025939 | Bacteria | 969 |
| 461 | Ga0207665_10518702 | 3300025939 | Bacteria | 922 |
| 462 | Ga0207691_10045318 | 3300025940 | Bacteria | 4043 |
| 463 | Ga0207691_10492720 | 3300025940 | Bacteria | 1041 |
| 464 | Ga0207711_10045167 | 3300025941 | Bacteria | 3764 |
| 465 | Ga0207711_11187115 | 3300025941 | Bacteria | 705 |
| 466 | Ga0207689_10066424 | 3300025942 | Bacteria | 2966 |
| 467 | Ga0207661_10000337 | 3300025944 | Bacteria | 29905 |
| 468 | Ga0207661_10018159 | 3300025944 | Bacteria | 5225 |
| 469 | Ga0207661_10996896 | 3300025944 | Bacteria | 772 |
| 470 | Ga0207679_10215161 | 3300025945 | Bacteria | 1614 |
| 471 | Ga0207679_10618509 | 3300025945 | Bacteria | 977 |
| 472 | Ga0207667_10003256 | 3300025949 | Bacteria | 20033 |
| 473 | Ga0207667_10050410 | 3300025949 | Bacteria | 4392 |
| 474 | Ga0207667_10140872 | 3300025949 | Bacteria | 2483 |
| 475 | Ga0207667_10232460 | 3300025949 | Bacteria | 1887 |
| 476 | Ga0207667_10278654 | 3300025949 | Bacteria | 1709 |
| 477 | Ga0207667_10606710 | 3300025949 | Bacteria | 1103 |
| 478 | Ga0207667_11036650 | 3300025949 | Bacteria | 806 |
| 479 | Ga0207712_10345263 | 3300025961 | Bacteria | 1236 |
| 480 | Ga0207712_10531696 | 3300025961 | Bacteria | 1009 |
| 481 | Ga0207712_10591811 | 3300025961 | Bacteria | 959 |
| 482 | Ga0207668_10135455 | 3300025972 | Bacteria | 1886 |
| 483 | Ga0207668_10312606 | 3300025972 | Bacteria | 1301 |
| 484 | Ga0207640_10063155 | 3300025981 | Bacteria | 2460 |
| 485 | Ga0207640_10071663 | 3300025981 | Bacteria | 2335 |
| 486 | Ga0207640_10143796 | 3300025981 | Bacteria | 1742 |
| 487 | Ga0207658_10272065 | 3300025986 | Bacteria | 1448 |
| 488 | Ga0207658_10297594 | 3300025986 | Bacteria | 1389 |
| 489 | Ga0207658_10411315 | 3300025986 | Bacteria | 1191 |
| 490 | Ga0207677_10237545 | 3300026023 | Bacteria | 1472 |
| 491 | Ga0207677_10353441 | 3300026023 | Bacteria | 1232 |
| 492 | Ga0207703_10088904 | 3300026035 | Bacteria | 2594 |
| 493 | Ga0207703_10182019 | 3300026035 | Bacteria | 1855 |
| 494 | Ga0207703_10302211 | 3300026035 | Bacteria | 1460 |
| 495 | Ga0207703_10345310 | 3300026035 | Bacteria | 1369 |
| 496 | Ga0207703_10446631 | 3300026035 | Bacteria | 1207 |
| 497 | Ga0207703_10625757 | 3300026035 | Bacteria | 1019 |
| 498 | Ga0207639_10025935 | 3300026041 | Bacteria | 4254 |
| 499 | Ga0207639_10084602 | 3300026041 | Bacteria | 2520 |
| 500 | Ga0207639_10085798 | 3300026041 | Bacteria | 2505 |
| 501 | Ga0207639_10114439 | 3300026041 | Bacteria | 2205 |
| 502 | Ga0207639_10263388 | 3300026041 | Bacteria | 1509 |
| 503 | Ga0207639_10291337 | 3300026041 | Bacteria | 1439 |
| 504 | Ga0207639_10390719 | 3300026041 | Bacteria | 1251 |
| 505 | Ga0207639_10842190 | 3300026041 | Bacteria | 856 |
| 506 | Ga0207639_10895630 | 3300026041 | Bacteria | 829 |
| 507 | Ga0207639_10950287 | 3300026041 | Bacteria | 804 |
| 508 | Ga0207678_10010382 | 3300026067 | Bacteria | 8176 |
| 509 | Ga0207678_10066135 | 3300026067 | Bacteria | 3104 |
| 510 | Ga0207678_10074427 | 3300026067 | Bacteria | 2910 |
| 511 | Ga0207678_10104740 | 3300026067 | Bacteria | 2414 |
| 512 | Ga0207678_10155438 | 3300026067 | Bacteria | 1953 |
| 513 | Ga0207678_10214880 | 3300026067 | Bacteria | 1645 |
| 514 | Ga0207678_10414327 | 3300026067 | Bacteria | 1168 |
| 515 | Ga0207708_10150662 | 3300026075 | Bacteria | 1831 |
| 516 | Ga0207708_10901275 | 3300026075 | Bacteria | 765 |
| 517 | Ga0207702_10000041 | 3300026078 | Bacteria | 150754 |
| 518 | Ga0207702_10038734 | 3300026078 | Bacteria | 3993 |
| 519 | Ga0207702_10144995 | 3300026078 | Bacteria | 2153 |
| 520 | Ga0207702_10195323 | 3300026078 | Bacteria | 1873 |
| 521 | Ga0207702_10250553 | 3300026078 | Bacteria | 1663 |
| 522 | Ga0207702_10588059 | 3300026078 | Bacteria | 1091 |
| 523 | Ga0207702_10691826 | 3300026078 | Bacteria | 1005 |
| 524 | Ga0207648_10041877 | 3300026089 | Bacteria | 4021 |
| 525 | Ga0207676_10537052 | 3300026095 | Bacteria | 1115 |
| 526 | Ga0207676_11086806 | 3300026095 | Bacteria | 790 |
| 527 | Ga0207674_10020311 | 3300026116 | Bacteria | 7178 |
| 528 | Ga0207674_10029226 | 3300026116 | Bacteria | 5805 |
| 529 | Ga0207674_10074961 | 3300026116 | Bacteria | 3394 |
| 530 | Ga0207674_10368732 | 3300026116 | Bacteria | 1388 |
| 531 | Ga0207675_100039999 | 3300026118 | Bacteria | 4375 |
| 532 | Ga0207675_100123217 | 3300026118 | Bacteria | 2454 |
| 533 | Ga0207675_100328919 | 3300026118 | Bacteria | 1493 |
| 534 | Ga0207675_100367634 | 3300026118 | Bacteria | 1412 |
| 535 | Ga0207683_10033939 | 3300026121 | Bacteria | 4434 |
| 536 | Ga0207683_10135303 | 3300026121 | Bacteria | 2219 |
| 537 | Ga0207683_10232036 | 3300026121 | Bacteria | 1683 |
| 538 | Ga0207683_10236025 | 3300026121 | Bacteria | 1668 |
| 539 | Ga0207683_10398674 | 3300026121 | Bacteria | 1266 |
| 540 | Ga0207683_10605963 | 3300026121 | Bacteria | 1014 |
| 541 | Ga0207683_10757070 | 3300026121 | Bacteria | 901 |
| 542 | Ga0207683_11033378 | 3300026121 | Bacteria | 763 |
| 543 | Ga0207698_10479265 | 3300026142 | Bacteria | 1207 |
| 544 | Ga0209389_1000004 | 3300027296 | Bacteria | 263759 |
| 545 | Ga0209389_1000023 | 3300027296 | Bacteria | 150730 |
| 546 | Ga0209589_1000006 | 3300027357 | Bacteria | 436292 |
| 547 | Ga0209589_1000010 | 3300027357 | Bacteria | 237657 |
| 548 | Ga0209489_100007 | 3300027361 | Bacteria | 436292 |
| 549 | Ga0209489_100011 | 3300027361 | Bacteria | 244710 |
| 550 | Ga0209489_100295 | 3300027361 | Bacteria | 87273 |
| 551 | Ga0209700_100008 | 3300027363 | Bacteria | 436292 |
| 552 | Ga0209700_100013 | 3300027363 | Bacteria | 341906 |
| 553 | Ga0209588_1001349 | 3300027671 | Bacteria | 6391 |
| 554 | Ga0209588_1058263 | 3300027671 | Bacteria | 1248 |
| 555 | Ga0209813_10063594 | 3300027866 | Bacteria | 1184 |
| 556 | Ga0268266_10035607 | 3300028379 | Bacteria | 4235 |
| 557 | Ga0268266_10191046 | 3300028379 | Bacteria | 1869 |
| 558 | Ga0268266_10197166 | 3300028379 | Bacteria | 1841 |
| 559 | Ga0268265_10066596 | 3300028380 | Bacteria | 2785 |
| 560 | Ga0268265_10397830 | 3300028380 | Bacteria | 1272 |
| 561 | Ga0268265_11213566 | 3300028380 | Bacteria | 752 |
| 562 | Ga0268264_10098887 | 3300028381 | Bacteria | 2531 |
| 563 | Ga0268264_10456807 | 3300028381 | Bacteria | 1238 |
| 564 | Ga0268264_10477128 | 3300028381 | Bacteria | 1213 |
| 565 | Ga0307517_10000085 | 3300028786 | Bacteria | 131200 |
| 566 | Ga0307517_10108504 | 3300028786 | Bacteria | 2130 |
| 567 | Ga0307515_10022248 | 3300028794 | Bacteria | 11182 |
| 568 | Ga0265330_10019495 | 3300031235 | Bacteria | 3108 |
| 569 | Ga0265332_10098022 | 3300031238 | Bacteria | 1237 |
| 570 | Ga0265325_10003289 | 3300031241 | Bacteria | 10627 |
| 571 | Ga0265340_10071688 | 3300031247 | Bacteria | 1641 |
| 572 | Ga0265316_10015335 | 3300031344 | Bacteria | 6704 |
| 573 | Ga0307513_10058631 | 3300031456 | Bacteria | 4090 |
| 574 | Ga0307408_100745257 | 3300031548 | Bacteria | 884 |
| 575 | Ga0307408_101071979 | 3300031548 | Bacteria | 746 |
| 576 | Ga0307408_101278836 | 3300031548 | Bacteria | 687 |
| 577 | Ga0265313_10132253 | 3300031595 | Bacteria | 1080 |
| 578 | Ga0307508_10133366 | 3300031616 | Bacteria | 2087 |
| 579 | Ga0265314_10004541 | 3300031711 | Bacteria | 12819 |
| 580 | Ga0265314_10141877 | 3300031711 | Bacteria | 1484 |
| 581 | Ga0265342_10184532 | 3300031712 | Bacteria | 1141 |
| 582 | Ga0307516_10195889 | 3300031730 | Bacteria | 1743 |
| 583 | Ga0307413_10159836 | 3300031824 | Bacteria | 1581 |
| 584 | Ga0307413_10224888 | 3300031824 | Bacteria | 1373 |
| 585 | Ga0326468_10010087 | 3300031889 | Bacteria | 949 |
| 586 | Ga0307406_10137638 | 3300031901 | Bacteria | 1724 |
| 587 | Ga0307407_10602398 | 3300031903 | Bacteria | 818 |
| 588 | Ga0307409_100404725 | 3300031995 | Bacteria | 1304 |
| 589 | Ga0307416_100134078 | 3300032002 | Bacteria | 2236 |
| 590 | Ga0307416_100617515 | 3300032002 | Bacteria | 1166 |
| 591 | Ga0307414_10651802 | 3300032004 | Bacteria | 949 |
| 592 | Ga0307414_11070450 | 3300032004 | Bacteria | 744 |
| 593 | Ga0307411_10112784 | 3300032005 | Bacteria | 1949 |
| 594 | Ga0307411_11001541 | 3300032005 | Bacteria | 748 |
| 595 | Ga0307415_100330992 | 3300032126 | Bacteria | 1274 |
| 596 | Ga0307415_100359851 | 3300032126 | Bacteria | 1228 |
| 597 | Ga0307415_100394413 | 3300032126 | Bacteria | 1179 |
| 598 | Ga0307510_10006173 | 3300033180 | Bacteria | 14287 |
| 599 | Ga0307510_10007269 | 3300033180 | Bacteria | 13192 |
| 600 | Ga0307510_10089756 | 3300033180 | Bacteria | 2924 |
| 601 | Ga0307510_10168832 | 3300033180 | Bacteria | 1770 |
| 602 | Ga0307510_10392312 | 3300033180 | Bacteria | 832 |
| 603 | Ga0315911_1000010 | 3300033442 | Bacteria | 322197 |
| 604 | Ga0373938_0054753 | 3300034957 | Bacteria | 920 |
| 605 | Ga0373929_0015474 | 3300035085 | Bacteria | 1484 |
| 606 | Ga0373934_0014490 | 3300035086 | Bacteria | 2988 |
| 607 | Ga0373934_0044104 | 3300035086 | Bacteria | 1763 |
| 608 | Ga0373923_0047683 | 3300035111 | Bacteria | 1787 |
| 609 | Ga0373936_0029079 | 3300035113 | Bacteria | 2174 |
| 610 | Ga0373936_0060858 | 3300035113 | Bacteria | 1541 |
| 611 | Ga0373945_0001490 | 3300035116 | Bacteria | 7162 |
| 612 | Ga0373953_0005417 | 3300035117 | Bacteria | 4141 |
| 613 | Ga0373953_0009791 | 3300035117 | Bacteria | 3314 |
| 614 | Ga0373953_0161298 | 3300035117 | Bacteria | 964 |
| 615 | Ga0373954_0000761 | 3300035118 | Bacteria | 12424 |
| 616 | Ga0373954_0017839 | 3300035118 | Bacteria | 3191 |
| 617 | Ga0373956_0048232 | 3300035119 | Bacteria | 1907 |
| 618 | Ga0373957_0001113 | 3300035120 | Bacteria | 7129 |
| 619 | Ga0373943_0106955 | 3300035170 | Bacteria | 1470 |
| 620 | Ga0373946_0008010 | 3300035171 | Bacteria | 3882 |
| 621 | Ga0373955_0008271 | 3300035172 | Bacteria | 4826 |
| 622 | Ga0373955_0172016 | 3300035172 | Bacteria | 1282 |
| 623 | Ga0373924_0004508 | 3300035410 | Bacteria | 4872 |
| 624 | Ga0373931_0009812 | 3300035691 | Bacteria | 4585 |
| 625 | Ga0373935_0030424 | 3300035692 | Bacteria | 3346 |
| 626 | Ga0373927_0022902 | 3300035695 | Bacteria | 4092 |
| 627 | Ga0373927_0178619 | 3300035695 | Bacteria | 1392 |
| 628 | Ga0373933_0001647 | 3300035724 | Bacteria | 12991 |
| 629 | Ga0373933_0017996 | 3300035724 | Bacteria | 3968 |
| 630 | Ga0373947_0043950 | 3300035725 | Bacteria | 2669 |
| 631 | Ga0373947_0054943 | 3300035725 | Bacteria | 2404 |
| 632 | Ga0373937_0029135 | 3300036401 | Bacteria | 4999 |
| 633 | Ga0373937_0128172 | 3300036401 | Bacteria | 2368 |
| 634 | Ga0372808_021957 | 3300036459 | Bacteria | 918 |
| 635 | Ga0373925_0011894 | 3300037068 | Bacteria | 6298 |
| 636 | Ga0373925_0056168 | 3300037068 | Bacteria | 2949 |
| 637 | Ga0373925_0188082 | 3300037068 | Bacteria | 1637 |
| 638 | Ga0395899_0010190 | 3300037312 | Bacteria | 7202 |
| 639 | Ga0395900_0020421 | 3300037418 | Bacteria | 6762 |
| 640 | Ga0395900_0266450 | 3300037418 | Bacteria | 1709 |
| 641 | Ga0395900_0339366 | 3300037418 | Bacteria | 1478 |
| 642 | Ga0395898_0002370 | 3300037466 | Bacteria | 22395 |
| 643 | Ga0395898_0232191 | 3300037466 | Bacteria | 1759 |
| 644 | Ga0395905_0002934 | 3300037471 | Bacteria | 18550 |
| 645 | Ga0395905_0207330 | 3300037471 | Bacteria | 1837 |
| 646 | Ga0395905_0715356 | 3300037471 | Bacteria | 904 |
| 647 | Ga0436364_0342298 | 3300037853 | Bacteria | 4528 |
| 648 | Ga0395901_0003499 | 3300038443 | Bacteria | 15834 |
| 649 | Ga0395901_0091456 | 3300038443 | Bacteria | 3185 |
| 650 | Ga0395901_0144865 | 3300038443 | Bacteria | 2497 |
| 651 | Ga0395901_0200322 | 3300038443 | Bacteria | 2093 |
| 652 | Ga0395901_0575906 | 3300038443 | Bacteria | 1138 |
| 653 | Ga0436365_0182621 | 3300039437 | Bacteria | 1633 |
| 654 | Ga0436365_0299844 | 3300039437 | Bacteria | 780 |
| 655 | Ga0436365_0486541 | 3300039437 | Bacteria | 4409 |
| 656 | Ga0436365_0605759 | 3300039437 | Bacteria | 6970 |
| 657 | Ga0436365_1283571 | 3300039437 | Bacteria | 25666 |
| 658 | Ga0436360_0872612 | 3300039438 | Bacteria | 3249 |
| 659 | Ga0436360_0895214 | 3300039438 | Bacteria | 3917 |
| 660 | Ga0436361_0216754 | 3300039447 | Bacteria | 1151 |
| 661 | Ga0436361_0539604 | 3300039447 | Bacteria | 1359 |
| 662 | Ga0436363_0029976 | 3300039450 | Bacteria | 1320 |
| 663 | Ga0436363_0843641 | 3300039450 | Bacteria | 958 |
| 664 | Ga0436362_0365003 | 3300039453 | Bacteria | 1027 |
| 665 | Ga0436362_0529262 | 3300039453 | Bacteria | 1695 |
| 666 | Ga0439465_0064550 | 3300041413 | Bacteria | 1218 |
| 667 | Ga0451791_1847493 | 3300041451 | Bacteria | 1389 |
| 668 | Ga0451793_1054860 | 3300041452 | Bacteria | 1249 |
| 669 | Ga0451833_1207251 | 3300041491 | Bacteria | 1170 |
| 670 | Ga0451835_0964677 | 3300041492 | Bacteria | 955 |
| 671 | Ga0451841_0596662 | 3300041498 | Bacteria | 1329 |
| 672 | Ga0439455_0024870 | 3300042012 | Bacteria | 1452 |
| 673 | Ga0439463_040713 | 3300042016 | Bacteria | 1181 |
| 674 | Ga0466969_0003503 | 3300044656 | Bacteria | 8333 |
| 675 | Ga0466972_0000185 | 3300044658 | Bacteria | 48335 |
| 676 | Ga0466965_0035908 | 3300044683 | Bacteria | 2430 |
| 677 | Ga0466966_0000952 | 3300044684 | Bacteria | 18530 |
| 678 | Ga0466961_0000737 | 3300044693 | Bacteria | 20495 |
| 679 | Ga0466961_0295031 | 3300044693 | Bacteria | 991 |
| 680 | Ga0466971_0246732 | 3300044719 | Bacteria | 850 |
| 681 | Ga0466968_0291324 | 3300044735 | Bacteria | 783 |
| 682 | Ga0466959_0028388 | 3300045049 | Bacteria | 4149 |
| 683 | Ga0466959_0047575 | 3300045049 | Bacteria | 3154 |
| 684 | Ga0466959_0070752 | 3300045049 | Bacteria | 2527 |
| 685 | Ga0466958_0454706 | 3300045836 | Bacteria | 829 |
| 686 | Ga0466967_0015901 | 3300045976 | Bacteria | 5914 |
| 687 | Ga0466967_0749416 | 3300045976 | Bacteria | 968 |
| 688 | Ga0495617_020436 | 3300046452 | Bacteria | 2238 |
| 689 | Ga0495617_025717 | 3300046452 | Bacteria | 1984 |
| 690 | Ga0495627_022541 | 3300046453 | Bacteria | 2072 |
| 691 | Ga0495592_0019398 | 3300046454 | Bacteria | 5172 |
| 692 | Ga0495592_0321425 | 3300046454 | Bacteria | 1000 |
| 693 | Ga0495603_0117629 | 3300046455 | Bacteria | 1549 |
| 694 | Ga0495603_0156343 | 3300046455 | Bacteria | 1323 |
| 695 | Ga0495603_0274637 | 3300046455 | Bacteria | 969 |
| 696 | Ga0495590_0027742 | 3300046457 | Bacteria | 1986 |
| 697 | Ga0495629_0062401 | 3300046459 | Bacteria | 2603 |
| 698 | Ga0495629_0079747 | 3300046459 | Bacteria | 2286 |
| 699 | Ga0495629_0114972 | 3300046459 | Bacteria | 1875 |
| 700 | Ga0495629_0238698 | 3300046459 | Bacteria | 1252 |
| 701 | Ga0495638_0003540 | 3300046460 | Bacteria | 12240 |
| 702 | Ga0495651_0025900 | 3300046462 | Bacteria | 4567 |
| 703 | Ga0495651_0104445 | 3300046462 | Bacteria | 2103 |
| 704 | Ga0495651_0119914 | 3300046462 | Bacteria | 1934 |
| 705 | Ga0495653_0004690 | 3300046463 | Bacteria | 11064 |
| 706 | Ga0495650_0174327 | 3300046471 | Bacteria | 760 |
| 707 | Ga0495580_0005215 | 3300046472 | Bacteria | 10795 |
| 708 | Ga0495580_0048262 | 3300046472 | Bacteria | 3016 |
| 709 | Ga0495580_0359919 | 3300046472 | Bacteria | 985 |
| 710 | Ga0495582_0054925 | 3300046473 | Bacteria | 2195 |
| 711 | Ga0495605_0177445 | 3300046474 | Bacteria | 938 |
| 712 | Ga0495639_0003015 | 3300046475 | Bacteria | 7335 |
| 713 | Ga0495639_0073169 | 3300046475 | Bacteria | 1586 |
| 714 | Ga0495639_0076899 | 3300046475 | Bacteria | 1549 |
| 715 | Ga0495662_0044223 | 3300046476 | Bacteria | 2150 |
| 716 | Ga0495664_0098627 | 3300046477 | Bacteria | 1759 |
| 717 | Ga0495664_0514785 | 3300046477 | Bacteria | 714 |
| 718 | Ga0495584_0076422 | 3300046491 | Bacteria | 1684 |
| 719 | Ga0495584_0107053 | 3300046491 | Bacteria | 1414 |
| 720 | Ga0495584_0173646 | 3300046491 | Bacteria | 1095 |
| 721 | Ga0495585_0017623 | 3300046492 | Bacteria | 4124 |
| 722 | Ga0495594_0016398 | 3300046499 | Bacteria | 3903 |
| 723 | Ga0495594_0088498 | 3300046499 | Bacteria | 1734 |
| 724 | Ga0495594_0491454 | 3300046499 | Bacteria | 697 |
| 725 | Ga0495596_0014778 | 3300046500 | Bacteria | 3284 |
| 726 | Ga0495607_0170161 | 3300046501 | Bacteria | 1101 |
| 727 | Ga0495607_0191310 | 3300046501 | Bacteria | 1019 |
| 728 | Ga0495583_0056740 | 3300046506 | Bacteria | 1764 |
| 729 | Ga0495606_0024349 | 3300046507 | Bacteria | 4364 |
| 730 | Ga0495606_0190609 | 3300046507 | Bacteria | 1175 |
| 731 | Ga0495608_0001839 | 3300046511 | Bacteria | 15137 |
| 732 | Ga0495610_0166524 | 3300046512 | Bacteria | 928 |
| 733 | Ga0495616_0050935 | 3300046513 | Bacteria | 2068 |
| 734 | Ga0495616_0100475 | 3300046513 | Bacteria | 1357 |
| 735 | Ga0495618_0009386 | 3300046514 | Bacteria | 5907 |
| 736 | Ga0495618_0113479 | 3300046514 | Bacteria | 1735 |
| 737 | Ga0495620_0140692 | 3300046515 | Bacteria | 944 |
| 738 | Ga0495628_0023039 | 3300046516 | Bacteria | 5112 |
| 739 | Ga0495628_0028229 | 3300046516 | Bacteria | 4561 |
| 740 | Ga0495630_0175168 | 3300046517 | Bacteria | 1635 |
| 741 | Ga0495632_0153582 | 3300046519 | Bacteria | 1063 |
| 742 | Ga0495643_0026574 | 3300046522 | Bacteria | 3264 |
| 743 | Ga0495644_0025964 | 3300046523 | Bacteria | 2223 |
| 744 | Ga0495644_0149016 | 3300046523 | Bacteria | 895 |
| 745 | Ga0495648_0158805 | 3300046524 | Bacteria | 1171 |
| 746 | Ga0495648_0201389 | 3300046524 | Bacteria | 996 |
| 747 | Ga0495642_0258900 | 3300046528 | Bacteria | 761 |
| 748 | Ga0495652_0193615 | 3300046529 | Bacteria | 1549 |
| 749 | Ga0495652_0222807 | 3300046529 | Bacteria | 1416 |
| 750 | Ga0495654_0270048 | 3300046530 | Bacteria | 703 |
| 751 | Ga0495665_0308393 | 3300046531 | Bacteria | 809 |
| 752 | Ga0495640_0011654 | 3300046533 | Bacteria | 6750 |
| 753 | Ga0495586_0277101 | 3300046535 | Bacteria | 959 |
| 754 | Ga0495598_0021060 | 3300046537 | Bacteria | 1729 |
| 755 | Ga0495621_0015707 | 3300046539 | Bacteria | 2417 |
| 756 | Ga0495645_0009481 | 3300046543 | Bacteria | 6803 |
| 757 | Ga0495645_0017734 | 3300046543 | Bacteria | 5104 |
| 758 | Ga0495645_0136803 | 3300046543 | Bacteria | 1713 |
| 759 | Ga0495622_0055185 | 3300046557 | Bacteria | 1843 |
| 760 | Ga0495633_0071338 | 3300046558 | Bacteria | 1620 |
| 761 | Ga0495633_0177789 | 3300046558 | Bacteria | 980 |
| 762 | Ga0495656_0001457 | 3300046615 | Bacteria | 7744 |
| 763 | Ga0495656_0016098 | 3300046615 | Bacteria | 2834 |
| 764 | Ga0495656_0027153 | 3300046615 | Bacteria | 2284 |
| 765 | Ga0495656_0079876 | 3300046615 | Bacteria | 1473 |
| 766 | Ga0495668_0101566 | 3300046616 | Bacteria | 1573 |
| 767 | Ga0495668_0178692 | 3300046616 | Bacteria | 1163 |
| 768 | Ga0495668_0534132 | 3300046616 | Bacteria | 647 |
| 769 | Ga0495634_0004673 | 3300046642 | Bacteria | 10655 |
| 770 | Ga0495634_0015562 | 3300046642 | Bacteria | 5460 |
| 771 | Ga0495634_0110179 | 3300046642 | Bacteria | 1771 |
| 772 | Ga0495611_0358414 | 3300046648 | Bacteria | 669 |
| 773 | Ga0495625_0214830 | 3300046660 | Bacteria | 1263 |
| 774 | Ga0495635_0009056 | 3300046663 | Bacteria | 6947 |
| 775 | Ga0495635_0013629 | 3300046663 | Bacteria | 5690 |
| 776 | Ga0495659_0037332 | 3300046664 | Bacteria | 1720 |
| 777 | Ga0495659_0132521 | 3300046664 | Bacteria | 989 |
| 778 | Ga0495659_0347327 | 3300046664 | Bacteria | 633 |
| 779 | Ga0495661_0196480 | 3300046665 | Bacteria | 1059 |
| 780 | Ga0495588_0002625 | 3300046674 | Bacteria | 7697 |
| 781 | Ga0495588_0035958 | 3300046674 | Bacteria | 2511 |
| 782 | Ga0495657_0001190 | 3300046675 | Bacteria | 22816 |
| 783 | Ga0495657_0296704 | 3300046675 | Bacteria | 964 |
| 784 | Ga0495599_0160049 | 3300046678 | Bacteria | 1392 |
| 785 | Ga0495599_0208627 | 3300046678 | Bacteria | 1198 |
| 786 | Ga0495623_0053830 | 3300046679 | Bacteria | 2540 |
| 787 | Ga0495646_0024473 | 3300046680 | Bacteria | 3802 |
| 788 | Ga0495646_0035486 | 3300046680 | Bacteria | 3093 |
| 789 | Ga0495658_0046236 | 3300046683 | Bacteria | 2446 |
| 790 | Ga0495669_0038625 | 3300046684 | Bacteria | 2114 |
| 791 | Ga0495669_0084784 | 3300046684 | Bacteria | 1457 |
| 792 | Ga0495613_0004933 | 3300046689 | Bacteria | 10027 |
| 793 | Ga0495613_0026734 | 3300046689 | Bacteria | 4298 |
| 794 | Ga0495613_0278177 | 3300046689 | Bacteria | 1163 |
| 795 | Ga0495624_0039037 | 3300046690 | Bacteria | 3046 |
| 796 | Ga0495624_0043034 | 3300046690 | Bacteria | 2882 |
| 797 | Ga0495624_0146414 | 3300046690 | Bacteria | 1446 |
| 798 | Ga0495624_0411718 | 3300046690 | Bacteria | 811 |
| 799 | Ga0495670_0108571 | 3300046691 | Bacteria | 1434 |
| 800 | Ga0495670_0277530 | 3300046691 | Bacteria | 896 |
| 801 | Ga0495671_0261100 | 3300046692 | Bacteria | 835 |
| 802 | Ga0495649_0013503 | 3300046694 | Bacteria | 4710 |
| 803 | Ga0495600_0044036 | 3300046809 | Bacteria | 2912 |
| 804 | Ga0495600_0125078 | 3300046809 | Bacteria | 1672 |
| 805 | Ga0495660_0129615 | 3300046810 | Bacteria | 1267 |
| 806 | Ga0495581_0108700 | 3300047315 | Bacteria | 1612 |
| 807 | Ga0495581_0182847 | 3300047315 | Bacteria | 1226 |
| 808 | Ga0495604_0040533 | 3300047317 | Bacteria | 3656 |
| 809 | Ga0495604_0178776 | 3300047317 | Bacteria | 1485 |
| 810 | Ga0495604_0185446 | 3300047317 | Bacteria | 1453 |
| 811 | Ga0495636_0016540 | 3300047318 | Bacteria | 2948 |
| 812 | Ga0495636_0045819 | 3300047318 | Bacteria | 1823 |
| 813 | Ga0495674_0015364 | 3300047319 | Bacteria | 7160 |
| 814 | Ga0495674_0114385 | 3300047319 | Bacteria | 2285 |
| 815 | Ga0495674_0133798 | 3300047319 | Bacteria | 2088 |
| 816 | Ga0495676_0095206 | 3300047321 | Bacteria | 2216 |
| 817 | Ga0495676_0218471 | 3300047321 | Bacteria | 1315 |
| 818 | Ga0495683_0058399 | 3300047323 | Bacteria | 1916 |
| 819 | Ga0495683_0146386 | 3300047323 | Bacteria | 1103 |
| 820 | Ga0495687_028429 | 3300047443 | Bacteria | 2601 |
| 821 | Ga0495677_0044535 | 3300047445 | Bacteria | 1627 |
| 822 | Ga0495685_071778 | 3300047447 | Bacteria | 1159 |
| 823 | Ga0495673_0048293 | 3300047469 | Bacteria | 1877 |
| 824 | Ga0495673_0064322 | 3300047469 | Bacteria | 1561 |
| 825 | Ga0495684_0012073 | 3300047471 | Bacteria | 6664 |
| 826 | Ga0495684_0092044 | 3300047471 | Bacteria | 2296 |
| 827 | Ga0495684_0129746 | 3300047471 | Bacteria | 1894 |
| 828 | Ga0495686_0030828 | 3300047472 | Bacteria | 3481 |
| 829 | Ga0495686_0219641 | 3300047472 | Bacteria | 1082 |
| 830 | Ga0495686_0233030 | 3300047472 | Bacteria | 1042 |
| 831 | Ga0495686_0266130 | 3300047472 | Bacteria | 958 |
| 832 | Ga0495593_0006291 | 3300047673 | Bacteria | 6967 |
| 833 | Ga0495593_0013864 | 3300047673 | Bacteria | 4591 |
| 834 | Ga0495593_0062689 | 3300047673 | Bacteria | 1942 |
| 835 | Ga0495602_0108924 | 3300048088 | Bacteria | 2254 |
| 836 | Ga0495602_0183488 | 3300048088 | Bacteria | 1611 |
| 837 | Ga0496100_0029828 | 3300048903 | Bacteria | 3377 |
| 838 | Ga0496100_0034063 | 3300048903 | Bacteria | 3192 |
| 839 | Ga0496100_0177080 | 3300048903 | Bacteria | 1540 |
| 840 | Ga0496101_0013278 | 3300048904 | Bacteria | 5516 |
| 841 | Ga0496102_0005792 | 3300048905 | Bacteria | 10507 |
| 842 | Ga0496102_0037882 | 3300048905 | Bacteria | 4349 |
| 843 | Ga0496102_0066081 | 3300048905 | Bacteria | 3315 |
| 844 | Ga0496102_0909752 | 3300048905 | Bacteria | 801 |
| 845 | Ga0496103_0064463 | 3300048906 | Bacteria | 2284 |
| 846 | Ga0496103_0089519 | 3300048906 | Bacteria | 1941 |
| 847 | Ga0496103_0147041 | 3300048906 | Bacteria | 1509 |
| 848 | Ga0496103_0195361 | 3300048906 | Bacteria | 1301 |
| 849 | Ga0496104_0003629 | 3300048907 | Bacteria | 13335 |
| 850 | Ga0496104_0009841 | 3300048907 | Bacteria | 8529 |
| 851 | Ga0496105_0000532 | 3300048908 | Bacteria | 25166 |
| 852 | Ga0496105_0017523 | 3300048908 | Bacteria | 5745 |
| 853 | Ga0496105_0040985 | 3300048908 | Bacteria | 3816 |
| 854 | Ga0496105_0065362 | 3300048908 | Bacteria | 3002 |
| 855 | Ga0496105_0215109 | 3300048908 | Bacteria | 1565 |
| 856 | Ga0496105_0272564 | 3300048908 | Bacteria | 1366 |
| 857 | Ga0496105_0352779 | 3300048908 | Bacteria | 1175 |
| 858 | Ga0496105_0947768 | 3300048908 | Bacteria | 646 |
| 859 | Ga0496106_0004534 | 3300048909 | Bacteria | 10292 |
| 860 | Ga0496106_0021741 | 3300048909 | Bacteria | 4764 |
| 861 | Ga0496106_0090447 | 3300048909 | Bacteria | 2362 |
| 862 | Ga0496107_0004981 | 3300048910 | Bacteria | 9041 |
| 863 | Ga0496107_0021095 | 3300048910 | Bacteria | 4603 |
| 864 | Ga0496107_0243758 | 3300048910 | Bacteria | 1337 |
| 865 | Ga0496108_0031661 | 3300048911 | Bacteria | 4389 |
| 866 | Ga0496108_0037694 | 3300048911 | Bacteria | 4028 |
| 867 | Ga0496108_0185182 | 3300048911 | Bacteria | 1803 |
| 868 | Ga0496108_0267706 | 3300048911 | Bacteria | 1487 |
| 869 | Ga0496109_0043823 | 3300048912 | Bacteria | 4056 |
| 870 | Ga0496109_0051626 | 3300048912 | Bacteria | 3746 |
| 871 | Ga0496109_0094810 | 3300048912 | Bacteria | 2763 |
| 872 | Ga0496109_0131481 | 3300048912 | Bacteria | 2336 |
| 873 | Ga0496109_0259682 | 3300048912 | Bacteria | 1636 |
| 874 | Ga0496109_0747928 | 3300048912 | Bacteria | 915 |
| 875 | Ga0496110_0017079 | 3300048913 | Bacteria | 6066 |
| 876 | Ga0496110_0067797 | 3300048913 | Bacteria | 3157 |
| 877 | Ga0496110_0112123 | 3300048913 | Bacteria | 2452 |
| 878 | Ga0496111_0019062 | 3300048914 | Bacteria | 4760 |
| 879 | Ga0496111_0097002 | 3300048914 | Bacteria | 2164 |
| 880 | Ga0496111_0328711 | 3300048914 | Bacteria | 1132 |
| 881 | Ga0496112_0022085 | 3300048915 | Bacteria | 6060 |
| 882 | Ga0496112_0038861 | 3300048915 | Bacteria | 4649 |
| 883 | Ga0496112_0088235 | 3300048915 | Bacteria | 3069 |
| 884 | Ga0496112_0096797 | 3300048915 | Bacteria | 2922 |
| 885 | Ga0496112_0109369 | 3300048915 | Bacteria | 2734 |
| 886 | Ga0496113_0004246 | 3300048916 | Bacteria | 8772 |
| 887 | Ga0496113_0479279 | 3300048916 | Bacteria | 999 |
| 888 | Ga0496114_0042370 | 3300048917 | Bacteria | 3773 |
| 889 | Ga0496114_0052696 | 3300048917 | Bacteria | 3390 |
| 890 | Ga0496114_0104830 | 3300048917 | Bacteria | 2418 |
| 891 | Ga0496115_0002752 | 3300048918 | Bacteria | 12637 |
| 892 | Ga0496115_0003734 | 3300048918 | Bacteria | 10954 |
| 893 | Ga0496115_0049284 | 3300048918 | Bacteria | 3371 |
| 894 | Ga0496115_0230125 | 3300048918 | Bacteria | 1529 |
| 895 | Ga0496115_0276600 | 3300048918 | Bacteria | 1379 |
| 896 | Ga0496115_0440419 | 3300048918 | Bacteria | 1054 |
| 897 | Ga0496115_0737571 | 3300048918 | Bacteria | 771 |
| 898 | Ga0496116_0195631 | 3300048919 | Bacteria | 1065 |
| 899 | Ga0496117_0068971 | 3300048920 | Bacteria | 2384 |
| 900 | Ga0496117_0099484 | 3300048920 | Bacteria | 1845 |
| 901 | Ga0496118_0067040 | 3300048921 | Bacteria | 2617 |
| 902 | Ga0496118_0118989 | 3300048921 | Bacteria | 1728 |
| 903 | Ga0496118_0286140 | 3300048921 | Bacteria | 914 |
| 904 | Ga0496119_0002440 | 3300048922 | Bacteria | 20413 |
| 905 | Ga0496119_0025596 | 3300048922 | Bacteria | 4116 |
| 906 | Ga0496121_0000379 | 3300048924 | Bacteria | 91131 |
| 907 | Ga0496121_0002853 | 3300048924 | Bacteria | 25499 |
| 908 | Ga0496121_0033344 | 3300048924 | Bacteria | 4661 |
| 909 | Ga0496121_0058666 | 3300048924 | Bacteria | 3179 |
| 910 | Ga0496121_0090597 | 3300048924 | Bacteria | 2390 |
| 911 | Ga0496121_0094491 | 3300048924 | Bacteria | 2326 |
| 912 | Ga0496123_0142619 | 3300048926 | Bacteria | 1307 |
| 913 | Ga0496124_0054484 | 3300048927 | Bacteria | 3385 |
| 914 | Ga0496124_0058250 | 3300048927 | Bacteria | 3250 |
| 915 | Ga0496125_0012802 | 3300048928 | Bacteria | 8293 |
| 916 | Ga0496125_0113929 | 3300048928 | Bacteria | 1949 |
| 917 | Ga0496125_0270909 | 3300048928 | Bacteria | 1058 |
| 918 | Ga0496126_0005562 | 3300048929 | Bacteria | 14331 |
| 919 | Ga0496126_0024926 | 3300048929 | Bacteria | 5767 |
| 920 | Ga0496126_0025106 | 3300048929 | Bacteria | 5740 |
| 921 | Ga0496126_0036885 | 3300048929 | Bacteria | 4567 |
| 922 | Ga0496126_0088228 | 3300048929 | Bacteria | 2732 |
| 923 | Ga0496126_0099741 | 3300048929 | Bacteria | 2543 |
| 924 | Ga0496126_0104128 | 3300048929 | Bacteria | 2479 |
| 925 | Ga0496126_0105816 | 3300048929 | Bacteria | 2456 |
| 926 | Ga0496126_0222243 | 3300048929 | Bacteria | 1586 |
| 927 | Ga0496126_0245615 | 3300048929 | Bacteria | 1493 |
| 928 | Ga0496126_0254787 | 3300048929 | Bacteria | 1461 |
| 929 | Ga0496126_0292368 | 3300048929 | Bacteria | 1347 |
| 930 | Ga0496126_0343951 | 3300048929 | Bacteria | 1221 |
| 931 | Ga0496126_0570181 | 3300048929 | Bacteria | 896 |
| 932 | Ga0496126_0618543 | 3300048929 | Bacteria | 851 |
| 933 | Ga0495678_068821 | 3300049459 | Bacteria | 1304 |
| 934 | Ga0495682_0033493 | 3300049460 | Bacteria | 1896 |
| 935 | Ga0501031_0233022 | 3300049568 | Bacteria | 1198 |
| 936 | Ga0501032_0000269 | 3300049569 | Bacteria | 43721 |
| 937 | Ga0501033_0000399 | 3300049570 | Bacteria | 41761 |
| 938 | Ga0501034_0000039 | 3300049571 | Bacteria | 237357 |
| 939 | Ga0501036_0004794 | 3300049572 | Bacteria | 10934 |
| 940 | Ga0501037_0000279 | 3300049573 | Bacteria | 43594 |
| 941 | Ga0501038_0000727 | 3300049574 | Bacteria | 29411 |
| 942 | Ga0501039_0007019 | 3300049575 | Bacteria | 8574 |
| 943 | Ga0501042_0262144 | 3300049578 | Bacteria | 1248 |
| 944 | Ga0501043_0000257 | 3300049579 | Bacteria | 48196 |
| 945 | Ga0501046_0006020 | 3300049580 | Bacteria | 10788 |
| 946 | Ga0501047_0002128 | 3300049581 | Bacteria | 18968 |
| 947 | Ga0501047_0120453 | 3300049581 | Bacteria | 2506 |
| 948 | Ga0501047_0163016 | 3300049581 | Bacteria | 2101 |
| 949 | Ga0501048_0000677 | 3300049582 | Bacteria | 24715 |
| 950 | Ga0501067_0000220 | 3300049583 | Bacteria | 31959 |
| 951 | Ga0501067_0017563 | 3300049583 | Bacteria | 3960 |
| 952 | Ga0501067_0088962 | 3300049583 | Bacteria | 1714 |
| 953 | Ga0501068_0006651 | 3300049584 | Bacteria | 6381 |
| 954 | Ga0501069_0020320 | 3300049585 | Bacteria | 3597 |
| 955 | Ga0501070_0022913 | 3300049586 | Bacteria | 5227 |
| 956 | Ga0501070_0051654 | 3300049586 | Bacteria | 3412 |
| 957 | Ga0501070_0925857 | 3300049586 | Bacteria | 679 |
| 958 | Ga0501071_0244725 | 3300049587 | Bacteria | 1353 |
| 959 | Ga0501072_0411408 | 3300049588 | Bacteria | 1072 |
| 960 | Ga0501073_0000103 | 3300049589 | Bacteria | 53962 |
| 961 | Ga0501073_0131724 | 3300049589 | Bacteria | 1733 |
| 962 | Ga0501073_0825548 | 3300049589 | Bacteria | 639 |
| 963 | Ga0501074_0000203 | 3300049590 | Bacteria | 32417 |
| 964 | Ga0501074_0367657 | 3300049590 | Bacteria | 1020 |
| 965 | Ga0501075_0539491 | 3300049591 | Bacteria | 890 |
| 966 | Ga0501076_0293053 | 3300049592 | Bacteria | 1333 |
| 967 | Ga0501079_0005568 | 3300049741 | Bacteria | 9399 |
| 968 | Ga0501080_0002271 | 3300049742 | Bacteria | 16721 |
| 969 | Ga0501080_0025362 | 3300049742 | Bacteria | 5501 |
| 970 | Ga0501081_0961887 | 3300049743 | Bacteria | 645 |
| 971 | Ga0501083_0000213 | 3300049744 | Bacteria | 37485 |
| 972 | Ga0501035_0000523 | 3300049822 | Bacteria | 43259 |
| 973 | Ga0501044_0000435 | 3300049823 | Bacteria | 51516 |
| 974 | Ga0501044_0091934 | 3300049823 | Bacteria | 3060 |
| 975 | Ga0501044_0953539 | 3300049823 | Bacteria | 731 |
| 976 | nmdc:mga03683_4322_c1 | 3300050489 | Bacteria | 4698 |
| 977 | nmdc:mga03n38_101147_c1 | 3300050490 | Bacteria | 1390 |
| 978 | nmdc:mga03n38_150290_c1 | 3300050490 | Bacteria | 1171 |
| 979 | nmdc:mga03n38_16005_c1 | 3300050490 | Bacteria | 2909 |
| 980 | nmdc:mga00v17_356220_c1 | 3300050491 | Bacteria | 951 |
| 981 | nmdc:mga00v17_388605_c1 | 3300050491 | Bacteria | 907 |
| 982 | nmdc:mga0yw44_125079_c1 | 3300050492 | Bacteria | 1660 |
| 983 | nmdc:mga0yw44_190785_c1 | 3300050492 | Bacteria | 1352 |
| 984 | nmdc:mga0yw44_19854_c1 | 3300050492 | Bacteria | 3715 |
| 985 | nmdc:mga0yw44_5033_c1 | 3300050492 | Bacteria | 6175 |
| 986 | nmdc:mga0yw44_75470_c1 | 3300050492 | Bacteria | 2102 |
| 987 | nmdc:mga0yw44_90894_c1 | 3300050492 | Bacteria | 1929 |
| 988 | nmdc:mga0k408_110148_c1 | 3300050493 | Bacteria | 1628 |
| 989 | nmdc:mga0k408_33069_c1 | 3300050493 | Bacteria | 2956 |
| 990 | nmdc:mga06z11_138670_c1 | 3300050494 | Bacteria | 1373 |
| 991 | nmdc:mga06z11_270267_c1 | 3300050494 | Bacteria | 1005 |
| 992 | nmdc:mga06z11_374_c1 | 3300050494 | Bacteria | 16845 |
| 993 | nmdc:mga06z11_41002_c1 | 3300050494 | Bacteria | 2314 |
| 994 | nmdc:mga06z11_527625_c1 | 3300050494 | Bacteria | 716 |
| 995 | nmdc:mga06z11_81738_c1 | 3300050494 | Bacteria | 1735 |
| 996 | nmdc:mga06z11_98945_c1 | 3300050494 | Bacteria | 1597 |
| 997 | nmdc:mga07m45_20854_c1 | 3300050496 | Bacteria | 3563 |
| 998 | nmdc:mga05p37_228831_c1 | 3300050507 | Bacteria | 2241 |
| 999 | nmdc:mga09592_60003_c1 | 3300050508 | Bacteria | 3216 |
| 1000 | nmdc:mga09592_784794_c1 | 3300050508 | Bacteria | 806 |
| 1001 | nmdc:mga0qj67_171885_c1 | 3300050509 | Bacteria | 1760 |
| 1002 | nmdc:mga0n895_227086_c1 | 3300050512 | Bacteria | 1895 |
| 1003 | nmdc:mga0n895_95973_c1 | 3300050512 | Bacteria | 2970 |
| 1004 | nmdc:mga0rr50_139437_c1 | 3300050513 | Bacteria | 1949 |
| 1005 | nmdc:mga0rr50_433086_c1 | 3300050513 | Bacteria | 1113 |
| 1006 | nmdc:mga08x19_576053_c1 | 3300050514 | Bacteria | 797 |
| 1007 | nmdc:mga0a205_178743_c1 | 3300050515 | Bacteria | 2016 |
| 1008 | nmdc:mga0a205_61269_c1 | 3300050515 | Bacteria | 3634 |
| 1009 | nmdc:mga0sz30_22941_c1 | 3300050516 | Bacteria | 2536 |
| 1010 | Ga0495601_0084096 | 3300053077 | Bacteria | 2044 |
| 1011 | Ga0495601_0135232 | 3300053077 | Bacteria | 1607 |
| 1012 | Ga0495601_0333462 | 3300053077 | Bacteria | 987 |
| 1013 | Ga0495612_0007098 | 3300053078 | Bacteria | 4585 |
| 1014 | Ga0495612_0009090 | 3300053078 | Bacteria | 4031 |
| 1015 | Ga0495612_0080707 | 3300053078 | Bacteria | 1367 |
| 1016 | Ga0500610_0305457 | 3300053079 | Bacteria | 699 |
| 1017 | Ga0495655_0002836 | 3300053083 | Bacteria | 2791 |
| 1018 | Ga0495595_0046672 | 3300053084 | Bacteria | 1996 |
| 1019 | Ga0495619_0020964 | 3300053085 | Bacteria | 4168 |
| 1020 | Ga0495619_0194064 | 3300053085 | Bacteria | 1406 |
| 1021 | Ga0500578_0178869 | 3300053086 | Bacteria | 1308 |
| 1022 | Ga0500578_0362817 | 3300053086 | Bacteria | 844 |
| 1023 | Ga0500643_000197 | 3300053087 | Bacteria | 57531 |
| 1024 | Ga0500581_062520 | 3300053089 | Bacteria | 1883 |
| 1025 | Ga0500646_0015819 | 3300053090 | Bacteria | 1967 |
| 1026 | Ga0500646_0080622 | 3300053090 | Bacteria | 992 |
| 1027 | Ga0500647_0087469 | 3300053091 | Bacteria | 1493 |
| 1028 | Ga0500583_0020859 | 3300053092 | Bacteria | 2713 |
| 1029 | Ga0500651_0028346 | 3300053093 | Bacteria | 3522 |
| 1030 | Ga0500651_0233440 | 3300053093 | Bacteria | 1075 |
| 1031 | Ga0500651_0248833 | 3300053093 | Bacteria | 1034 |
| 1032 | Ga0500566_0000008 | 3300053094 | Bacteria | 143641 |
| 1033 | Ga0500566_0000102 | 3300053094 | Bacteria | 43512 |
| 1034 | Ga0500566_0005439 | 3300053094 | Bacteria | 7576 |
| 1035 | Ga0500640_000058 | 3300053095 | Bacteria | 17553 |
| 1036 | Ga0500641_0000868 | 3300053096 | Bacteria | 10795 |
| 1037 | Ga0500641_0002877 | 3300053096 | Bacteria | 6105 |
| 1038 | Ga0500641_0005542 | 3300053096 | Bacteria | 4471 |
| 1039 | Ga0500641_0253529 | 3300053096 | Bacteria | 737 |
| 1040 | Ga0500555_000761 | 3300053103 | Bacteria | 11847 |
| 1041 | Ga0500556_0005792 | 3300053104 | Bacteria | 3496 |
| 1042 | Ga0500557_000029 | 3300053105 | Bacteria | 77152 |
| 1043 | Ga0500562_004449 | 3300053108 | Bacteria | 3546 |
| 1044 | Ga0500562_064385 | 3300053108 | Bacteria | 986 |
| 1045 | Ga0500569_001944 | 3300053109 | Bacteria | 4002 |
| 1046 | Ga0500569_043655 | 3300053109 | Bacteria | 1325 |
| 1047 | Ga0500572_000050 | 3300053111 | Bacteria | 35855 |
| 1048 | Ga0500594_0056242 | 3300053118 | Bacteria | 1122 |
| 1049 | Ga0500595_000327 | 3300053119 | Bacteria | 31289 |
| 1050 | Ga0500595_002045 | 3300053119 | Bacteria | 10305 |
| 1051 | Ga0500595_021852 | 3300053119 | Bacteria | 2277 |
| 1052 | Ga0500595_026464 | 3300053119 | Bacteria | 1998 |
| 1053 | Ga0500614_001235 | 3300053123 | Bacteria | 6228 |
| 1054 | Ga0500642_0000241 | 3300053130 | Bacteria | 21103 |
| 1055 | Ga0500658_0059353 | 3300053134 | Bacteria | 1587 |
| 1056 | Ga0500559_0012776 | 3300053136 | Bacteria | 3564 |
| 1057 | Ga0500559_0065227 | 3300053136 | Bacteria | 1631 |
| 1058 | Ga0500559_0077370 | 3300053136 | Bacteria | 1507 |
| 1059 | Ga0500568_0007903 | 3300053139 | Bacteria | 5177 |
| 1060 | Ga0500568_0022500 | 3300053139 | Bacteria | 2694 |
| 1061 | Ga0500568_0064410 | 3300053139 | Bacteria | 1412 |
| 1062 | Ga0500577_0020215 | 3300053142 | Bacteria | 2174 |
| 1063 | Ga0500588_0031385 | 3300053146 | Bacteria | 1533 |
| 1064 | Ga0500589_053434 | 3300053147 | Bacteria | 1869 |
| 1065 | Ga0500590_077746 | 3300053148 | Bacteria | 1637 |
| 1066 | Ga0500603_000040 | 3300053150 | Bacteria | 30803 |
| 1067 | Ga0500603_000999 | 3300053150 | Bacteria | 6657 |
| 1068 | Ga0500603_089254 | 3300053150 | Bacteria | 903 |
| 1069 | Ga0500604_0062743 | 3300053151 | Bacteria | 1170 |
| 1070 | Ga0500604_0082535 | 3300053151 | Bacteria | 1040 |
| 1071 | Ga0500616_0015546 | 3300053153 | Bacteria | 4349 |
| 1072 | Ga0500619_046631 | 3300053154 | Bacteria | 1390 |
| 1073 | Ga0500622_0006790 | 3300053156 | Bacteria | 6584 |
| 1074 | Ga0500630_002184 | 3300053159 | Bacteria | 9456 |
| 1075 | Ga0500634_0084986 | 3300053161 | Bacteria | 1620 |
| 1076 | Ga0500638_004687 | 3300053162 | Bacteria | 5324 |
| 1077 | Ga0500638_215201 | 3300053162 | Bacteria | 801 |
| 1078 | Ga0500639_000010 | 3300053163 | Bacteria | 136747 |
| 1079 | Ga0500636_0025748 | 3300053177 | Bacteria | 3477 |
| 1080 | Ga0500636_0126980 | 3300053177 | Bacteria | 1425 |
| 1081 | Ga0500636_0368282 | 3300053177 | Bacteria | 679 |
| 1082 | Ga0500637_0000084 | 3300053178 | Bacteria | 33745 |
| 1083 | Ga0500637_0002664 | 3300053178 | Bacteria | 7997 |
| 1084 | Ga0500637_0126638 | 3300053178 | Bacteria | 1481 |
| 1085 | Ga0500625_017306 | 3300053729 | Bacteria | 3366 |
| 1086 | Ga0500645_091333 | 3300053730 | Bacteria | 863 |
| 1087 | Ga0500552_012288 | 3300053733 | Bacteria | 1092 |
| 1088 | Ga0500596_000151 | 3300053735 | Bacteria | 10667 |
| 1089 | Ga0500599_004187 | 3300053736 | Bacteria | 1781 |
| 1090 | Ga0500601_000123 | 3300053737 | Bacteria | 15976 |
| 1091 | Ga0500601_006858 | 3300053737 | Bacteria | 1259 |
| 1092 | Ga0500661_000153 | 3300055283 | Bacteria | 11809 |
| 1093 | Ga0501082_0029219 | 3300060353 | Bacteria | 4748 |
| 1094 | Ga0501082_0186594 | 3300060353 | Bacteria | 1804 |
| 1095 | Ga0466962_0029471 | 3300061719 | Bacteria | 2628 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046475 | Ga0495639_0073169 | Ga0495639_0073169_821_1384 | 185 |
| 2 | 3300047321 | Ga0495676_0218471 | Ga0495676_0218471_710_1273 | 186 |
| 3 | 3300046455 | Ga0495603_0117629 | Ga0495603_0117629_708_1448 | 187 |
| 4 | 3300013307 | Ga0157372_10117449 | Ga0157372_101174492 | 196 |
| 5 | 3300006177 | Ga0075362_10189600 | Ga0075362_101896001 | 197 |
| 6 | 3300048911 | Ga0496108_0267706 | Ga0496108_0267706_43_720 | 197 |
| 7 | 3300005937 | Ga0081455_10627158 | Ga0081455_106271581 | 198 |
| 8 | iso_pu_bacteria | 2508501128 | 2509147122 | 198 |
| 9 | iso_pu_bacteria | 2513237104 | 2513716855 | 198 |
| 10 | iso_pu_bacteria | 2513237141 | 2513894540 | 198 |
| 11 | 3300006038 | Ga0075365_10036146 | Ga0075365_100361463 | 199 |
| 12 | 3300006042 | Ga0075368_10016671 | Ga0075368_100166712 | 199 |
| 13 | 3300006048 | Ga0075363_100063181 | Ga0075363_1000631812 | 199 |
| 14 | 3300006177 | Ga0075362_10065808 | Ga0075362_100658082 | 199 |
| 15 | 3300006178 | Ga0075367_10021204 | Ga0075367_100212043 | 199 |
| 16 | 3300006195 | Ga0075366_10017172 | Ga0075366_100171724 | 199 |
| 17 | 3300027866 | Ga0209813_10063594 | Ga0209813_100635942 | 199 |
| 18 | 3300028381 | Ga0268264_10477128 | Ga0268264_104771282 | 199 |
| 19 | 3300049823 | Ga0501044_0091934 | Ga0501044_0091934_2200_2802 | 199 |
| 20 | 3300050489 | nmdc:mga03683_4322_c1 | nmdc:mga03683_4322_c1_3889_4488 | 199 |
| 21 | 3300050490 | nmdc:mga03n38_101147_c1 | nmdc:mga03n38_101147_c1_648_1247 | 199 |
| 22 | 3300050491 | nmdc:mga00v17_356220_c1 | nmdc:mga00v17_356220_c1_90_689 | 199 |
| 23 | 3300050492 | nmdc:mga0yw44_190785_c1 | nmdc:mga0yw44_190785_c1_290_889 | 199 |
| 24 | 3300050494 | nmdc:mga06z11_98945_c1 | nmdc:mga06z11_98945_c1_176_775 | 199 |
| 25 | 3300053096 | Ga0500641_0000868 | Ga0500641_0000868_9273_9872 | 199 |
| 26 | iso_pu_bacteria | 2507262055 | 2507510939 | 199 |
| 27 | iso_pu_bacteria | 2508501009 | 2508544758 | 199 |
| 28 | iso_pu_bacteria | 2508501042 | 2508697015 | 199 |
| 29 | iso_pu_bacteria | 2511231028 | 2511400441 | 199 |
| 30 | iso_pu_bacteria | 2513237094 | 2513637546 | 199 |
| 31 | iso_pu_bacteria | 2513237095 | 2513649614 | 199 |
| 32 | iso_pu_bacteria | 2513237096 | 2513654972 | 199 |
| 33 | iso_pu_bacteria | 2513237098 | 2513671109 | 199 |
| 34 | iso_pu_bacteria | 2513237101 | 2513697379 | 199 |
| 35 | iso_pu_bacteria | 2513237137 | 2513861231 | 199 |
| 36 | iso_pu_bacteria | 2513237139 | 2513874595 | 199 |
| 37 | iso_pu_bacteria | 2513237145 | 2513916005 | 199 |
| 38 | iso_pu_bacteria | 2513237161 | 2514015501 | 199 |
| 39 | iso_pu_bacteria | 2515154112 | 2515625515 | 199 |
| 40 | iso_pu_bacteria | 2517093001 | 2517100525 | 199 |
| 41 | iso_pu_bacteria | 2517572143 | 2517894692 | 199 |
| 42 | iso_pu_bacteria | 2524023205 | 2524437389 | 199 |
| 43 | iso_pu_bacteria | 2524023210 | 2524464032 | 199 |
| 44 | iso_pu_bacteria | 2524023228 | 2524534432 | 199 |
| 45 | iso_pu_bacteria | 2528768022 | 2528849891 | 199 |
| 46 | iso_pu_bacteria | 2617270741 | 2617377895 | 199 |
| 47 | iso_pu_bacteria | 2667528175 | 2671119114 | 199 |
| 48 | iso_pu_bacteria | 2721755755 | 2723843125 | 199 |
| 49 | iso_pu_bacteria | 2728368998 | 2728747651 | 199 |
| 50 | iso_pu_bacteria | 2744054633 | 2745076867 | 199 |
| 51 | iso_pu_bacteria | 2791355196 | 2793064604 | 199 |
| 52 | iso_pu_bacteria | 2791355197 | 2793071162 | 199 |
| 53 | iso_pu_bacteria | 2791355199 | 2793079471 | 199 |
| 54 | iso_pu_bacteria | 2802429603 | 2805916591 | 199 |
| 55 | iso_pu_bacteria | 2816332527 | 2818238085 | 199 |
| 56 | iso_pu_bacteria | 2824661429 | 2824667504 | 199 |
| 57 | iso_pu_bacteria | 2824696289 | 2824702345 | 199 |
| 58 | iso_pu_bacteria | 2824704595 | 2824709813 | 199 |
| 59 | iso_pu_bacteria | 2824746037 | 2824753064 | 199 |
| 60 | iso_pu_bacteria | 2824753945 | 2824760991 | 199 |
| 61 | iso_pu_bacteria | 2824763712 | 2824770580 | 199 |
| 62 | iso_pu_bacteria | 2844315083 | 2844316978 | 199 |
| 63 | iso_pu_bacteria | 2847939898 | 2847944296 | 199 |
| 64 | iso_pu_bacteria | 2879099564 | 2879102037 | 199 |
| 65 | iso_pu_bacteria | 2885374607 | 2885383352 | 199 |
| 66 | iso_pu_bacteria | 2885383462 | 2885385706 | 199 |
| 67 | iso_pu_bacteria | 2903727486 | 2903734025 | 199 |
| 68 | iso_pu_bacteria | 2903748898 | 2903757880 | 199 |
| 69 | iso_pu_bacteria | 2903768456 | 2903778046 | 199 |
| 70 | iso_pu_bacteria | 2904690495 | 2904696975 | 199 |
| 71 | iso_pu_bacteria | 2904699407 | 2904705726 | 199 |
| 72 | iso_pu_bacteria | 2904711408 | 2904719147 | 199 |
| 73 | iso_pu_bacteria | 2906602504 | 2906604641 | 199 |
| 74 | iso_pu_bacteria | 2906610324 | 2906611419 | 199 |
| 75 | iso_pu_bacteria | 2906635258 | 2906641017 | 199 |
| 76 | iso_pu_bacteria | 2906643746 | 2906650335 | 199 |
| 77 | iso_pu_bacteria | 2906660503 | 2906660850 | 199 |
| 78 | iso_pu_bacteria | 2908739725 | 2908745005 | 199 |
| 79 | iso_pu_bacteria | 2908756301 | 2908762757 | 199 |
| 80 | iso_pu_bacteria | 2908775508 | 2908782055 | 199 |
| 81 | iso_pu_bacteria | 2922368715 | 2922371266 | 199 |
| 82 | iso_pu_bacteria | 2922386360 | 2922390275 | 199 |
| 83 | iso_pu_bacteria | 2922425934 | 2922427948 | 199 |
| 84 | iso_pu_bacteria | 2929615660 | 2929619648 | 199 |
| 85 | iso_pu_bacteria | 2929624759 | 2929627881 | 199 |
| 86 | iso_pu_bacteria | 2932784394 | 2932785979 | 199 |
| 87 | iso_pu_bacteria | 2932794094 | 2932798249 | 199 |
| 88 | iso_pu_bacteria | 2932801729 | 2932804046 | 199 |
| 89 | iso_pu_bacteria | 2932809354 | 2932817074 | 199 |
| 90 | iso_pu_bacteria | 2932818245 | 2932822435 | 199 |
| 91 | iso_pu_bacteria | 2932828146 | 2932831023 | 199 |
| 92 | iso_pu_bacteria | 2933577622 | 2933581567 | 199 |
| 93 | iso_pu_bacteria | 2935608549 | 2935612831 | 199 |
| 94 | iso_pu_bacteria | 2935616580 | 2935624189 | 199 |
| 95 | iso_pu_bacteria | 2935630451 | 2935632133 | 199 |
| 96 | iso_pu_bacteria | 2935638405 | 2935640165 | 199 |
| 97 | iso_pu_bacteria | 2935648319 | 2935655378 | 199 |
| 98 | iso_pu_bacteria | 2935656913 | 2935664321 | 199 |
| 99 | iso_pu_bacteria | 2935665750 | 2935666997 | 199 |
| 100 | iso_pu_bacteria | 2935675223 | 2935680362 | 199 |
| 101 | iso_pu_bacteria | 2935684952 | 2935690128 | 199 |
| 102 | iso_pu_bacteria | 2935694250 | 2935699787 | 199 |
| 103 | iso_pu_bacteria | 2935703347 | 2935704752 | 199 |
| 104 | iso_pu_bacteria | 2935713505 | 2935722159 | 199 |
| 105 | iso_pu_bacteria | 2935722832 | 2935731469 | 199 |
| 106 | iso_pu_bacteria | 2935732158 | 2935735443 | 199 |
| 107 | iso_pu_bacteria | 2935741537 | 2935745286 | 199 |
| 108 | iso_pu_bacteria | 2935750917 | 2935755139 | 199 |
| 109 | iso_pu_bacteria | 2935760218 | 2935762344 | 199 |
| 110 | iso_pu_bacteria | 2935801545 | 2935803845 | 199 |
| 111 | iso_pu_bacteria | 2935810662 | 2935811761 | 199 |
| 112 | iso_pu_bacteria | 2935819856 | 2935824319 | 199 |
| 113 | iso_pu_bacteria | 2935827899 | 2935829648 | 199 |
| 114 | iso_pu_bacteria | 2935837841 | 2935843020 | 199 |
| 115 | iso_pu_bacteria | 2935847175 | 2935852536 | 199 |
| 116 | iso_pu_bacteria | 2935855204 | 2935862311 | 199 |
| 117 | iso_pu_bacteria | 2935864058 | 2935870446 | 199 |
| 118 | iso_pu_bacteria | 2935873716 | 2935881028 | 199 |
| 119 | iso_pu_bacteria | 2935883170 | 2935884150 | 199 |
| 120 | iso_pu_bacteria | 2935908558 | 2935912317 | 199 |
| 121 | iso_pu_bacteria | 2935916978 | 2935924009 | 199 |
| 122 | iso_pu_bacteria | 2935926038 | 2935929346 | 199 |
| 123 | iso_pu_bacteria | 2935934488 | 2935935977 | 199 |
| 124 | iso_pu_bacteria | 2935942939 | 2935949877 | 199 |
| 125 | iso_pu_bacteria | 2935951376 | 2935957357 | 199 |
| 126 | iso_pu_bacteria | 2935967501 | 2935968388 | 199 |
| 127 | iso_pu_bacteria | 2935975950 | 2935976572 | 199 |
| 128 | iso_pu_bacteria | 2935984226 | 2935987979 | 199 |
| 129 | iso_pu_bacteria | 2935992306 | 2935993525 | 199 |
| 130 | iso_pu_bacteria | 2936002035 | 2936004421 | 199 |
| 131 | iso_pu_bacteria | 2936011229 | 2936018391 | 199 |
| 132 | iso_pu_bacteria | 2936019824 | 2936026846 | 199 |
| 133 | iso_pu_bacteria | 2936028420 | 2936035790 | 199 |
| 134 | iso_pu_bacteria | 2936037263 | 2936038344 | 199 |
| 135 | iso_pu_bacteria | 2936046547 | 2936053869 | 199 |
| 136 | iso_pu_bacteria | 2936055302 | 2936058683 | 199 |
| 137 | iso_pu_bacteria | 2940556831 | 2940561581 | 199 |
| 138 | iso_pu_bacteria | 2941507105 | 2941508081 | 199 |
| 139 | iso_pu_bacteria | 2941515067 | 2941515414 | 199 |
| 140 | iso_pu_bacteria | 2941523033 | 2941524011 | 199 |
| 141 | iso_pu_bacteria | 2941531003 | 2941533759 | 199 |
| 142 | iso_pu_bacteria | 2941538514 | 2941544244 | 199 |
| 143 | iso_pu_bacteria | 3005474847 | 3005477656 | 199 |
| 144 | iso_pu_bacteria | 3005506211 | 3005507189 | 199 |
| 145 | iso_pu_bacteria | 3005594810 | 3005596618 | 199 |
| 146 | iso_pu_bacteria | 3005710791 | 3005712690 | 199 |
| 147 | iso_pu_bacteria | 3005718088 | 3005719735 | 199 |
| 148 | iso_pu_bacteria | 8006933436 | 8006933562 | 199 |
| 149 | iso_pu_bacteria | 8006964411 | 8006966480 | 199 |
| 150 | iso_pu_bacteria | 8006973647 | 8006983235 | 199 |
| 151 | iso_pu_bacteria | 8006984368 | 8006989308 | 199 |
| 152 | iso_pu_bacteria | 8006994254 | 8006997789 | 199 |
| 153 | iso_pu_bacteria | 8016511872 | 8016516361 | 199 |
| 154 | iso_pu_bacteria | 8016583857 | 8016589218 | 199 |
| 155 | iso_pu_bacteria | 8016630954 | 8016633768 | 199 |
| 156 | iso_pu_bacteria | 8017057580 | 8017060175 | 199 |
| 157 | iso_pu_bacteria | 8019555841 | 8019559489 | 199 |
| 158 | iso_pu_bacteria | 8019565922 | 8019569591 | 199 |
| 159 | iso_pu_bacteria | 8019576017 | 8019579692 | 199 |
| 160 | iso_pu_bacteria | 8019586578 | 8019587405 | 199 |
| 161 | iso_pu_bacteria | 8019597564 | 8019603939 | 199 |
| 162 | iso_pu_bacteria | 8019608314 | 8019614593 | 199 |
| 163 | iso_pu_bacteria | 8019619141 | 8019625224 | 199 |
| 164 | iso_pu_bacteria | 8019629233 | 8019636957 | 199 |
| 165 | iso_pu_bacteria | 8019638758 | 8019642652 | 199 |
| 166 | iso_pu_bacteria | 8019648815 | 8019649944 | 199 |
| 167 | iso_pu_bacteria | 8019659431 | 8019664787 | 199 |
| 168 | iso_pu_bacteria | 8019668869 | 8019674360 | 199 |
| 169 | iso_pu_bacteria | 8019687851 | 8019694028 | 199 |
| 170 | iso_pu_bacteria | 8055742211 | 8055749096 | 199 |
| 171 | iso_pu_bacteria | 8056673599 | 8056674824 | 199 |
| 172 | iso_pu_bacteria | 8056681323 | 8056682421 | 199 |
| 173 | iso_pu_bacteria | 8056689827 | 8056695119 | 199 |
| 174 | iso_pu_bacteria | 8056967851 | 8056969953 | 199 |
| 175 | 3300005468 | Ga0070707_100725866 | Ga0070707_1007258662 | 200 |
| 176 | 3300009177 | Ga0105248_10051252 | Ga0105248_100512522 | 200 |
| 177 | 3300009551 | Ga0105238_10562419 | Ga0105238_105624192 | 200 |
| 178 | 3300011119 | Ga0105246_10035501 | Ga0105246_100355014 | 200 |
| 179 | 3300013105 | Ga0157369_10368991 | Ga0157369_103689912 | 200 |
| 180 | 3300013297 | Ga0157378_11217780 | Ga0157378_112177801 | 200 |
| 181 | 3300037853 | Ga0436364_0342298 | Ga0436364_0342298_1841_2446 | 200 |
| 182 | 3300041413 | Ga0439465_0064550 | Ga0439465_0064550_573_1175 | 200 |
| 183 | 3300042016 | Ga0439463_040713 | Ga0439463_040713_127_729 | 200 |
| 184 | 3300044658 | Ga0466972_0000185 | Ga0466972_0000185_27375_27977 | 200 |
| 185 | 3300044683 | Ga0466965_0035908 | Ga0466965_0035908_1450_2052 | 200 |
| 186 | 3300044735 | Ga0466968_0291324 | Ga0466968_0291324_56_658 | 200 |
| 187 | 3300046459 | Ga0495629_0079747 | Ga0495629_0079747_207_809 | 200 |
| 188 | 3300046474 | Ga0495605_0177445 | Ga0495605_0177445_242_844 | 200 |
| 189 | 3300046491 | Ga0495584_0107053 | Ga0495584_0107053_148_750 | 200 |
| 190 | 3300046491 | Ga0495584_0173646 | Ga0495584_0173646_442_1047 | 200 |
| 191 | 3300046500 | Ga0495596_0014778 | Ga0495596_0014778_2433_3035 | 200 |
| 192 | 3300046501 | Ga0495607_0170161 | Ga0495607_0170161_418_1020 | 200 |
| 193 | 3300046507 | Ga0495606_0190609 | Ga0495606_0190609_303_905 | 200 |
| 194 | 3300046523 | Ga0495644_0149016 | Ga0495644_0149016_68_670 | 200 |
| 195 | 3300046524 | Ga0495648_0201389 | Ga0495648_0201389_62_664 | 200 |
| 196 | 3300046528 | Ga0495642_0258900 | Ga0495642_0258900_74_676 | 200 |
| 197 | 3300046615 | Ga0495656_0027153 | Ga0495656_0027153_1237_1839 | 200 |
| 198 | 3300046616 | Ga0495668_0101566 | Ga0495668_0101566_504_1106 | 200 |
| 199 | 3300046660 | Ga0495625_0214830 | Ga0495625_0214830_614_1216 | 200 |
| 200 | 3300046664 | Ga0495659_0347327 | Ga0495659_0347327_15_617 | 200 |
| 201 | 3300046684 | Ga0495669_0084784 | Ga0495669_0084784_440_1042 | 200 |
| 202 | 3300046691 | Ga0495670_0277530 | Ga0495670_0277530_67_672 | 200 |
| 203 | 3300047323 | Ga0495683_0058399 | Ga0495683_0058399_1249_1851 | 200 |
| 204 | 3300047445 | Ga0495677_0044535 | Ga0495677_0044535_812_1414 | 200 |
| 205 | 3300047472 | Ga0495686_0030828 | Ga0495686_0030828_600_1202 | 200 |
| 206 | 3300047472 | Ga0495686_0233030 | Ga0495686_0233030_379_981 | 200 |
| 207 | 3300048906 | Ga0496103_0147041 | Ga0496103_0147041_897_1499 | 200 |
| 208 | 3300048908 | Ga0496105_0352779 | Ga0496105_0352779_446_1048 | 200 |
| 209 | 3300048910 | Ga0496107_0243758 | Ga0496107_0243758_367_969 | 200 |
| 210 | 3300048911 | Ga0496108_0185182 | Ga0496108_0185182_876_1478 | 200 |
| 211 | 3300048912 | Ga0496109_0259682 | Ga0496109_0259682_52_660 | 200 |
| 212 | 3300048912 | Ga0496109_0747928 | Ga0496109_0747928_213_815 | 200 |
| 213 | 3300048919 | Ga0496116_0195631 | Ga0496116_0195631_438_1040 | 200 |
| 214 | 3300048920 | Ga0496117_0068971 | Ga0496117_0068971_672_1274 | 200 |
| 215 | 3300048924 | Ga0496121_0033344 | Ga0496121_0033344_3605_4207 | 200 |
| 216 | 3300048924 | Ga0496121_0058666 | Ga0496121_0058666_1049_1651 | 200 |
| 217 | 3300048927 | Ga0496124_0058250 | Ga0496124_0058250_1113_1715 | 200 |
| 218 | 3300048928 | Ga0496125_0113929 | Ga0496125_0113929_1018_1620 | 200 |
| 219 | 3300048929 | Ga0496126_0025106 | Ga0496126_0025106_2702_3304 | 200 |
| 220 | 3300048929 | Ga0496126_0088228 | Ga0496126_0088228_342_944 | 200 |
| 221 | 3300049459 | Ga0495678_068821 | Ga0495678_068821_251_853 | 200 |
| 222 | 3300050490 | nmdc:mga03n38_16005_c1 | nmdc:mga03n38_16005_c1_2230_2832 | 200 |
| 223 | 3300050491 | nmdc:mga00v17_388605_c1 | nmdc:mga00v17_388605_c1_192_794 | 200 |
| 224 | 3300050492 | nmdc:mga0yw44_19854_c1 | nmdc:mga0yw44_19854_c1_2081_2689 | 200 |
| 225 | 3300050492 | nmdc:mga0yw44_75470_c1 | nmdc:mga0yw44_75470_c1_1157_1759 | 200 |
| 226 | 3300050493 | nmdc:mga0k408_110148_c1 | nmdc:mga0k408_110148_c1_221_823 | 200 |
| 227 | 3300050493 | nmdc:mga0k408_33069_c1 | nmdc:mga0k408_33069_c1_1906_2508 | 200 |
| 228 | 3300050494 | nmdc:mga06z11_138670_c1 | nmdc:mga06z11_138670_c1_444_1046 | 200 |
| 229 | 3300050494 | nmdc:mga06z11_81738_c1 | nmdc:mga06z11_81738_c1_543_1145 | 200 |
| 230 | 3300050496 | nmdc:mga07m45_20854_c1 | nmdc:mga07m45_20854_c1_2328_2930 | 200 |
| 231 | 3300050508 | nmdc:mga09592_784794_c1 | nmdc:mga09592_784794_c1_174_776 | 200 |
| 232 | 3300050512 | nmdc:mga0n895_227086_c1 | nmdc:mga0n895_227086_c1_1221_1823 | 200 |
| 233 | 3300050516 | nmdc:mga0sz30_22941_c1 | nmdc:mga0sz30_22941_c1_809_1411 | 200 |
| 234 | 3300053086 | Ga0500578_0362817 | Ga0500578_0362817_214_816 | 200 |
| 235 | 3300053089 | Ga0500581_062520 | Ga0500581_062520_802_1404 | 200 |
| 236 | 3300053090 | Ga0500646_0015819 | Ga0500646_0015819_401_1003 | 200 |
| 237 | 3300053092 | Ga0500583_0020859 | Ga0500583_0020859_246_848 | 200 |
| 238 | 3300053093 | Ga0500651_0233440 | Ga0500651_0233440_112_714 | 200 |
| 239 | 3300053096 | Ga0500641_0005542 | Ga0500641_0005542_324_926 | 200 |
| 240 | 3300053103 | Ga0500555_000761 | Ga0500555_000761_3544_4146 | 200 |
| 241 | 3300053108 | Ga0500562_064385 | Ga0500562_064385_122_724 | 200 |
| 242 | 3300053109 | Ga0500569_043655 | Ga0500569_043655_46_648 | 200 |
| 243 | 3300053119 | Ga0500595_021852 | Ga0500595_021852_1392_1994 | 200 |
| 244 | 3300053119 | Ga0500595_026464 | Ga0500595_026464_134_736 | 200 |
| 245 | 3300053146 | Ga0500588_0031385 | Ga0500588_0031385_341_943 | 200 |
| 246 | 3300053150 | Ga0500603_089254 | Ga0500603_089254_265_867 | 200 |
| 247 | 3300053151 | Ga0500604_0062743 | Ga0500604_0062743_401_1003 | 200 |
| 248 | 3300053153 | Ga0500616_0015546 | Ga0500616_0015546_3124_3726 | 200 |
| 249 | 3300053161 | Ga0500634_0084986 | Ga0500634_0084986_969_1571 | 200 |
| 250 | 3300053178 | Ga0500637_0126638 | Ga0500637_0126638_205_807 | 200 |
| 251 | 3300053730 | Ga0500645_091333 | Ga0500645_091333_247_849 | 200 |
| 252 | 3300003203 | JGI25406J46586_10002021 | JGI25406J46586_100020213 | 201 |
| 253 | 3300003322 | rootL2_10198724 | rootL2_101987241 | 201 |
| 254 | 3300003323 | rootH1_10224479 | rootH1_102244792 | 201 |
| 255 | 3300003659 | JGI25404J52841_10000868 | JGI25404J52841_100008682 | 201 |
| 256 | 3300003659 | JGI25404J52841_10062363 | JGI25404J52841_100623631 | 201 |
| 257 | 3300005439 | Ga0070711_100153320 | Ga0070711_1001533202 | 201 |
| 258 | 3300005539 | Ga0068853_100119521 | Ga0068853_1001195212 | 201 |
| 259 | 3300005563 | Ga0068855_100327963 | Ga0068855_1003279631 | 201 |
| 260 | 3300005577 | Ga0068857_100514516 | Ga0068857_1005145161 | 201 |
| 261 | 3300005983 | Ga0081540_1005220 | Ga0081540_10052203 | 201 |
| 262 | 3300005983 | Ga0081540_1212295 | Ga0081540_12122951 | 201 |
| 263 | 3300005985 | Ga0081539_10002516 | Ga0081539_1000251623 | 201 |
| 264 | 3300005985 | Ga0081539_10043336 | Ga0081539_100433362 | 201 |
| 265 | 3300006175 | Ga0070712_100261990 | Ga0070712_1002619902 | 201 |
| 266 | 3300006844 | Ga0075428_101376576 | Ga0075428_1013765761 | 201 |
| 267 | 3300009545 | Ga0105237_10283706 | Ga0105237_102837062 | 201 |
| 268 | 3300009551 | Ga0105238_10036806 | Ga0105238_100368063 | 201 |
| 269 | 3300009551 | Ga0105238_10330068 | Ga0105238_103300682 | 201 |
| 270 | 3300010375 | Ga0105239_10757708 | Ga0105239_107577082 | 201 |
| 271 | 3300013296 | Ga0157374_10800889 | Ga0157374_108008891 | 201 |
| 272 | 3300025898 | Ga0207692_10005899 | Ga0207692_100058993 | 201 |
| 273 | 3300025906 | Ga0207699_10049665 | Ga0207699_100496653 | 201 |
| 274 | 3300025915 | Ga0207693_10048463 | Ga0207693_100484633 | 201 |
| 275 | 3300025924 | Ga0207694_10351438 | Ga0207694_103514382 | 201 |
| 276 | 3300025939 | Ga0207665_10468350 | Ga0207665_104683502 | 201 |
| 277 | 3300025949 | Ga0207667_10606710 | Ga0207667_106067102 | 201 |
| 278 | 3300026116 | Ga0207674_10368732 | Ga0207674_103687322 | 201 |
| 279 | 3300031616 | Ga0307508_10133366 | Ga0307508_101333662 | 201 |
| 280 | 3300045976 | Ga0466967_0749416 | Ga0466967_0749416_60_665 | 201 |
| 281 | 3300048929 | Ga0496126_0024926 | Ga0496126_0024926_1461_2069 | 201 |
| 282 | 3300003323 | rootH1_10140860 | rootH1_101408601 | 202 |
| 283 | 3300003659 | JGI25404J52841_10007121 | JGI25404J52841_100071212 | 202 |
| 284 | 3300005327 | Ga0070658_10435416 | Ga0070658_104354161 | 202 |
| 285 | 3300005329 | Ga0070683_100012766 | Ga0070683_1000127663 | 202 |
| 286 | 3300005336 | Ga0070680_100047681 | Ga0070680_1000476813 | 202 |
| 287 | 3300005434 | Ga0070709_10000324 | Ga0070709_1000032422 | 202 |
| 288 | 3300005435 | Ga0070714_100055285 | Ga0070714_1000552852 | 202 |
| 289 | 3300005436 | Ga0070713_100059037 | Ga0070713_1000590374 | 202 |
| 290 | 3300005437 | Ga0070710_10004545 | Ga0070710_100045452 | 202 |
| 291 | 3300005439 | Ga0070711_100005717 | Ga0070711_1000057174 | 202 |
| 292 | 3300005458 | Ga0070681_10044524 | Ga0070681_100445242 | 202 |
| 293 | 3300005458 | Ga0070681_10105694 | Ga0070681_101056943 | 202 |
| 294 | 3300005530 | Ga0070679_100044114 | Ga0070679_1000441142 | 202 |
| 295 | 3300005530 | Ga0070679_100078665 | Ga0070679_1000786653 | 202 |
| 296 | 3300005535 | Ga0070684_100002379 | Ga0070684_1000023793 | 202 |
| 297 | 3300005539 | Ga0068853_100364061 | Ga0068853_1003640612 | 202 |
| 298 | 3300005563 | Ga0068855_100012351 | Ga0068855_1000123514 | 202 |
| 299 | 3300005563 | Ga0068855_100293910 | Ga0068855_1002939102 | 202 |
| 300 | 3300005937 | Ga0081455_10001565 | Ga0081455_100015652 | 202 |
| 301 | 3300005937 | Ga0081455_10011569 | Ga0081455_100115694 | 202 |
| 302 | 3300005937 | Ga0081455_10023918 | Ga0081455_100239187 | 202 |
| 303 | 3300005937 | Ga0081455_10284251 | Ga0081455_102842511 | 202 |
| 304 | 3300005983 | Ga0081540_1001316 | Ga0081540_100131615 | 202 |
| 305 | 3300005983 | Ga0081540_1002055 | Ga0081540_10020557 | 202 |
| 306 | 3300005983 | Ga0081540_1003766 | Ga0081540_10037663 | 202 |
| 307 | 3300005985 | Ga0081539_10071980 | Ga0081539_100719803 | 202 |
| 308 | 3300006028 | Ga0070717_10110584 | Ga0070717_101105842 | 202 |
| 309 | 3300006173 | Ga0070716_100001795 | Ga0070716_1000017953 | 202 |
| 310 | 3300006175 | Ga0070712_100028537 | Ga0070712_1000285372 | 202 |
| 311 | 3300006175 | Ga0070712_100388878 | Ga0070712_1003888781 | 202 |
| 312 | 3300006237 | Ga0097621_100509455 | Ga0097621_1005094552 | 202 |
| 313 | 3300006358 | Ga0068871_100228886 | Ga0068871_1002288862 | 202 |
| 314 | 3300006914 | Ga0075436_100607155 | Ga0075436_1006071552 | 202 |
| 315 | 3300007076 | Ga0075435_100582548 | Ga0075435_1005825482 | 202 |
| 316 | 3300007788 | Ga0099795_10006561 | Ga0099795_100065612 | 202 |
| 317 | 3300009093 | Ga0105240_10332078 | Ga0105240_103320782 | 202 |
| 318 | 3300009174 | Ga0105241_10231558 | Ga0105241_102315582 | 202 |
| 319 | 3300010159 | Ga0099796_10156582 | Ga0099796_101565821 | 202 |
| 320 | 3300013104 | Ga0157370_10137706 | Ga0157370_101377062 | 202 |
| 321 | 3300013105 | Ga0157369_10469407 | Ga0157369_104694072 | 202 |
| 322 | 3300013297 | Ga0157378_10476080 | Ga0157378_104760802 | 202 |
| 323 | 3300013307 | Ga0157372_10044995 | Ga0157372_100449953 | 202 |
| 324 | 3300021384 | Ga0213876_10016320 | Ga0213876_100163202 | 202 |
| 325 | 3300021441 | Ga0213871_10013056 | Ga0213871_100130561 | 202 |
| 326 | 3300025898 | Ga0207692_10006552 | Ga0207692_100065522 | 202 |
| 327 | 3300025906 | Ga0207699_10001062 | Ga0207699_100010625 | 202 |
| 328 | 3300025909 | Ga0207705_10688904 | Ga0207705_106889041 | 202 |
| 329 | 3300025912 | Ga0207707_10003996 | Ga0207707_100039965 | 202 |
| 330 | 3300025912 | Ga0207707_10012694 | Ga0207707_100126942 | 202 |
| 331 | 3300025912 | Ga0207707_10025470 | Ga0207707_100254702 | 202 |
| 332 | 3300025912 | Ga0207707_10706916 | Ga0207707_107069161 | 202 |
| 333 | 3300025913 | Ga0207695_10198040 | Ga0207695_101980402 | 202 |
| 334 | 3300025915 | Ga0207693_10008114 | Ga0207693_100081142 | 202 |
| 335 | 3300025915 | Ga0207693_10185455 | Ga0207693_101854552 | 202 |
| 336 | 3300025916 | Ga0207663_10007196 | Ga0207663_100071963 | 202 |
| 337 | 3300025917 | Ga0207660_10046064 | Ga0207660_100460642 | 202 |
| 338 | 3300025917 | Ga0207660_10129366 | Ga0207660_101293662 | 202 |
| 339 | 3300025921 | Ga0207652_10081505 | Ga0207652_100815053 | 202 |
| 340 | 3300025928 | Ga0207700_10033953 | Ga0207700_100339534 | 202 |
| 341 | 3300025929 | Ga0207664_10004165 | Ga0207664_100041656 | 202 |
| 342 | 3300025939 | Ga0207665_10053611 | Ga0207665_100536112 | 202 |
| 343 | 3300025939 | Ga0207665_10228528 | Ga0207665_102285282 | 202 |
| 344 | 3300025944 | Ga0207661_10018159 | Ga0207661_100181594 | 202 |
| 345 | 3300025949 | Ga0207667_10050410 | Ga0207667_100504102 | 202 |
| 346 | 3300026041 | Ga0207639_10084602 | Ga0207639_100846022 | 202 |
| 347 | 3300026041 | Ga0207639_10950287 | Ga0207639_109502871 | 202 |
| 348 | 3300026121 | Ga0207683_10605963 | Ga0207683_106059631 | 202 |
| 349 | 3300026121 | Ga0207683_10757070 | Ga0207683_107570701 | 202 |
| 350 | 3300026121 | Ga0207683_11033378 | Ga0207683_110333781 | 202 |
| 351 | 3300031548 | Ga0307408_101071979 | Ga0307408_1010719791 | 202 |
| 352 | 3300031548 | Ga0307408_101278836 | Ga0307408_1012788361 | 202 |
| 353 | 3300032002 | Ga0307416_100617515 | Ga0307416_1006175152 | 202 |
| 354 | 3300035086 | Ga0373934_0044104 | Ga0373934_0044104_487_1098 | 202 |
| 355 | 3300035113 | Ga0373936_0060858 | Ga0373936_0060858_55_663 | 202 |
| 356 | 3300035116 | Ga0373945_0001490 | Ga0373945_0001490_2451_3062 | 202 |
| 357 | 3300035117 | Ga0373953_0009791 | Ga0373953_0009791_1702_2313 | 202 |
| 358 | 3300035118 | Ga0373954_0017839 | Ga0373954_0017839_2044_2655 | 202 |
| 359 | 3300035170 | Ga0373943_0106955 | Ga0373943_0106955_227_838 | 202 |
| 360 | 3300035171 | Ga0373946_0008010 | Ga0373946_0008010_34_645 | 202 |
| 361 | 3300035172 | Ga0373955_0172016 | Ga0373955_0172016_148_759 | 202 |
| 362 | 3300035410 | Ga0373924_0004508 | Ga0373924_0004508_416_1027 | 202 |
| 363 | 3300035692 | Ga0373935_0030424 | Ga0373935_0030424_270_881 | 202 |
| 364 | 3300035724 | Ga0373933_0001647 | Ga0373933_0001647_4469_5077 | 202 |
| 365 | 3300035725 | Ga0373947_0043950 | Ga0373947_0043950_306_917 | 202 |
| 366 | 3300036401 | Ga0373937_0029135 | Ga0373937_0029135_3534_4145 | 202 |
| 367 | 3300037068 | Ga0373925_0011894 | Ga0373925_0011894_2188_2799 | 202 |
| 368 | 3300037068 | Ga0373925_0188082 | Ga0373925_0188082_325_936 | 202 |
| 369 | 3300037312 | Ga0395899_0010190 | Ga0395899_0010190_5971_6624 | 202 |
| 370 | 3300037466 | Ga0395898_0002370 | Ga0395898_0002370_16378_17031 | 202 |
| 371 | 3300038443 | Ga0395901_0003499 | Ga0395901_0003499_4096_4749 | 202 |
| 372 | 3300039437 | Ga0436365_1283571 | Ga0436365_1283571_12831_13439 | 202 |
| 373 | 3300039438 | Ga0436360_0872612 | Ga0436360_0872612_1442_2062 | 202 |
| 374 | 3300039438 | Ga0436360_0895214 | Ga0436360_0895214_92_706 | 202 |
| 375 | 3300039447 | Ga0436361_0216754 | Ga0436361_0216754_85_705 | 202 |
| 376 | 3300039447 | Ga0436361_0539604 | Ga0436361_0539604_536_1156 | 202 |
| 377 | 3300039450 | Ga0436363_0843641 | Ga0436363_0843641_185_793 | 202 |
| 378 | 3300039453 | Ga0436362_0365003 | Ga0436362_0365003_178_786 | 202 |
| 379 | 3300039453 | Ga0436362_0529262 | Ga0436362_0529262_958_1578 | 202 |
| 380 | 3300045049 | Ga0466959_0070752 | Ga0466959_0070752_740_1351 | 202 |
| 381 | 3300046455 | Ga0495603_0274637 | Ga0495603_0274637_257_868 | 202 |
| 382 | 3300046459 | Ga0495629_0114972 | Ga0495629_0114972_846_1457 | 202 |
| 383 | 3300046471 | Ga0495650_0174327 | Ga0495650_0174327_115_729 | 202 |
| 384 | 3300046472 | Ga0495580_0005215 | Ga0495580_0005215_4875_5486 | 202 |
| 385 | 3300046473 | Ga0495582_0054925 | Ga0495582_0054925_1176_1787 | 202 |
| 386 | 3300046475 | Ga0495639_0003015 | Ga0495639_0003015_5076_5687 | 202 |
| 387 | 3300046475 | Ga0495639_0076899 | Ga0495639_0076899_591_1208 | 202 |
| 388 | 3300046476 | Ga0495662_0044223 | Ga0495662_0044223_536_1147 | 202 |
| 389 | 3300046477 | Ga0495664_0098627 | Ga0495664_0098627_823_1434 | 202 |
| 390 | 3300046513 | Ga0495616_0050935 | Ga0495616_0050935_95_718 | 202 |
| 391 | 3300046514 | Ga0495618_0009386 | Ga0495618_0009386_3261_3872 | 202 |
| 392 | 3300046515 | Ga0495620_0140692 | Ga0495620_0140692_72_686 | 202 |
| 393 | 3300046516 | Ga0495628_0023039 | Ga0495628_0023039_4172_4783 | 202 |
| 394 | 3300046531 | Ga0495665_0308393 | Ga0495665_0308393_93_704 | 202 |
| 395 | 3300046535 | Ga0495586_0277101 | Ga0495586_0277101_317_928 | 202 |
| 396 | 3300046543 | Ga0495645_0136803 | Ga0495645_0136803_25_636 | 202 |
| 397 | 3300046558 | Ga0495633_0177789 | Ga0495633_0177789_352_966 | 202 |
| 398 | 3300046642 | Ga0495634_0004673 | Ga0495634_0004673_5038_5649 | 202 |
| 399 | 3300046678 | Ga0495599_0160049 | Ga0495599_0160049_760_1371 | 202 |
| 400 | 3300046680 | Ga0495646_0024473 | Ga0495646_0024473_2647_3258 | 202 |
| 401 | 3300046683 | Ga0495658_0046236 | Ga0495658_0046236_1793_2404 | 202 |
| 402 | 3300046689 | Ga0495613_0026734 | Ga0495613_0026734_3382_3993 | 202 |
| 403 | 3300046690 | Ga0495624_0039037 | Ga0495624_0039037_683_1294 | 202 |
| 404 | 3300046809 | Ga0495600_0044036 | Ga0495600_0044036_1248_1859 | 202 |
| 405 | 3300047315 | Ga0495581_0108700 | Ga0495581_0108700_560_1171 | 202 |
| 406 | 3300047319 | Ga0495674_0015364 | Ga0495674_0015364_1313_1924 | 202 |
| 407 | 3300047471 | Ga0495684_0092044 | Ga0495684_0092044_1620_2231 | 202 |
| 408 | 3300047673 | Ga0495593_0013864 | Ga0495593_0013864_3363_3974 | 202 |
| 409 | 3300048926 | Ga0496123_0142619 | Ga0496123_0142619_686_1297 | 202 |
| 410 | 3300048929 | Ga0496126_0005562 | Ga0496126_0005562_3915_4544 | 202 |
| 411 | 3300048929 | Ga0496126_0222243 | Ga0496126_0222243_358_966 | 202 |
| 412 | 3300048929 | Ga0496126_0254787 | Ga0496126_0254787_512_1120 | 202 |
| 413 | 3300049583 | Ga0501067_0017563 | Ga0501067_0017563_2307_2927 | 202 |
| 414 | 3300049586 | Ga0501070_0051654 | Ga0501070_0051654_2222_2833 | 202 |
| 415 | 3300049589 | Ga0501073_0131724 | Ga0501073_0131724_550_1161 | 202 |
| 416 | 3300049590 | Ga0501074_0367657 | Ga0501074_0367657_56_667 | 202 |
| 417 | 3300049742 | Ga0501080_0025362 | Ga0501080_0025362_2975_3586 | 202 |
| 418 | 3300050494 | nmdc:mga06z11_374_c1 | nmdc:mga06z11_374_c1_5170_5778 | 202 |
| 419 | 3300050513 | nmdc:mga0rr50_433086_c1 | nmdc:mga0rr50_433086_c1_410_1024 | 202 |
| 420 | 3300050514 | nmdc:mga08x19_576053_c1 | nmdc:mga08x19_576053_c1_55_663 | 202 |
| 421 | 3300050515 | nmdc:mga0a205_178743_c1 | nmdc:mga0a205_178743_c1_1031_1684 | 202 |
| 422 | 3300053077 | Ga0495601_0135232 | Ga0495601_0135232_890_1501 | 202 |
| 423 | 3300053078 | Ga0495612_0009090 | Ga0495612_0009090_1440_2051 | 202 |
| 424 | 3300053085 | Ga0495619_0194064 | Ga0495619_0194064_147_758 | 202 |
| 425 | 3300053094 | Ga0500566_0005439 | Ga0500566_0005439_6423_7031 | 202 |
| 426 | 3300053119 | Ga0500595_000327 | Ga0500595_000327_10352_10960 | 202 |
| 427 | 3300053136 | Ga0500559_0065227 | Ga0500559_0065227_821_1429 | 202 |
| 428 | 3300053139 | Ga0500568_0007903 | Ga0500568_0007903_1810_2418 | 202 |
| 429 | 3300053162 | Ga0500638_004687 | Ga0500638_004687_1144_1752 | 202 |
| 430 | 3300053177 | Ga0500636_0126980 | Ga0500636_0126980_503_1111 | 202 |
| 431 | 3300053178 | Ga0500637_0000084 | Ga0500637_0000084_5939_6547 | 202 |
| 432 | 3300055283 | Ga0500661_000153 | Ga0500661_000153_117_725 | 202 |
| 433 | 3300002077 | JGI24744J21845_10017086 | JGI24744J21845_100170862 | 203 |
| 434 | 3300002244 | JGI24742J22300_10012181 | JGI24742J22300_100121812 | 203 |
| 435 | 3300003215 | JGI25153J46596_10000432 | JGI25153J46596_1000043224 | 203 |
| 436 | 3300003215 | JGI25153J46596_10002180 | JGI25153J46596_100021809 | 203 |
| 437 | 3300003215 | JGI25153J46596_10004682 | JGI25153J46596_1000468212 | 203 |
| 438 | 3300003215 | JGI25153J46596_10006584 | JGI25153J46596_100065847 | 203 |
| 439 | 3300003354 | JGI25160J50197_1000709 | JGI25160J50197_10007098 | 203 |
| 440 | 3300003354 | JGI25160J50197_1002513 | JGI25160J50197_10025134 | 203 |
| 441 | 3300003354 | JGI25160J50197_1043457 | JGI25160J50197_10434571 | 203 |
| 442 | 3300003659 | JGI25404J52841_10022763 | JGI25404J52841_100227632 | 203 |
| 443 | 3300003762 | Ga0055542_1005116 | Ga0055542_10051164 | 203 |
| 444 | 3300003771 | Ga0055526_1050218 | Ga0055526_10502182 | 203 |
| 445 | 3300003794 | Ga0055531_10001452 | Ga0055531_1000145215 | 203 |
| 446 | 3300005262 | Ga0065165_1001305 | Ga0065165_100130519 | 203 |
| 447 | 3300005262 | Ga0065165_1001628 | Ga0065165_10016287 | 203 |
| 448 | 3300005262 | Ga0065165_1011953 | Ga0065165_10119532 | 203 |
| 449 | 3300005262 | Ga0065165_1048550 | Ga0065165_10485502 | 203 |
| 450 | 3300005327 | Ga0070658_10154929 | Ga0070658_101549292 | 203 |
| 451 | 3300005327 | Ga0070658_10636029 | Ga0070658_106360291 | 203 |
| 452 | 3300005334 | Ga0068869_100092774 | Ga0068869_1000927743 | 203 |
| 453 | 3300005335 | Ga0070666_10065236 | Ga0070666_100652362 | 203 |
| 454 | 3300005337 | Ga0070682_100426915 | Ga0070682_1004269152 | 203 |
| 455 | 3300005338 | Ga0068868_100510741 | Ga0068868_1005107412 | 203 |
| 456 | 3300005338 | Ga0068868_101073500 | Ga0068868_1010735001 | 203 |
| 457 | 3300005339 | Ga0070660_100004273 | Ga0070660_1000042735 | 203 |
| 458 | 3300005344 | Ga0070661_100133759 | Ga0070661_1001337592 | 203 |
| 459 | 3300005344 | Ga0070661_100166016 | Ga0070661_1001660162 | 203 |
| 460 | 3300005347 | Ga0070668_100048206 | Ga0070668_1000482063 | 203 |
| 461 | 3300005347 | Ga0070668_100077446 | Ga0070668_1000774462 | 203 |
| 462 | 3300005347 | Ga0070668_100282659 | Ga0070668_1002826592 | 203 |
| 463 | 3300005347 | Ga0070668_100298895 | Ga0070668_1002988952 | 203 |
| 464 | 3300005353 | Ga0070669_100092335 | Ga0070669_1000923352 | 203 |
| 465 | 3300005354 | Ga0070675_100985946 | Ga0070675_1009859461 | 203 |
| 466 | 3300005355 | Ga0070671_100249816 | Ga0070671_1002498162 | 203 |
| 467 | 3300005356 | Ga0070674_100274672 | Ga0070674_1002746722 | 203 |
| 468 | 3300005364 | Ga0070673_100257228 | Ga0070673_1002572282 | 203 |
| 469 | 3300005364 | Ga0070673_100394246 | Ga0070673_1003942462 | 203 |
| 470 | 3300005365 | Ga0070688_100062463 | Ga0070688_1000624631 | 203 |
| 471 | 3300005365 | Ga0070688_100074393 | Ga0070688_1000743932 | 203 |
| 472 | 3300005367 | Ga0070667_100235235 | Ga0070667_1002352351 | 203 |
| 473 | 3300005367 | Ga0070667_100550328 | Ga0070667_1005503281 | 203 |
| 474 | 3300005434 | Ga0070709_10002143 | Ga0070709_100021436 | 203 |
| 475 | 3300005435 | Ga0070714_100039343 | Ga0070714_1000393434 | 203 |
| 476 | 3300005435 | Ga0070714_100158596 | Ga0070714_1001585962 | 203 |
| 477 | 3300005436 | Ga0070713_100072454 | Ga0070713_1000724542 | 203 |
| 478 | 3300005436 | Ga0070713_100079742 | Ga0070713_1000797422 | 203 |
| 479 | 3300005436 | Ga0070713_100133978 | Ga0070713_1001339782 | 203 |
| 480 | 3300005436 | Ga0070713_100329922 | Ga0070713_1003299221 | 203 |
| 481 | 3300005437 | Ga0070710_10061500 | Ga0070710_100615002 | 203 |
| 482 | 3300005439 | Ga0070711_100009594 | Ga0070711_1000095942 | 203 |
| 483 | 3300005439 | Ga0070711_100013807 | Ga0070711_1000138073 | 203 |
| 484 | 3300005440 | Ga0070705_100260842 | Ga0070705_1002608422 | 203 |
| 485 | 3300005455 | Ga0070663_100005116 | Ga0070663_1000051166 | 203 |
| 486 | 3300005455 | Ga0070663_100011980 | Ga0070663_1000119803 | 203 |
| 487 | 3300005455 | Ga0070663_100065337 | Ga0070663_1000653373 | 203 |
| 488 | 3300005455 | Ga0070663_100100609 | Ga0070663_1001006091 | 203 |
| 489 | 3300005455 | Ga0070663_100359676 | Ga0070663_1003596761 | 203 |
| 490 | 3300005455 | Ga0070663_100392510 | Ga0070663_1003925102 | 203 |
| 491 | 3300005455 | Ga0070663_100734552 | Ga0070663_1007345521 | 203 |
| 492 | 3300005456 | Ga0070678_100062747 | Ga0070678_1000627472 | 203 |
| 493 | 3300005456 | Ga0070678_100235325 | Ga0070678_1002353252 | 203 |
| 494 | 3300005456 | Ga0070678_100289109 | Ga0070678_1002891092 | 203 |
| 495 | 3300005457 | Ga0070662_100065597 | Ga0070662_1000655971 | 203 |
| 496 | 3300005457 | Ga0070662_100145189 | Ga0070662_1001451891 | 203 |
| 497 | 3300005458 | Ga0070681_10054107 | Ga0070681_100541074 | 203 |
| 498 | 3300005458 | Ga0070681_10159140 | Ga0070681_101591402 | 203 |
| 499 | 3300005459 | Ga0068867_100047009 | Ga0068867_1000470093 | 203 |
| 500 | 3300005459 | Ga0068867_100148110 | Ga0068867_1001481102 | 203 |
| 501 | 3300005471 | Ga0070698_100026181 | Ga0070698_1000261811 | 203 |
| 502 | 3300005518 | Ga0070699_100468596 | Ga0070699_1004685962 | 203 |
| 503 | 3300005530 | Ga0070679_100041981 | Ga0070679_1000419812 | 203 |
| 504 | 3300005530 | Ga0070679_100097758 | Ga0070679_1000977582 | 203 |
| 505 | 3300005535 | Ga0070684_100019513 | Ga0070684_1000195133 | 203 |
| 506 | 3300005535 | Ga0070684_100051309 | Ga0070684_1000513093 | 203 |
| 507 | 3300005535 | Ga0070684_100105307 | Ga0070684_1001053073 | 203 |
| 508 | 3300005539 | Ga0068853_100233155 | Ga0068853_1002331552 | 203 |
| 509 | 3300005539 | Ga0068853_100269387 | Ga0068853_1002693872 | 203 |
| 510 | 3300005539 | Ga0068853_100278145 | Ga0068853_1002781452 | 203 |
| 511 | 3300005539 | Ga0068853_100380218 | Ga0068853_1003802182 | 203 |
| 512 | 3300005539 | Ga0068853_100405323 | Ga0068853_1004053232 | 203 |
| 513 | 3300005543 | Ga0070672_100032454 | Ga0070672_1000324543 | 203 |
| 514 | 3300005543 | Ga0070672_100193361 | Ga0070672_1001933612 | 203 |
| 515 | 3300005547 | Ga0070693_100338802 | Ga0070693_1003388022 | 203 |
| 516 | 3300005548 | Ga0070665_100049667 | Ga0070665_1000496673 | 203 |
| 517 | 3300005548 | Ga0070665_100073653 | Ga0070665_1000736533 | 203 |
| 518 | 3300005548 | Ga0070665_100075172 | Ga0070665_1000751722 | 203 |
| 519 | 3300005549 | Ga0070704_100039644 | Ga0070704_1000396442 | 203 |
| 520 | 3300005563 | Ga0068855_100011091 | Ga0068855_1000110919 | 203 |
| 521 | 3300005563 | Ga0068855_100046970 | Ga0068855_1000469702 | 203 |
| 522 | 3300005563 | Ga0068855_100832987 | Ga0068855_1008329872 | 203 |
| 523 | 3300005563 | Ga0068855_100901861 | Ga0068855_1009018611 | 203 |
| 524 | 3300005564 | Ga0070664_100496340 | Ga0070664_1004963401 | 203 |
| 525 | 3300005577 | Ga0068857_100021122 | Ga0068857_1000211225 | 203 |
| 526 | 3300005578 | Ga0068854_100066050 | Ga0068854_1000660502 | 203 |
| 527 | 3300005578 | Ga0068854_100070200 | Ga0068854_1000702002 | 203 |
| 528 | 3300005614 | Ga0068856_100000091 | Ga0068856_10000009110 | 203 |
| 529 | 3300005614 | Ga0068856_100043323 | Ga0068856_1000433236 | 203 |
| 530 | 3300005614 | Ga0068856_100202648 | Ga0068856_1002026482 | 203 |
| 531 | 3300005614 | Ga0068856_100225707 | Ga0068856_1002257071 | 203 |
| 532 | 3300005614 | Ga0068856_100348348 | Ga0068856_1003483481 | 203 |
| 533 | 3300005615 | Ga0070702_100039568 | Ga0070702_1000395683 | 203 |
| 534 | 3300005616 | Ga0068852_100215150 | Ga0068852_1002151502 | 203 |
| 535 | 3300005616 | Ga0068852_100908109 | Ga0068852_1009081091 | 203 |
| 536 | 3300005617 | Ga0068859_100014165 | Ga0068859_1000141654 | 203 |
| 537 | 3300005617 | Ga0068859_100089670 | Ga0068859_1000896704 | 203 |
| 538 | 3300005617 | Ga0068859_100375335 | Ga0068859_1003753351 | 203 |
| 539 | 3300005617 | Ga0068859_100593503 | Ga0068859_1005935032 | 203 |
| 540 | 3300005618 | Ga0068864_100228267 | Ga0068864_1002282672 | 203 |
| 541 | 3300005618 | Ga0068864_101067572 | Ga0068864_1010675721 | 203 |
| 542 | 3300005718 | Ga0068866_10259068 | Ga0068866_102590682 | 203 |
| 543 | 3300005719 | Ga0068861_100010097 | Ga0068861_1000100973 | 203 |
| 544 | 3300005719 | Ga0068861_100331473 | Ga0068861_1003314732 | 203 |
| 545 | 3300005834 | Ga0068851_10020652 | Ga0068851_100206522 | 203 |
| 546 | 3300005834 | Ga0068851_10165377 | Ga0068851_101653772 | 203 |
| 547 | 3300005840 | Ga0068870_10014005 | Ga0068870_100140054 | 203 |
| 548 | 3300005840 | Ga0068870_10431464 | Ga0068870_104314642 | 203 |
| 549 | 3300005841 | Ga0068863_100499699 | Ga0068863_1004996991 | 203 |
| 550 | 3300005842 | Ga0068858_100207127 | Ga0068858_1002071272 | 203 |
| 551 | 3300005843 | Ga0068860_100229138 | Ga0068860_1002291382 | 203 |
| 552 | 3300005844 | Ga0068862_100193040 | Ga0068862_1001930402 | 203 |
| 553 | 3300005844 | Ga0068862_100599328 | Ga0068862_1005993282 | 203 |
| 554 | 3300005937 | Ga0081455_10048845 | Ga0081455_100488452 | 203 |
| 555 | 3300005981 | Ga0081538_10018190 | Ga0081538_100181904 | 203 |
| 556 | 3300005983 | Ga0081540_1003177 | Ga0081540_10031771 | 203 |
| 557 | 3300005983 | Ga0081540_1035251 | Ga0081540_10352513 | 203 |
| 558 | 3300005983 | Ga0081540_1045180 | Ga0081540_10451803 | 203 |
| 559 | 3300005983 | Ga0081540_1062702 | Ga0081540_10627022 | 203 |
| 560 | 3300005983 | Ga0081540_1067617 | Ga0081540_10676171 | 203 |
| 561 | 3300005985 | Ga0081539_10017368 | Ga0081539_100173682 | 203 |
| 562 | 3300006028 | Ga0070717_10040796 | Ga0070717_100407962 | 203 |
| 563 | 3300006028 | Ga0070717_10151157 | Ga0070717_101511572 | 203 |
| 564 | 3300006038 | Ga0075365_10023148 | Ga0075365_100231483 | 203 |
| 565 | 3300006038 | Ga0075365_10094148 | Ga0075365_100941482 | 203 |
| 566 | 3300006038 | Ga0075365_10125194 | Ga0075365_101251942 | 203 |
| 567 | 3300006042 | Ga0075368_10023074 | Ga0075368_100230742 | 203 |
| 568 | 3300006042 | Ga0075368_10123748 | Ga0075368_101237482 | 203 |
| 569 | 3300006048 | Ga0075363_100011292 | Ga0075363_1000112925 | 203 |
| 570 | 3300006051 | Ga0075364_10120161 | Ga0075364_101201612 | 203 |
| 571 | 3300006173 | Ga0070716_100094586 | Ga0070716_1000945862 | 203 |
| 572 | 3300006175 | Ga0070712_100008170 | Ga0070712_1000081703 | 203 |
| 573 | 3300006175 | Ga0070712_100045139 | Ga0070712_1000451392 | 203 |
| 574 | 3300006175 | Ga0070712_100147746 | Ga0070712_1001477462 | 203 |
| 575 | 3300006177 | Ga0075362_10036149 | Ga0075362_100361492 | 203 |
| 576 | 3300006178 | Ga0075367_10026486 | Ga0075367_100264861 | 203 |
| 577 | 3300006178 | Ga0075367_10046559 | Ga0075367_100465592 | 203 |
| 578 | 3300006178 | Ga0075367_10138714 | Ga0075367_101387141 | 203 |
| 579 | 3300006178 | Ga0075367_10151449 | Ga0075367_101514492 | 203 |
| 580 | 3300006178 | Ga0075367_10446652 | Ga0075367_104466522 | 203 |
| 581 | 3300006186 | Ga0075369_10029760 | Ga0075369_100297602 | 203 |
| 582 | 3300006186 | Ga0075369_10211141 | Ga0075369_102111411 | 203 |
| 583 | 3300006195 | Ga0075366_10056721 | Ga0075366_100567215 | 203 |
| 584 | 3300006195 | Ga0075366_10077813 | Ga0075366_100778132 | 203 |
| 585 | 3300006195 | Ga0075366_10090033 | Ga0075366_100900332 | 203 |
| 586 | 3300006353 | Ga0075370_10028858 | Ga0075370_100288586 | 203 |
| 587 | 3300006353 | Ga0075370_10108112 | Ga0075370_101081122 | 203 |
| 588 | 3300006353 | Ga0075370_10193921 | Ga0075370_101939211 | 203 |
| 589 | 3300006353 | Ga0075370_10263366 | Ga0075370_102633661 | 203 |
| 590 | 3300006353 | Ga0075370_10488411 | Ga0075370_104884111 | 203 |
| 591 | 3300006358 | Ga0068871_100065219 | Ga0068871_1000652192 | 203 |
| 592 | 3300006844 | Ga0075428_100352923 | Ga0075428_1003529232 | 203 |
| 593 | 3300006844 | Ga0075428_100388241 | Ga0075428_1003882412 | 203 |
| 594 | 3300006852 | Ga0075433_10112872 | Ga0075433_101128722 | 203 |
| 595 | 3300006871 | Ga0075434_100197637 | Ga0075434_1001976372 | 203 |
| 596 | 3300006871 | Ga0075434_100234838 | Ga0075434_1002348382 | 203 |
| 597 | 3300006881 | Ga0068865_100091839 | Ga0068865_1000918392 | 203 |
| 598 | 3300006881 | Ga0068865_100622352 | Ga0068865_1006223522 | 203 |
| 599 | 3300006931 | Ga0097620_100014164 | Ga0097620_1000141644 | 203 |
| 600 | 3300006931 | Ga0097620_100089668 | Ga0097620_1000896684 | 203 |
| 601 | 3300006931 | Ga0097620_100375337 | Ga0097620_1003753371 | 203 |
| 602 | 3300006931 | Ga0097620_100593500 | Ga0097620_1005935002 | 203 |
| 603 | 3300006942 | Ga0099824_1003225 | Ga0099824_10032253 | 203 |
| 604 | 3300006942 | Ga0099824_1015288 | Ga0099824_10152885 | 203 |
| 605 | 3300006943 | Ga0099822_1025589 | Ga0099822_10255893 | 203 |
| 606 | 3300007265 | Ga0099794_10004324 | Ga0099794_100043245 | 203 |
| 607 | 3300009093 | Ga0105240_10006270 | Ga0105240_100062703 | 203 |
| 608 | 3300009093 | Ga0105240_10399540 | Ga0105240_103995401 | 203 |
| 609 | 3300009093 | Ga0105240_10530153 | Ga0105240_105301532 | 203 |
| 610 | 3300009094 | Ga0111539_10039518 | Ga0111539_100395182 | 203 |
| 611 | 3300009094 | Ga0111539_10663285 | Ga0111539_106632851 | 203 |
| 612 | 3300009098 | Ga0105245_10119877 | Ga0105245_101198772 | 203 |
| 613 | 3300009098 | Ga0105245_10580408 | Ga0105245_105804082 | 203 |
| 614 | 3300009098 | Ga0105245_11179746 | Ga0105245_111797462 | 203 |
| 615 | 3300009101 | Ga0105247_10060832 | Ga0105247_100608322 | 203 |
| 616 | 3300009101 | Ga0105247_10485961 | Ga0105247_104859611 | 203 |
| 617 | 3300009147 | Ga0114129_10045838 | Ga0114129_100458381 | 203 |
| 618 | 3300009147 | Ga0114129_11738208 | Ga0114129_117382081 | 203 |
| 619 | 3300009148 | Ga0105243_10085596 | Ga0105243_100855962 | 203 |
| 620 | 3300009148 | Ga0105243_10289824 | Ga0105243_102898241 | 203 |
| 621 | 3300009174 | Ga0105241_10020501 | Ga0105241_100205015 | 203 |
| 622 | 3300009174 | Ga0105241_10039006 | Ga0105241_100390062 | 203 |
| 623 | 3300009174 | Ga0105241_10061907 | Ga0105241_100619073 | 203 |
| 624 | 3300009176 | Ga0105242_10121787 | Ga0105242_101217873 | 203 |
| 625 | 3300009176 | Ga0105242_10713070 | Ga0105242_107130701 | 203 |
| 626 | 3300009177 | Ga0105248_10070301 | Ga0105248_100703013 | 203 |
| 627 | 3300009177 | Ga0105248_10269930 | Ga0105248_102699302 | 203 |
| 628 | 3300009177 | Ga0105248_10985866 | Ga0105248_109858662 | 203 |
| 629 | 3300009545 | Ga0105237_10001391 | Ga0105237_1000139114 | 203 |
| 630 | 3300009545 | Ga0105237_10003041 | Ga0105237_1000304110 | 203 |
| 631 | 3300009545 | Ga0105237_10055891 | Ga0105237_100558913 | 203 |
| 632 | 3300009545 | Ga0105237_10436943 | Ga0105237_104369432 | 203 |
| 633 | 3300009551 | Ga0105238_10007433 | Ga0105238_100074332 | 203 |
| 634 | 3300009551 | Ga0105238_10101444 | Ga0105238_101014443 | 203 |
| 635 | 3300009551 | Ga0105238_10224266 | Ga0105238_102242662 | 203 |
| 636 | 3300009553 | Ga0105249_10151912 | Ga0105249_101519122 | 203 |
| 637 | 3300009553 | Ga0105249_10857413 | Ga0105249_108574132 | 203 |
| 638 | 3300010159 | Ga0099796_10026232 | Ga0099796_100262322 | 203 |
| 639 | 3300010375 | Ga0105239_10005113 | Ga0105239_100051134 | 203 |
| 640 | 3300010375 | Ga0105239_10008417 | Ga0105239_100084173 | 203 |
| 641 | 3300010375 | Ga0105239_10564610 | Ga0105239_105646102 | 203 |
| 642 | 3300011119 | Ga0105246_10011638 | Ga0105246_100116382 | 203 |
| 643 | 3300011119 | Ga0105246_10205378 | Ga0105246_102053782 | 203 |
| 644 | 3300013104 | Ga0157370_10060883 | Ga0157370_100608832 | 203 |
| 645 | 3300013104 | Ga0157370_11316179 | Ga0157370_113161791 | 203 |
| 646 | 3300013105 | Ga0157369_10003636 | Ga0157369_100036365 | 203 |
| 647 | 3300013105 | Ga0157369_10007202 | Ga0157369_100072025 | 203 |
| 648 | 3300013296 | Ga0157374_10046894 | Ga0157374_100468943 | 203 |
| 649 | 3300013296 | Ga0157374_10141279 | Ga0157374_101412792 | 203 |
| 650 | 3300013296 | Ga0157374_10453594 | Ga0157374_104535941 | 203 |
| 651 | 3300013297 | Ga0157378_10099257 | Ga0157378_100992573 | 203 |
| 652 | 3300013297 | Ga0157378_10172702 | Ga0157378_101727022 | 203 |
| 653 | 3300013297 | Ga0157378_10280939 | Ga0157378_102809392 | 203 |
| 654 | 3300013297 | Ga0157378_10474105 | Ga0157378_104741052 | 203 |
| 655 | 3300013297 | Ga0157378_11141698 | Ga0157378_111416981 | 203 |
| 656 | 3300013306 | Ga0163162_10079922 | Ga0163162_100799222 | 203 |
| 657 | 3300013306 | Ga0163162_10102084 | Ga0163162_101020841 | 203 |
| 658 | 3300013306 | Ga0163162_10145155 | Ga0163162_101451552 | 203 |
| 659 | 3300013306 | Ga0163162_10234207 | Ga0163162_102342072 | 203 |
| 660 | 3300013306 | Ga0163162_10299735 | Ga0163162_102997352 | 203 |
| 661 | 3300013307 | Ga0157372_11107729 | Ga0157372_111077292 | 203 |
| 662 | 3300013308 | Ga0157375_10028075 | Ga0157375_100280751 | 203 |
| 663 | 3300013308 | Ga0157375_10640633 | Ga0157375_106406332 | 203 |
| 664 | 3300014325 | Ga0163163_10048811 | Ga0163163_100488113 | 203 |
| 665 | 3300014325 | Ga0163163_10752537 | Ga0163163_107525371 | 203 |
| 666 | 3300014325 | Ga0163163_11043038 | Ga0163163_110430381 | 203 |
| 667 | 3300014326 | Ga0157380_10052903 | Ga0157380_100529032 | 203 |
| 668 | 3300014326 | Ga0157380_10531269 | Ga0157380_105312692 | 203 |
| 669 | 3300014968 | Ga0157379_10854091 | Ga0157379_108540911 | 203 |
| 670 | 3300014968 | Ga0157379_10946769 | Ga0157379_109467691 | 203 |
| 671 | 3300014969 | Ga0157376_10083196 | Ga0157376_100831963 | 203 |
| 672 | 3300014969 | Ga0157376_10106270 | Ga0157376_101062702 | 203 |
| 673 | 3300014969 | Ga0157376_10414208 | Ga0157376_104142082 | 203 |
| 674 | 3300014969 | Ga0157376_11607915 | Ga0157376_116079151 | 203 |
| 675 | 3300017792 | Ga0163161_10166568 | Ga0163161_101665682 | 203 |
| 676 | 3300017792 | Ga0163161_10190471 | Ga0163161_101904712 | 203 |
| 677 | 3300017792 | Ga0163161_10820547 | Ga0163161_108205471 | 203 |
| 678 | 3300020082 | Ga0206353_10094903 | Ga0206353_100949032 | 203 |
| 679 | 3300021320 | Ga0214544_1000026 | Ga0214544_100002676 | 203 |
| 680 | 3300021320 | Ga0214544_1027092 | Ga0214544_10270922 | 203 |
| 681 | 3300021321 | Ga0214542_1000025 | Ga0214542_100002585 | 203 |
| 682 | 3300021321 | Ga0214542_1031522 | Ga0214542_10315222 | 203 |
| 683 | 3300021324 | Ga0214545_1000014 | Ga0214545_100001493 | 203 |
| 684 | 3300021327 | Ga0214543_1000034 | Ga0214543_100003484 | 203 |
| 685 | 3300021388 | Ga0213875_10020469 | Ga0213875_100204692 | 203 |
| 686 | 3300025245 | Ga0207425_1020389 | Ga0207425_10203892 | 203 |
| 687 | 3300025254 | Ga0209148_1000250 | Ga0209148_100025027 | 203 |
| 688 | 3300025261 | Ga0209233_1002562 | Ga0209233_10025623 | 203 |
| 689 | 3300025261 | Ga0209233_1004484 | Ga0209233_10044843 | 203 |
| 690 | 3300025261 | Ga0209233_1007321 | Ga0209233_10073212 | 203 |
| 691 | 3300025272 | Ga0209455_1001255 | Ga0209455_10012552 | 203 |
| 692 | 3300025295 | Ga0209564_1003732 | Ga0209564_10037327 | 203 |
| 693 | 3300025297 | Ga0209758_1000141 | Ga0209758_100014189 | 203 |
| 694 | 3300025297 | Ga0209758_1000324 | Ga0209758_100032473 | 203 |
| 695 | 3300025297 | Ga0209758_1000476 | Ga0209758_100047646 | 203 |
| 696 | 3300025297 | Ga0209758_1001151 | Ga0209758_100115116 | 203 |
| 697 | 3300025297 | Ga0209758_1037257 | Ga0209758_10372572 | 203 |
| 698 | 3300025299 | Ga0209256_1023807 | Ga0209256_10238072 | 203 |
| 699 | 3300025299 | Ga0209256_1044938 | Ga0209256_10449381 | 203 |
| 700 | 3300025302 | Ga0207426_1000523 | Ga0207426_100052310 | 203 |
| 701 | 3300025302 | Ga0207426_1000768 | Ga0207426_100076811 | 203 |
| 702 | 3300025302 | Ga0207426_1002739 | Ga0207426_10027392 | 203 |
| 703 | 3300025302 | Ga0207426_1095774 | Ga0207426_10957741 | 203 |
| 704 | 3300025304 | Ga0209257_1001317 | Ga0209257_10013173 | 203 |
| 705 | 3300025315 | Ga0207697_10142440 | Ga0207697_101424401 | 203 |
| 706 | 3300025315 | Ga0207697_10219247 | Ga0207697_102192471 | 203 |
| 707 | 3300025321 | Ga0207656_10051297 | Ga0207656_100512972 | 203 |
| 708 | 3300025711 | Ga0207696_1041155 | Ga0207696_10411552 | 203 |
| 709 | 3300025885 | Ga0207653_10038609 | Ga0207653_100386091 | 203 |
| 710 | 3300025898 | Ga0207692_10115659 | Ga0207692_101156592 | 203 |
| 711 | 3300025898 | Ga0207692_10123617 | Ga0207692_101236172 | 203 |
| 712 | 3300025899 | Ga0207642_10023275 | Ga0207642_100232752 | 203 |
| 713 | 3300025900 | Ga0207710_10043781 | Ga0207710_100437812 | 203 |
| 714 | 3300025901 | Ga0207688_10017927 | Ga0207688_100179272 | 203 |
| 715 | 3300025901 | Ga0207688_10119736 | Ga0207688_101197362 | 203 |
| 716 | 3300025901 | Ga0207688_10147702 | Ga0207688_101477021 | 203 |
| 717 | 3300025901 | Ga0207688_10201535 | Ga0207688_102015352 | 203 |
| 718 | 3300025903 | Ga0207680_10022446 | Ga0207680_100224463 | 203 |
| 719 | 3300025903 | Ga0207680_10065256 | Ga0207680_100652562 | 203 |
| 720 | 3300025904 | Ga0207647_10075009 | Ga0207647_100750091 | 203 |
| 721 | 3300025904 | Ga0207647_10165006 | Ga0207647_101650062 | 203 |
| 722 | 3300025904 | Ga0207647_10258870 | Ga0207647_102588702 | 203 |
| 723 | 3300025904 | Ga0207647_10359981 | Ga0207647_103599811 | 203 |
| 724 | 3300025906 | Ga0207699_10226048 | Ga0207699_102260482 | 203 |
| 725 | 3300025907 | Ga0207645_10014665 | Ga0207645_100146652 | 203 |
| 726 | 3300025907 | Ga0207645_10301602 | Ga0207645_103016021 | 203 |
| 727 | 3300025908 | Ga0207643_10399467 | Ga0207643_103994671 | 203 |
| 728 | 3300025910 | Ga0207684_10184562 | Ga0207684_101845622 | 203 |
| 729 | 3300025910 | Ga0207684_10448655 | Ga0207684_104486551 | 203 |
| 730 | 3300025911 | Ga0207654_10016235 | Ga0207654_100162353 | 203 |
| 731 | 3300025912 | Ga0207707_10008329 | Ga0207707_100083297 | 203 |
| 732 | 3300025912 | Ga0207707_10244387 | Ga0207707_102443872 | 203 |
| 733 | 3300025912 | Ga0207707_10345815 | Ga0207707_103458152 | 203 |
| 734 | 3300025913 | Ga0207695_10000062 | Ga0207695_10000062205 | 203 |
| 735 | 3300025913 | Ga0207695_10073392 | Ga0207695_100733923 | 203 |
| 736 | 3300025913 | Ga0207695_10415388 | Ga0207695_104153882 | 203 |
| 737 | 3300025913 | Ga0207695_10525286 | Ga0207695_105252861 | 203 |
| 738 | 3300025914 | Ga0207671_10001205 | Ga0207671_1000120512 | 203 |
| 739 | 3300025914 | Ga0207671_10007037 | Ga0207671_100070373 | 203 |
| 740 | 3300025914 | Ga0207671_10196302 | Ga0207671_101963022 | 203 |
| 741 | 3300025914 | Ga0207671_10321425 | Ga0207671_103214252 | 203 |
| 742 | 3300025914 | Ga0207671_10367156 | Ga0207671_103671562 | 203 |
| 743 | 3300025914 | Ga0207671_10710762 | Ga0207671_107107622 | 203 |
| 744 | 3300025915 | Ga0207693_10004791 | Ga0207693_100047912 | 203 |
| 745 | 3300025915 | Ga0207693_10024069 | Ga0207693_100240693 | 203 |
| 746 | 3300025915 | Ga0207693_10506875 | Ga0207693_105068751 | 203 |
| 747 | 3300025916 | Ga0207663_10037455 | Ga0207663_100374552 | 203 |
| 748 | 3300025916 | Ga0207663_10063692 | Ga0207663_100636922 | 203 |
| 749 | 3300025916 | Ga0207663_10870846 | Ga0207663_108708461 | 203 |
| 750 | 3300025917 | Ga0207660_10001063 | Ga0207660_100010637 | 203 |
| 751 | 3300025917 | Ga0207660_10079957 | Ga0207660_100799573 | 203 |
| 752 | 3300025918 | Ga0207662_10243912 | Ga0207662_102439122 | 203 |
| 753 | 3300025919 | Ga0207657_10001360 | Ga0207657_1000136022 | 203 |
| 754 | 3300025919 | Ga0207657_10072567 | Ga0207657_100725672 | 203 |
| 755 | 3300025919 | Ga0207657_10240445 | Ga0207657_102404452 | 203 |
| 756 | 3300025919 | Ga0207657_10426039 | Ga0207657_104260391 | 203 |
| 757 | 3300025920 | Ga0207649_10511938 | Ga0207649_105119381 | 203 |
| 758 | 3300025921 | Ga0207652_10003881 | Ga0207652_100038813 | 203 |
| 759 | 3300025921 | Ga0207652_10017473 | Ga0207652_100174733 | 203 |
| 760 | 3300025922 | Ga0207646_10145117 | Ga0207646_101451174 | 203 |
| 761 | 3300025923 | Ga0207681_10493530 | Ga0207681_104935302 | 203 |
| 762 | 3300025923 | Ga0207681_10785618 | Ga0207681_107856182 | 203 |
| 763 | 3300025924 | Ga0207694_10226680 | Ga0207694_102266802 | 203 |
| 764 | 3300025925 | Ga0207650_10354975 | Ga0207650_103549751 | 203 |
| 765 | 3300025925 | Ga0207650_10473682 | Ga0207650_104736821 | 203 |
| 766 | 3300025927 | Ga0207687_10033271 | Ga0207687_100332712 | 203 |
| 767 | 3300025927 | Ga0207687_10493296 | Ga0207687_104932961 | 203 |
| 768 | 3300025928 | Ga0207700_10002104 | Ga0207700_100021042 | 203 |
| 769 | 3300025928 | Ga0207700_10058030 | Ga0207700_100580303 | 203 |
| 770 | 3300025928 | Ga0207700_10190364 | Ga0207700_101903642 | 203 |
| 771 | 3300025928 | Ga0207700_10324779 | Ga0207700_103247792 | 203 |
| 772 | 3300025929 | Ga0207664_10196138 | Ga0207664_101961382 | 203 |
| 773 | 3300025931 | Ga0207644_10160166 | Ga0207644_101601661 | 203 |
| 774 | 3300025931 | Ga0207644_10441707 | Ga0207644_104417072 | 203 |
| 775 | 3300025931 | Ga0207644_10742255 | Ga0207644_107422551 | 203 |
| 776 | 3300025932 | Ga0207690_10229716 | Ga0207690_102297162 | 203 |
| 777 | 3300025932 | Ga0207690_10727933 | Ga0207690_107279331 | 203 |
| 778 | 3300025933 | Ga0207706_10041999 | Ga0207706_100419992 | 203 |
| 779 | 3300025933 | Ga0207706_10141635 | Ga0207706_101416352 | 203 |
| 780 | 3300025934 | Ga0207686_10214684 | Ga0207686_102146842 | 203 |
| 781 | 3300025935 | Ga0207709_10004831 | Ga0207709_100048314 | 203 |
| 782 | 3300025935 | Ga0207709_10391658 | Ga0207709_103916582 | 203 |
| 783 | 3300025935 | Ga0207709_10477191 | Ga0207709_104771912 | 203 |
| 784 | 3300025935 | Ga0207709_10640623 | Ga0207709_106406232 | 203 |
| 785 | 3300025936 | Ga0207670_10256795 | Ga0207670_102567952 | 203 |
| 786 | 3300025937 | Ga0207669_10167590 | Ga0207669_101675902 | 203 |
| 787 | 3300025937 | Ga0207669_10560614 | Ga0207669_105606142 | 203 |
| 788 | 3300025938 | Ga0207704_10205689 | Ga0207704_102056892 | 203 |
| 789 | 3300025939 | Ga0207665_10123034 | Ga0207665_101230342 | 203 |
| 790 | 3300025939 | Ga0207665_10381652 | Ga0207665_103816522 | 203 |
| 791 | 3300025939 | Ga0207665_10518702 | Ga0207665_105187021 | 203 |
| 792 | 3300025940 | Ga0207691_10045318 | Ga0207691_100453183 | 203 |
| 793 | 3300025940 | Ga0207691_10492720 | Ga0207691_104927202 | 203 |
| 794 | 3300025941 | Ga0207711_10045167 | Ga0207711_100451673 | 203 |
| 795 | 3300025941 | Ga0207711_11187115 | Ga0207711_111871151 | 203 |
| 796 | 3300025942 | Ga0207689_10066424 | Ga0207689_100664242 | 203 |
| 797 | 3300025944 | Ga0207661_10000337 | Ga0207661_1000033724 | 203 |
| 798 | 3300025944 | Ga0207661_10996896 | Ga0207661_109968961 | 203 |
| 799 | 3300025945 | Ga0207679_10215161 | Ga0207679_102151612 | 203 |
| 800 | 3300025945 | Ga0207679_10618509 | Ga0207679_106185091 | 203 |
| 801 | 3300025949 | Ga0207667_10003256 | Ga0207667_1000325612 | 203 |
| 802 | 3300025949 | Ga0207667_10140872 | Ga0207667_101408722 | 203 |
| 803 | 3300025949 | Ga0207667_10232460 | Ga0207667_102324602 | 203 |
| 804 | 3300025949 | Ga0207667_10278654 | Ga0207667_102786541 | 203 |
| 805 | 3300025949 | Ga0207667_11036650 | Ga0207667_110366501 | 203 |
| 806 | 3300025961 | Ga0207712_10345263 | Ga0207712_103452632 | 203 |
| 807 | 3300025961 | Ga0207712_10531696 | Ga0207712_105316962 | 203 |
| 808 | 3300025961 | Ga0207712_10591811 | Ga0207712_105918111 | 203 |
| 809 | 3300025972 | Ga0207668_10135455 | Ga0207668_101354552 | 203 |
| 810 | 3300025972 | Ga0207668_10312606 | Ga0207668_103126062 | 203 |
| 811 | 3300025981 | Ga0207640_10063155 | Ga0207640_100631552 | 203 |
| 812 | 3300025981 | Ga0207640_10071663 | Ga0207640_100716632 | 203 |
| 813 | 3300025981 | Ga0207640_10143796 | Ga0207640_101437962 | 203 |
| 814 | 3300025986 | Ga0207658_10272065 | Ga0207658_102720652 | 203 |
| 815 | 3300025986 | Ga0207658_10297594 | Ga0207658_102975942 | 203 |
| 816 | 3300025986 | Ga0207658_10411315 | Ga0207658_104113152 | 203 |
| 817 | 3300026023 | Ga0207677_10237545 | Ga0207677_102375452 | 203 |
| 818 | 3300026023 | Ga0207677_10353441 | Ga0207677_103534411 | 203 |
| 819 | 3300026035 | Ga0207703_10088904 | Ga0207703_100889043 | 203 |
| 820 | 3300026035 | Ga0207703_10182019 | Ga0207703_101820192 | 203 |
| 821 | 3300026035 | Ga0207703_10302211 | Ga0207703_103022112 | 203 |
| 822 | 3300026035 | Ga0207703_10345310 | Ga0207703_103453102 | 203 |
| 823 | 3300026035 | Ga0207703_10446631 | Ga0207703_104466311 | 203 |
| 824 | 3300026035 | Ga0207703_10625757 | Ga0207703_106257571 | 203 |
| 825 | 3300026041 | Ga0207639_10025935 | Ga0207639_100259354 | 203 |
| 826 | 3300026041 | Ga0207639_10085798 | Ga0207639_100857982 | 203 |
| 827 | 3300026041 | Ga0207639_10114439 | Ga0207639_101144392 | 203 |
| 828 | 3300026041 | Ga0207639_10263388 | Ga0207639_102633882 | 203 |
| 829 | 3300026041 | Ga0207639_10291337 | Ga0207639_102913372 | 203 |
| 830 | 3300026041 | Ga0207639_10390719 | Ga0207639_103907192 | 203 |
| 831 | 3300026041 | Ga0207639_10842190 | Ga0207639_108421902 | 203 |
| 832 | 3300026041 | Ga0207639_10895630 | Ga0207639_108956301 | 203 |
| 833 | 3300026067 | Ga0207678_10010382 | Ga0207678_1001038210 | 203 |
| 834 | 3300026067 | Ga0207678_10066135 | Ga0207678_100661352 | 203 |
| 835 | 3300026067 | Ga0207678_10074427 | Ga0207678_100744272 | 203 |
| 836 | 3300026067 | Ga0207678_10104740 | Ga0207678_101047402 | 203 |
| 837 | 3300026067 | Ga0207678_10155438 | Ga0207678_101554382 | 203 |
| 838 | 3300026067 | Ga0207678_10214880 | Ga0207678_102148802 | 203 |
| 839 | 3300026067 | Ga0207678_10414327 | Ga0207678_104143272 | 203 |
| 840 | 3300026075 | Ga0207708_10150662 | Ga0207708_101506622 | 203 |
| 841 | 3300026075 | Ga0207708_10901275 | Ga0207708_109012752 | 203 |
| 842 | 3300026078 | Ga0207702_10000041 | Ga0207702_1000004124 | 203 |
| 843 | 3300026078 | Ga0207702_10038734 | Ga0207702_100387345 | 203 |
| 844 | 3300026078 | Ga0207702_10144995 | Ga0207702_101449952 | 203 |
| 845 | 3300026078 | Ga0207702_10195323 | Ga0207702_101953231 | 203 |
| 846 | 3300026078 | Ga0207702_10250553 | Ga0207702_102505531 | 203 |
| 847 | 3300026078 | Ga0207702_10588059 | Ga0207702_105880592 | 203 |
| 848 | 3300026078 | Ga0207702_10691826 | Ga0207702_106918261 | 203 |
| 849 | 3300026089 | Ga0207648_10041877 | Ga0207648_100418774 | 203 |
| 850 | 3300026095 | Ga0207676_10537052 | Ga0207676_105370522 | 203 |
| 851 | 3300026095 | Ga0207676_11086806 | Ga0207676_110868061 | 203 |
| 852 | 3300026116 | Ga0207674_10020311 | Ga0207674_100203113 | 203 |
| 853 | 3300026116 | Ga0207674_10029226 | Ga0207674_100292265 | 203 |
| 854 | 3300026116 | Ga0207674_10074961 | Ga0207674_100749612 | 203 |
| 855 | 3300026118 | Ga0207675_100039999 | Ga0207675_1000399993 | 203 |
| 856 | 3300026118 | Ga0207675_100123217 | Ga0207675_1001232172 | 203 |
| 857 | 3300026118 | Ga0207675_100328919 | Ga0207675_1003289192 | 203 |
| 858 | 3300026118 | Ga0207675_100367634 | Ga0207675_1003676342 | 203 |
| 859 | 3300026121 | Ga0207683_10033939 | Ga0207683_100339392 | 203 |
| 860 | 3300026121 | Ga0207683_10135303 | Ga0207683_101353032 | 203 |
| 861 | 3300026121 | Ga0207683_10232036 | Ga0207683_102320361 | 203 |
| 862 | 3300026121 | Ga0207683_10236025 | Ga0207683_102360251 | 203 |
| 863 | 3300026121 | Ga0207683_10398674 | Ga0207683_103986742 | 203 |
| 864 | 3300026142 | Ga0207698_10479265 | Ga0207698_104792652 | 203 |
| 865 | 3300027296 | Ga0209389_1000004 | Ga0209389_100000465 | 203 |
| 866 | 3300027296 | Ga0209389_1000023 | Ga0209389_100002359 | 203 |
| 867 | 3300027357 | Ga0209589_1000006 | Ga0209589_1000006328 | 203 |
| 868 | 3300027357 | Ga0209589_1000010 | Ga0209589_1000010100 | 203 |
| 869 | 3300027361 | Ga0209489_100007 | Ga0209489_100007328 | 203 |
| 870 | 3300027361 | Ga0209489_100011 | Ga0209489_100011136 | 203 |
| 871 | 3300027361 | Ga0209489_100295 | Ga0209489_10029564 | 203 |
| 872 | 3300027363 | Ga0209700_100008 | Ga0209700_100008328 | 203 |
| 873 | 3300027363 | Ga0209700_100013 | Ga0209700_100013151 | 203 |
| 874 | 3300027671 | Ga0209588_1001349 | Ga0209588_10013491 | 203 |
| 875 | 3300027671 | Ga0209588_1058263 | Ga0209588_10582632 | 203 |
| 876 | 3300028379 | Ga0268266_10035607 | Ga0268266_100356074 | 203 |
| 877 | 3300028379 | Ga0268266_10191046 | Ga0268266_101910462 | 203 |
| 878 | 3300028379 | Ga0268266_10197166 | Ga0268266_101971661 | 203 |
| 879 | 3300028380 | Ga0268265_10066596 | Ga0268265_100665962 | 203 |
| 880 | 3300028380 | Ga0268265_10397830 | Ga0268265_103978302 | 203 |
| 881 | 3300028380 | Ga0268265_11213566 | Ga0268265_112135661 | 203 |
| 882 | 3300028381 | Ga0268264_10098887 | Ga0268264_100988872 | 203 |
| 883 | 3300028381 | Ga0268264_10456807 | Ga0268264_104568071 | 203 |
| 884 | 3300028786 | Ga0307517_10000085 | Ga0307517_1000008556 | 203 |
| 885 | 3300028786 | Ga0307517_10108504 | Ga0307517_101085042 | 203 |
| 886 | 3300028794 | Ga0307515_10022248 | Ga0307515_100222484 | 203 |
| 887 | 3300031235 | Ga0265330_10019495 | Ga0265330_100194953 | 203 |
| 888 | 3300031238 | Ga0265332_10098022 | Ga0265332_100980222 | 203 |
| 889 | 3300031241 | Ga0265325_10003289 | Ga0265325_1000328910 | 203 |
| 890 | 3300031247 | Ga0265340_10071688 | Ga0265340_100716882 | 203 |
| 891 | 3300031344 | Ga0265316_10015335 | Ga0265316_100153352 | 203 |
| 892 | 3300031456 | Ga0307513_10058631 | Ga0307513_100586311 | 203 |
| 893 | 3300031548 | Ga0307408_100745257 | Ga0307408_1007452572 | 203 |
| 894 | 3300031595 | Ga0265313_10132253 | Ga0265313_101322532 | 203 |
| 895 | 3300031711 | Ga0265314_10004541 | Ga0265314_100045419 | 203 |
| 896 | 3300031711 | Ga0265314_10141877 | Ga0265314_101418771 | 203 |
| 897 | 3300031712 | Ga0265342_10184532 | Ga0265342_101845322 | 203 |
| 898 | 3300031730 | Ga0307516_10195889 | Ga0307516_101958892 | 203 |
| 899 | 3300031824 | Ga0307413_10159836 | Ga0307413_101598362 | 203 |
| 900 | 3300031824 | Ga0307413_10224888 | Ga0307413_102248881 | 203 |
| 901 | 3300031889 | Ga0326468_10010087 | Ga0326468_100100871 | 203 |
| 902 | 3300031901 | Ga0307406_10137638 | Ga0307406_101376382 | 203 |
| 903 | 3300031903 | Ga0307407_10602398 | Ga0307407_106023981 | 203 |
| 904 | 3300031995 | Ga0307409_100404725 | Ga0307409_1004047252 | 203 |
| 905 | 3300032002 | Ga0307416_100134078 | Ga0307416_1001340781 | 203 |
| 906 | 3300032004 | Ga0307414_10651802 | Ga0307414_106518021 | 203 |
| 907 | 3300032004 | Ga0307414_11070450 | Ga0307414_110704502 | 203 |
| 908 | 3300032005 | Ga0307411_10112784 | Ga0307411_101127842 | 203 |
| 909 | 3300032005 | Ga0307411_11001541 | Ga0307411_110015411 | 203 |
| 910 | 3300032126 | Ga0307415_100330992 | Ga0307415_1003309922 | 203 |
| 911 | 3300032126 | Ga0307415_100359851 | Ga0307415_1003598512 | 203 |
| 912 | 3300032126 | Ga0307415_100394413 | Ga0307415_1003944131 | 203 |
| 913 | 3300033180 | Ga0307510_10006173 | Ga0307510_100061739 | 203 |
| 914 | 3300033180 | Ga0307510_10007269 | Ga0307510_100072692 | 203 |
| 915 | 3300033180 | Ga0307510_10089756 | Ga0307510_100897561 | 203 |
| 916 | 3300033180 | Ga0307510_10168832 | Ga0307510_101688322 | 203 |
| 917 | 3300033180 | Ga0307510_10392312 | Ga0307510_103923121 | 203 |
| 918 | 3300033442 | Ga0315911_1000010 | Ga0315911_1000010214 | 203 |
| 919 | 3300034957 | Ga0373938_0054753 | Ga0373938_0054753_93_704 | 203 |
| 920 | 3300035085 | Ga0373929_0015474 | Ga0373929_0015474_704_1315 | 203 |
| 921 | 3300035086 | Ga0373934_0014490 | Ga0373934_0014490_2186_2797 | 203 |
| 922 | 3300035111 | Ga0373923_0047683 | Ga0373923_0047683_395_1006 | 203 |
| 923 | 3300035113 | Ga0373936_0029079 | Ga0373936_0029079_67_678 | 203 |
| 924 | 3300035117 | Ga0373953_0005417 | Ga0373953_0005417_924_1535 | 203 |
| 925 | 3300035117 | Ga0373953_0161298 | Ga0373953_0161298_338_949 | 203 |
| 926 | 3300035118 | Ga0373954_0000761 | Ga0373954_0000761_2944_3555 | 203 |
| 927 | 3300035119 | Ga0373956_0048232 | Ga0373956_0048232_925_1536 | 203 |
| 928 | 3300035120 | Ga0373957_0001113 | Ga0373957_0001113_5718_6329 | 203 |
| 929 | 3300035172 | Ga0373955_0008271 | Ga0373955_0008271_413_1024 | 203 |
| 930 | 3300035691 | Ga0373931_0009812 | Ga0373931_0009812_526_1137 | 203 |
| 931 | 3300035695 | Ga0373927_0022902 | Ga0373927_0022902_2837_3460 | 203 |
| 932 | 3300035695 | Ga0373927_0178619 | Ga0373927_0178619_182_802 | 203 |
| 933 | 3300035724 | Ga0373933_0017996 | Ga0373933_0017996_3027_3638 | 203 |
| 934 | 3300035725 | Ga0373947_0054943 | Ga0373947_0054943_476_1099 | 203 |
| 935 | 3300036401 | Ga0373937_0128172 | Ga0373937_0128172_1328_1939 | 203 |
| 936 | 3300036459 | Ga0372808_021957 | Ga0372808_021957_45_656 | 203 |
| 937 | 3300037068 | Ga0373925_0056168 | Ga0373925_0056168_33_644 | 203 |
| 938 | 3300037418 | Ga0395900_0020421 | Ga0395900_0020421_1369_1983 | 203 |
| 939 | 3300037418 | Ga0395900_0266450 | Ga0395900_0266450_616_1239 | 203 |
| 940 | 3300037418 | Ga0395900_0339366 | Ga0395900_0339366_392_1003 | 203 |
| 941 | 3300037466 | Ga0395898_0232191 | Ga0395898_0232191_939_1550 | 203 |
| 942 | 3300037471 | Ga0395905_0002934 | Ga0395905_0002934_1685_2311 | 203 |
| 943 | 3300037471 | Ga0395905_0207330 | Ga0395905_0207330_483_1226 | 203 |
| 944 | 3300037471 | Ga0395905_0715356 | Ga0395905_0715356_218_829 | 203 |
| 945 | 3300038443 | Ga0395901_0091456 | Ga0395901_0091456_1021_1632 | 203 |
| 946 | 3300038443 | Ga0395901_0144865 | Ga0395901_0144865_256_867 | 203 |
| 947 | 3300038443 | Ga0395901_0200322 | Ga0395901_0200322_17_760 | 203 |
| 948 | 3300038443 | Ga0395901_0575906 | Ga0395901_0575906_233_859 | 203 |
| 949 | 3300039437 | Ga0436365_0182621 | Ga0436365_0182621_734_1345 | 203 |
| 950 | 3300039437 | Ga0436365_0299844 | Ga0436365_0299844_55_666 | 203 |
| 951 | 3300039437 | Ga0436365_0486541 | Ga0436365_0486541_2943_3572 | 203 |
| 952 | 3300039437 | Ga0436365_0605759 | Ga0436365_0605759_1528_2142 | 203 |
| 953 | 3300039450 | Ga0436363_0029976 | Ga0436363_0029976_254_883 | 203 |
| 954 | 3300041451 | Ga0451791_1847493 | Ga0451791_1847493_500_1153 | 203 |
| 955 | 3300041452 | Ga0451793_1054860 | Ga0451793_1054860_266_877 | 203 |
| 956 | 3300041491 | Ga0451833_1207251 | Ga0451833_1207251_80_691 | 203 |
| 957 | 3300041492 | Ga0451835_0964677 | Ga0451835_0964677_240_851 | 203 |
| 958 | 3300041498 | Ga0451841_0596662 | Ga0451841_0596662_150_761 | 203 |
| 959 | 3300042012 | Ga0439455_0024870 | Ga0439455_0024870_223_834 | 203 |
| 960 | 3300044656 | Ga0466969_0003503 | Ga0466969_0003503_1529_2140 | 203 |
| 961 | 3300044684 | Ga0466966_0000952 | Ga0466966_0000952_2851_3462 | 203 |
| 962 | 3300044693 | Ga0466961_0000737 | Ga0466961_0000737_18612_19223 | 203 |
| 963 | 3300044693 | Ga0466961_0295031 | Ga0466961_0295031_256_867 | 203 |
| 964 | 3300044719 | Ga0466971_0246732 | Ga0466971_0246732_133_747 | 203 |
| 965 | 3300045049 | Ga0466959_0028388 | Ga0466959_0028388_2611_3225 | 203 |
| 966 | 3300045049 | Ga0466959_0047575 | Ga0466959_0047575_412_1023 | 203 |
| 967 | 3300045836 | Ga0466958_0454706 | Ga0466958_0454706_172_786 | 203 |
| 968 | 3300045976 | Ga0466967_0015901 | Ga0466967_0015901_176_787 | 203 |
| 969 | 3300046452 | Ga0495617_020436 | Ga0495617_020436_1056_1667 | 203 |
| 970 | 3300046452 | Ga0495617_025717 | Ga0495617_025717_398_1009 | 203 |
| 971 | 3300046453 | Ga0495627_022541 | Ga0495627_022541_805_1416 | 203 |
| 972 | 3300046454 | Ga0495592_0019398 | Ga0495592_0019398_2406_3017 | 203 |
| 973 | 3300046454 | Ga0495592_0321425 | Ga0495592_0321425_222_842 | 203 |
| 974 | 3300046455 | Ga0495603_0156343 | Ga0495603_0156343_287_898 | 203 |
| 975 | 3300046457 | Ga0495590_0027742 | Ga0495590_0027742_76_687 | 203 |
| 976 | 3300046459 | Ga0495629_0062401 | Ga0495629_0062401_68_688 | 203 |
| 977 | 3300046459 | Ga0495629_0238698 | Ga0495629_0238698_505_1116 | 203 |
| 978 | 3300046460 | Ga0495638_0003540 | Ga0495638_0003540_6261_6872 | 203 |
| 979 | 3300046462 | Ga0495651_0025900 | Ga0495651_0025900_3890_4501 | 203 |
| 980 | 3300046462 | Ga0495651_0104445 | Ga0495651_0104445_37_648 | 203 |
| 981 | 3300046462 | Ga0495651_0119914 | Ga0495651_0119914_472_1092 | 203 |
| 982 | 3300046463 | Ga0495653_0004690 | Ga0495653_0004690_2056_2667 | 203 |
| 983 | 3300046472 | Ga0495580_0048262 | Ga0495580_0048262_2088_2711 | 203 |
| 984 | 3300046472 | Ga0495580_0359919 | Ga0495580_0359919_350_961 | 203 |
| 985 | 3300046477 | Ga0495664_0514785 | Ga0495664_0514785_44_655 | 203 |
| 986 | 3300046491 | Ga0495584_0076422 | Ga0495584_0076422_685_1296 | 203 |
| 987 | 3300046492 | Ga0495585_0017623 | Ga0495585_0017623_2541_3152 | 203 |
| 988 | 3300046499 | Ga0495594_0016398 | Ga0495594_0016398_1423_2034 | 203 |
| 989 | 3300046499 | Ga0495594_0088498 | Ga0495594_0088498_1011_1631 | 203 |
| 990 | 3300046499 | Ga0495594_0491454 | Ga0495594_0491454_40_651 | 203 |
| 991 | 3300046501 | Ga0495607_0191310 | Ga0495607_0191310_24_635 | 203 |
| 992 | 3300046506 | Ga0495583_0056740 | Ga0495583_0056740_389_1009 | 203 |
| 993 | 3300046507 | Ga0495606_0024349 | Ga0495606_0024349_3346_3966 | 203 |
| 994 | 3300046511 | Ga0495608_0001839 | Ga0495608_0001839_8912_9523 | 203 |
| 995 | 3300046512 | Ga0495610_0166524 | Ga0495610_0166524_212_823 | 203 |
| 996 | 3300046513 | Ga0495616_0100475 | Ga0495616_0100475_553_1164 | 203 |
| 997 | 3300046514 | Ga0495618_0113479 | Ga0495618_0113479_122_733 | 203 |
| 998 | 3300046516 | Ga0495628_0028229 | Ga0495628_0028229_3248_3859 | 203 |
| 999 | 3300046517 | Ga0495630_0175168 | Ga0495630_0175168_422_1033 | 203 |
| 1000 | 3300046519 | Ga0495632_0153582 | Ga0495632_0153582_430_1041 | 203 |
| 1001 | 3300046522 | Ga0495643_0026574 | Ga0495643_0026574_561_1172 | 203 |
| 1002 | 3300046523 | Ga0495644_0025964 | Ga0495644_0025964_1016_1627 | 203 |
| 1003 | 3300046524 | Ga0495648_0158805 | Ga0495648_0158805_116_736 | 203 |
| 1004 | 3300046529 | Ga0495652_0193615 | Ga0495652_0193615_203_814 | 203 |
| 1005 | 3300046529 | Ga0495652_0222807 | Ga0495652_0222807_760_1380 | 203 |
| 1006 | 3300046530 | Ga0495654_0270048 | Ga0495654_0270048_32_643 | 203 |
| 1007 | 3300046533 | Ga0495640_0011654 | Ga0495640_0011654_1496_2107 | 203 |
| 1008 | 3300046537 | Ga0495598_0021060 | Ga0495598_0021060_273_884 | 203 |
| 1009 | 3300046539 | Ga0495621_0015707 | Ga0495621_0015707_985_1596 | 203 |
| 1010 | 3300046543 | Ga0495645_0009481 | Ga0495645_0009481_2935_3549 | 203 |
| 1011 | 3300046543 | Ga0495645_0017734 | Ga0495645_0017734_354_965 | 203 |
| 1012 | 3300046557 | Ga0495622_0055185 | Ga0495622_0055185_468_1079 | 203 |
| 1013 | 3300046558 | Ga0495633_0071338 | Ga0495633_0071338_580_1191 | 203 |
| 1014 | 3300046615 | Ga0495656_0001457 | Ga0495656_0001457_1506_2117 | 203 |
| 1015 | 3300046615 | Ga0495656_0016098 | Ga0495656_0016098_147_758 | 203 |
| 1016 | 3300046615 | Ga0495656_0079876 | Ga0495656_0079876_197_808 | 203 |
| 1017 | 3300046616 | Ga0495668_0178692 | Ga0495668_0178692_44_655 | 203 |
| 1018 | 3300046616 | Ga0495668_0534132 | Ga0495668_0534132_15_626 | 203 |
| 1019 | 3300046642 | Ga0495634_0015562 | Ga0495634_0015562_2121_2732 | 203 |
| 1020 | 3300046642 | Ga0495634_0110179 | Ga0495634_0110179_410_1021 | 203 |
| 1021 | 3300046648 | Ga0495611_0358414 | Ga0495611_0358414_11_622 | 203 |
| 1022 | 3300046663 | Ga0495635_0009056 | Ga0495635_0009056_2856_3467 | 203 |
| 1023 | 3300046663 | Ga0495635_0013629 | Ga0495635_0013629_472_1092 | 203 |
| 1024 | 3300046664 | Ga0495659_0037332 | Ga0495659_0037332_354_965 | 203 |
| 1025 | 3300046664 | Ga0495659_0132521 | Ga0495659_0132521_79_699 | 203 |
| 1026 | 3300046665 | Ga0495661_0196480 | Ga0495661_0196480_348_959 | 203 |
| 1027 | 3300046674 | Ga0495588_0002625 | Ga0495588_0002625_1823_2434 | 203 |
| 1028 | 3300046674 | Ga0495588_0035958 | Ga0495588_0035958_1859_2470 | 203 |
| 1029 | 3300046675 | Ga0495657_0001190 | Ga0495657_0001190_16195_16815 | 203 |
| 1030 | 3300046675 | Ga0495657_0296704 | Ga0495657_0296704_23_634 | 203 |
| 1031 | 3300046678 | Ga0495599_0208627 | Ga0495599_0208627_331_942 | 203 |
| 1032 | 3300046679 | Ga0495623_0053830 | Ga0495623_0053830_1005_1616 | 203 |
| 1033 | 3300046680 | Ga0495646_0035486 | Ga0495646_0035486_166_777 | 203 |
| 1034 | 3300046684 | Ga0495669_0038625 | Ga0495669_0038625_342_953 | 203 |
| 1035 | 3300046689 | Ga0495613_0004933 | Ga0495613_0004933_9247_9867 | 203 |
| 1036 | 3300046689 | Ga0495613_0278177 | Ga0495613_0278177_456_1079 | 203 |
| 1037 | 3300046690 | Ga0495624_0043034 | Ga0495624_0043034_2252_2872 | 203 |
| 1038 | 3300046690 | Ga0495624_0146414 | Ga0495624_0146414_328_939 | 203 |
| 1039 | 3300046690 | Ga0495624_0411718 | Ga0495624_0411718_138_761 | 203 |
| 1040 | 3300046691 | Ga0495670_0108571 | Ga0495670_0108571_38_649 | 203 |
| 1041 | 3300046692 | Ga0495671_0261100 | Ga0495671_0261100_177_788 | 203 |
| 1042 | 3300046694 | Ga0495649_0013503 | Ga0495649_0013503_3211_3831 | 203 |
| 1043 | 3300046809 | Ga0495600_0125078 | Ga0495600_0125078_1041_1661 | 203 |
| 1044 | 3300046810 | Ga0495660_0129615 | Ga0495660_0129615_335_946 | 203 |
| 1045 | 3300047315 | Ga0495581_0182847 | Ga0495581_0182847_42_662 | 203 |
| 1046 | 3300047317 | Ga0495604_0040533 | Ga0495604_0040533_445_1065 | 203 |
| 1047 | 3300047317 | Ga0495604_0178776 | Ga0495604_0178776_331_942 | 203 |
| 1048 | 3300047317 | Ga0495604_0185446 | Ga0495604_0185446_490_1101 | 203 |
| 1049 | 3300047318 | Ga0495636_0016540 | Ga0495636_0016540_59_679 | 203 |
| 1050 | 3300047318 | Ga0495636_0045819 | Ga0495636_0045819_1133_1744 | 203 |
| 1051 | 3300047319 | Ga0495674_0114385 | Ga0495674_0114385_175_786 | 203 |
| 1052 | 3300047319 | Ga0495674_0133798 | Ga0495674_0133798_483_1094 | 203 |
| 1053 | 3300047321 | Ga0495676_0095206 | Ga0495676_0095206_1558_2178 | 203 |
| 1054 | 3300047323 | Ga0495683_0146386 | Ga0495683_0146386_442_1053 | 203 |
| 1055 | 3300047443 | Ga0495687_028429 | Ga0495687_028429_1809_2420 | 203 |
| 1056 | 3300047447 | Ga0495685_071778 | Ga0495685_071778_408_1019 | 203 |
| 1057 | 3300047469 | Ga0495673_0048293 | Ga0495673_0048293_296_907 | 203 |
| 1058 | 3300047469 | Ga0495673_0064322 | Ga0495673_0064322_421_1032 | 203 |
| 1059 | 3300047471 | Ga0495684_0012073 | Ga0495684_0012073_2806_3417 | 203 |
| 1060 | 3300047471 | Ga0495684_0129746 | Ga0495684_0129746_1249_1869 | 203 |
| 1061 | 3300047472 | Ga0495686_0219641 | Ga0495686_0219641_62_673 | 203 |
| 1062 | 3300047472 | Ga0495686_0266130 | Ga0495686_0266130_219_830 | 203 |
| 1063 | 3300047673 | Ga0495593_0006291 | Ga0495593_0006291_2117_2728 | 203 |
| 1064 | 3300047673 | Ga0495593_0062689 | Ga0495593_0062689_391_1011 | 203 |
| 1065 | 3300048088 | Ga0495602_0108924 | Ga0495602_0108924_544_1155 | 203 |
| 1066 | 3300048088 | Ga0495602_0183488 | Ga0495602_0183488_965_1585 | 203 |
| 1067 | 3300048903 | Ga0496100_0029828 | Ga0496100_0029828_2201_2821 | 203 |
| 1068 | 3300048903 | Ga0496100_0034063 | Ga0496100_0034063_915_1526 | 203 |
| 1069 | 3300048903 | Ga0496100_0177080 | Ga0496100_0177080_809_1420 | 203 |
| 1070 | 3300048904 | Ga0496101_0013278 | Ga0496101_0013278_1260_1880 | 203 |
| 1071 | 3300048905 | Ga0496102_0005792 | Ga0496102_0005792_7350_7970 | 203 |
| 1072 | 3300048905 | Ga0496102_0037882 | Ga0496102_0037882_48_659 | 203 |
| 1073 | 3300048905 | Ga0496102_0066081 | Ga0496102_0066081_2657_3268 | 203 |
| 1074 | 3300048905 | Ga0496102_0909752 | Ga0496102_0909752_133_753 | 203 |
| 1075 | 3300048906 | Ga0496103_0064463 | Ga0496103_0064463_1591_2202 | 203 |
| 1076 | 3300048906 | Ga0496103_0089519 | Ga0496103_0089519_280_900 | 203 |
| 1077 | 3300048906 | Ga0496103_0195361 | Ga0496103_0195361_233_844 | 203 |
| 1078 | 3300048907 | Ga0496104_0003629 | Ga0496104_0003629_2780_3391 | 203 |
| 1079 | 3300048907 | Ga0496104_0009841 | Ga0496104_0009841_61_681 | 203 |
| 1080 | 3300048908 | Ga0496105_0000532 | Ga0496105_0000532_18192_18812 | 203 |
| 1081 | 3300048908 | Ga0496105_0017523 | Ga0496105_0017523_3120_3731 | 203 |
| 1082 | 3300048908 | Ga0496105_0040985 | Ga0496105_0040985_2279_2899 | 203 |
| 1083 | 3300048908 | Ga0496105_0065362 | Ga0496105_0065362_1074_1685 | 203 |
| 1084 | 3300048908 | Ga0496105_0215109 | Ga0496105_0215109_54_665 | 203 |
| 1085 | 3300048908 | Ga0496105_0272564 | Ga0496105_0272564_696_1307 | 203 |
| 1086 | 3300048908 | Ga0496105_0947768 | Ga0496105_0947768_21_632 | 203 |
| 1087 | 3300048909 | Ga0496106_0004534 | Ga0496106_0004534_2859_3470 | 203 |
| 1088 | 3300048909 | Ga0496106_0021741 | Ga0496106_0021741_3238_3858 | 203 |
| 1089 | 3300048909 | Ga0496106_0090447 | Ga0496106_0090447_918_1529 | 203 |
| 1090 | 3300048910 | Ga0496107_0004981 | Ga0496107_0004981_621_1232 | 203 |
| 1091 | 3300048910 | Ga0496107_0021095 | Ga0496107_0021095_47_658 | 203 |
| 1092 | 3300048911 | Ga0496108_0031661 | Ga0496108_0031661_1232_1852 | 203 |
| 1093 | 3300048911 | Ga0496108_0037694 | Ga0496108_0037694_2798_3409 | 203 |
| 1094 | 3300048912 | Ga0496109_0043823 | Ga0496109_0043823_2721_3341 | 203 |
| 1095 | 3300048912 | Ga0496109_0051626 | Ga0496109_0051626_607_1218 | 203 |
| 1096 | 3300048912 | Ga0496109_0094810 | Ga0496109_0094810_2117_2728 | 203 |
| 1097 | 3300048912 | Ga0496109_0131481 | Ga0496109_0131481_82_693 | 203 |
| 1098 | 3300048913 | Ga0496110_0017079 | Ga0496110_0017079_2710_3321 | 203 |
| 1099 | 3300048913 | Ga0496110_0067797 | Ga0496110_0067797_1888_2499 | 203 |
| 1100 | 3300048913 | Ga0496110_0112123 | Ga0496110_0112123_555_1166 | 203 |
| 1101 | 3300048914 | Ga0496111_0019062 | Ga0496111_0019062_3574_4194 | 203 |
| 1102 | 3300048914 | Ga0496111_0097002 | Ga0496111_0097002_1179_1790 | 203 |
| 1103 | 3300048914 | Ga0496111_0328711 | Ga0496111_0328711_509_1120 | 203 |
| 1104 | 3300048915 | Ga0496112_0022085 | Ga0496112_0022085_1401_2012 | 203 |
| 1105 | 3300048915 | Ga0496112_0038861 | Ga0496112_0038861_2642_3253 | 203 |
| 1106 | 3300048915 | Ga0496112_0088235 | Ga0496112_0088235_2290_2910 | 203 |
| 1107 | 3300048915 | Ga0496112_0096797 | Ga0496112_0096797_1565_2176 | 203 |
| 1108 | 3300048915 | Ga0496112_0109369 | Ga0496112_0109369_369_980 | 203 |
| 1109 | 3300048916 | Ga0496113_0004246 | Ga0496113_0004246_1274_1885 | 203 |
| 1110 | 3300048916 | Ga0496113_0479279 | Ga0496113_0479279_374_985 | 203 |
| 1111 | 3300048917 | Ga0496114_0042370 | Ga0496114_0042370_1888_2499 | 203 |
| 1112 | 3300048917 | Ga0496114_0052696 | Ga0496114_0052696_164_775 | 203 |
| 1113 | 3300048917 | Ga0496114_0104830 | Ga0496114_0104830_1032_1652 | 203 |
| 1114 | 3300048918 | Ga0496115_0002752 | Ga0496115_0002752_10904_11524 | 203 |
| 1115 | 3300048918 | Ga0496115_0003734 | Ga0496115_0003734_3445_4056 | 203 |
| 1116 | 3300048918 | Ga0496115_0049284 | Ga0496115_0049284_875_1489 | 203 |
| 1117 | 3300048918 | Ga0496115_0230125 | Ga0496115_0230125_48_668 | 203 |
| 1118 | 3300048918 | Ga0496115_0276600 | Ga0496115_0276600_655_1293 | 203 |
| 1119 | 3300048918 | Ga0496115_0440419 | Ga0496115_0440419_421_1032 | 203 |
| 1120 | 3300048918 | Ga0496115_0737571 | Ga0496115_0737571_141_752 | 203 |
| 1121 | 3300048920 | Ga0496117_0099484 | Ga0496117_0099484_298_909 | 203 |
| 1122 | 3300048921 | Ga0496118_0067040 | Ga0496118_0067040_128_739 | 203 |
| 1123 | 3300048921 | Ga0496118_0118989 | Ga0496118_0118989_73_684 | 203 |
| 1124 | 3300048921 | Ga0496118_0286140 | Ga0496118_0286140_269_889 | 203 |
| 1125 | 3300048922 | Ga0496119_0002440 | Ga0496119_0002440_16786_17406 | 203 |
| 1126 | 3300048922 | Ga0496119_0025596 | Ga0496119_0025596_2946_3557 | 203 |
| 1127 | 3300048924 | Ga0496121_0000379 | Ga0496121_0000379_25715_26326 | 203 |
| 1128 | 3300048924 | Ga0496121_0002853 | Ga0496121_0002853_23565_24176 | 203 |
| 1129 | 3300048924 | Ga0496121_0090597 | Ga0496121_0090597_700_1314 | 203 |
| 1130 | 3300048924 | Ga0496121_0094491 | Ga0496121_0094491_1384_2004 | 203 |
| 1131 | 3300048927 | Ga0496124_0054484 | Ga0496124_0054484_133_744 | 203 |
| 1132 | 3300048928 | Ga0496125_0012802 | Ga0496125_0012802_6628_7239 | 203 |
| 1133 | 3300048928 | Ga0496125_0270909 | Ga0496125_0270909_77_688 | 203 |
| 1134 | 3300048929 | Ga0496126_0036885 | Ga0496126_0036885_3736_4356 | 203 |
| 1135 | 3300048929 | Ga0496126_0099741 | Ga0496126_0099741_780_1391 | 203 |
| 1136 | 3300048929 | Ga0496126_0104128 | Ga0496126_0104128_1613_2236 | 203 |
| 1137 | 3300048929 | Ga0496126_0105816 | Ga0496126_0105816_41_652 | 203 |
| 1138 | 3300048929 | Ga0496126_0245615 | Ga0496126_0245615_744_1355 | 203 |
| 1139 | 3300048929 | Ga0496126_0292368 | Ga0496126_0292368_389_1000 | 203 |
| 1140 | 3300048929 | Ga0496126_0343951 | Ga0496126_0343951_598_1209 | 203 |
| 1141 | 3300048929 | Ga0496126_0570181 | Ga0496126_0570181_40_651 | 203 |
| 1142 | 3300048929 | Ga0496126_0618543 | Ga0496126_0618543_175_786 | 203 |
| 1143 | 3300049460 | Ga0495682_0033493 | Ga0495682_0033493_520_1140 | 203 |
| 1144 | 3300049568 | Ga0501031_0233022 | Ga0501031_0233022_544_1164 | 203 |
| 1145 | 3300049569 | Ga0501032_0000269 | Ga0501032_0000269_27544_28155 | 203 |
| 1146 | 3300049570 | Ga0501033_0000399 | Ga0501033_0000399_5101_5712 | 203 |
| 1147 | 3300049571 | Ga0501034_0000039 | Ga0501034_0000039_11589_12200 | 203 |
| 1148 | 3300049572 | Ga0501036_0004794 | Ga0501036_0004794_5024_5635 | 203 |
| 1149 | 3300049573 | Ga0501037_0000279 | Ga0501037_0000279_4899_5510 | 203 |
| 1150 | 3300049574 | Ga0501038_0000727 | Ga0501038_0000727_14184_14795 | 203 |
| 1151 | 3300049575 | Ga0501039_0007019 | Ga0501039_0007019_2982_3593 | 203 |
| 1152 | 3300049578 | Ga0501042_0262144 | Ga0501042_0262144_146_757 | 203 |
| 1153 | 3300049579 | Ga0501043_0000257 | Ga0501043_0000257_5027_5638 | 203 |
| 1154 | 3300049580 | Ga0501046_0006020 | Ga0501046_0006020_1264_1875 | 203 |
| 1155 | 3300049581 | Ga0501047_0002128 | Ga0501047_0002128_9103_9714 | 203 |
| 1156 | 3300049581 | Ga0501047_0120453 | Ga0501047_0120453_125_736 | 203 |
| 1157 | 3300049581 | Ga0501047_0163016 | Ga0501047_0163016_639_1262 | 203 |
| 1158 | 3300049582 | Ga0501048_0000677 | Ga0501048_0000677_11044_11655 | 203 |
| 1159 | 3300049583 | Ga0501067_0000220 | Ga0501067_0000220_29782_30393 | 203 |
| 1160 | 3300049583 | Ga0501067_0088962 | Ga0501067_0088962_521_1132 | 203 |
| 1161 | 3300049584 | Ga0501068_0006651 | Ga0501068_0006651_2355_2966 | 203 |
| 1162 | 3300049585 | Ga0501069_0020320 | Ga0501069_0020320_2751_3362 | 203 |
| 1163 | 3300049586 | Ga0501070_0022913 | Ga0501070_0022913_2959_3570 | 203 |
| 1164 | 3300049586 | Ga0501070_0925857 | Ga0501070_0925857_47_658 | 203 |
| 1165 | 3300049587 | Ga0501071_0244725 | Ga0501071_0244725_97_708 | 203 |
| 1166 | 3300049588 | Ga0501072_0411408 | Ga0501072_0411408_83_694 | 203 |
| 1167 | 3300049589 | Ga0501073_0000103 | Ga0501073_0000103_52884_53495 | 203 |
| 1168 | 3300049589 | Ga0501073_0825548 | Ga0501073_0825548_18_629 | 203 |
| 1169 | 3300049590 | Ga0501074_0000203 | Ga0501074_0000203_596_1207 | 203 |
| 1170 | 3300049591 | Ga0501075_0539491 | Ga0501075_0539491_239_850 | 203 |
| 1171 | 3300049592 | Ga0501076_0293053 | Ga0501076_0293053_139_759 | 203 |
| 1172 | 3300049741 | Ga0501079_0005568 | Ga0501079_0005568_5060_5671 | 203 |
| 1173 | 3300049742 | Ga0501080_0002271 | Ga0501080_0002271_416_1027 | 203 |
| 1174 | 3300049743 | Ga0501081_0961887 | Ga0501081_0961887_21_632 | 203 |
| 1175 | 3300049744 | Ga0501083_0000213 | Ga0501083_0000213_3087_3698 | 203 |
| 1176 | 3300049822 | Ga0501035_0000523 | Ga0501035_0000523_18331_18942 | 203 |
| 1177 | 3300049823 | Ga0501044_0000435 | Ga0501044_0000435_26461_27072 | 203 |
| 1178 | 3300049823 | Ga0501044_0953539 | Ga0501044_0953539_71_691 | 203 |
| 1179 | 3300050490 | nmdc:mga03n38_150290_c1 | nmdc:mga03n38_150290_c1_43_663 | 203 |
| 1180 | 3300050492 | nmdc:mga0yw44_125079_c1 | nmdc:mga0yw44_125079_c1_500_1111 | 203 |
| 1181 | 3300050492 | nmdc:mga0yw44_5033_c1 | nmdc:mga0yw44_5033_c1_4806_5417 | 203 |
| 1182 | 3300050492 | nmdc:mga0yw44_90894_c1 | nmdc:mga0yw44_90894_c1_784_1395 | 203 |
| 1183 | 3300050494 | nmdc:mga06z11_270267_c1 | nmdc:mga06z11_270267_c1_183_794 | 203 |
| 1184 | 3300050494 | nmdc:mga06z11_41002_c1 | nmdc:mga06z11_41002_c1_1667_2278 | 203 |
| 1185 | 3300050494 | nmdc:mga06z11_527625_c1 | nmdc:mga06z11_527625_c1_11_622 | 203 |
| 1186 | 3300050507 | nmdc:mga05p37_228831_c1 | nmdc:mga05p37_228831_c1_121_732 | 203 |
| 1187 | 3300050508 | nmdc:mga09592_60003_c1 | nmdc:mga09592_60003_c1_155_826 | 203 |
| 1188 | 3300050509 | nmdc:mga0qj67_171885_c1 | nmdc:mga0qj67_171885_c1_85_756 | 203 |
| 1189 | 3300050512 | nmdc:mga0n895_95973_c1 | nmdc:mga0n895_95973_c1_1505_2116 | 203 |
| 1190 | 3300050513 | nmdc:mga0rr50_139437_c1 | nmdc:mga0rr50_139437_c1_1079_1690 | 203 |
| 1191 | 3300050515 | nmdc:mga0a205_61269_c1 | nmdc:mga0a205_61269_c1_1742_2353 | 203 |
| 1192 | 3300053077 | Ga0495601_0084096 | Ga0495601_0084096_138_752 | 203 |
| 1193 | 3300053077 | Ga0495601_0333462 | Ga0495601_0333462_61_672 | 203 |
| 1194 | 3300053078 | Ga0495612_0007098 | Ga0495612_0007098_2083_2697 | 203 |
| 1195 | 3300053078 | Ga0495612_0080707 | Ga0495612_0080707_124_735 | 203 |
| 1196 | 3300053079 | Ga0500610_0305457 | Ga0500610_0305457_46_657 | 203 |
| 1197 | 3300053083 | Ga0495655_0002836 | Ga0495655_0002836_1724_2344 | 203 |
| 1198 | 3300053084 | Ga0495595_0046672 | Ga0495595_0046672_1227_1838 | 203 |
| 1199 | 3300053085 | Ga0495619_0020964 | Ga0495619_0020964_1456_2067 | 203 |
| 1200 | 3300053086 | Ga0500578_0178869 | Ga0500578_0178869_130_750 | 203 |
| 1201 | 3300053087 | Ga0500643_000197 | Ga0500643_000197_17065_17676 | 203 |
| 1202 | 3300053090 | Ga0500646_0080622 | Ga0500646_0080622_225_836 | 203 |
| 1203 | 3300053091 | Ga0500647_0087469 | Ga0500647_0087469_835_1446 | 203 |
| 1204 | 3300053093 | Ga0500651_0028346 | Ga0500651_0028346_2568_3188 | 203 |
| 1205 | 3300053093 | Ga0500651_0248833 | Ga0500651_0248833_338_949 | 203 |
| 1206 | 3300053094 | Ga0500566_0000008 | Ga0500566_0000008_32582_33193 | 203 |
| 1207 | 3300053094 | Ga0500566_0000102 | Ga0500566_0000102_19286_19897 | 203 |
| 1208 | 3300053095 | Ga0500640_000058 | Ga0500640_000058_4657_5268 | 203 |
| 1209 | 3300053096 | Ga0500641_0002877 | Ga0500641_0002877_798_1409 | 203 |
| 1210 | 3300053096 | Ga0500641_0253529 | Ga0500641_0253529_35_646 | 203 |
| 1211 | 3300053104 | Ga0500556_0005792 | Ga0500556_0005792_353_964 | 203 |
| 1212 | 3300053105 | Ga0500557_000029 | Ga0500557_000029_65014_65625 | 203 |
| 1213 | 3300053108 | Ga0500562_004449 | Ga0500562_004449_2630_3241 | 203 |
| 1214 | 3300053109 | Ga0500569_001944 | Ga0500569_001944_3280_3900 | 203 |
| 1215 | 3300053111 | Ga0500572_000050 | Ga0500572_000050_26464_27075 | 203 |
| 1216 | 3300053118 | Ga0500594_0056242 | Ga0500594_0056242_65_676 | 203 |
| 1217 | 3300053119 | Ga0500595_002045 | Ga0500595_002045_1139_1750 | 203 |
| 1218 | 3300053123 | Ga0500614_001235 | Ga0500614_001235_3974_4585 | 203 |
| 1219 | 3300053130 | Ga0500642_0000241 | Ga0500642_0000241_1325_1936 | 203 |
| 1220 | 3300053134 | Ga0500658_0059353 | Ga0500658_0059353_948_1559 | 203 |
| 1221 | 3300053136 | Ga0500559_0012776 | Ga0500559_0012776_836_1447 | 203 |
| 1222 | 3300053136 | Ga0500559_0077370 | Ga0500559_0077370_646_1266 | 203 |
| 1223 | 3300053139 | Ga0500568_0022500 | Ga0500568_0022500_1115_1726 | 203 |
| 1224 | 3300053139 | Ga0500568_0064410 | Ga0500568_0064410_789_1400 | 203 |
| 1225 | 3300053142 | Ga0500577_0020215 | Ga0500577_0020215_363_983 | 203 |
| 1226 | 3300053147 | Ga0500589_053434 | Ga0500589_053434_278_889 | 203 |
| 1227 | 3300053148 | Ga0500590_077746 | Ga0500590_077746_192_803 | 203 |
| 1228 | 3300053150 | Ga0500603_000040 | Ga0500603_000040_17575_18186 | 203 |
| 1229 | 3300053150 | Ga0500603_000999 | Ga0500603_000999_4884_5495 | 203 |
| 1230 | 3300053151 | Ga0500604_0082535 | Ga0500604_0082535_87_698 | 203 |
| 1231 | 3300053154 | Ga0500619_046631 | Ga0500619_046631_273_884 | 203 |
| 1232 | 3300053156 | Ga0500622_0006790 | Ga0500622_0006790_1110_1721 | 203 |
| 1233 | 3300053159 | Ga0500630_002184 | Ga0500630_002184_4242_4853 | 203 |
| 1234 | 3300053162 | Ga0500638_215201 | Ga0500638_215201_136_747 | 203 |
| 1235 | 3300053163 | Ga0500639_000010 | Ga0500639_000010_59294_59905 | 203 |
| 1236 | 3300053177 | Ga0500636_0025748 | Ga0500636_0025748_2376_2987 | 203 |
| 1237 | 3300053177 | Ga0500636_0368282 | Ga0500636_0368282_32_643 | 203 |
| 1238 | 3300053178 | Ga0500637_0002664 | Ga0500637_0002664_2657_3268 | 203 |
| 1239 | 3300053729 | Ga0500625_017306 | Ga0500625_017306_1616_2227 | 203 |
| 1240 | 3300053733 | Ga0500552_012288 | Ga0500552_012288_170_790 | 203 |
| 1241 | 3300053735 | Ga0500596_000151 | Ga0500596_000151_8337_8948 | 203 |
| 1242 | 3300053736 | Ga0500599_004187 | Ga0500599_004187_270_881 | 203 |
| 1243 | 3300053737 | Ga0500601_000123 | Ga0500601_000123_6823_7434 | 203 |
| 1244 | 3300053737 | Ga0500601_006858 | Ga0500601_006858_289_900 | 203 |
| 1245 | 3300060353 | Ga0501082_0029219 | Ga0501082_0029219_3876_4487 | 203 |
| 1246 | 3300060353 | Ga0501082_0186594 | Ga0501082_0186594_1067_1678 | 203 |
| 1247 | 3300061719 | Ga0466962_0029471 | Ga0466962_0029471_1462_2076 | 203 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1rkt-assembly1.cif.gz_B | crystal structure of yfir, a putative transcriptional regulator from bacillus subtilis | 0.7932 | 11 | 192 |
| 6zui-assembly1.cif.gz_A | crystal structure of the cys-ser mutant of the cpyfp-based biosensor for hypochlorous acid | 0.7832 | 12 | 89 |
| 3bti-assembly2.cif.gz_D | crystal structure of qacr(e58q) bound to berberine | 0.7728 | 13 | 171 |
| 5gpa-assembly1.cif.gz_A | structural analysis of fatty acid degradation regulator fadr from bacillus halodurans | 0.7725 | 13 | 179 |
| 2g3b-assembly1.cif.gz_A | crystal structure of putative tetr-family transcriptional regulator from rhodococcus sp. | 0.7691 | 13 | 192 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3whcC01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like | 0.9982 | 13 | 55 | 1.10.10.60 |
| 5gp9B01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like | 0.9942 | 16 | 55 | 1.10.10.60 |
| 3whbA01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like | 0.9942 | 13 | 55 | 1.10.10.60 |
| 5gpaA01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like | 0.9937 | 13 | 55 | 1.10.10.60 |
| 5gpaB01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like | 0.9931 | 16 | 55 | 1.10.10.60 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1Q3KUL1-F1-model_v4 | TetR family transcriptional regulator | 0.952 | 1 | 197 |
GO:0000976
GO:0003700 |
| AF-A0A1Q3KUL1-F1-model_v4 | TetR family transcriptional regulator | 0.9425 | 1 | 197 |
GO:0000976
GO:0003700 |
| AF-A0A5H2YQ45-F1-model_v4 | deleted | 0.9187 | 18 | 203 |
|
| AF-A0A5H2YQ45-F1-model_v4 | deleted | 0.9094 | 18 | 203 |
|
| AF-A0A537MLB6-F1-model_v4 | TetR/AcrR family transcriptional regulator | 0.9039 | 1 | 125 |
GO:0000976
GO:0003700 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar