metagRoot

F492128

General Info

Members	Datasets	Scaffolds	Average Seq Length
1245	638	1107	376

Family's Representative Sequence

Representative Sequence	3300039447\|Ga0436361_0046388\|Ga0436361_0046388_17499_18845
Length	432
Sequence	MGRRVNQDNLRGDADSFLIIRNPPGCEAQQMPLKRSPRDSPQHGNADELKTRSVKVASDFLFTSESVSEGHPQQDPRSRVAAETLCNTGLVVLAGEITTNAHVDYIQVARDTIKRIGYDNTEYGIDYKGCAVLVAYDKQSNDIAQGVDHASDDHLNTGAGDQGLMFGYACDETPELMPAPIYYAHRLVERQAHMRKDGRMPFLRPDAKSQVTMRYVDGKPHSIDTVVLSTQHSPEWSLGEKMKPEFYEAVREDIIKPVLPAAWLTPETKYLINPTGRFVIGGPQGDCGLTGRKIIVDTYGGACPHGGGAFSGKDPTKVDRSAAYAARYVAKNIVAAGLARQCQIQVAYAIGVARPMNVTVYTEGTGVIPDEQIAALVREHFDLRPKGIIQMLDLLRPIYSKTAAYGHFGREEPEFTWERTDKAAALRAAAGL

Samples

	Sample ID	Description	Type	Environment
1	2510065045	Paraburkholderia sprentiae WSM5005	Isolate	Nodule
2	2511231003	Herbaspirillum sp. CF444	Isolate	Rhizosphere
3	2511231026	Herbaspirillum sp. YR522	Isolate	Rhizosphere
4	2513020051	Variovorax sp. CF313	Isolate	Rhizosphere
5	2515154123	Trinickia symbiotica JPY347	Isolate	Nodule
6	2521172590	Herbaspirillum sp. GW103	Isolate	Rhizosphere
7	2526164512	Azovibrio restrictus DSM 23866	Isolate	Unclassified
8	2547132103	Chromobacterium sp. C-61	Isolate	Rhizosphere
9	2547132374	Acidovorax radicis N35	Isolate	Unclassified
10	2547132512	Azospira oryzae 6a3	Isolate	Unclassified
11	2548876994	Herbaspirillum lusitanum P6-12	Isolate	Nodule
12	2551306416	Herbaspirillum seropedicae Os34	Isolate	Unclassified
13	2585428057	Methylibium sp. YR605	Isolate	Rhizosphere
14	2585428058	Methylibium sp. CF468	Isolate	Rhizosphere
15	2585428062	Methylibium sp. CF059	Isolate	Rhizosphere
16	2588253510	Rhizobacter sp. OV335	Isolate	Rhizosphere
17	2596583598	Ralstonia sp. UNCCL144	Isolate	Unclassified
18	2599185178	Ralstonia sp. NFACC01	Isolate	Rhizoplane
19	2599185214	Variovorax sp. NFACC26	Isolate	Rhizoplane
20	2599185226	Variovorax sp. NFACC27	Isolate	Rhizoplane
21	2599185227	Variovorax sp. NFACC28	Isolate	Rhizoplane
22	2599185229	Variovorax sp. NFACC29	Isolate	Endosphere
23	2599185292	Achromobacter sp. NFACC18-2	Isolate	Rhizoplane
24	2643221544	Pelomonas sp. Root1444	Isolate	Unclassified
25	2643221569	Achromobacter sp. Root565	Isolate	Unclassified
26	2643221570	Acidovorax sp. Root568	Isolate	Unclassified
27	2643221585	Pelomonas sp. Root662	Isolate	Unclassified
28	2643221592	Rhizobacter sp. Root16D2	Isolate	Unclassified
29	2643221594	Achromobacter sp. Root170	Isolate	Unclassified
30	2643221596	Acidovorax sp. Root70	Isolate	Unclassified
31	2643221603	Noviherbaspirillum sp. Root189	Isolate	Unclassified
32	2643221609	Acidovorax sp. Root217	Isolate	Unclassified
33	2643221611	Acidovorax sp. Root219	Isolate	Unclassified
34	2643221621	Achromobacter sp. Root83	Isolate	Unclassified
35	2643221625	Rhizobacter sp. Root29	Isolate	Unclassified
36	2643221628	Variovorax sp. Root318D1	Isolate	Unclassified
37	2643221639	Pelomonas sp. Root1217	Isolate	Unclassified
38	2643221644	Rhizobacter sp. Root1221	Isolate	Unclassified
39	2643221646	Pelomonas sp. Root1237	Isolate	Unclassified
40	2643221648	Rhizobacter sp. Root1238	Isolate	Unclassified
41	2643221652	Acidovorax sp. Root402	Isolate	Unclassified
42	2643221654	Rhizobacter sp. Root404	Isolate	Unclassified
43	2643221656	Pelomonas sp. Root405	Isolate	Unclassified
44	2643221658	Variovorax sp. Root411	Isolate	Unclassified
45	2643221660	Methylibium sp. Root1272	Isolate	Unclassified
46	2643221672	Variovorax sp. Root434	Isolate	Unclassified
47	2643221683	Variovorax sp. Root473	Isolate	Unclassified
48	2643221717	Acidovorax sp. Root267	Isolate	Unclassified
49	2721755523	Delftia sp. HK171	Isolate	Unclassified
50	2721755763	Pandoraea thiooxydans ATSB16	Isolate	Rhizosphere
51	2738541277	Variovorax sp. GV051	Isolate	Unclassified
52	2738541307	Variovorax sp. GV008	Isolate	Unclassified
53	2738541337	Pelomonas sp. BT06	Isolate	Unclassified
54	2738543012	Acidovorax sp. CF301	Isolate	Unclassified
55	2738543013	Variovorax sp. BT01	Isolate	Unclassified
56	2738543019	Variovorax sp. GV040	Isolate	Unclassified
57	2739367655	Pusillimonas sp. YR330	Isolate	Unclassified
58	2765235838	Herbaspirillum robiniae AA6	Isolate	Unclassified
59	2808606384	Burkholderia sp. SJZ089	Isolate	Rhizosphere
60	2808606386	Herbaspirillum sp. SJZ099	Isolate	Rhizosphere
61	2808606390	Burkholderia sp. SJZ115	Isolate	Rhizosphere
62	2808606391	Burkholderia sp. SJZ091	Isolate	Rhizosphere
63	2808606395	Achromobacter sp. SLBN-14	Isolate	Unclassified
64	2808606415	Herbaspirillum sp. SJZ130	Isolate	Rhizosphere
65	2808606419	Herbaspirillum sp. SJZ106	Isolate	Rhizosphere
66	2816332133	Acidovorax radicis 2721A	Isolate	Unclassified
67	2818991436	Collimonas arenae 515	Isolate	Unclassified
68	2818991445	Herbaspirillum hiltneri 3195	Isolate	Unclassified
69	2818991446	Variovorax sp. 1180	Isolate	Unclassified
70	2818991449	Herbaspirillum huttiense 1147	Isolate	Unclassified
71	2831265667	Variovorax guangxiensis DSM 27352	Isolate	Rhizosphere
72	2838054893	Variovorax guangxiensis 34/80	Isolate	Nodule
73	2839094727	Herbaspirillum robiniae HZ10	Isolate	Nodule
74	2839138175	Delftia acidovorans B15	Isolate	Rhizosphere
75	2842677519	Variovorax sp. R-72495	Isolate	Unclassified
76	2842718218	Acidovorax sp. R-73343	Isolate	Unclassified
77	2842733646	Variovorax sp. R-72446	Isolate	Unclassified
78	2842747753	Variovorax sp. R-72060	Isolate	Unclassified
79	2843690924	Chromobacterium rhizoryzae JP2-74	Isolate	Rhizosphere
80	2846033681	Chromobacterium sinusclupearum MWU13-2610	Isolate	Rhizosphere
81	2846037992	Chromobacterium alticapitis MWU14-2602	Isolate	Rhizosphere
82	2852618963	Herbaspirillum sp. SJZ102	Isolate	Rhizosphere
83	2855730933	Achromobacter sp. HZ28	Isolate	Nodule
84	2855767633	Achromobacter sp. HZ34	Isolate	Nodule
85	2857537821	Achromobacter sp. R-71975	Isolate	Unclassified
86	2857542790	Achromobacter sp. R-72367	Isolate	Unclassified
87	2857576091	Pigmentiphaga sp. R-72090	Isolate	Unclassified
88	2858950400	Achromobacter sp. K91	Isolate	Unclassified
89	2881412998	Achromobacter aloeverae AVA-1	Isolate	Unclassified
90	2884811622	Herbaspirillum sp. 3C11	Isolate	Unclassified
91	2884836552	Herbaspirillum sp. 3R-11	Isolate	Unclassified
92	2884852848	Herbaspirillum sp. 3R11	Isolate	Unclassified
93	2885192300	Variovorax sp. MHTC-1	Isolate	Rhizosphere
94	2885198086	Variovorax sp. 679	Isolate	Unclassified
95	2885211737	Variovorax sp. 553	Isolate	Unclassified
96	2885266251	Ralstonia sp. SET104	Isolate	Nodule
97	2894023352	Diaphorobacter ruginosibacter DSM 27467	Isolate	Nodule
98	2895511927	Pseudoxanthomonas sp. SGD-5-1	Isolate	Rhizosphere
99	2896154374	Herbaspirillum sp. 3R-3a1	Isolate	Nodule
100	2899924645	Variovorax sp. 369	Isolate	Unclassified
101	2900577576	Ralstonia sp. TCR112	Isolate	Rhizosphere
102	2904439833	Herbaspirillum sp. 1589	Isolate	Rhizosphere
103	2904449895	Variovorax sp. 1763	Isolate	Rhizosphere
104	2904456579	Variovorax sp. 2002	Isolate	Unclassified
105	2904479285	Comamonas sediminis 4487	Isolate	Rhizosphere
106	2904530477	Herbaspirillum huttiense 611	Isolate	Unclassified
107	2904541872	Variovorax sp. 1615	Isolate	Rhizosphere
108	2904584206	Herbaspirillum sp. 1050	Isolate	Unclassified
109	2904589729	Herbaspirillum sp. 1130	Isolate	Unclassified
110	2904601388	Herbaspirillum sp. 1273	Isolate	Rhizosphere
111	2919046199	Herbaspirillum frisingense 596	Isolate	Unclassified
112	2919079590	Herbaspirillum sp. 1173	Isolate	Unclassified
113	2919462493	Variovorax sp. 3319	Isolate	Rhizosphere
114	2919704043	Hydrogenophaga palleronii 4249	Isolate	Unclassified
115	2923510766	Herbaspirillum rubrisubalbicans SLBN-127	Isolate	Rhizosphere
116	2928037797	Variovorax sp. 1126	Isolate	Unclassified
117	2928044640	Variovorax sp. 1128	Isolate	Unclassified
118	2928051484	Variovorax sp. 1133	Isolate	Unclassified
119	2928058823	Ralstonia sp. 1138	Isolate	Unclassified
120	2928064002	Variovorax sp. 1140	Isolate	Rhizosphere
121	2928070936	Variovorax gossypii 1167	Isolate	Unclassified
122	2928084124	Variovorax paradoxus 1218	Isolate	Unclassified
123	2928115317	Pseudacidovorax sp. 1753	Isolate	Rhizosphere
124	2928130867	Herbaspirillum seropedicae 1977	Isolate	Unclassified
125	2929160207	Variovorax sp. R-72349 Hybrid assembly	Isolate	Unclassified
126	2929520902	Variovorax beijingensis 502	Isolate	Unclassified
127	2932422444	Comamonas sp. 4034	Isolate	Rhizosphere
128	2939631187	Ottowia thiooxydans 2709	Isolate	Rhizosphere
129	2941479691
130	2945909444	Variovorax sp. CRF3-Va-1 W1I1	Isolate	Rhizosphere
131	2945945610	Variovorax paradoxus W1I18	Isolate	Rhizosphere
132	2945972063	Variovorax paradoxus W2I8	Isolate	Rhizosphere
133	2945984333	Variovorax sp. W2I14	Isolate	Rhizosphere
134	2954767861	Variovorax sp. TBS-050B	Isolate	Rhizosphere
135	2974320154	Acidovorax wautersii SORGH_AS 335	Isolate	Unclassified
136	2990710928	Acidovorax delafieldii SLBN-75	Isolate	Rhizosphere
137	3300001915	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7	Metagenome	Rhizosphere
138	3300001979	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6	Metagenome	Rhizosphere
139	3300001989	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5	Metagenome	Rhizosphere
140	3300002704	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB	Metagenome	Unclassified
141	3300002705	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS	Metagenome	Unclassified
142	3300002737	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA	Metagenome	Endosphere
143	3300002738	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA	Metagenome	Unclassified
144	3300002741	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL	Metagenome	Unclassified
145	3300002774	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA	Metagenome	Endosphere
146	3300002987	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB	Metagenome	Endosphere
147	3300003187	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB	Metagenome	Endosphere
148	3300003214	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL	Metagenome	Endosphere
149	3300003354	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS	Metagenome	Endosphere
150	3300003374	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF	Metagenome	Endosphere
151	3300003544	Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only)	Metatranscriptome	Rhizosphere
152	3300003574	Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only)	Metatranscriptome	Rhizosphere
153	3300003575	Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only)	Metatranscriptome	Rhizosphere
154	3300003577	Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only)	Metatranscriptome	Rhizosphere
155	3300003578	Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only)	Metatranscriptome	Unclassified
156	3300003693	Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
157	3300003751	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2	Metagenome	Endosphere
158	3300003752	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2	Metagenome	Endosphere
159	3300003756	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2	Metagenome	Endosphere
160	3300003758	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2	Metagenome	Endosphere
161	3300003759	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2	Metagenome	Endosphere
162	3300003761	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2	Metagenome	Endosphere
163	3300003762	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2	Metagenome	Endosphere
164	3300003763	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2	Metagenome	Endosphere
165	3300003771	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2	Metagenome	Endosphere
166	3300003773	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2	Metagenome	Endosphere
167	3300003775	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2	Metagenome	Endosphere
168	3300003781	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2	Metagenome	Endosphere
169	3300003790	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2	Metagenome	Endosphere
170	3300003791	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2	Metagenome	Endosphere
171	3300003792	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2	Metagenome	Endosphere
172	3300003794	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2	Metagenome	Endosphere
173	3300003841	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2	Metagenome	Endosphere
174	3300003856	Agave microbial communities from Guanajuato, Mexico - At.Am.rz	Metagenome	Rhizosphere
175	3300004625	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2	Metagenome	Endosphere
176	3300005289	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2)	Metagenome	Rhizosphere
177	3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Metagenome	Rhizosphere
178	3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Metagenome	Rhizosphere
179	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
180	3300005333	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG	Metagenome	Rhizosphere
181	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
182	3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Metagenome	Rhizosphere
183	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
184	3300005343	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG	Metagenome	Rhizosphere
185	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
186	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
187	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
188	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
189	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
190	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
191	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
192	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
193	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
194	3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Metagenome	Rhizosphere
195	3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Metagenome	Rhizosphere
196	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
197	3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Metagenome	Rhizosphere
198	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
199	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
200	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
201	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
202	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
203	3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Metagenome	Rhizosphere
204	3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Metagenome	Rhizosphere
205	3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Metagenome	Rhizosphere
206	3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Metagenome	Rhizosphere
207	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
208	3300005536	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG	Metagenome	Rhizosphere
209	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
210	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
211	3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Metagenome	Rhizosphere
212	3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Metagenome	Rhizosphere
213	3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Metagenome	Rhizosphere
214	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
215	3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Metagenome	Rhizosphere
216	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
217	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
218	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
219	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
220	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
221	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
222	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
223	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
224	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
225	3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Metagenome	Rhizosphere
226	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
227	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
228	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
229	3300005985	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
230	3300006042	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3	Metagenome	Endosphere
231	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
232	3300006058	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1	Metagenome	Rhizosphere
233	3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Metagenome	Rhizosphere
234	3300006177	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2	Metagenome	Endosphere
235	3300006178	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Metagenome	Endosphere
236	3300006186	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4	Metagenome	Endosphere
237	3300006195	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1	Metagenome	Endosphere
238	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
239	3300006353	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5	Metagenome	Endosphere
240	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
241	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
242	3300006846	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Metagenome	Rhizosphere
243	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
244	3300006852	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Metagenome	Rhizosphere
245	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
246	3300006880	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Metagenome	Rhizosphere
247	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
248	3300006914	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Metagenome	Rhizosphere
249	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
250	3300006946	Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG	Metagenome	Nodule
251	3300006948	Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15	Metagenome	Nodule
252	3300007076	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Metagenome	Rhizosphere
253	3300007265	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1	Metagenome	Rhizosphere
254	3300009036	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG	Metagenome	Rhizosphere
255	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
256	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
257	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
258	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
259	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
260	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
261	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
262	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
263	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
264	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
265	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
266	3300009978	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG	Metagenome	Rhizosphere
267	3300010159	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3	Metagenome	Rhizosphere
268	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
269	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
270	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
271	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
272	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
273	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
274	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
275	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
276	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
277	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
278	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
279	3300014497	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG	Metagenome	Rhizosphere
280	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
281	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
282	3300015262	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG	Metagenome	Rhizosphere
283	3300015265	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG	Metagenome	Rhizosphere
284	3300015683	Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04	Metagenome	Rhizosphere
285	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
286	3300020610	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
287	3300021361	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2	Metagenome	Rhizosphere
288	3300021384	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9	Metagenome	Unclassified
289	3300025206	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2)	Metagenome	Unclassified
290	3300025208	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2)	Metagenome	Endosphere
291	3300025224	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
292	3300025225	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
293	3300025226	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
294	3300025228	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
295	3300025229	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
296	3300025230	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2)	Metagenome	Endosphere
297	3300025231	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2)	Metagenome	Endosphere
298	3300025233	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2)	Metagenome	Endosphere
299	3300025242	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
300	3300025245	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3)	Metagenome	Endosphere
301	3300025246	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2)	Metagenome	Unclassified
302	3300025250	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2)	Metagenome	Unclassified
303	3300025253	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
304	3300025254	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2)	Metagenome	Endosphere
305	3300025256	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2)	Metagenome	Unclassified
306	3300025258	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3)	Metagenome	Endosphere
307	3300025261	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2)	Metagenome	Endosphere
308	3300025263	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3)	Metagenome	Endosphere
309	3300025272	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
310	3300025273	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3)	Metagenome	Endosphere
311	3300025284	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2)	Metagenome	Endosphere
312	3300025291	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3)	Metagenome	Endosphere
313	3300025292	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
314	3300025294	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2)	Metagenome	Endosphere
315	3300025295	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3)	Metagenome	Endosphere
316	3300025297	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2)	Metagenome	Endosphere
317	3300025298	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
318	3300025299	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3)	Metagenome	Endosphere
319	3300025302	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2)	Metagenome	Endosphere
320	3300025303	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
321	3300025304	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
322	3300025315	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2)	Metagenome	Rhizosphere
323	3300025711	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
324	3300025728	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
325	3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
326	3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
327	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
328	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
329	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
330	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
331	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
332	3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
333	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
334	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
335	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
336	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
337	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
338	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
339	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
340	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
341	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
342	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
343	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
344	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
345	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
346	3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
347	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
348	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
349	3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
350	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
351	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
352	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
353	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
354	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
355	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
356	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
357	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
358	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
359	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
360	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
361	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
362	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
363	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
364	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
365	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
366	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
367	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
368	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
369	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
370	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
371	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
372	3300027111	Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2)	Metagenome	Nodule
373	3300027312	Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2)	Metagenome	Rhizosphere
374	3300027395	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2)	Metagenome	Rhizosphere
375	3300027471	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2)	Metagenome	Rhizosphere
376	3300027543	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2)	Metagenome	Rhizosphere
377	3300027614	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2)	Metagenome	Rhizosphere
378	3300027665	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2)	Metagenome	Rhizosphere
379	3300027666	Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2)	Metagenome	Nodule
380	3300027671	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2)	Metagenome	Rhizosphere
381	3300027682	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2)	Metagenome	Rhizosphere
382	3300027695	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2)	Metagenome	Rhizosphere
383	3300027717	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2)	Metagenome	Rhizosphere
384	3300027876	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2)	Metagenome	Rhizosphere
385	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
386	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
387	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
388	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
389	3300028666	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG	Metagenome	Rhizosphere
390	3300028786	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM	Metagenome	Unclassified
391	3300028794	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM	Metagenome	Unclassified
392	3300028800	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG	Metagenome	Rhizosphere
393	3300029957	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG	Metagenome	Rhizosphere
394	3300030500	Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3)	Metagenome	Rhizosphere
395	3300030521	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM	Metagenome	Unclassified
396	3300030732	Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1	Metagenome	Rhizosphere
397	3300031235	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG	Metagenome	Rhizosphere
398	3300031238	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG	Metagenome	Rhizosphere
399	3300031239	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG	Metagenome	Rhizosphere
400	3300031240	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG	Metagenome	Rhizosphere
401	3300031241	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG	Metagenome	Rhizosphere
402	3300031242	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG	Metagenome	Rhizosphere
403	3300031247	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG	Metagenome	Rhizosphere
404	3300031250	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG	Metagenome	Rhizosphere
405	3300031251	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG	Metagenome	Rhizosphere
406	3300031344	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG	Metagenome	Rhizosphere
407	3300031456	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM	Metagenome	Unclassified
408	3300031507	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM	Metagenome	Unclassified
409	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
410	3300031616	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM	Metagenome	Unclassified
411	3300031649	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM	Metagenome	Unclassified
412	3300031711	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG	Metagenome	Rhizosphere
413	3300031727	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5	Metagenome	Rhizosphere
414	3300031728	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC	Metagenome	Rhizosphere
415	3300031730	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM	Metagenome	Unclassified
416	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
417	3300031733	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1	Metagenome	Rhizosphere
418	3300031824	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2	Metagenome	Rhizosphere
419	3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Metagenome	Rhizosphere
420	3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Metagenome	Rhizosphere
421	3300031903	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1	Metagenome	Rhizosphere
422	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
423	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
424	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
425	3300032004	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3	Metagenome	Rhizosphere
426	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
427	3300032126	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2	Metagenome	Rhizosphere
428	3300032133	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA	Metagenome	Rhizosphere
429	3300032137	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC	Metagenome	Rhizosphere
430	3300032139	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB	Metagenome	Rhizosphere
431	3300033179	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM	Metagenome	Unclassified
432	3300033180	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM	Metagenome	Unclassified
433	3300033541	Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
434	3300034957	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2	Metagenome	Rhizosphere
435	3300035083	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17	Metagenome	Rhizosphere
436	3300035089	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2	Metagenome	Rhizosphere
437	3300035092	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11	Metagenome	Rhizosphere
438	3300035113	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12	Metagenome	Rhizosphere
439	3300035114	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3	Metagenome	Rhizosphere
440	3300035117	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1	Metagenome	Rhizosphere
441	3300035118	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2	Metagenome	Rhizosphere
442	3300035120	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5	Metagenome	Rhizosphere
443	3300035121	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3	Metagenome	Rhizosphere
444	3300035170	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1	Metagenome	Rhizosphere
445	3300035171	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4	Metagenome	Rhizosphere
446	3300035207	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16	Metagenome	Rhizosphere
447	3300035398	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1	Metagenome	Rhizosphere
448	3300035410	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12	Metagenome	Rhizosphere
449	3300035691	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4	Metagenome	Rhizosphere
450	3300035692	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11	Metagenome	Rhizosphere
451	3300035695	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19	Metagenome	Rhizosphere
452	3300035724	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1	Metagenome	Rhizosphere
453	3300035725	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8	Metagenome	Rhizosphere
454	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
455	3300036647	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA	Metagenome	Rhizosphere
456	3300036712	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA	Metagenome	Rhizosphere
457	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
458	3300037312	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2	Metagenome	Rhizosphere
459	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
460	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
461	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
462	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
463	3300038725	Seagrass microbial communities from Seahorse Key, FL, USA - HV0818	Metagenome	Unclassified
464	3300038726	Seagrass microbial communities from Seahorse Key, FL, USA - TH0319	Metagenome	Unclassified
465	3300038727	Seagrass microbial communities from Seahorse Key, FL, USA - TV0818	Metagenome	Unclassified
466	3300038741	Seagrass microbial communities from Seahorse Key, FL, USA - SV0818	Metagenome	Unclassified
467	3300039062	Seagrass microbial communities from Seahorse Key, FL, USA - HH0818	Metagenome	Unclassified
468	3300039110	Seagrass microbial communities from Seahorse Key, FL, USA - SV0319	Metagenome	Unclassified
469	3300039437	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2	Metagenome	Unclassified
470	3300039438	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2	Metagenome	Rhizosphere
471	3300039447	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2	Metagenome	Rhizosphere
472	3300041410	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596	Metagenome	Rhizosphere
473	3300041456	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG	Metagenome	Rhizoplane
474	3300041997	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607	Metagenome	Rhizosphere
475	3300042001	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542	Metagenome	Rhizosphere
476	3300042003	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551	Metagenome	Rhizosphere
477	3300042007	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290	Metagenome	Rhizosphere
478	3300042009	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348	Metagenome	Rhizosphere
479	3300042115	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642	Metagenome	Rhizosphere
480	3300042130	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97	Metagenome	Rhizosphere
481	3300042147	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618	Metagenome	Rhizosphere
482	3300042156	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593	Metagenome	Rhizosphere
483	3300042435	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613	Metagenome	Rhizosphere
484	3300042436	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520	Metagenome	Rhizosphere
485	3300042437	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554	Metagenome	Rhizosphere
486	3300042461	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366	Metagenome	Rhizosphere
487	3300042876	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED	Metagenome	Rhizosphere
488	3300044658	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R	Metagenome	Rhizosphere
489	3300044673	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED	Metagenome	Rhizosphere
490	3300044683	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R	Metagenome	Rhizosphere
491	3300044684	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R	Metagenome	Rhizosphere
492	3300044693	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R	Metagenome	Rhizosphere
493	3300044706	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R	Metagenome	Rhizosphere
494	3300044712	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED	Metagenome	Rhizosphere
495	3300044765	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R	Metagenome	Rhizosphere
496	3300045049	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R	Metagenome	Rhizosphere
497	3300045051	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED	Metagenome	Rhizosphere
498	3300046454	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere	Metagenome	Rhizosphere
499	3300046455	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere	Metagenome	Rhizosphere
500	3300046461	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere	Metagenome	Rhizosphere
501	3300046462	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere	Metagenome	Rhizosphere
502	3300046463	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere	Metagenome	Rhizosphere
503	3300046472	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere	Metagenome	Rhizosphere
504	3300046473	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere	Metagenome	Rhizosphere
505	3300046475	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere	Metagenome	Rhizosphere
506	3300046476	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere	Metagenome	Rhizosphere
507	3300046499	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere	Metagenome	Rhizosphere
508	3300046501	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere	Metagenome	Rhizosphere
509	3300046511	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere	Metagenome	Rhizosphere
510	3300046513	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere	Metagenome	Rhizosphere
511	3300046514	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere	Metagenome	Rhizosphere
512	3300046516	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere	Metagenome	Rhizosphere
513	3300046517	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere	Metagenome	Rhizosphere
514	3300046528	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere	Metagenome	Rhizosphere
515	3300046529	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere	Metagenome	Rhizosphere
516	3300046531	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere	Metagenome	Rhizosphere
517	3300046533	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere	Metagenome	Rhizosphere
518	3300046535	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere	Metagenome	Rhizosphere
519	3300046536	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere	Metagenome	Rhizosphere
520	3300046539	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere	Metagenome	Rhizosphere
521	3300046542	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere	Metagenome	Rhizosphere
522	3300046543	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere	Metagenome	Rhizosphere
523	3300046557	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere	Metagenome	Rhizosphere
524	3300046559	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere	Metagenome	Rhizosphere
525	3300046615	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere	Metagenome	Rhizosphere
526	3300046642	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere	Metagenome	Rhizosphere
527	3300046648	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere	Metagenome	Rhizosphere
528	3300046660	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere	Metagenome	Rhizosphere
529	3300046663	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere	Metagenome	Rhizosphere
530	3300046674	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere	Metagenome	Rhizosphere
531	3300046675	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere	Metagenome	Rhizosphere
532	3300046678	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere	Metagenome	Rhizosphere
533	3300046679	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere	Metagenome	Rhizosphere
534	3300046681	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere	Metagenome	Rhizosphere
535	3300046683	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere	Metagenome	Rhizosphere
536	3300046684	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere	Metagenome	Rhizosphere
537	3300046689	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere	Metagenome	Rhizosphere
538	3300046690	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere	Metagenome	Rhizosphere
539	3300046809	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere	Metagenome	Rhizosphere
540	3300047315	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere	Metagenome	Rhizosphere
541	3300047317	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere	Metagenome	Rhizosphere
542	3300047318	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere	Metagenome	Rhizosphere
543	3300047321	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere	Metagenome	Rhizosphere
544	3300047322	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere	Metagenome	Rhizosphere
545	3300047443	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere	Metagenome	Rhizosphere
546	3300047444	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere	Metagenome	Rhizosphere
547	3300047469	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere	Metagenome	Rhizosphere
548	3300047471	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere	Metagenome	Rhizosphere
549	3300047472	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere	Metagenome	Rhizosphere
550	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
551	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
552	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
553	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
554	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
555	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
556	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
557	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
558	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
559	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
560	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
561	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
562	3300048919	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled	Metagenome	Unclassified
563	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
564	3300048922	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15	Metagenome	Unclassified
565	3300048923	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15	Metagenome	Unclassified
566	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
567	3300048925	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled	Metagenome	Unclassified
568	3300048926	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled	Metagenome	Unclassified
569	3300048927	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15	Metagenome	Unclassified
570	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
571	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
572	3300049519	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought	Metagenome	Rhizosphere
573	3300049568	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01	Metagenome	Rhizosphere
574	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
575	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
576	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
577	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
578	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
579	3300049576	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01	Metagenome	Rhizosphere
580	3300049577	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02	Metagenome	Rhizosphere
581	3300049578	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03	Metagenome	Rhizosphere
582	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
583	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
584	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
585	3300049583	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01	Metagenome	Rhizosphere
586	3300049584	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02	Metagenome	Rhizosphere
587	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
588	3300049587	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02	Metagenome	Rhizosphere
589	3300049588	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03	Metagenome	Rhizosphere
590	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
591	3300049590	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02	Metagenome	Rhizosphere
592	3300049591	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03	Metagenome	Rhizosphere
593	3300049592	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01	Metagenome	Rhizosphere
594	3300049593	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02	Metagenome	Rhizosphere
595	3300049658	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought	Metagenome	Rhizosphere
596	3300049704	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control	Metagenome	Rhizosphere
597	3300049706	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control	Metagenome	Rhizosphere
598	3300049741	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01	Metagenome	Rhizosphere
599	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
600	3300049743	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03	Metagenome	Rhizosphere
601	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
602	3300049757	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control	Metagenome	Rhizosphere
603	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
604	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
605	3300049824	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03	Metagenome	Rhizosphere
606	3300050489	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation	Metagenome	Endosphere
607	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
608	3300050493	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation	Metagenome	Endosphere
609	3300050496	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation	Metagenome	Endosphere
610	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
611	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
612	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
613	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
614	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
615	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
616	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
617	3300050514	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation	Metagenome	Rhizosphere
618	3300050515	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation	Metagenome	Rhizosphere
619	3300050516	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation	Metagenome	Endosphere
620	3300053077	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere	Metagenome	Rhizosphere
621	3300053084	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere	Metagenome	Rhizosphere
622	3300053085	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere	Metagenome	Rhizosphere
623	3300053093	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere	Metagenome	Endosphere
624	3300053125	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere	Metagenome	Endosphere
625	3300053131	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere	Metagenome	Endosphere
626	3300053134	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere	Metagenome	Endosphere
627	3300053136	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere	Metagenome	Endosphere
628	3300053149	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere	Metagenome	Endosphere
629	3300053156	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere	Metagenome	Endosphere
630	3300053177	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere	Metagenome	Endosphere
631	3300053729	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere	Metagenome	Endosphere
632	3300053730	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere	Metagenome	Endosphere
633	3300054114	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03	Metagenome	Rhizosphere
634	3300059643	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
635	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere
636	3300061734	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2)	Metagenome	Rhizosphere
637	8002392321	Alcaligenes faecalis Mc250	Isolate	Rhizosphere
638	8055225921	Achromobacter panacis KCTC 42751	Isolate	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	88.19
Metatranscriptomes	0.72
Isolates	11.08

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	16.95
Nodule	1.37
Rhizoplane	2.01
Rhizosphere	65.14
Stem	0
Stem Tuber	0
Unclassified	14.54

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	JGI24741J21665_1000147	3300001915	Bacteria	19734
2	JGI24740J21852_10013967	3300001979	Bacteria	2976
3	JGI24739J22299_10030698	3300001989	Bacteria	1861
4	JGI24739J22299_10034097	3300001989	Bacteria	1736
5	JGI25155J39150_1000024	3300002704	Bacteria	133561
6	JGI25155J39150_1000403	3300002704	Bacteria	12058
7	JGI25155J39150_1000671	3300002704	Bacteria	6492
8	JGI25156J39149_1000005	3300002705	Bacteria	263980
9	JGI25156J39149_1000117	3300002705	Bacteria	57700
10	JGI25156J39149_1001439	3300002705	Bacteria	10102
11	JGI25156J39149_1007927	3300002705	Bacteria	2731
12	JGI25162J39368_1000148	3300002737	Bacteria	76611
13	JGI25162J39368_1004431	3300002737	Bacteria	3255
14	JGI25154J39366_1000017	3300002738	Bacteria	252448
15	JGI25154J39366_1000107	3300002738	Bacteria	73482
16	JGI25154J39366_1000419	3300002738	Bacteria	22793
17	JGI25154J39366_1000440	3300002738	Bacteria	22091
18	JGI25157J39369_1000003	3300002741	Bacteria	274935
19	JGI25157J39369_1000054	3300002741	Bacteria	108825
20	JGI25157J39369_1000284	3300002741	Bacteria	36859
21	JGI25150J39212_1001018	3300002774	Bacteria	8659
22	JGI25150J39212_1003592	3300002774	Bacteria	3613
23	JGI25159J45721_1001014	3300002987	Bacteria	12109
24	JGI25159J45721_1005758	3300002987	Bacteria	3834
25	JGI25151J46595_10011710	3300003187	Bacteria	4019
26	JGI25165J46597_1000030	3300003214	Bacteria	305254
27	JGI25160J50197_1001385	3300003354	Bacteria	12205
28	JGI25161J50226_1000098	3300003374	Bacteria	71121
29	Ga0007417J51691_1017909	3300003544	Bacteria	1394
30	Ga0007410J51695_1027212	3300003574	Bacteria	1469
31	Ga0007409J51694_1013190	3300003575	Bacteria	1731
32	Ga0007416J51690_1014859	3300003577	Bacteria	2343
33	Ga0006562J51391_1006175	3300003578	Bacteria	2270
34	Ga0032354_1018871	3300003693	Bacteria	1663
35	Ga0055538_1000017	3300003751	Bacteria	305254
36	Ga0055538_1000085	3300003751	Bacteria	81616
37	Ga0055538_1003227	3300003751	Bacteria	2123
38	Ga0055539_1000022	3300003752	Bacteria	305254
39	Ga0055539_1000056	3300003752	Bacteria	155106
40	Ga0055539_1000126	3300003752	Bacteria	81616
41	Ga0055533_1000030	3300003756	Bacteria	305254
42	Ga0055533_1000133	3300003756	Bacteria	81616
43	Ga0055533_1002042	3300003756	Bacteria	4889
44	Ga0055532_1000044	3300003758	Bacteria	191110
45	Ga0055532_1000111	3300003758	Bacteria	86875
46	Ga0055525_1000034	3300003759	Bacteria	305254
47	Ga0055525_1000054	3300003759	Bacteria	216523
48	Ga0055525_1000174	3300003759	Bacteria	81616
49	Ga0055525_1000834	3300003759	Bacteria	9310
50	Ga0055535_1000114	3300003761	Bacteria	86875
51	Ga0055535_1000286	3300003761	Bacteria	53400
52	Ga0055542_1000080	3300003762	Bacteria	129634
53	Ga0055542_1001089	3300003762	Bacteria	16513
54	Ga0055542_1001355	3300003762	Bacteria	12614
55	Ga0055529_1000179	3300003763	Bacteria	86863
56	Ga0055529_1000854	3300003763	Bacteria	17673
57	Ga0055529_1002858	3300003763	Bacteria	3116
58	Ga0055526_1008831	3300003771	Bacteria	4954
59	Ga0055537_1000250	3300003773	Bacteria	39199
60	Ga0055537_1000992	3300003773	Bacteria	12855
61	Ga0055524_1000950	3300003775	Bacteria	18399
62	Ga0055524_1001346	3300003775	Bacteria	14318
63	Ga0055536_1009176	3300003781	Bacteria	4133
64	Ga0055536_1009686	3300003781	Bacteria	3944
65	Ga0055528_1000429	3300003790	Bacteria	33812
66	Ga0055528_1000573	3300003790	Bacteria	27790
67	Ga0055528_1002298	3300003790	Bacteria	10350
68	Ga0055530_10002253	3300003791	Bacteria	12707
69	Ga0055530_10004556	3300003791	Bacteria	7078
70	Ga0055530_10005015	3300003791	Bacteria	6529
71	Ga0055540_1000037	3300003792	Bacteria	162957
72	Ga0055540_1000280	3300003792	Bacteria	45825
73	Ga0055531_10000001	3300003794	Bacteria	543586
74	Ga0055531_10001254	3300003794	Bacteria	19241
75	Ga0055531_10008413	3300003794	Bacteria	5445
76	Ga0055541_1000015	3300003841	Bacteria	305254
77	Ga0055541_1000085	3300003841	Bacteria	81616
78	Ga0055541_1000355	3300003841	Bacteria	14225
79	Ga0058692_1000274	3300003856	Bacteria	27449
80	Ga0055543_1000441	3300004625	Bacteria	25571
81	Ga0065704_10144622	3300005289	Bacteria	1484
82	Ga0070676_10005197	3300005328	Bacteria	6915
83	Ga0070690_100017574	3300005330	Bacteria	4304
84	Ga0070670_100005430	3300005331	Bacteria	10749
85	Ga0070670_100111027	3300005331	Bacteria	2362
86	Ga0070677_10076458	3300005333	Bacteria	1421
87	Ga0068869_100000346	3300005334	Bacteria	24854
88	Ga0068869_100078771	3300005334	Bacteria	2455
89	Ga0068869_100119660	3300005334	Bacteria	2013
90	Ga0070682_100012848	3300005337	Bacteria	4806
91	Ga0070682_100069855	3300005337	Bacteria	2243
92	Ga0070660_100000015	3300005339	Bacteria	105703
93	Ga0070687_100069892	3300005343	Bacteria	1882
94	Ga0070661_100000173	3300005344	Bacteria	53059
95	Ga0070661_100001313	3300005344	Bacteria	17442
96	Ga0070661_100015606	3300005344	Bacteria	5362
97	Ga0070668_100006171	3300005347	Bacteria	8874
98	Ga0070668_100056840	3300005347	Bacteria	3022
99	Ga0070669_100003316	3300005353	Bacteria	11568
100	Ga0070669_100021365	3300005353	Bacteria	4624
101	Ga0070675_100000818	3300005354	Bacteria	21944
102	Ga0070675_100019498	3300005354	Bacteria	5407
103	Ga0070675_100178564	3300005354	Bacteria	1834
104	Ga0070674_100012149	3300005356	Bacteria	5279
105	Ga0070674_100021597	3300005356	Bacteria	4138
106	Ga0070674_100024154	3300005356	Bacteria	3942
107	Ga0070688_100092538	3300005365	Bacteria	1978
108	Ga0070659_100000505	3300005366	Bacteria	28646
109	Ga0070659_100000670	3300005366	Bacteria	24895
110	Ga0070659_100001479	3300005366	Bacteria	16931
111	Ga0070667_100000294	3300005367	Bacteria	56218
112	Ga0070667_100004788	3300005367	Bacteria	11336
113	Ga0070667_100057125	3300005367	Bacteria	3297
114	Ga0070667_100079665	3300005367	Bacteria	2800
115	Ga0070667_100252216	3300005367	Bacteria	1578
116	Ga0070714_100020336	3300005435	Bacteria	5420
117	Ga0070711_100202875	3300005439	Bacteria	1531
118	Ga0070705_100027052	3300005440	Bacteria	3128
119	Ga0070705_100031096	3300005440	Bacteria	2953
120	Ga0070705_100033683	3300005440	Bacteria	2857
121	Ga0070700_100001929	3300005441	Bacteria	10495
122	Ga0070694_100007385	3300005444	Bacteria	6701
123	Ga0070694_100060199	3300005444	Bacteria	2589
124	Ga0070663_100000021	3300005455	Bacteria	111983
125	Ga0070663_100000938	3300005455	Bacteria	15825
126	Ga0070678_100048641	3300005456	Bacteria	3055
127	Ga0070662_100002980	3300005457	Bacteria	10527
128	Ga0070662_100067547	3300005457	Bacteria	2626
129	Ga0070681_10000135	3300005458	Bacteria	56156
130	Ga0070681_10002448	3300005458	Bacteria	17001
131	Ga0068867_100000606	3300005459	Bacteria	23757
132	Ga0068867_100037438	3300005459	Bacteria	3526
133	Ga0070706_100003188	3300005467	Bacteria	16188
134	Ga0070707_100037315	3300005468	Bacteria	4637
135	Ga0070698_100283860	3300005471	Bacteria	1587
136	Ga0070699_100027160	3300005518	Bacteria	4937
137	Ga0070679_100002206	3300005530	Bacteria	17585
138	Ga0070679_100046897	3300005530	Bacteria	4308
139	Ga0070679_100098525	3300005530	Bacteria	2911
140	Ga0070697_100011057	3300005536	Bacteria	7052
141	Ga0070697_100017635	3300005536	Bacteria	5623
142	Ga0068853_100002617	3300005539	Bacteria	13541
143	Ga0068853_100009229	3300005539	Bacteria	7948
144	Ga0068853_100042632	3300005539	Bacteria	3881
145	Ga0068853_100070506	3300005539	Bacteria	3042
146	Ga0070672_100009824	3300005543	Bacteria	6614
147	Ga0070672_100164844	3300005543	Bacteria	1840
148	Ga0070686_100045497	3300005544	Bacteria	2765
149	Ga0070695_100003127	3300005545	Bacteria	9643
150	Ga0070695_100156194	3300005545	Bacteria	1596
151	Ga0070696_100001158	3300005546	Bacteria	17126
152	Ga0070696_100043993	3300005546	Bacteria	3091
153	Ga0070696_100084837	3300005546	Bacteria	2248
154	Ga0070665_100035834	3300005548	Bacteria	4991
155	Ga0070704_100001058	3300005549	Bacteria	14244
156	Ga0070704_100009462	3300005549	Bacteria	5888
157	Ga0070704_100028351	3300005549	Bacteria	3724
158	Ga0070704_100104908	3300005549	Bacteria	2139
159	Ga0068855_100005276	3300005563	Bacteria	15776
160	Ga0068855_100011808	3300005563	Bacteria	10561
161	Ga0068855_100177195	3300005563	Bacteria	2412
162	Ga0068855_100298212	3300005563	Bacteria	1785
163	Ga0070664_100000021	3300005564	Bacteria	111983
164	Ga0070664_100005281	3300005564	Bacteria	10367
165	Ga0070664_100013261	3300005564	Bacteria	6713
166	Ga0070664_100048490	3300005564	Bacteria	3590
167	Ga0068857_100004966	3300005577	Bacteria	11301
168	Ga0068857_100068797	3300005577	Bacteria	3152
169	Ga0068854_100000011	3300005578	Bacteria	172150
170	Ga0068854_100002477	3300005578	Bacteria	11421
171	Ga0068856_100000127	3300005614	Bacteria	76855
172	Ga0068856_100125690	3300005614	Bacteria	2568
173	Ga0068852_100009208	3300005616	Bacteria	7316
174	Ga0068859_100004410	3300005617	Bacteria	14353
175	Ga0068864_100007242	3300005618	Bacteria	9120
176	Ga0068864_100008061	3300005618	Bacteria	8687
177	Ga0068861_100000492	3300005719	Bacteria	22985
178	Ga0068851_10016446	3300005834	Bacteria	3539
179	Ga0068863_100001702	3300005841	Bacteria	21786
180	Ga0068863_100244087	3300005841	Bacteria	1734
181	Ga0068862_100002979	3300005844	Bacteria	14786
182	Ga0068862_100057538	3300005844	Bacteria	3334
183	Ga0068862_100089780	3300005844	Bacteria	2675
184	Ga0081455_10008233	3300005937	Bacteria	10866
185	Ga0081539_10001863	3300005985	Bacteria	33168
186	Ga0075368_10001585	3300006042	Bacteria	7303
187	Ga0075364_10000449	3300006051	Bacteria	20713
188	Ga0075364_10001306	3300006051	Bacteria	13411
189	Ga0075364_10003711	3300006051	Bacteria	8712
190	Ga0075364_10009882	3300006051	Bacteria	5741
191	Ga0075364_10041388	3300006051	Bacteria	2992
192	Ga0075432_10001475	3300006058	Bacteria	7680
193	Ga0070712_100012658	3300006175	Bacteria	5370
194	Ga0075362_10019779	3300006177	Bacteria	2805
195	Ga0075367_10019903	3300006178	Bacteria	3729
196	Ga0075367_10034518	3300006178	Bacteria	2923
197	Ga0075369_10011858	3300006186	Bacteria	3434
198	Ga0075369_10022846	3300006186	Bacteria	2582
199	Ga0075366_10005237	3300006195	Bacteria	7024
200	Ga0075366_10011180	3300006195	Bacteria	5061
201	Ga0075366_10100129	3300006195	Bacteria	1739
202	Ga0097621_100029903	3300006237	Bacteria	4306
203	Ga0097621_100031866	3300006237	Bacteria	4185
204	Ga0075370_10011130	3300006353	Bacteria	4719
205	Ga0068871_100001506	3300006358	Bacteria	15616
206	Ga0068871_100225008	3300006358	Bacteria	1627
207	Ga0075428_100002781	3300006844	Bacteria	19061
208	Ga0075428_100002843	3300006844	Bacteria	18876
209	Ga0075428_100013270	3300006844	Bacteria	9168
210	Ga0075430_100000762	3300006846	Bacteria	24850
211	Ga0075430_100001016	3300006846	Bacteria	22196
212	Ga0075431_100000015	3300006847	Bacteria	85838
213	Ga0075431_100003266	3300006847	Bacteria	15685
214	Ga0075431_100021059	3300006847	Bacteria	6664
215	Ga0075431_100040353	3300006847	Bacteria	4810
216	Ga0075433_10030224	3300006852	Bacteria	4621
217	Ga0075434_100000002	3300006871	Bacteria	135661
218	Ga0075434_100003145	3300006871	Bacteria	14715
219	Ga0075429_100000209	3300006880	Bacteria	39220
220	Ga0075429_100000853	3300006880	Bacteria	23971
221	Ga0075429_100003856	3300006880	Bacteria	12809
222	Ga0075429_100134393	3300006880	Bacteria	2164
223	Ga0068865_100007318	3300006881	Bacteria	6783
224	Ga0068865_100039310	3300006881	Bacteria	3208
225	Ga0068865_100040198	3300006881	Bacteria	3176
226	Ga0075436_100040699	3300006914	Bacteria	3206
227	Ga0075436_100131315	3300006914	Bacteria	1756
228	Ga0097620_100004410	3300006931	Bacteria	14353
229	Ga0079104_1000016	3300006946	Bacteria	313865
230	Ga0079104_1000053	3300006946	Bacteria	168604
231	Ga0079104_1006366	3300006946	Bacteria	4487
232	Ga0099826_10000894	3300006948	Bacteria	16356
233	Ga0075435_100004018	3300007076	Bacteria	10052
234	Ga0075435_100058296	3300007076	Bacteria	3127
235	Ga0075435_100080809	3300007076	Bacteria	2669
236	Ga0099794_10017600	3300007265	Bacteria	3188
237	Ga0099794_10077275	3300007265	Bacteria	1637
238	Ga0105244_10002827	3300009036	Bacteria	12876
239	Ga0105244_10056709	3300009036	Bacteria	1982
240	Ga0105240_10037011	3300009093	Bacteria	6273
241	Ga0105240_10106158	3300009093	Bacteria	3407
242	Ga0105240_10236090	3300009093	Bacteria	2122
243	Ga0111539_10021028	3300009094	Bacteria	8035
244	Ga0111539_10086864	3300009094	Bacteria	3675
245	Ga0111539_10096889	3300009094	Bacteria	3465
246	Ga0105247_10014533	3300009101	Bacteria	4722
247	Ga0114129_10000147	3300009147	Bacteria	74181
248	Ga0114129_10021455	3300009147	Bacteria	9167
249	Ga0114129_10174441	3300009147	Bacteria	2929
250	Ga0105243_10009190	3300009148	Bacteria	7544
251	Ga0105243_10009781	3300009148	Bacteria	7298
252	Ga0105243_10197950	3300009148	Bacteria	1760
253	Ga0105241_10048545	3300009174	Bacteria	3231
254	Ga0105242_10005758	3300009176	Bacteria	9548
255	Ga0105242_10016919	3300009176	Bacteria	5675
256	Ga0105242_10018789	3300009176	Bacteria	5409
257	Ga0105248_10005965	3300009177	Bacteria	13384
258	Ga0105237_10018091	3300009545	Bacteria	7299
259	Ga0105237_10155782	3300009545	Bacteria	2281
260	Ga0105238_10000038	3300009551	Bacteria	162920
261	Ga0105238_10098567	3300009551	Bacteria	2907
262	Ga0105238_10121819	3300009551	Bacteria	2588
263	Ga0105249_10002300	3300009553	Bacteria	16598
264	Ga0105249_10017728	3300009553	Bacteria	6323
265	Ga0105249_10027507	3300009553	Bacteria	5131
266	Ga0105249_10273253	3300009553	Bacteria	1684
267	Ga0105148_101101	3300009978	Bacteria	1937
268	Ga0099796_10007620	3300010159	Bacteria	2839
269	Ga0105239_10004364	3300010375	Bacteria	16946
270	Ga0157373_10004822	3300013100	Bacteria	10154
271	Ga0157373_10014586	3300013100	Bacteria	5760
272	Ga0157371_10000003	3300013102	Bacteria	543317
273	Ga0157371_10000072	3300013102	Bacteria	163917
274	Ga0157370_10000219	3300013104	Bacteria	72924
275	Ga0157370_10014341	3300013104	Bacteria	8108
276	Ga0157369_10002892	3300013105	Bacteria	20518
277	Ga0157369_10006494	3300013105	Bacteria	13552
278	Ga0157378_10006496	3300013297	Bacteria	10221
279	Ga0163162_10001148	3300013306	Bacteria	24691
280	Ga0163162_10292514	3300013306	Bacteria	1760
281	Ga0157372_10000201	3300013307	Bacteria	66061
282	Ga0157372_10036326	3300013307	Bacteria	5430
283	Ga0157375_10111961	3300013308	Bacteria	2829
284	Ga0163163_10004403	3300014325	Bacteria	12004
285	Ga0157380_10002283	3300014326	Bacteria	12892
286	Ga0157380_10002614	3300014326	Bacteria	12184
287	Ga0157380_10023465	3300014326	Bacteria	4653
288	Ga0157380_10322343	3300014326	Bacteria	1433
289	Ga0182008_10002226	3300014497	Bacteria	12288
290	Ga0182008_10056295	3300014497	Bacteria	1943
291	Ga0157379_10025849	3300014968	Bacteria	5219
292	Ga0157376_10007505	3300014969	Bacteria	7792
293	Ga0182007_10001939	3300015262	Bacteria	10710
294	Ga0182005_1000142	3300015265	Bacteria	50650
295	Ga0183362_10003	3300015683	Bacteria	977584
296	Ga0163161_10002188	3300017792	Bacteria	14097
297	Ga0163161_10010750	3300017792	Bacteria	6341
298	Ga0163161_10025733	3300017792	Bacteria	4167
299	Ga0154015_1516177	3300020610	Bacteria	12779
300	Ga0213872_10000167	3300021361	Bacteria	59191
301	Ga0213872_10000333	3300021361	Bacteria	40014
302	Ga0213872_10000982	3300021361	Bacteria	19943
303	Ga0213872_10001672	3300021361	Bacteria	13956
304	Ga0213872_10007693	3300021361	Bacteria	5272
305	Ga0213876_10046674	3300021384	Bacteria	2290
306	Ga0209435_100002	3300025206	Bacteria	794178
307	Ga0209435_100004	3300025206	Bacteria	633417
308	Ga0209435_100711	3300025206	Bacteria	5680
309	Ga0209436_104659	3300025208	Bacteria	3338
310	Ga0209784_100006	3300025224	Bacteria	930704
311	Ga0209784_100021	3300025224	Bacteria	408534
312	Ga0209784_100034	3300025224	Bacteria	305504
313	Ga0209784_100369	3300025224	Bacteria	21278
314	Ga0209566_100002	3300025225	Bacteria	2614868
315	Ga0209566_100038	3300025225	Bacteria	305504
316	Ga0209566_100039	3300025225	Bacteria	303368
317	Ga0209566_100459	3300025225	Bacteria	29680
318	Ga0209674_100010	3300025226	Bacteria	1038638
319	Ga0209674_100036	3300025226	Bacteria	408534
320	Ga0209674_100056	3300025226	Bacteria	305504
321	Ga0209674_100098	3300025226	Bacteria	167037
322	Ga0209672_100071	3300025228	Bacteria	169941
323	Ga0209672_100467	3300025228	Bacteria	22801
324	Ga0209147_100011	3300025229	Bacteria	702140
325	Ga0209147_100015	3300025229	Bacteria	565073
326	Ga0209147_100364	3300025229	Bacteria	32130
327	Ga0209147_100450	3300025229	Bacteria	25862
328	Ga0209563_100040	3300025230	Bacteria	408534
329	Ga0209563_100057	3300025230	Bacteria	305604
330	Ga0209563_100075	3300025230	Bacteria	216575
331	Ga0209563_100109	3300025230	Bacteria	142790
332	Ga0207427_100853	3300025231	Bacteria	13563
333	Ga0209437_100071	3300025233	Bacteria	305604
334	Ga0209437_100393	3300025233	Bacteria	42190
335	Ga0209258_100021	3300025242	Bacteria	565073
336	Ga0209258_100093	3300025242	Bacteria	223559
337	Ga0209258_100207	3300025242	Bacteria	119062
338	Ga0207425_1000717	3300025245	Bacteria	17832
339	Ga0207425_1001026	3300025245	Bacteria	13030
340	Ga0207425_1003493	3300025245	Bacteria	5003
341	Ga0209646_1000001	3300025246	Bacteria	3092932
342	Ga0209646_1000082	3300025246	Bacteria	200645
343	Ga0209646_1000149	3300025246	Bacteria	100004
344	Ga0209646_1000191	3300025246	Bacteria	75546
345	Ga0209646_1000233	3300025246	Bacteria	57776
346	Ga0209026_1000001	3300025250	Bacteria	1228671
347	Ga0209026_1000066	3300025250	Bacteria	207691
348	Ga0209026_1002225	3300025250	Bacteria	7491
349	Ga0209026_1005624	3300025250	Bacteria	3308
350	Ga0209677_100007	3300025253	Bacteria	1021332
351	Ga0209677_100023	3300025253	Bacteria	408534
352	Ga0209677_100035	3300025253	Bacteria	305504
353	Ga0209148_1000007	3300025254	Bacteria	1592273
354	Ga0209148_1000134	3300025254	Bacteria	169941
355	Ga0209148_1000190	3300025254	Bacteria	116621
356	Ga0209759_1000001	3300025256	Bacteria	2799452
357	Ga0209759_1000072	3300025256	Bacteria	178206
358	Ga0209759_1000182	3300025256	Bacteria	102836
359	Ga0209759_1002510	3300025256	Bacteria	8001
360	Ga0209759_1003697	3300025256	Bacteria	5998
361	Ga0209129_1000024	3300025258	Bacteria	417268
362	Ga0209129_1000185	3300025258	Bacteria	86854
363	Ga0209233_1000094	3300025261	Bacteria	305604
364	Ga0209565_1000098	3300025263	Bacteria	132021
365	Ga0209565_1000128	3300025263	Bacteria	108959
366	Ga0209565_1005369	3300025263	Bacteria	3735
367	Ga0209565_1006663	3300025263	Bacteria	3212
368	Ga0209565_1013293	3300025263	Bacteria	1930
369	Ga0209455_1000028	3300025272	Bacteria	565073
370	Ga0209455_1000241	3300025272	Bacteria	68235
371	Ga0209455_1000596	3300025272	Bacteria	23241
372	Ga0209673_1000008	3300025273	Bacteria	626013
373	Ga0209673_1000058	3300025273	Bacteria	269028
374	Ga0209673_1000102	3300025273	Bacteria	189583
375	Ga0209673_1002131	3300025273	Bacteria	14771
376	Ga0209673_1014354	3300025273	Bacteria	3067
377	Ga0209673_1016496	3300025273	Bacteria	2758
378	Ga0209130_1000104	3300025284	Bacteria	136694
379	Ga0209130_1000757	3300025284	Bacteria	28010
380	Ga0209130_1001248	3300025284	Bacteria	17775
381	Ga0209130_1001429	3300025284	Bacteria	15870
382	Ga0209675_1000010	3300025291	Bacteria	541927
383	Ga0209675_1000099	3300025291	Bacteria	128911
384	Ga0209675_1000695	3300025291	Bacteria	23368
385	Ga0209675_1001131	3300025291	Bacteria	16273
386	Ga0209675_1004911	3300025291	Bacteria	5773
387	Ga0209675_1014408	3300025291	Bacteria	2410
388	Ga0209676_1000023	3300025292	Bacteria	589732
389	Ga0209676_1000028	3300025292	Bacteria	559745
390	Ga0209676_1000317	3300025292	Bacteria	94105
391	Ga0209676_1001130	3300025292	Bacteria	29344
392	Ga0209676_1007885	3300025292	Bacteria	4888
393	Ga0209676_1008286	3300025292	Bacteria	4660
394	Ga0209676_1015470	3300025292	Bacteria	2806
395	Ga0209025_1000776	3300025294	Bacteria	52843
396	Ga0209025_1001526	3300025294	Bacteria	29626
397	Ga0209025_1004318	3300025294	Bacteria	12435
398	Ga0209025_1004675	3300025294	Bacteria	11702
399	Ga0209025_1008169	3300025294	Bacteria	7581
400	Ga0209025_1019436	3300025294	Bacteria	3778
401	Ga0209564_1000349	3300025295	Bacteria	86861
402	Ga0209564_1000543	3300025295	Bacteria	60959
403	Ga0209564_1001505	3300025295	Bacteria	23368
404	Ga0209564_1001769	3300025295	Bacteria	20104
405	Ga0209564_1002447	3300025295	Bacteria	14665
406	Ga0209564_1006257	3300025295	Bacteria	6492
407	Ga0209758_1000339	3300025297	Bacteria	86850
408	Ga0209758_1000510	3300025297	Bacteria	62591
409	Ga0209758_1001209	3300025297	Bacteria	32513
410	Ga0209758_1018820	3300025297	Bacteria	3364
411	Ga0209050_1000022	3300025298	Bacteria	565239
412	Ga0209050_1000072	3300025298	Bacteria	293619
413	Ga0209050_1000786	3300025298	Bacteria	45131
414	Ga0209050_1003402	3300025298	Bacteria	11794
415	Ga0209050_1004102	3300025298	Bacteria	10172
416	Ga0209050_1011963	3300025298	Bacteria	4041
417	Ga0209256_1000001	3300025299	Bacteria	2166974
418	Ga0209256_1000045	3300025299	Bacteria	325506
419	Ga0209256_1000151	3300025299	Bacteria	145299
420	Ga0209256_1000256	3300025299	Bacteria	94699
421	Ga0207426_1000049	3300025302	Bacteria	401954
422	Ga0207426_1000156	3300025302	Bacteria	178646
423	Ga0207426_1000315	3300025302	Bacteria	94699
424	Ga0207426_1001899	3300025302	Bacteria	15143
425	Ga0209051_1000004	3300025303	Bacteria	1155596
426	Ga0209051_1000013	3300025303	Bacteria	565239
427	Ga0209051_1000015	3300025303	Bacteria	546798
428	Ga0209051_1000056	3300025303	Bacteria	271616
429	Ga0209051_1000392	3300025303	Bacteria	61223
430	Ga0209051_1007172	3300025303	Bacteria	6139
431	Ga0209051_1017524	3300025303	Bacteria	3198
432	Ga0209257_1000033	3300025304	Bacteria	671006
433	Ga0209257_1000037	3300025304	Bacteria	612915
434	Ga0209257_1000042	3300025304	Bacteria	537149
435	Ga0209257_1000315	3300025304	Bacteria	102293
436	Ga0207697_10054065	3300025315	Bacteria	1663
437	Ga0207696_1002531	3300025711	Bacteria	8922
438	Ga0207655_1002097	3300025728	Bacteria	16711
439	Ga0207642_10001198	3300025899	Bacteria	8000
440	Ga0207642_10002100	3300025899	Bacteria	6161
441	Ga0207643_10006194	3300025908	Bacteria	6403
442	Ga0207707_10003001	3300025912	Bacteria	15006
443	Ga0207707_10004221	3300025912	Bacteria	12720
444	Ga0207695_10000979	3300025913	Bacteria	50790
445	Ga0207695_10002079	3300025913	Bacteria	30518
446	Ga0207695_10004413	3300025913	Bacteria	19219
447	Ga0207695_10016069	3300025913	Bacteria	8777
448	Ga0207671_10001710	3300025914	Bacteria	24779
449	Ga0207671_10003773	3300025914	Bacteria	14891
450	Ga0207671_10076784	3300025914	Bacteria	2500
451	Ga0207671_10092484	3300025914	Bacteria	2281
452	Ga0207693_10020549	3300025915	Bacteria	5250
453	Ga0207660_10031667	3300025917	Bacteria	3645
454	Ga0207660_10089323	3300025917	Bacteria	2281
455	Ga0207660_10115583	3300025917	Bacteria	2025
456	Ga0207662_10000147	3300025918	Bacteria	33968
457	Ga0207657_10000039	3300025919	Bacteria	121088
458	Ga0207649_10000157	3300025920	Bacteria	55705
459	Ga0207649_10003219	3300025920	Bacteria	8942
460	Ga0207649_10003790	3300025920	Bacteria	8245
461	Ga0207652_10048484	3300025921	Bacteria	3631
462	Ga0207652_10059375	3300025921	Bacteria	3297
463	Ga0207652_10259607	3300025921	Bacteria	1567
464	Ga0207652_10306096	3300025921	Bacteria	1434
465	Ga0207681_10000420	3300025923	Bacteria	29486
466	Ga0207681_10003667	3300025923	Bacteria	9545
467	Ga0207681_10007568	3300025923	Bacteria	6656
468	Ga0207694_10000069	3300025924	Bacteria	124500
469	Ga0207694_10042314	3300025924	Bacteria	3514
470	Ga0207694_10086456	3300025924	Bacteria	2469
471	Ga0207650_10000553	3300025925	Bacteria	30415
472	Ga0207650_10001006	3300025925	Bacteria	21205
473	Ga0207659_10001264	3300025926	Bacteria	15136
474	Ga0207659_10010425	3300025926	Bacteria	5841
475	Ga0207659_10202881	3300025926	Bacteria	1585
476	Ga0207687_10000574	3300025927	Bacteria	24851
477	Ga0207687_10048321	3300025927	Bacteria	2953
478	Ga0207664_10111334	3300025929	Bacteria	2277
479	Ga0207690_10000010	3300025932	Bacteria	330298
480	Ga0207690_10002613	3300025932	Bacteria	10849
481	Ga0207690_10005140	3300025932	Bacteria	7723
482	Ga0207706_10004957	3300025933	Bacteria	12440
483	Ga0207706_10037247	3300025933	Bacteria	4320
484	Ga0207686_10000769	3300025934	Bacteria	19713
485	Ga0207686_10042706	3300025934	Bacteria	2773
486	Ga0207686_10052447	3300025934	Bacteria	2545
487	Ga0207686_10080423	3300025934	Bacteria	2124
488	Ga0207709_10000117	3300025935	Bacteria	122667
489	Ga0207709_10000955	3300025935	Bacteria	21620
490	Ga0207709_10005125	3300025935	Bacteria	7479
491	Ga0207709_10006131	3300025935	Bacteria	6774
492	Ga0207670_10014632	3300025936	Bacteria	4665
493	Ga0207670_10048378	3300025936	Bacteria	2837
494	Ga0207669_10018523	3300025937	Bacteria	3602
495	Ga0207669_10034823	3300025937	Bacteria	2858
496	Ga0207704_10004352	3300025938	Bacteria	6474
497	Ga0207704_10008831	3300025938	Bacteria	4838
498	Ga0207665_10012383	3300025939	Bacteria	5603
499	Ga0207665_10054058	3300025939	Bacteria	2707
500	Ga0207691_10031874	3300025940	Bacteria	4919
501	Ga0207711_10025563	3300025941	Bacteria	4952
502	Ga0207711_10066916	3300025941	Bacteria	3108
503	Ga0207689_10005334	3300025942	Bacteria	11519
504	Ga0207689_10017773	3300025942	Bacteria	6009
505	Ga0207661_10147476	3300025944	Bacteria	2031
506	Ga0207679_10000007	3300025945	Bacteria	460140
507	Ga0207679_10001217	3300025945	Bacteria	16366
508	Ga0207679_10025836	3300025945	Bacteria	4043
509	Ga0207667_10000043	3300025949	Bacteria	261426
510	Ga0207667_10009925	3300025949	Bacteria	11169
511	Ga0207667_10025668	3300025949	Bacteria	6448
512	Ga0207667_10030751	3300025949	Bacteria	5802
513	Ga0207651_10004767	3300025960	Bacteria	6892
514	Ga0207712_10001907	3300025961	Bacteria	13705
515	Ga0207712_10225750	3300025961	Bacteria	1500
516	Ga0207668_10017137	3300025972	Bacteria	4533
517	Ga0207668_10091941	3300025972	Bacteria	2231
518	Ga0207640_10000012	3300025981	Bacteria	242060
519	Ga0207640_10041971	3300025981	Bacteria	2913
520	Ga0207640_10051251	3300025981	Bacteria	2682
521	Ga0207640_10082276	3300025981	Bacteria	2204
522	Ga0207658_10000212	3300025986	Bacteria	60851
523	Ga0207658_10092356	3300025986	Bacteria	2351
524	Ga0207703_10200691	3300026035	Bacteria	1772
525	Ga0207639_10003687	3300026041	Bacteria	10295
526	Ga0207639_10142630	3300026041	Bacteria	1997
527	Ga0207678_10000032	3300026067	Bacteria	109814
528	Ga0207678_10000050	3300026067	Bacteria	90037
529	Ga0207708_10001477	3300026075	Bacteria	17566
530	Ga0207708_10010615	3300026075	Bacteria	6839
531	Ga0207708_10077478	3300026075	Bacteria	2551
532	Ga0207641_10001060	3300026088	Bacteria	27782
533	Ga0207641_10137768	3300026088	Bacteria	2198
534	Ga0207648_10000362	3300026089	Bacteria	50094
535	Ga0207648_10001117	3300026089	Bacteria	30142
536	Ga0207648_10080728	3300026089	Bacteria	2837
537	Ga0207676_10010713	3300026095	Bacteria	6538
538	Ga0207676_10101148	3300026095	Bacteria	2389
539	Ga0207674_10000679	3300026116	Bacteria	44201
540	Ga0207674_10052901	3300026116	Bacteria	4140
541	Ga0207674_10099453	3300026116	Bacteria	2891
542	Ga0207674_10136133	3300026116	Bacteria	2418
543	Ga0207675_100008476	3300026118	Bacteria	9683
544	Ga0207675_100026415	3300026118	Bacteria	5405
545	Ga0207683_10002129	3300026121	Bacteria	17399
546	Ga0207683_10133007	3300026121	Bacteria	2238
547	Ga0207698_10090752	3300026142	Bacteria	2499
548	Ga0209281_1000017	3300027111	Bacteria	583251
549	Ga0209281_1000147	3300027111	Bacteria	168586
550	Ga0209371_1000145	3300027312	Bacteria	116135
551	Ga0209996_1005891	3300027395	Bacteria	1574
552	Ga0209995_1001148	3300027471	Bacteria	4070
553	Ga0209995_1009093	3300027471	Bacteria	1606
554	Ga0209999_1001859	3300027543	Bacteria	3674
555	Ga0209970_1006649	3300027614	Bacteria	1898
556	Ga0209983_1017921	3300027665	Bacteria	1468
557	Ga0209282_1000362	3300027666	Bacteria	22248
558	Ga0209588_1000820	3300027671	Bacteria	7898
559	Ga0209588_1020262	3300027671	Bacteria	2082
560	Ga0209971_1009800	3300027682	Bacteria	2269
561	Ga0209971_1017717	3300027682	Bacteria	1688
562	Ga0209966_1000929	3300027695	Bacteria	5525
563	Ga0209998_10005234	3300027717	Bacteria	2719
564	Ga0209974_10027722	3300027876	Bacteria	1874
565	Ga0209974_10036938	3300027876	Bacteria	1622
566	Ga0207428_10006938	3300027907	Bacteria	10378
567	Ga0207428_10025610	3300027907	Bacteria	4936
568	Ga0207428_10037946	3300027907	Bacteria	3919
569	Ga0268266_10013661	3300028379	Bacteria	6993
570	Ga0268265_10001605	3300028380	Bacteria	18666
571	Ga0268265_10121123	3300028380	Bacteria	2155
572	Ga0268264_10001043	3300028381	Bacteria	27736
573	Ga0268264_10005661	3300028381	Bacteria	10589
574	Ga0265336_10000822	3300028666	Bacteria	16279
575	Ga0307517_10012331	3300028786	Bacteria	11744
576	Ga0307515_10000096	3300028794	Bacteria	206366
577	Ga0307515_10000139	3300028794	Bacteria	173074
578	Ga0307515_10006898	3300028794	Bacteria	22565
579	Ga0307515_10010714	3300028794	Bacteria	17519
580	Ga0307515_10018130	3300028794	Bacteria	12769
581	Ga0307515_10070862	3300028794	Bacteria	4736
582	Ga0307515_10093591	3300028794	Bacteria	3724
583	Ga0265338_10000258	3300028800	Bacteria	96517
584	Ga0265338_10110469	3300028800	Bacteria	2216
585	Ga0265324_10002038	3300029957	Bacteria	10739
586	Ga0268256_1000128	3300030500	Bacteria	108651
587	Ga0307511_10004057	3300030521	Bacteria	14962
588	Ga0316176_1060699	3300030732	Bacteria	2517
589	Ga0265330_10000091	3300031235	Bacteria	76638
590	Ga0265332_10000028	3300031238	Bacteria	184029
591	Ga0265332_10000292	3300031238	Bacteria	39473
592	Ga0265328_10000007	3300031239	Bacteria	224310
593	Ga0265320_10064983	3300031240	Bacteria	1732
594	Ga0265325_10009426	3300031241	Bacteria	5698
595	Ga0265325_10010371	3300031241	Bacteria	5400
596	Ga0265325_10014931	3300031241	Bacteria	4378
597	Ga0265329_10051822	3300031242	Bacteria	1306
598	Ga0265340_10021521	3300031247	Bacteria	3308
599	Ga0265331_10005817	3300031250	Bacteria	7388
600	Ga0265327_10000136	3300031251	Bacteria	160868
601	Ga0265327_10000247	3300031251	Bacteria	107636
602	Ga0265327_10000364	3300031251	Bacteria	86161
603	Ga0265327_10004413	3300031251	Bacteria	12477
604	Ga0265327_10006673	3300031251	Bacteria	9152
605	Ga0265316_10000069	3300031344	Bacteria	104235
606	Ga0265316_10045333	3300031344	Bacteria	3491
607	Ga0265316_10079627	3300031344	Bacteria	2514
608	Ga0307513_10000029	3300031456	Bacteria	191823
609	Ga0307513_10000038	3300031456	Bacteria	174780
610	Ga0307513_10019952	3300031456	Bacteria	7962
611	Ga0307513_10043294	3300031456	Bacteria	4947
612	Ga0307509_10000127	3300031507	Bacteria	112456
613	Ga0307509_10000500	3300031507	Bacteria	66483
614	Ga0307509_10001647	3300031507	Bacteria	37422
615	Ga0307509_10006706	3300031507	Bacteria	15360
616	Ga0307509_10029240	3300031507	Bacteria	6119
617	Ga0307408_100000016	3300031548	Bacteria	356896
618	Ga0307408_100000263	3300031548	Bacteria	53454
619	Ga0307408_100010360	3300031548	Bacteria	6147
620	Ga0307408_100021976	3300031548	Bacteria	4327
621	Ga0307408_100141436	3300031548	Bacteria	1889
622	Ga0307508_10000028	3300031616	Bacteria	168639
623	Ga0307508_10000212	3300031616	Bacteria	70345
624	Ga0307508_10001377	3300031616	Bacteria	27383
625	Ga0307508_10045147	3300031616	Bacteria	3938
626	Ga0307508_10106659	3300031616	Bacteria	2400
627	Ga0307514_10000369	3300031649	Bacteria	102951
628	Ga0307514_10003041	3300031649	Bacteria	16567
629	Ga0265314_10000054	3300031711	Bacteria	184029
630	Ga0316576_10000452	3300031727	Bacteria	19171
631	Ga0316578_10000723	3300031728	Bacteria	12002
632	Ga0307516_10001817	3300031730	Bacteria	29320
633	Ga0307516_10002006	3300031730	Bacteria	27820
634	Ga0307516_10007489	3300031730	Bacteria	12553
635	Ga0307516_10164984	3300031730	Bacteria	1961
636	Ga0307405_10002360	3300031731	Bacteria	8311
637	Ga0307405_10013156	3300031731	Bacteria	4406
638	Ga0307405_10014639	3300031731	Bacteria	4224
639	Ga0307405_10022795	3300031731	Bacteria	3547
640	Ga0307405_10129156	3300031731	Bacteria	1743
641	Ga0307405_10194634	3300031731	Bacteria	1467
642	Ga0316577_10004626	3300031733	Bacteria	7133
643	Ga0307413_10014573	3300031824	Bacteria	3999
644	Ga0307413_10036239	3300031824	Bacteria	2838
645	Ga0307410_10007361	3300031852	Bacteria	6022
646	Ga0307410_10022173	3300031852	Bacteria	3920
647	Ga0307406_10012755	3300031901	Bacteria	4796
648	Ga0307407_10027976	3300031903	Bacteria	3008
649	Ga0307407_10058913	3300031903	Bacteria	2234
650	Ga0307412_10000106	3300031911	Bacteria	67067
651	Ga0307412_10007399	3300031911	Bacteria	6228
652	Ga0307412_10089028	3300031911	Bacteria	2154
653	Ga0307409_100000528	3300031995	Bacteria	16509
654	Ga0307409_100023618	3300031995	Bacteria	4266
655	Ga0307409_100210644	3300031995	Bacteria	1746
656	Ga0307416_100002866	3300032002	Bacteria	10042
657	Ga0307416_100004470	3300032002	Bacteria	8436
658	Ga0307416_100055531	3300032002	Bacteria	3190
659	Ga0307416_100059005	3300032002	Bacteria	3115
660	Ga0307414_10175914	3300032004	Bacteria	1716
661	Ga0307411_10000207	3300032005	Bacteria	18989
662	Ga0307411_10022548	3300032005	Bacteria	3709
663	Ga0307411_10023117	3300032005	Bacteria	3675
664	Ga0307411_10063927	3300032005	Bacteria	2462
665	Ga0307411_10088880	3300032005	Bacteria	2150
666	Ga0307411_10102467	3300032005	Bacteria	2028
667	Ga0307415_100000956	3300032126	Bacteria	13308
668	Ga0307415_100001275	3300032126	Bacteria	11866
669	Ga0316583_10000332	3300032133	Bacteria	13332
670	Ga0316585_10000662	3300032137	Bacteria	8542
671	Ga0316580_10000392	3300032139	Bacteria	9889
672	Ga0307507_10074188	3300033179	Bacteria	3053
673	Ga0307510_10001817	3300033180	Bacteria	23867
674	Ga0307510_10014828	3300033180	Bacteria	9225
675	Ga0307510_10059773	3300033180	Bacteria	3931
676	Ga0316596_1005806	3300033541	Bacteria	2841
677	Ga0373938_0013179	3300034957	Bacteria	1564
678	Ga0373926_0001544	3300035083	Bacteria	7065
679	Ga0373944_0019985	3300035089	Bacteria	1925
680	Ga0373952_0002609	3300035092	Bacteria	3246
681	Ga0373936_0002768	3300035113	Bacteria	6534
682	Ga0373936_0014717	3300035113	Bacteria	2994
683	Ga0373939_0000115	3300035114	Bacteria	24025
684	Ga0373953_0001403	3300035117	Bacteria	6949
685	Ga0373954_0000052	3300035118	Bacteria	41421
686	Ga0373954_0018111	3300035118	Bacteria	3168
687	Ga0373957_0009453	3300035120	Bacteria	3190
688	Ga0373960_0000107	3300035121	Bacteria	13271
689	Ga0373960_0017019	3300035121	Bacteria	1878
690	Ga0373943_0002072	3300035170	Bacteria	9098
691	Ga0373946_0012927	3300035171	Bacteria	3131
692	Ga0373942_0031519	3300035207	Bacteria	1402
693	Ga0316574_0000224	3300035398	Bacteria	20278
694	Ga0316574_0016443	3300035398	Bacteria	4312
695	Ga0373924_0006400	3300035410	Bacteria	4219
696	Ga0373931_0000152	3300035691	Bacteria	30330
697	Ga0373931_0001491	3300035691	Bacteria	10067
698	Ga0373931_0017494	3300035691	Bacteria	3548
699	Ga0373931_0037570	3300035691	Bacteria	2529
700	Ga0373935_0006006	3300035692	Bacteria	7209
701	Ga0373935_0049667	3300035692	Bacteria	2659
702	Ga0373935_0145217	3300035692	Bacteria	1606
703	Ga0373927_0027042	3300035695	Bacteria	3749
704	Ga0373933_0022316	3300035724	Bacteria	3603
705	Ga0373933_0074738	3300035724	Bacteria	2067
706	Ga0373947_0003598	3300035725	Bacteria	9138
707	Ga0373937_0000645	3300036401	Bacteria	30604
708	Ga0373937_0042897	3300036401	Bacteria	4128
709	Ga0373937_0057513	3300036401	Bacteria	3573
710	Ga0373937_0115378	3300036401	Bacteria	2501
711	Ga0373937_0147047	3300036401	Bacteria	2206
712	Ga0316582_0000019	3300036647	Bacteria	39316
713	Ga0316584_0006785	3300036712	Bacteria	7769
714	Ga0373925_0006928	3300037068	Bacteria	8290
715	Ga0373925_0016010	3300037068	Bacteria	5430
716	Ga0395899_0000329	3300037312	Bacteria	60135
717	Ga0395900_0000555	3300037418	Bacteria	51872
718	Ga0395900_0004673	3300037418	Bacteria	14438
719	Ga0395900_0005802	3300037418	Bacteria	12899
720	Ga0395900_0036767	3300037418	Bacteria	5047
721	Ga0395898_0251077	3300037466	Bacteria	1687
722	Ga0395905_0000181	3300037471	Bacteria	100569
723	Ga0395905_0000844	3300037471	Bacteria	40009
724	Ga0395905_0001494	3300037471	Bacteria	28004
725	Ga0395905_0038473	3300037471	Bacteria	4489
726	Ga0395905_0064505	3300037471	Bacteria	3427
727	Ga0395905_0120362	3300037471	Bacteria	2468
728	Ga0395901_0001622	3300038443	Bacteria	23269
729	Ga0400484_06254	3300038725	Bacteria	35023
730	Ga0400484_15735	3300038725	Bacteria	52349
731	Ga0400490_00822	3300038726	Bacteria	38098
732	Ga0400490_27043	3300038726	Bacteria	22747
733	Ga0400490_36401	3300038726	Bacteria	1495
734	Ga0400490_36608	3300038726	Bacteria	2654
735	Ga0400491_13511	3300038727	Bacteria	5143
736	Ga0400488_08648	3300038741	Bacteria	6931
737	Ga0400483_235087	3300039062	Bacteria	4981
738	Ga0400487_14880	3300039110	Bacteria	1716
739	Ga0400487_25945	3300039110	Bacteria	95730
740	Ga0400487_51369	3300039110	Bacteria	98129
741	Ga0436365_1366251	3300039437	Bacteria	1328
742	Ga0436365_1683879	3300039437	Bacteria	1578
743	Ga0436360_0156237	3300039438	Bacteria	1915
744	Ga0436361_0027627	3300039447	Bacteria	7149
745	Ga0436361_0043634	3300039447	Bacteria	18783
746	Ga0436361_0046388	3300039447	Bacteria	28554
747	Ga0436361_0224146	3300039447	Bacteria	2316
748	Ga0436361_0375867	3300039447	Bacteria	4701
749	Ga0436361_0447230	3300039447	Bacteria	11401
750	Ga0436361_0540776	3300039447	Bacteria	3083
751	Ga0436361_0542450	3300039447	Bacteria	2246
752	Ga0436361_0653054	3300039447	Bacteria	18423
753	Ga0436361_0756295	3300039447	Bacteria	14846
754	Ga0436361_0891393	3300039447	Bacteria	99242
755	Ga0436361_0940884	3300039447	Bacteria	3290
756	Ga0439461_0002763	3300041410	Bacteria	2836
757	Ga0439461_0008242	3300041410	Bacteria	1862
758	Ga0451795_0441351	3300041456	Bacteria	1618
759	Ga0439431_0011178	3300041997	Bacteria	2047
760	Ga0439441_001253	3300042001	Bacteria	3254
761	Ga0439441_003876	3300042001	Bacteria	2233
762	Ga0439443_000769	3300042003	Bacteria	3160
763	Ga0439449_0000718	3300042007	Bacteria	12673
764	Ga0439449_0020437	3300042007	Bacteria	2480
765	Ga0439451_017427	3300042009	Bacteria	1448
766	Ga0450911_000644	3300042115	Bacteria	10463
767	Ga0450892_000175	3300042130	Bacteria	7427
768	Ga0450910_005695	3300042147	Bacteria	1705
769	Ga0439446_0006598	3300042156	Bacteria	3034
770	Ga0439434_0001191	3300042435	Bacteria	7492
771	Ga0439434_0003178	3300042435	Bacteria	4825
772	Ga0439435_0000179	3300042436	Bacteria	8927
773	Ga0439435_0010094	3300042436	Bacteria	2231
774	Ga0439444_0004421	3300042437	Bacteria	2042
775	Ga0439460_0000008	3300042461	Bacteria	30223
776	Ga0439460_0006491	3300042461	Bacteria	2904
777	Ga0451577_0000388	3300042876	Bacteria	81462
778	Ga0451577_0000489	3300042876	Bacteria	67100
779	Ga0451577_0002438	3300042876	Bacteria	22187
780	Ga0451577_0007943	3300042876	Bacteria	10364
781	Ga0451577_0052775	3300042876	Bacteria	3630
782	Ga0451577_0073590	3300042876	Bacteria	3048
783	Ga0451577_0146747	3300042876	Bacteria	2121
784	Ga0466972_0000345	3300044658	Bacteria	25432
785	Ga0453683_0003537	3300044673	Bacteria	11484
786	Ga0466965_0009545	3300044683	Bacteria	4510
787	Ga0466966_0006925	3300044684	Bacteria	7510
788	Ga0466961_0000371	3300044693	Bacteria	29071
789	Ga0466964_0065737	3300044706	Bacteria	1520
790	Ga0453684_0000014	3300044712	Bacteria	993311
791	Ga0453684_0000187	3300044712	Bacteria	272378
792	Ga0453684_0000731	3300044712	Bacteria	115326
793	Ga0453684_0000826	3300044712	Bacteria	104663
794	Ga0453684_0001597	3300044712	Bacteria	62266
795	Ga0453684_0002735	3300044712	Bacteria	41744
796	Ga0453684_0032472	3300044712	Bacteria	7305
797	Ga0453684_0366164	3300044712	Bacteria	1622
798	Ga0466970_0053949	3300044765	Bacteria	2147
799	Ga0466959_0030903	3300045049	Bacteria	3965
800	Ga0451576_0000140	3300045051	Bacteria	183279
801	Ga0451576_0000272	3300045051	Bacteria	126530
802	Ga0451576_0000925	3300045051	Bacteria	55396
803	Ga0451576_0002279	3300045051	Bacteria	29284
804	Ga0451576_0016220	3300045051	Bacteria	8228
805	Ga0451576_0040217	3300045051	Bacteria	4950
806	Ga0451576_0048830	3300045051	Bacteria	4443
807	Ga0451576_0060769	3300045051	Bacteria	3941
808	Ga0451576_0078095	3300045051	Bacteria	3445
809	Ga0451576_0096410	3300045051	Bacteria	3077
810	Ga0451576_0245951	3300045051	Bacteria	1869
811	Ga0495592_0004208	3300046454	Bacteria	10512
812	Ga0495592_0007024	3300046454	Bacteria	8418
813	Ga0495592_0221010	3300046454	Bacteria	1266
814	Ga0495603_0001057	3300046455	Bacteria	15967
815	Ga0495603_0006547	3300046455	Bacteria	6989
816	Ga0495603_0015200	3300046455	Bacteria	4657
817	Ga0495641_0022971	3300046461	Bacteria	3109
818	Ga0495641_0068202	3300046461	Bacteria	1599
819	Ga0495651_0011936	3300046462	Bacteria	6684
820	Ga0495651_0057791	3300046462	Bacteria	2977
821	Ga0495653_0002451	3300046463	Bacteria	14737
822	Ga0495580_0003042	3300046472	Bacteria	14357
823	Ga0495580_0057124	3300046472	Bacteria	2747
824	Ga0495582_0022698	3300046473	Bacteria	3434
825	Ga0495582_0061872	3300046473	Bacteria	2067
826	Ga0495639_0001353	3300046475	Bacteria	11001
827	Ga0495662_0000837	3300046476	Bacteria	14929
828	Ga0495662_0016770	3300046476	Bacteria	3547
829	Ga0495594_0025720	3300046499	Bacteria	3164
830	Ga0495594_0058091	3300046499	Bacteria	2136
831	Ga0495607_0000331	3300046501	Bacteria	49095
832	Ga0495607_0065782	3300046501	Bacteria	2042
833	Ga0495608_0001891	3300046511	Bacteria	14993
834	Ga0495608_0011241	3300046511	Bacteria	6231
835	Ga0495616_0000072	3300046513	Bacteria	87767
836	Ga0495618_0153032	3300046514	Bacteria	1473
837	Ga0495628_0001953	3300046516	Bacteria	18701
838	Ga0495628_0009168	3300046516	Bacteria	8459
839	Ga0495628_0010917	3300046516	Bacteria	7691
840	Ga0495628_0017800	3300046516	Bacteria	5900
841	Ga0495628_0029195	3300046516	Bacteria	4474
842	Ga0495628_0220079	3300046516	Bacteria	1426
843	Ga0495630_0026776	3300046517	Bacteria	4271
844	Ga0495630_0051080	3300046517	Bacteria	3094
845	Ga0495642_0002231	3300046528	Bacteria	7933
846	Ga0495642_0018006	3300046528	Bacteria	2763
847	Ga0495652_0029817	3300046529	Bacteria	4789
848	Ga0495652_0034109	3300046529	Bacteria	4437
849	Ga0495652_0093956	3300046529	Bacteria	2447
850	Ga0495652_0097826	3300046529	Bacteria	2386
851	Ga0495652_0231475	3300046529	Bacteria	1381
852	Ga0495665_0044874	3300046531	Bacteria	2348
853	Ga0495640_0002780	3300046533	Bacteria	14073
854	Ga0495586_0014361	3300046535	Bacteria	4208
855	Ga0495586_0022098	3300046535	Bacteria	3394
856	Ga0495586_0027075	3300046535	Bacteria	3068
857	Ga0495587_0015066	3300046536	Bacteria	4832
858	Ga0495587_0020865	3300046536	Bacteria	4041
859	Ga0495621_0005030	3300046539	Bacteria	3770
860	Ga0495621_0043616	3300046539	Bacteria	1582
861	Ga0495597_0000542	3300046542	Bacteria	31279
862	Ga0495645_0000366	3300046543	Bacteria	31440
863	Ga0495622_0027921	3300046557	Bacteria	2634
864	Ga0495622_0028370	3300046557	Bacteria	2614
865	Ga0495667_0000661	3300046559	Bacteria	22019
866	Ga0495656_0000173	3300046615	Bacteria	22836
867	Ga0495656_0036119	3300046615	Bacteria	2034
868	Ga0495634_0001760	3300046642	Bacteria	18738
869	Ga0495611_0025136	3300046648	Bacteria	2593
870	Ga0495625_0001007	3300046660	Bacteria	37199
871	Ga0495625_0003200	3300046660	Bacteria	16629
872	Ga0495625_0003215	3300046660	Bacteria	16569
873	Ga0495625_0012242	3300046660	Bacteria	6958
874	Ga0495635_0018406	3300046663	Bacteria	4875
875	Ga0495588_0006619	3300046674	Bacteria	5230
876	Ga0495657_0008873	3300046675	Bacteria	7653
877	Ga0495599_0001911	3300046678	Bacteria	12058
878	Ga0495599_0005546	3300046678	Bacteria	7565
879	Ga0495599_0066787	3300046678	Bacteria	2246
880	Ga0495623_0034322	3300046679	Bacteria	3254
881	Ga0495647_0000263	3300046681	Bacteria	14508
882	Ga0495647_0001901	3300046681	Bacteria	6500
883	Ga0495658_0009180	3300046683	Bacteria	4918
884	Ga0495658_0026623	3300046683	Bacteria	3101
885	Ga0495669_0006884	3300046684	Bacteria	4761
886	Ga0495613_0030162	3300046689	Bacteria	4028
887	Ga0495624_0033172	3300046690	Bacteria	3345
888	Ga0495624_0076683	3300046690	Bacteria	2074
889	Ga0495600_0025844	3300046809	Bacteria	3785
890	Ga0495600_0081990	3300046809	Bacteria	2105
891	Ga0495581_0171346	3300047315	Bacteria	1269
892	Ga0495604_0026850	3300047317	Bacteria	4582
893	Ga0495636_0006216	3300047318	Bacteria	4690
894	Ga0495676_0050045	3300047321	Bacteria	3354
895	Ga0495680_0002911	3300047322	Bacteria	17205
896	Ga0495687_000890	3300047443	Bacteria	31459
897	Ga0495687_023652	3300047443	Bacteria	2931
898	Ga0495675_0008550	3300047444	Bacteria	6345
899	Ga0495673_0000185	3300047469	Bacteria	100703
900	Ga0495684_0025638	3300047471	Bacteria	4530
901	Ga0495684_0083758	3300047471	Bacteria	2419
902	Ga0495686_0000728	3300047472	Bacteria	44006
903	Ga0495686_0004536	3300047472	Bacteria	11381
904	Ga0495686_0048151	3300047472	Bacteria	2689
905	Ga0496100_0240600	3300048903	Bacteria	1335
906	Ga0496101_0010759	3300048904	Bacteria	6052
907	Ga0496101_0092416	3300048904	Bacteria	2253
908	Ga0496101_0112607	3300048904	Bacteria	2050
909	Ga0496102_0006260	3300048905	Bacteria	10150
910	Ga0496102_0010420	3300048905	Bacteria	7994
911	Ga0496102_0040087	3300048905	Bacteria	4235
912	Ga0496103_0059009	3300048906	Bacteria	2384
913	Ga0496104_0108344	3300048907	Bacteria	2662
914	Ga0496105_0046822	3300048908	Bacteria	3569
915	Ga0496106_0012425	3300048909	Bacteria	6288
916	Ga0496107_0036208	3300048910	Bacteria	3539
917	Ga0496108_0285017	3300048911	Bacteria	1438
918	Ga0496109_0222975	3300048912	Bacteria	1773
919	Ga0496112_0046123	3300048915	Bacteria	4273
920	Ga0496114_0000554	3300048917	Bacteria	27680
921	Ga0496114_0003037	3300048917	Bacteria	12860
922	Ga0496114_0016554	3300048917	Bacteria	5943
923	Ga0496114_0073540	3300048917	Bacteria	2877
924	Ga0496116_0026635	3300048919	Bacteria	4223
925	Ga0496118_0010145	3300048921	Bacteria	9360
926	Ga0496119_0011352	3300048922	Bacteria	7389
927	Ga0496120_0003586	3300048923	Bacteria	13947
928	Ga0496121_0000165	3300048924	Bacteria	145052
929	Ga0496121_0016622	3300048924	Bacteria	7582
930	Ga0496121_0075549	3300048924	Bacteria	2691
931	Ga0496121_0203299	3300048924	Bacteria	1410
932	Ga0496122_0000612	3300048925	Bacteria	73307
933	Ga0496122_0003378	3300048925	Bacteria	21016
934	Ga0496122_0005611	3300048925	Bacteria	14841
935	Ga0496123_0000274	3300048926	Bacteria	101783
936	Ga0496123_0000916	3300048926	Bacteria	46316
937	Ga0496123_0004481	3300048926	Bacteria	14648
938	Ga0496123_0028736	3300048926	Bacteria	4110
939	Ga0496124_0000007	3300048927	Bacteria	883534
940	Ga0496124_0003531	3300048927	Bacteria	19035
941	Ga0496125_0000121	3300048928	Bacteria	174971
942	Ga0496125_0004656	3300048928	Bacteria	15641
943	Ga0496125_0012566	3300048928	Bacteria	8392
944	Ga0496125_0044521	3300048928	Bacteria	3752
945	Ga0496125_0150794	3300048928	Bacteria	1597
946	Ga0496126_0037081	3300048929	Bacteria	4552
947	Ga0501296_004798	3300049519	Bacteria	1488
948	Ga0501031_0009313	3300049568	Bacteria	6384
949	Ga0501033_0002541	3300049570	Bacteria	15450
950	Ga0501033_0007045	3300049570	Bacteria	8780
951	Ga0501034_0003833	3300049571	Bacteria	16946
952	Ga0501034_0042191	3300049571	Bacteria	4618
953	Ga0501034_0123202	3300049571	Bacteria	2578
954	Ga0501034_0331958	3300049571	Bacteria	1452
955	Ga0501036_0001819	3300049572	Bacteria	16536
956	Ga0501036_0035700	3300049572	Bacteria	4206
957	Ga0501036_0096421	3300049572	Bacteria	2500
958	Ga0501038_0000189	3300049574	Bacteria	53371
959	Ga0501038_0070254	3300049574	Bacteria	2974
960	Ga0501038_0084190	3300049574	Bacteria	2676
961	Ga0501039_0000247	3300049575	Bacteria	39539
962	Ga0501039_0001909	3300049575	Bacteria	15432
963	Ga0501039_0006986	3300049575	Bacteria	8596
964	Ga0501040_0000641	3300049576	Bacteria	21409
965	Ga0501040_0007394	3300049576	Bacteria	7112
966	Ga0501040_0011302	3300049576	Bacteria	5841
967	Ga0501040_0040856	3300049576	Bacteria	3158
968	Ga0501040_0067482	3300049576	Bacteria	2465
969	Ga0501040_0102183	3300049576	Bacteria	2000
970	Ga0501041_0000032	3300049577	Bacteria	44999
971	Ga0501041_0000908	3300049577	Bacteria	16021
972	Ga0501041_0001680	3300049577	Bacteria	12395
973	Ga0501042_0168928	3300049578	Bacteria	1578
974	Ga0501046_0000051	3300049580	Bacteria	133545
975	Ga0501046_0000156	3300049580	Bacteria	70512
976	Ga0501046_0058266	3300049580	Bacteria	3028
977	Ga0501046_0116894	3300049580	Bacteria	2032
978	Ga0501047_0000003	3300049581	Bacteria	508375
979	Ga0501048_0000957	3300049582	Bacteria	21341
980	Ga0501048_0023957	3300049582	Bacteria	4457
981	Ga0501048_0063204	3300049582	Bacteria	2619
982	Ga0501067_0036556	3300049583	Bacteria	2726
983	Ga0501068_0006605	3300049584	Bacteria	6401
984	Ga0501070_0001514	3300049586	Bacteria	20720
985	Ga0501070_0158643	3300049586	Bacteria	1865
986	Ga0501071_0008815	3300049587	Bacteria	6684
987	Ga0501071_0029087	3300049587	Bacteria	3897
988	Ga0501071_0066156	3300049587	Bacteria	2626
989	Ga0501072_0004967	3300049588	Bacteria	10115
990	Ga0501072_0005510	3300049588	Bacteria	9631
991	Ga0501072_0084095	3300049588	Bacteria	2523
992	Ga0501073_0005171	3300049589	Bacteria	9787
993	Ga0501073_0111184	3300049589	Bacteria	1900
994	Ga0501073_0152505	3300049589	Bacteria	1601
995	Ga0501074_0075756	3300049590	Bacteria	2415
996	Ga0501075_0000053	3300049591	Bacteria	49110
997	Ga0501075_0000790	3300049591	Bacteria	19774
998	Ga0501075_0015270	3300049591	Bacteria	5509
999	Ga0501075_0083603	3300049591	Bacteria	2418
1000	Ga0501076_0000575	3300049592	Bacteria	23441
1001	Ga0501076_0000683	3300049592	Bacteria	21818
1002	Ga0501076_0002082	3300049592	Bacteria	13718
1003	Ga0501077_0000543	3300049593	Bacteria	22905
1004	Ga0501077_0007836	3300049593	Bacteria	6594
1005	Ga0501211_000837	3300049658	Bacteria	3194
1006	Ga0501221_007635	3300049704	Bacteria	1859
1007	Ga0501229_002186	3300049706	Bacteria	2299
1008	Ga0501079_0000351	3300049741	Bacteria	29422
1009	Ga0501079_0030564	3300049741	Bacteria	4139
1010	Ga0501079_0035998	3300049741	Bacteria	3811
1011	Ga0501079_0156506	3300049741	Bacteria	1776
1012	Ga0501079_0171746	3300049741	Bacteria	1690
1013	Ga0501080_0003200	3300049742	Bacteria	14440
1014	Ga0501080_0007436	3300049742	Bacteria	9889
1015	Ga0501080_0016104	3300049742	Bacteria	6901
1016	Ga0501080_0016153	3300049742	Bacteria	6891
1017	Ga0501080_0057134	3300049742	Bacteria	3633
1018	Ga0501080_0085111	3300049742	Bacteria	2938
1019	Ga0501080_0185057	3300049742	Bacteria	1915
1020	Ga0501081_0000440	3300049743	Bacteria	22990
1021	Ga0501081_0002478	3300049743	Bacteria	11632
1022	Ga0501081_0018231	3300049743	Bacteria	4660
1023	Ga0501081_0052473	3300049743	Bacteria	2814
1024	Ga0501081_0113891	3300049743	Bacteria	1921
1025	Ga0501083_0021601	3300049744	Bacteria	4470
1026	Ga0501083_0181112	3300049744	Bacteria	1376
1027	Ga0501232_001808	3300049757	Bacteria	1766
1028	Ga0501035_0019631	3300049822	Bacteria	6211
1029	Ga0501035_0087188	3300049822	Bacteria	2751
1030	Ga0501035_0322753	3300049822	Bacteria	1297
1031	Ga0501044_0001590	3300049823	Bacteria	26597
1032	Ga0501044_0021562	3300049823	Bacteria	6869
1033	Ga0501045_0000135	3300049824	Bacteria	38657
1034	Ga0501045_0015830	3300049824	Bacteria	5349
1035	Ga0501045_0029478	3300049824	Bacteria	3967
1036	Ga0501045_0089061	3300049824	Bacteria	2279
1037	nmdc:mga03683_11342_c1	3300050489	Bacteria	3224
1038	nmdc:mga00v17_13579_c1	3300050491	Bacteria	4525
1039	nmdc:mga00v17_3027_c1	3300050491	Bacteria	8639
1040	nmdc:mga00v17_44196_c1	3300050491	Bacteria	2686
1041	nmdc:mga00v17_62026_c1	3300050491	Bacteria	2299
1042	nmdc:mga0k408_19633_c1	3300050493	Bacteria	3780
1043	nmdc:mga0k408_29749_c1	3300050493	Bacteria	3111
1044	nmdc:mga0k408_4953_c1	3300050493	Bacteria	7058
1045	nmdc:mga07m45_12903_c1	3300050496	Bacteria	4127
1046	nmdc:mga07m45_2117_c1	3300050496	Bacteria	9240
1047	nmdc:mga07m45_2148_c1	3300050496	Bacteria	9185
1048	nmdc:mga07m45_4744_c1	3300050496	Bacteria	6680
1049	nmdc:mga05p37_1300_c1	3300050507	Bacteria	29031
1050	nmdc:mga05p37_1754_c1	3300050507	Bacteria	25297
1051	nmdc:mga05p37_70588_c1	3300050507	Bacteria	4296
1052	nmdc:mga09592_156_c1	3300050508	Bacteria	38056
1053	nmdc:mga09592_24649_c1	3300050508	Bacteria	4977
1054	nmdc:mga09592_37332_c1	3300050508	Bacteria	4076
1055	nmdc:mga09592_612_c1	3300050508	Bacteria	27211
1056	nmdc:mga09592_681_c1	3300050508	Bacteria	26007
1057	nmdc:mga0qj67_136011_c1	3300050509	Bacteria	1992
1058	nmdc:mga0qj67_19089_c1	3300050509	Bacteria	5235
1059	nmdc:mga0qj67_24181_c1	3300050509	Bacteria	4681
1060	nmdc:mga0qj67_910_c1	3300050509	Bacteria	20336
1061	nmdc:mga06r32_17959_c1	3300050510	Bacteria	6467
1062	nmdc:mga06r32_90_c1	3300050510	Bacteria	62738
1063	nmdc:mga06r32_9_c1	3300050510	Bacteria	115522
1064	nmdc:mga08y16_193672_c1	3300050511	Bacteria	2108
1065	nmdc:mga08y16_270079_c1	3300050511	Bacteria	1756
1066	nmdc:mga08y16_2769_c1	3300050511	Bacteria	17964
1067	nmdc:mga08y16_36460_c1	3300050511	Bacteria	5165
1068	nmdc:mga08y16_44513_c1	3300050511	Bacteria	4650
1069	nmdc:mga08y16_87061_c1	3300050511	Bacteria	3255
1070	nmdc:mga0n895_10659_c1	3300050512	Bacteria	8139
1071	nmdc:mga0n895_1811_c1	3300050512	Bacteria	16267
1072	nmdc:mga0rr50_113814_c1	3300050513	Bacteria	2144
1073	nmdc:mga0rr50_1193_c1	3300050513	Bacteria	14104
1074	nmdc:mga0rr50_91723_c1	3300050513	Bacteria	2367
1075	nmdc:mga08x19_124191_c1	3300050514	Bacteria	1732
1076	nmdc:mga08x19_188636_c1	3300050514	Bacteria	1410
1077	nmdc:mga08x19_45962_c1	3300050514	Bacteria	2791
1078	nmdc:mga08x19_762_c1	3300050514	Bacteria	20508
1079	nmdc:mga0a205_17376_c1	3300050515	Bacteria	6740
1080	nmdc:mga0sz30_18909_c1	3300050516	Bacteria	2762
1081	Ga0495601_0003328	3300053077	Bacteria	9198
1082	Ga0495601_0004787	3300053077	Bacteria	7849
1083	Ga0495601_0024437	3300053077	Bacteria	3721
1084	Ga0495595_0002687	3300053084	Bacteria	6978
1085	Ga0495619_0003760	3300053085	Bacteria	9770
1086	Ga0500651_0000057	3300053093	Bacteria	72615
1087	Ga0500651_0034223	3300053093	Bacteria	3202
1088	Ga0500618_001130	3300053125	Bacteria	12963
1089	Ga0500652_000663	3300053131	Bacteria	11691
1090	Ga0500658_0000652	3300053134	Bacteria	14279
1091	Ga0500658_0002762	3300053134	Bacteria	6750
1092	Ga0500559_0000133	3300053136	Bacteria	56972
1093	Ga0500600_0093424	3300053149	Bacteria	1601
1094	Ga0500622_0000029	3300053156	Bacteria	213762
1095	Ga0500622_0000307	3300053156	Bacteria	50070
1096	Ga0500622_0041807	3300053156	Bacteria	2383
1097	Ga0500636_0000732	3300053177	Bacteria	17678
1098	Ga0500625_015619	3300053729	Bacteria	3525
1099	Ga0500645_001732	3300053730	Bacteria	10580
1100	Ga0501084_0008574	3300054114	Bacteria	8454
1101	Ga0501084_0052172	3300054114	Bacteria	3423
1102	Ga0587072_003092	3300059643	Bacteria	2307
1103	Ga0501082_0006238	3300060353	Bacteria	10350
1104	Ga0501082_0021131	3300060353	Bacteria	5613
1105	Ga0530510_0000115	3300061734	Bacteria	45273
1106	Ga0530510_0000232	3300061734	Bacteria	34895
1107	Ga0530510_0005523	3300061734	Bacteria	8757

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300049824	Ga0501045_0029478	Ga0501045_0029478_1836_3017	305
2	3300049571	Ga0501034_0123202	Ga0501034_0123202_1507_2562	326
3	3300027682	Ga0209971_1017717	Ga0209971_10177171	329
4	3300049706	Ga0501229_002186	Ga0501229_002186_244_1353	329
5	3300037471	Ga0395905_0000844	Ga0395905_0000844_35285_36448	334
6	3300045051	Ga0451576_0048830	Ga0451576_0048830_2653_3894	335
7	3300009553	Ga0105249_10273253	Ga0105249_102732532	337
8	3300007076	Ga0075435_100058296	Ga0075435_1000582963	338
9	3300035121	Ga0373960_0017019	Ga0373960_0017019_708_1865	339
10	3300006195	Ga0075366_10100129	Ga0075366_101001291	340
11	3300006852	Ga0075433_10030224	Ga0075433_100302242	340
12	3300006914	Ga0075436_100040699	Ga0075436_1000406993	340
13	3300031548	Ga0307408_100010360	Ga0307408_1000103603	340
14	3300031824	Ga0307413_10036239	Ga0307413_100362392	340
15	3300031852	Ga0307410_10007361	Ga0307410_100073617	340
16	3300031903	Ga0307407_10058913	Ga0307407_100589132	340
17	3300031995	Ga0307409_100023618	Ga0307409_1000236182	340
18	3300032126	Ga0307415_100001275	Ga0307415_10000127510	340
19	3300038725	Ga0400484_06254	Ga0400484_06254_33857_34960	340
20	3300046528	Ga0495642_0018006	Ga0495642_0018006_1285_2433	340
21	3300046684	Ga0495669_0006884	Ga0495669_0006884_3330_4478	340
22	3300050514	nmdc:mga08x19_188636_c1	nmdc:mga08x19_188636_c1_24_1172	340
23	3300050515	nmdc:mga0a205_17376_c1	nmdc:mga0a205_17376_c1_1971_3119	340
24	3300035692	Ga0373935_0145217	Ga0373935_0145217_159_1313	341
25	3300050514	nmdc:mga08x19_762_c1	nmdc:mga08x19_762_c1_5273_6553	341
26	3300048903	Ga0496100_0240600	Ga0496100_0240600_31_1137	342
27	3300049576	Ga0501040_0067482	Ga0501040_0067482_324_1475	342
28	3300007076	Ga0075435_100080809	Ga0075435_1000808092	343
29	3300042009	Ga0439451_017427	Ga0439451_017427_146_1303	343
30	3300049572	Ga0501036_0096421	Ga0501036_0096421_987_2195	343
31	3300049575	Ga0501039_0001909	Ga0501039_0001909_4630_5838	343
32	3300049576	Ga0501040_0011302	Ga0501040_0011302_3597_4805	343
33	3300049577	Ga0501041_0001680	Ga0501041_0001680_4791_5999	343
34	3300049580	Ga0501046_0058266	Ga0501046_0058266_1144_2352	343
35	3300049588	Ga0501072_0004967	Ga0501072_0004967_4286_5494	343
36	3300049591	Ga0501075_0000790	Ga0501075_0000790_18434_19642	343
37	3300049592	Ga0501076_0002082	Ga0501076_0002082_3871_5079	343
38	3300049593	Ga0501077_0007836	Ga0501077_0007836_4400_5608	343
39	3300049741	Ga0501079_0030564	Ga0501079_0030564_1369_2577	343
40	3300049742	Ga0501080_0003200	Ga0501080_0003200_3049_4257	343
41	3300049743	Ga0501081_0002478	Ga0501081_0002478_1817_3025	343
42	3300049822	Ga0501035_0087188	Ga0501035_0087188_885_2093	343
43	3300049824	Ga0501045_0000135	Ga0501045_0000135_12212_13420	343
44	3300050513	nmdc:mga0rr50_91723_c1	nmdc:mga0rr50_91723_c1_495_1646	343
45	3300060353	Ga0501082_0006238	Ga0501082_0006238_1469_2677	343
46	3300061734	Ga0530510_0000232	Ga0530510_0000232_7174_8382	343
47	3300039062	Ga0400483_235087	Ga0400483_235087_1849_3033	344
48	3300049576	Ga0501040_0040856	Ga0501040_0040856_554_1762	344
49	3300031250	Ga0265331_10005817	Ga0265331_100058171	345
50	3300031251	Ga0265327_10000136	Ga0265327_1000013675	345
51	3300039110	Ga0400487_25945	Ga0400487_25945_69516_70700	345
52	3300046455	Ga0495603_0006547	Ga0495603_0006547_1235_2437	345
53	3300049587	Ga0501071_0066156	Ga0501071_0066156_1244_2452	345
54	3300049588	Ga0501072_0084095	Ga0501072_0084095_104_1288	345
55	3300031548	Ga0307408_100021976	Ga0307408_1000219766	346
56	3300031731	Ga0307405_10002360	Ga0307405_100023608	346
57	3300031903	Ga0307407_10027976	Ga0307407_100279763	346
58	3300032002	Ga0307416_100059005	Ga0307416_1000590054	346
59	3300032004	Ga0307414_10175914	Ga0307414_101759142	346
60	3300041410	Ga0439461_0002763	Ga0439461_0002763_956_2140	346
61	3300041997	Ga0439431_0011178	Ga0439431_0011178_76_1260	346
62	3300042147	Ga0450910_005695	Ga0450910_005695_337_1521	346
63	3300042156	Ga0439446_0006598	Ga0439446_0006598_701_1885	346
64	3300042435	Ga0439434_0001191	Ga0439434_0001191_5309_6493	346
65	3300042437	Ga0439444_0004421	Ga0439444_0004421_531_1715	346
66	3300049574	Ga0501038_0084190	Ga0501038_0084190_70_1326	346
67	3300049741	Ga0501079_0171746	Ga0501079_0171746_355_1539	346
68	3300049743	Ga0501081_0052473	Ga0501081_0052473_1121_2305	346
69	3300045051	Ga0451576_0096410	Ga0451576_0096410_475_1659	347
70	3300049587	Ga0501071_0029087	Ga0501071_0029087_681_1838	347
71	3300049589	Ga0501073_0111184	Ga0501073_0111184_598_1755	347
72	3300049741	Ga0501079_0156506	Ga0501079_0156506_561_1718	347
73	3300049742	Ga0501080_0016104	Ga0501080_0016104_572_1729	347
74	3300049743	Ga0501081_0113891	Ga0501081_0113891_329_1486	347
75	3300054114	Ga0501084_0052172	Ga0501084_0052172_2196_3353	347
76	3300013308	Ga0157375_10111961	Ga0157375_101119612	348
77	3300036401	Ga0373937_0057513	Ga0373937_0057513_774_1940	348
78	3300038725	Ga0400484_15735	Ga0400484_15735_116_1300	348
79	3300005435	Ga0070714_100020336	Ga0070714_1000203363	349
80	3300005440	Ga0070705_100031096	Ga0070705_1000310962	349
81	3300005440	Ga0070705_100033683	Ga0070705_1000336832	349
82	3300005536	Ga0070697_100017635	Ga0070697_1000176355	349
83	3300005545	Ga0070695_100003127	Ga0070695_1000031276	349
84	3300005546	Ga0070696_100001158	Ga0070696_10000115815	349
85	3300005549	Ga0070704_100001058	Ga0070704_1000010589	349
86	3300005985	Ga0081539_10001863	Ga0081539_1000186315	349
87	3300009148	Ga0105243_10197950	Ga0105243_101979502	349
88	3300017792	Ga0163161_10025733	Ga0163161_100257333	349
89	3300025899	Ga0207642_10001198	Ga0207642_100011983	349
90	3300025917	Ga0207660_10115583	Ga0207660_101155832	349
91	3300025918	Ga0207662_10000147	Ga0207662_1000014717	349
92	3300025921	Ga0207652_10259607	Ga0207652_102596072	349
93	3300025926	Ga0207659_10202881	Ga0207659_102028811	349
94	3300025927	Ga0207687_10000574	Ga0207687_1000057430	349
95	3300025929	Ga0207664_10111334	Ga0207664_101113342	349
96	3300025934	Ga0207686_10000769	Ga0207686_1000076911	349
97	3300025935	Ga0207709_10006131	Ga0207709_100061314	349
98	3300025936	Ga0207670_10014632	Ga0207670_100146324	349
99	3300025938	Ga0207704_10008831	Ga0207704_100088314	349
100	3300025981	Ga0207640_10041971	Ga0207640_100419712	349
101	3300026075	Ga0207708_10001477	Ga0207708_100014772	349
102	3300026089	Ga0207648_10001117	Ga0207648_1000111737	349
103	3300028380	Ga0268265_10121123	Ga0268265_101211232	349
104	3300028381	Ga0268264_10005661	Ga0268264_100056614	349
105	3300035083	Ga0373926_0001544	Ga0373926_0001544_5674_6825	349
106	3300035113	Ga0373936_0014717	Ga0373936_0014717_854_2005	349
107	3300035170	Ga0373943_0002072	Ga0373943_0002072_2310_3461	349
108	3300035692	Ga0373935_0006006	Ga0373935_0006006_3823_4974	349
109	3300035725	Ga0373947_0003598	Ga0373947_0003598_2632_3783	349
110	3300045051	Ga0451576_0245951	Ga0451576_0245951_124_1281	349
111	3300046455	Ga0495603_0001057	Ga0495603_0001057_7258_8409	349
112	3300046472	Ga0495580_0003042	Ga0495580_0003042_1095_2246	349
113	3300046473	Ga0495582_0022698	Ga0495582_0022698_381_1529	349
114	3300046674	Ga0495588_0006619	Ga0495588_0006619_2935_4086	349
115	3300046681	Ga0495647_0000263	Ga0495647_0000263_6978_8129	349
116	3300046683	Ga0495658_0009180	Ga0495658_0009180_29_1180	349
117	iso_pu_bacteria	2526164512	2526212784	349
118	iso_pu_bacteria	2547132103	2547374937	349
119	iso_pu_bacteria	2547132512	2548846403	349
120	iso_pu_bacteria	2599185292	2599904329	349
121	iso_pu_bacteria	2643221569	2643863725	349
122	iso_pu_bacteria	2643221621	2644123230	349
123	iso_pu_bacteria	2739367655	2739611594	349
124	iso_pu_bacteria	2818991436	2819542332	349
125	iso_pu_bacteria	2843690924	2843694601	349
126	iso_pu_bacteria	2846033681	2846035028	349
127	iso_pu_bacteria	2846037992	2846040705	349
128	iso_pu_bacteria	2855730933	2855735408	349
129	iso_pu_bacteria	2855767633	2855771191	349
130	iso_pu_bacteria	2857537821	2857537982	349
131	iso_pu_bacteria	2857542790	2857543933	349
132	iso_pu_bacteria	2858950400	2858954256	349
133	iso_pu_bacteria	2881412998	2881416934	349
134	iso_pu_bacteria	2941479691	2941484223	349
135	iso_pu_bacteria	8002392321	8002392748	349
136	3300005444	Ga0070694_100007385	Ga0070694_1000073852	350
137	3300005546	Ga0070696_100043993	Ga0070696_1000439933	350
138	3300005549	Ga0070704_100009462	Ga0070704_1000094622	350
139	3300005841	Ga0068863_100244087	Ga0068863_1002440871	350
140	3300006847	Ga0075431_100040353	Ga0075431_1000403533	350
141	3300009094	Ga0111539_10021028	Ga0111539_100210289	350
142	3300009094	Ga0111539_10096889	Ga0111539_100968891	350
143	3300009147	Ga0114129_10021455	Ga0114129_100214552	350
144	3300027695	Ga0209966_1000929	Ga0209966_10009295	350
145	3300027717	Ga0209998_10005234	Ga0209998_100052342	350
146	3300027876	Ga0209974_10036938	Ga0209974_100369382	350
147	3300027907	Ga0207428_10025610	Ga0207428_100256103	350
148	3300038726	Ga0400490_00822	Ga0400490_00822_6699_7883	350
149	3300038726	Ga0400490_27043	Ga0400490_27043_16565_17749	350
150	3300038726	Ga0400490_36401	Ga0400490_36401_213_1397	350
151	3300038726	Ga0400490_36608	Ga0400490_36608_228_1412	350
152	3300038727	Ga0400491_13511	Ga0400491_13511_1142_2326	350
153	3300038741	Ga0400488_08648	Ga0400488_08648_2095_3279	350
154	3300039110	Ga0400487_14880	Ga0400487_14880_412_1596	350
155	3300039110	Ga0400487_51369	Ga0400487_51369_23008_24192	350
156	3300042001	Ga0439441_003876	Ga0439441_003876_513_1670	350
157	3300042436	Ga0439435_0010094	Ga0439435_0010094_834_1991	350
158	3300042461	Ga0439460_0006491	Ga0439460_0006491_651_1808	350
159	3300046476	Ga0495662_0000837	Ga0495662_0000837_12884_14041	350
160	3300046517	Ga0495630_0051080	Ga0495630_0051080_893_2050	350
161	3300046535	Ga0495586_0027075	Ga0495586_0027075_1634_2791	350
162	3300047315	Ga0495581_0171346	Ga0495581_0171346_89_1246	350
163	3300047318	Ga0495636_0006216	Ga0495636_0006216_1595_2752	350
164	3300047471	Ga0495684_0083758	Ga0495684_0083758_816_1973	350
165	3300050508	nmdc:mga09592_37332_c1	nmdc:mga09592_37332_c1_2484_3641	350
166	3300050509	nmdc:mga0qj67_19089_c1	nmdc:mga0qj67_19089_c1_76_1233	350
167	3300050511	nmdc:mga08y16_193672_c1	nmdc:mga08y16_193672_c1_786_1943	350
168	3300050511	nmdc:mga08y16_44513_c1	nmdc:mga08y16_44513_c1_1352_2539	350
169	3300053156	Ga0500622_0000029	Ga0500622_0000029_119561_120718	350
170	iso_pu_bacteria	2511231003	2511249567	350
171	iso_pu_bacteria	2511231026	2511384101	350
172	iso_pu_bacteria	2521172590	2521560231	350
173	iso_pu_bacteria	2547132374	2548499115	350
174	iso_pu_bacteria	2548876994	2550695370	350
175	iso_pu_bacteria	2551306416	2553005033	350
176	iso_pu_bacteria	2585428057	2587725992	350
177	iso_pu_bacteria	2585428058	2587735654	350
178	iso_pu_bacteria	2585428062	2587759255	350
179	iso_pu_bacteria	2588253510	2588292799	350
180	iso_pu_bacteria	2643221544	2643742069	350
181	iso_pu_bacteria	2643221570	2643867682	350
182	iso_pu_bacteria	2643221585	2643933995	350
183	iso_pu_bacteria	2643221592	2643967906	350
184	iso_pu_bacteria	2643221596	2643991544	350
185	iso_pu_bacteria	2643221603	2644028178	350
186	iso_pu_bacteria	2643221609	2644062290	350
187	iso_pu_bacteria	2643221611	2644071477	350
188	iso_pu_bacteria	2643221625	2644143194	350
189	iso_pu_bacteria	2643221628	2644162125	350
190	iso_pu_bacteria	2643221639	2644220074	350
191	iso_pu_bacteria	2643221644	2644248471	350
192	iso_pu_bacteria	2643221646	2644261090	350
193	iso_pu_bacteria	2643221648	2644271718	350
194	iso_pu_bacteria	2643221652	2644293277	350
195	iso_pu_bacteria	2643221654	2644301113	350
196	iso_pu_bacteria	2643221656	2644315482	350
197	iso_pu_bacteria	2643221660	2644338542	350
198	iso_pu_bacteria	2643221717	2644648571	350
199	iso_pu_bacteria	2721755523	2722881865	350
200	iso_pu_bacteria	2738541277	2738720508	350
201	iso_pu_bacteria	2738541307	2738884079	350
202	iso_pu_bacteria	2738541337	2739056439	350
203	iso_pu_bacteria	2738543012	2739245899	350
204	iso_pu_bacteria	2738543019	2739279707	350
205	iso_pu_bacteria	2765235838	2765571403	350
206	iso_pu_bacteria	2808606386	2808982434	350
207	iso_pu_bacteria	2808606415	2809129739	350
208	iso_pu_bacteria	2808606419	2809149206	350
209	iso_pu_bacteria	2816332133	2816470595	350
210	iso_pu_bacteria	2818991445	2819592956	350
211	iso_pu_bacteria	2818991449	2819616588	350
212	iso_pu_bacteria	2839094727	2839098692	350
213	iso_pu_bacteria	2839138175	2839144810	350
214	iso_pu_bacteria	2842718218	2842721593	350
215	iso_pu_bacteria	2842733646	2842736450	350
216	iso_pu_bacteria	2842747753	2842748958	350
217	iso_pu_bacteria	2852618963	2852619346	350
218	iso_pu_bacteria	2857576091	2857577956	350
219	iso_pu_bacteria	2884811622	2884812061	350
220	iso_pu_bacteria	2884836552	2884838531	350
221	iso_pu_bacteria	2884852848	2884854822	350
222	iso_pu_bacteria	2885192300	2885197025	350
223	iso_pu_bacteria	2885198086	2885201070	350
224	iso_pu_bacteria	2885211737	2885214146	350
225	iso_pu_bacteria	2894023352	2894024126	350
226	iso_pu_bacteria	2895511927	2895518792	350
227	iso_pu_bacteria	2896154374	2896156509	350
228	iso_pu_bacteria	2904439833	2904440727	350
229	iso_pu_bacteria	2904449895	2904450808	350
230	iso_pu_bacteria	2904456579	2904459692	350
231	iso_pu_bacteria	2904479285	2904481611	350
232	iso_pu_bacteria	2904530477	2904535326	350
233	iso_pu_bacteria	2904541872	2904548033	350
234	iso_pu_bacteria	2904584206	2904589195	350
235	iso_pu_bacteria	2904589729	2904594587	350
236	iso_pu_bacteria	2904601388	2904605814	350
237	iso_pu_bacteria	2919046199	2919048892	350
238	iso_pu_bacteria	2919079590	2919084103	350
239	iso_pu_bacteria	2919704043	2919707054	350
240	iso_pu_bacteria	2923510766	2923513985	350
241	iso_pu_bacteria	2928115317	2928121254	350
242	iso_pu_bacteria	2928130867	2928134741	350
243	iso_pu_bacteria	2929160207	2929161572	350
244	iso_pu_bacteria	2929520902	2929521526	350
245	iso_pu_bacteria	2945972063	2945973584	350
246	iso_pu_bacteria	2974320154	2974322322	350
247	iso_pu_bacteria	2990710928	2990714010	350
248	3300005330	Ga0070690_100017574	Ga0070690_1000175743	351
249	3300005343	Ga0070687_100069892	Ga0070687_1000698922	351
250	3300005353	Ga0070669_100003316	Ga0070669_1000033168	351
251	3300005354	Ga0070675_100019498	Ga0070675_1000194982	351
252	3300005365	Ga0070688_100092538	Ga0070688_1000925382	351
253	3300005439	Ga0070711_100202875	Ga0070711_1002028751	351
254	3300005441	Ga0070700_100001929	Ga0070700_1000019296	351
255	3300005444	Ga0070694_100060199	Ga0070694_1000601993	351
256	3300005458	Ga0070681_10000135	Ga0070681_1000013526	351
257	3300005459	Ga0068867_100000606	Ga0068867_10000060620	351
258	3300005471	Ga0070698_100283860	Ga0070698_1002838602	351
259	3300005518	Ga0070699_100027160	Ga0070699_1000271602	351
260	3300005530	Ga0070679_100046897	Ga0070679_1000468973	351
261	3300005536	Ga0070697_100011057	Ga0070697_1000110575	351
262	3300005546	Ga0070696_100084837	Ga0070696_1000848373	351
263	3300005844	Ga0068862_100089780	Ga0068862_1000897803	351
264	3300006237	Ga0097621_100029903	Ga0097621_1000299035	351
265	3300006358	Ga0068871_100001506	Ga0068871_10000150616	351
266	3300006844	Ga0075428_100013270	Ga0075428_1000132704	351
267	3300006846	Ga0075430_100000762	Ga0075430_10000076223	351
268	3300006847	Ga0075431_100021059	Ga0075431_1000210595	351
269	3300006871	Ga0075434_100000002	Ga0075434_10000000271	351
270	3300006871	Ga0075434_100003145	Ga0075434_10000314510	351
271	3300006880	Ga0075429_100000209	Ga0075429_1000002097	351
272	3300006880	Ga0075429_100134393	Ga0075429_1001343931	351
273	3300006914	Ga0075436_100131315	Ga0075436_1001313152	351
274	3300007076	Ga0075435_100004018	Ga0075435_1000040189	351
275	3300009147	Ga0114129_10174441	Ga0114129_101744412	351
276	3300009553	Ga0105249_10017728	Ga0105249_100177283	351
277	3300021384	Ga0213876_10046674	Ga0213876_100466743	351
278	3300025912	Ga0207707_10003001	Ga0207707_1000300111	351
279	3300025917	Ga0207660_10089323	Ga0207660_100893232	351
280	3300025921	Ga0207652_10059375	Ga0207652_100593752	351
281	3300025926	Ga0207659_10010425	Ga0207659_100104256	351
282	3300025934	Ga0207686_10080423	Ga0207686_100804232	351
283	3300025936	Ga0207670_10048378	Ga0207670_100483783	351
284	3300025944	Ga0207661_10147476	Ga0207661_101474762	351
285	3300025961	Ga0207712_10225750	Ga0207712_102257502	351
286	3300027395	Ga0209996_1005891	Ga0209996_10058911	351
287	3300027471	Ga0209995_1001148	Ga0209995_10011482	351
288	3300027543	Ga0209999_1001859	Ga0209999_10018593	351
289	3300027614	Ga0209970_1006649	Ga0209970_10066492	351
290	3300027665	Ga0209983_1017921	Ga0209983_10179212	351
291	3300027671	Ga0209588_1020262	Ga0209588_10202621	351
292	3300027682	Ga0209971_1009800	Ga0209971_10098002	351
293	3300031239	Ga0265328_10000007	Ga0265328_10000007226	351
294	3300031241	Ga0265325_10014931	Ga0265325_100149313	351
295	3300031242	Ga0265329_10051822	Ga0265329_100518221	351
296	3300031251	Ga0265327_10004413	Ga0265327_100044133	351
297	3300031344	Ga0265316_10079627	Ga0265316_100796272	351
298	3300032002	Ga0307416_100055531	Ga0307416_1000555313	351
299	3300032133	Ga0316583_10000332	Ga0316583_100003328	351
300	3300034957	Ga0373938_0013179	Ga0373938_0013179_240_1397	351
301	3300035118	Ga0373954_0000052	Ga0373954_0000052_18123_19283	351
302	3300035207	Ga0373942_0031519	Ga0373942_0031519_129_1286	351
303	3300035398	Ga0316574_0016443	Ga0316574_0016443_1004_2161	351
304	3300035691	Ga0373931_0001491	Ga0373931_0001491_4924_6081	351
305	3300035724	Ga0373933_0022316	Ga0373933_0022316_2018_3178	351
306	3300036401	Ga0373937_0000645	Ga0373937_0000645_11326_12486	351
307	3300037418	Ga0395900_0004673	Ga0395900_0004673_1404_2567	351
308	3300037466	Ga0395898_0251077	Ga0395898_0251077_69_1232	351
309	3300037471	Ga0395905_0038473	Ga0395905_0038473_2298_3455	351
310	3300037471	Ga0395905_0120362	Ga0395905_0120362_885_2048	351
311	3300039437	Ga0436365_1683879	Ga0436365_1683879_254_1438	351
312	3300039438	Ga0436360_0156237	Ga0436360_0156237_496_1653	351
313	3300041410	Ga0439461_0008242	Ga0439461_0008242_287_1444	351
314	3300042001	Ga0439441_001253	Ga0439441_001253_1820_2977	351
315	3300042003	Ga0439443_000769	Ga0439443_000769_826_1983	351
316	3300042435	Ga0439434_0003178	Ga0439434_0003178_1120_2277	351
317	3300042436	Ga0439435_0000179	Ga0439435_0000179_2430_3587	351
318	3300042461	Ga0439460_0000008	Ga0439460_0000008_14151_15308	351
319	3300045051	Ga0451576_0040217	Ga0451576_0040217_1705_2862	351
320	3300046461	Ga0495641_0068202	Ga0495641_0068202_313_1470	351
321	3300046511	Ga0495608_0001891	Ga0495608_0001891_3678_4835	351
322	3300046516	Ga0495628_0001953	Ga0495628_0001953_8294_9451	351
323	3300046517	Ga0495630_0026776	Ga0495630_0026776_188_1345	351
324	3300046528	Ga0495642_0002231	Ga0495642_0002231_1250_2407	351
325	3300046529	Ga0495652_0029817	Ga0495652_0029817_2130_3287	351
326	3300046533	Ga0495640_0002780	Ga0495640_0002780_858_2015	351
327	3300046535	Ga0495586_0014361	Ga0495586_0014361_1338_2495	351
328	3300046536	Ga0495587_0020865	Ga0495587_0020865_1877_3034	351
329	3300046539	Ga0495621_0043616	Ga0495621_0043616_201_1358	351
330	3300046559	Ga0495667_0000661	Ga0495667_0000661_8098_9255	351
331	3300046642	Ga0495634_0001760	Ga0495634_0001760_8134_9291	351
332	3300046683	Ga0495658_0026623	Ga0495658_0026623_1215_2372	351
333	3300046809	Ga0495600_0081990	Ga0495600_0081990_229_1386	351
334	3300047322	Ga0495680_0002911	Ga0495680_0002911_7460_8617	351
335	3300049519	Ga0501296_004798	Ga0501296_004798_186_1343	351
336	3300049568	Ga0501031_0009313	Ga0501031_0009313_1403_2560	351
337	3300049570	Ga0501033_0002541	Ga0501033_0002541_1687_2844	351
338	3300049571	Ga0501034_0331958	Ga0501034_0331958_218_1375	351
339	3300049572	Ga0501036_0001819	Ga0501036_0001819_12479_13636	351
340	3300049572	Ga0501036_0035700	Ga0501036_0035700_904_2061	351
341	3300049574	Ga0501038_0000189	Ga0501038_0000189_21330_22487	351
342	3300049574	Ga0501038_0070254	Ga0501038_0070254_768_1925	351
343	3300049575	Ga0501039_0000247	Ga0501039_0000247_7679_8836	351
344	3300049575	Ga0501039_0006986	Ga0501039_0006986_6349_7506	351
345	3300049576	Ga0501040_0000641	Ga0501040_0000641_19484_20641	351
346	3300049576	Ga0501040_0007394	Ga0501040_0007394_48_1205	351
347	3300049576	Ga0501040_0102183	Ga0501040_0102183_102_1259	351
348	3300049577	Ga0501041_0000032	Ga0501041_0000032_41152_42309	351
349	3300049577	Ga0501041_0000908	Ga0501041_0000908_11316_12473	351
350	3300049578	Ga0501042_0168928	Ga0501042_0168928_110_1267	351
351	3300049580	Ga0501046_0000156	Ga0501046_0000156_45477_46634	351
352	3300049580	Ga0501046_0116894	Ga0501046_0116894_12_1175	351
353	3300049582	Ga0501048_0000957	Ga0501048_0000957_8628_9785	351
354	3300049582	Ga0501048_0063204	Ga0501048_0063204_1142_2299	351
355	3300049584	Ga0501068_0006605	Ga0501068_0006605_2036_3193	351
356	3300049586	Ga0501070_0158643	Ga0501070_0158643_453_1610	351
357	3300049587	Ga0501071_0008815	Ga0501071_0008815_1615_2772	351
358	3300049588	Ga0501072_0005510	Ga0501072_0005510_5784_6941	351
359	3300049591	Ga0501075_0000053	Ga0501075_0000053_23753_24910	351
360	3300049591	Ga0501075_0015270	Ga0501075_0015270_2748_3905	351
361	3300049591	Ga0501075_0083603	Ga0501075_0083603_1076_2344	351
362	3300049592	Ga0501076_0000575	Ga0501076_0000575_19425_20582	351
363	3300049592	Ga0501076_0000683	Ga0501076_0000683_3579_4736	351
364	3300049593	Ga0501077_0000543	Ga0501077_0000543_2901_4058	351
365	3300049741	Ga0501079_0000351	Ga0501079_0000351_26668_27825	351
366	3300049741	Ga0501079_0035998	Ga0501079_0035998_772_1929	351
367	3300049742	Ga0501080_0007436	Ga0501080_0007436_2096_3253	351
368	3300049742	Ga0501080_0016153	Ga0501080_0016153_1711_2868	351
369	3300049743	Ga0501081_0000440	Ga0501081_0000440_2036_3193	351
370	3300049743	Ga0501081_0018231	Ga0501081_0018231_1507_2664	351
371	3300049822	Ga0501035_0019631	Ga0501035_0019631_3937_5094	351
372	3300049822	Ga0501035_0322753	Ga0501035_0322753_103_1260	351
373	3300049824	Ga0501045_0015830	Ga0501045_0015830_1282_2439	351
374	3300049824	Ga0501045_0089061	Ga0501045_0089061_423_1580	351
375	3300050507	nmdc:mga05p37_1300_c1	nmdc:mga05p37_1300_c1_17504_18661	351
376	3300050507	nmdc:mga05p37_70588_c1	nmdc:mga05p37_70588_c1_256_1413	351
377	3300050508	nmdc:mga09592_24649_c1	nmdc:mga09592_24649_c1_1576_2733	351
378	3300050508	nmdc:mga09592_681_c1	nmdc:mga09592_681_c1_9834_10991	351
379	3300050509	nmdc:mga0qj67_136011_c1	nmdc:mga0qj67_136011_c1_198_1355	351
380	3300050509	nmdc:mga0qj67_24181_c1	nmdc:mga0qj67_24181_c1_1482_2639	351
381	3300050510	nmdc:mga06r32_17959_c1	nmdc:mga06r32_17959_c1_1801_2958	351
382	3300050512	nmdc:mga0n895_10659_c1	nmdc:mga0n895_10659_c1_1734_2891	351
383	3300050512	nmdc:mga0n895_1811_c1	nmdc:mga0n895_1811_c1_7510_8667	351
384	3300050513	nmdc:mga0rr50_113814_c1	nmdc:mga0rr50_113814_c1_148_1305	351
385	3300050513	nmdc:mga0rr50_1193_c1	nmdc:mga0rr50_1193_c1_7268_8425	351
386	3300050514	nmdc:mga08x19_45962_c1	nmdc:mga08x19_45962_c1_1272_2429	351
387	3300053077	Ga0495601_0004787	Ga0495601_0004787_919_2076	351
388	3300054114	Ga0501084_0008574	Ga0501084_0008574_3937_5094	351
389	3300060353	Ga0501082_0021131	Ga0501082_0021131_1556_2713	351
390	3300061734	Ga0530510_0000115	Ga0530510_0000115_24351_25508	351
391	3300061734	Ga0530510_0005523	Ga0530510_0005523_6631_7788	351
392	iso_pu_bacteria	2513020051	2513230039	351
393	iso_pu_bacteria	2599185214	2599620613	351
394	iso_pu_bacteria	2599185226	2599673912	351
395	iso_pu_bacteria	2599185227	2599678771	351
396	iso_pu_bacteria	2599185229	2599690124	351
397	iso_pu_bacteria	2643221658	2644324248	351
398	iso_pu_bacteria	2643221672	2644396089	351
399	iso_pu_bacteria	2643221683	2644465000	351
400	iso_pu_bacteria	2721755763	2723875852	351
401	iso_pu_bacteria	2738543013	2739250168	351
402	iso_pu_bacteria	2808606384	2808968594	351
403	iso_pu_bacteria	2808606390	2809003425	351
404	iso_pu_bacteria	2808606391	2809010702	351
405	iso_pu_bacteria	2818991446	2819601190	351
406	iso_pu_bacteria	2831265667	2831271495	351
407	iso_pu_bacteria	2838054893	2838055394	351
408	iso_pu_bacteria	2842677519	2842680546	351
409	iso_pu_bacteria	2899924645	2899927463	351
410	iso_pu_bacteria	2919462493	2919462662	351
411	iso_pu_bacteria	2928037797	2928042625	351
412	iso_pu_bacteria	2928044640	2928048948	351
413	iso_pu_bacteria	2928051484	2928051498	351
414	iso_pu_bacteria	2928064002	2928068710	351
415	iso_pu_bacteria	2928070936	2928073292	351
416	iso_pu_bacteria	2928084124	2928087052	351
417	iso_pu_bacteria	2945909444	2945913985	351
418	iso_pu_bacteria	2945945610	2945949540	351
419	iso_pu_bacteria	2945984333	2945990616	351
420	iso_pu_bacteria	2954767861	2954770800	351
421	iso_pu_bacteria	8055225921	8055226411	351
422	3300005545	Ga0070695_100156194	Ga0070695_1001561942	352
423	3300005719	Ga0068861_100000492	Ga0068861_1000004926	352
424	3300005844	Ga0068862_100002979	Ga0068862_1000029797	352
425	3300005844	Ga0068862_100057538	Ga0068862_1000575385	352
426	3300006844	Ga0075428_100002781	Ga0075428_1000027817	352
427	3300006846	Ga0075430_100001016	Ga0075430_10000101618	352
428	3300006847	Ga0075431_100003266	Ga0075431_1000032664	352
429	3300006880	Ga0075429_100000853	Ga0075429_10000085312	352
430	3300006881	Ga0068865_100007318	Ga0068865_1000073186	352
431	3300009094	Ga0111539_10086864	Ga0111539_100868643	352
432	3300009147	Ga0114129_10000147	Ga0114129_1000014750	352
433	3300009148	Ga0105243_10009781	Ga0105243_100097812	352
434	3300009553	Ga0105249_10002300	Ga0105249_1000230010	352
435	3300013306	Ga0163162_10292514	Ga0163162_102925142	352
436	3300014326	Ga0157380_10002283	Ga0157380_100022839	352
437	3300025292	Ga0209676_1015470	Ga0209676_10154702	352
438	3300025298	Ga0209050_1004102	Ga0209050_10041027	352
439	3300025917	Ga0207660_10031667	Ga0207660_100316673	352
440	3300025923	Ga0207681_10003667	Ga0207681_1000366710	352
441	3300025935	Ga0207709_10005125	Ga0207709_100051252	352
442	3300025938	Ga0207704_10004352	Ga0207704_100043526	352
443	3300025961	Ga0207712_10001907	Ga0207712_100019079	352
444	3300026075	Ga0207708_10010615	Ga0207708_100106156	352
445	3300026089	Ga0207648_10000362	Ga0207648_1000036238	352
446	3300027907	Ga0207428_10037946	Ga0207428_100379463	352
447	3300028380	Ga0268265_10001605	Ga0268265_1000160510	352
448	3300031616	Ga0307508_10106659	Ga0307508_101066592	352
449	3300031911	Ga0307412_10000106	Ga0307412_1000010646	352
450	3300046516	Ga0495628_0220079	Ga0495628_0220079_120_1280	352
451	3300046539	Ga0495621_0005030	Ga0495621_0005030_1397_2557	352
452	3300046690	Ga0495624_0076683	Ga0495624_0076683_295_1455	352
453	3300048904	Ga0496101_0112607	Ga0496101_0112607_280_1440	352
454	3300048905	Ga0496102_0040087	Ga0496102_0040087_2083_3243	352
455	3300048911	Ga0496108_0285017	Ga0496108_0285017_221_1384	352
456	3300048912	Ga0496109_0222975	Ga0496109_0222975_40_1200	352
457	3300048917	Ga0496114_0073540	Ga0496114_0073540_1451_2611	352
458	3300048921	Ga0496118_0010145	Ga0496118_0010145_5185_6348	352
459	3300048922	Ga0496119_0011352	Ga0496119_0011352_4339_5502	352
460	3300048923	Ga0496120_0003586	Ga0496120_0003586_3459_4622	352
461	3300048924	Ga0496121_0000165	Ga0496121_0000165_110066_111229	352
462	3300048924	Ga0496121_0016622	Ga0496121_0016622_4562_5725	352
463	3300048924	Ga0496121_0075549	Ga0496121_0075549_341_1504	352
464	3300048925	Ga0496122_0005611	Ga0496122_0005611_3059_4222	352
465	3300048926	Ga0496123_0004481	Ga0496123_0004481_2998_4161	352
466	3300048926	Ga0496123_0028736	Ga0496123_0028736_1440_2603	352
467	3300048927	Ga0496124_0000007	Ga0496124_0000007_257058_258221	352
468	3300048928	Ga0496125_0000121	Ga0496125_0000121_120532_121695	352
469	3300048928	Ga0496125_0044521	Ga0496125_0044521_1831_2994	352
470	3300048928	Ga0496125_0150794	Ga0496125_0150794_360_1523	352
471	3300049823	Ga0501044_0001590	Ga0501044_0001590_6074_7258	352
472	3300050507	nmdc:mga05p37_1754_c1	nmdc:mga05p37_1754_c1_12621_13808	352
473	3300050508	nmdc:mga09592_612_c1	nmdc:mga09592_612_c1_10882_12069	352
474	3300050509	nmdc:mga0qj67_910_c1	nmdc:mga0qj67_910_c1_7035_8222	352
475	3300050510	nmdc:mga06r32_90_c1	nmdc:mga06r32_90_c1_57193_58380	352
476	3300050511	nmdc:mga08y16_270079_c1	nmdc:mga08y16_270079_c1_483_1670	352
477	3300050511	nmdc:mga08y16_36460_c1	nmdc:mga08y16_36460_c1_1559_2770	352
478	3300050511	nmdc:mga08y16_87061_c1	nmdc:mga08y16_87061_c1_516_1784	352
479	3300053177	Ga0500636_0000732	Ga0500636_0000732_11685_12848	352
480	3300053729	Ga0500625_015619	Ga0500625_015619_2011_3174	352
481	iso_pu_bacteria	2515154123	2515688197	352
482	iso_pu_bacteria	2643221594	2643982928	352
483	iso_pu_bacteria	2808606395	2809033518	352
484	iso_pu_bacteria	2932422444	2932423931	352
485	3300001989	JGI24739J22299_10030698	JGI24739J22299_100306981	353
486	3300002704	JGI25155J39150_1000024	JGI25155J39150_100002491	353
487	3300002705	JGI25156J39149_1000005	JGI25156J39149_1000005163	353
488	3300002705	JGI25156J39149_1000117	JGI25156J39149_10001175	353
489	3300002737	JGI25162J39368_1000148	JGI25162J39368_100014849	353
490	3300002737	JGI25162J39368_1004431	JGI25162J39368_10044313	353
491	3300002738	JGI25154J39366_1000017	JGI25154J39366_1000017155	353
492	3300002738	JGI25154J39366_1000440	JGI25154J39366_100044016	353
493	3300002741	JGI25157J39369_1000003	JGI25157J39369_1000003171	353
494	3300002741	JGI25157J39369_1000054	JGI25157J39369_10000546	353
495	3300002741	JGI25157J39369_1000284	JGI25157J39369_100028433	353
496	3300002774	JGI25150J39212_1003592	JGI25150J39212_10035922	353
497	3300002987	JGI25159J45721_1001014	JGI25159J45721_100101411	353
498	3300002987	JGI25159J45721_1005758	JGI25159J45721_10057585	353
499	3300003214	JGI25165J46597_1000030	JGI25165J46597_100003025	353
500	3300003354	JGI25160J50197_1001385	JGI25160J50197_10013858	353
501	3300003374	JGI25161J50226_1000098	JGI25161J50226_10000988	353
502	3300003544	Ga0007417J51691_1017909	Ga0007417J51691_10179091	353
503	3300003574	Ga0007410J51695_1027212	Ga0007410J51695_10272121	353
504	3300003575	Ga0007409J51694_1013190	Ga0007409J51694_10131901	353
505	3300003577	Ga0007416J51690_1014859	Ga0007416J51690_10148591	353
506	3300003693	Ga0032354_1018871	Ga0032354_10188711	353
507	3300003751	Ga0055538_1000017	Ga0055538_1000017275	353
508	3300003752	Ga0055539_1000022	Ga0055539_1000022275	353
509	3300003756	Ga0055533_1000030	Ga0055533_1000030275	353
510	3300003758	Ga0055532_1000044	Ga0055532_1000044153	353
511	3300003759	Ga0055525_1000034	Ga0055525_1000034275	353
512	3300003763	Ga0055529_1002858	Ga0055529_10028582	353
513	3300003771	Ga0055526_1008831	Ga0055526_10088312	353
514	3300003773	Ga0055537_1000250	Ga0055537_100025036	353
515	3300003773	Ga0055537_1000992	Ga0055537_100099211	353
516	3300003775	Ga0055524_1001346	Ga0055524_10013461	353
517	3300003781	Ga0055536_1009176	Ga0055536_10091764	353
518	3300003781	Ga0055536_1009686	Ga0055536_10096861	353
519	3300003790	Ga0055528_1000429	Ga0055528_10004297	353
520	3300003790	Ga0055528_1000573	Ga0055528_100057319	353
521	3300003791	Ga0055530_10002253	Ga0055530_100022531	353
522	3300003791	Ga0055530_10004556	Ga0055530_100045567	353
523	3300003792	Ga0055540_1000037	Ga0055540_100003712	353
524	3300003794	Ga0055531_10000001	Ga0055531_10000001391	353
525	3300003794	Ga0055531_10001254	Ga0055531_1000125410	353
526	3300003841	Ga0055541_1000015	Ga0055541_1000015275	353
527	3300004625	Ga0055543_1000441	Ga0055543_10004414	353
528	3300005328	Ga0070676_10005197	Ga0070676_100051975	353
529	3300005331	Ga0070670_100005430	Ga0070670_1000054308	353
530	3300005331	Ga0070670_100111027	Ga0070670_1001110272	353
531	3300005334	Ga0068869_100000346	Ga0068869_1000003463	353
532	3300005344	Ga0070661_100001313	Ga0070661_10000131316	353
533	3300005347	Ga0070668_100006171	Ga0070668_1000061715	353
534	3300005347	Ga0070668_100056840	Ga0070668_1000568402	353
535	3300005353	Ga0070669_100021365	Ga0070669_1000213653	353
536	3300005354	Ga0070675_100000818	Ga0070675_10000081811	353
537	3300005356	Ga0070674_100012149	Ga0070674_1000121491	353
538	3300005356	Ga0070674_100021597	Ga0070674_1000215975	353
539	3300005356	Ga0070674_100024154	Ga0070674_1000241542	353
540	3300005366	Ga0070659_100000505	Ga0070659_10000050517	353
541	3300005367	Ga0070667_100000294	Ga0070667_10000029439	353
542	3300005367	Ga0070667_100004788	Ga0070667_1000047887	353
543	3300005367	Ga0070667_100079665	Ga0070667_1000796653	353
544	3300005367	Ga0070667_100252216	Ga0070667_1002522161	353
545	3300005457	Ga0070662_100002980	Ga0070662_1000029804	353
546	3300005457	Ga0070662_100067547	Ga0070662_1000675472	353
547	3300005467	Ga0070706_100003188	Ga0070706_10000318815	353
548	3300005468	Ga0070707_100037315	Ga0070707_1000373154	353
549	3300005539	Ga0068853_100070506	Ga0068853_1000705063	353
550	3300005543	Ga0070672_100009824	Ga0070672_1000098242	353
551	3300005549	Ga0070704_100028351	Ga0070704_1000283513	353
552	3300005549	Ga0070704_100104908	Ga0070704_1001049082	353
553	3300005563	Ga0068855_100005276	Ga0068855_10000527611	353
554	3300005564	Ga0070664_100005281	Ga0070664_10000528110	353
555	3300005564	Ga0070664_100013261	Ga0070664_1000132611	353
556	3300005614	Ga0068856_100125690	Ga0068856_1001256902	353
557	3300005616	Ga0068852_100009208	Ga0068852_1000092086	353
558	3300005617	Ga0068859_100004410	Ga0068859_1000044109	353
559	3300005841	Ga0068863_100001702	Ga0068863_1000017022	353
560	3300006042	Ga0075368_10001585	Ga0075368_100015853	353
561	3300006051	Ga0075364_10001306	Ga0075364_100013068	353
562	3300006051	Ga0075364_10003711	Ga0075364_100037116	353
563	3300006051	Ga0075364_10041388	Ga0075364_100413882	353
564	3300006058	Ga0075432_10001475	Ga0075432_100014754	353
565	3300006178	Ga0075367_10019903	Ga0075367_100199033	353
566	3300006186	Ga0075369_10011858	Ga0075369_100118581	353
567	3300006186	Ga0075369_10022846	Ga0075369_100228462	353
568	3300006195	Ga0075366_10005237	Ga0075366_100052377	353
569	3300006195	Ga0075366_10011180	Ga0075366_100111801	353
570	3300006353	Ga0075370_10011130	Ga0075370_100111304	353
571	3300006881	Ga0068865_100039310	Ga0068865_1000393102	353
572	3300006881	Ga0068865_100040198	Ga0068865_1000401984	353
573	3300006931	Ga0097620_100004410	Ga0097620_1000044109	353
574	3300006948	Ga0099826_10000894	Ga0099826_100008947	353
575	3300007265	Ga0099794_10017600	Ga0099794_100176002	353
576	3300007265	Ga0099794_10077275	Ga0099794_100772751	353
577	3300009093	Ga0105240_10037011	Ga0105240_100370111	353
578	3300009176	Ga0105242_10005758	Ga0105242_100057583	353
579	3300009176	Ga0105242_10018789	Ga0105242_100187895	353
580	3300009551	Ga0105238_10121819	Ga0105238_101218191	353
581	3300009553	Ga0105249_10027507	Ga0105249_100275075	353
582	3300010159	Ga0099796_10007620	Ga0099796_100076201	353
583	3300013102	Ga0157371_10000003	Ga0157371_1000000342	353
584	3300013306	Ga0163162_10001148	Ga0163162_1000114811	353
585	3300014325	Ga0163163_10004403	Ga0163163_100044034	353
586	3300014326	Ga0157380_10002614	Ga0157380_100026142	353
587	3300014326	Ga0157380_10023465	Ga0157380_100234652	353
588	3300014497	Ga0182008_10002226	Ga0182008_100022268	353
589	3300014497	Ga0182008_10056295	Ga0182008_100562951	353
590	3300015262	Ga0182007_10001939	Ga0182007_100019394	353
591	3300015265	Ga0182005_1000142	Ga0182005_100014229	353
592	3300017792	Ga0163161_10002188	Ga0163161_100021887	353
593	3300021361	Ga0213872_10000333	Ga0213872_1000033335	353
594	3300021361	Ga0213872_10001672	Ga0213872_100016726	353
595	3300025206	Ga0209435_100002	Ga0209435_100002279	353
596	3300025206	Ga0209435_100004	Ga0209435_100004562	353
597	3300025208	Ga0209436_104659	Ga0209436_1046592	353
598	3300025224	Ga0209784_100034	Ga0209784_10003425	353
599	3300025225	Ga0209566_100038	Ga0209566_100038274	353
600	3300025226	Ga0209674_100056	Ga0209674_10005625	353
601	3300025229	Ga0209147_100011	Ga0209147_100011631	353
602	3300025230	Ga0209563_100057	Ga0209563_100057274	353
603	3300025231	Ga0207427_100853	Ga0207427_10085311	353
604	3300025233	Ga0209437_100071	Ga0209437_100071274	353
605	3300025233	Ga0209437_100393	Ga0209437_10039326	353
606	3300025245	Ga0207425_1000717	Ga0207425_100071710	353
607	3300025245	Ga0207425_1003493	Ga0207425_10034935	353
608	3300025246	Ga0209646_1000001	Ga0209646_10000012422	353
609	3300025246	Ga0209646_1000149	Ga0209646_100014944	353
610	3300025246	Ga0209646_1000233	Ga0209646_10002335	353
611	3300025250	Ga0209026_1000001	Ga0209026_10000011079	353
612	3300025250	Ga0209026_1000066	Ga0209026_100006614	353
613	3300025250	Ga0209026_1005624	Ga0209026_10056242	353
614	3300025253	Ga0209677_100035	Ga0209677_10003525	353
615	3300025256	Ga0209759_1000001	Ga0209759_10000012053	353
616	3300025256	Ga0209759_1000182	Ga0209759_100018252	353
617	3300025258	Ga0209129_1000185	Ga0209129_100018525	353
618	3300025261	Ga0209233_1000094	Ga0209233_1000094274	353
619	3300025263	Ga0209565_1000098	Ga0209565_100009834	353
620	3300025263	Ga0209565_1000128	Ga0209565_100012810	353
621	3300025263	Ga0209565_1005369	Ga0209565_10053691	353
622	3300025272	Ga0209455_1000596	Ga0209455_100059614	353
623	3300025273	Ga0209673_1000008	Ga0209673_100000833	353
624	3300025273	Ga0209673_1000058	Ga0209673_1000058217	353
625	3300025273	Ga0209673_1002131	Ga0209673_10021315	353
626	3300025273	Ga0209673_1014354	Ga0209673_10143543	353
627	3300025273	Ga0209673_1016496	Ga0209673_10164962	353
628	3300025284	Ga0209130_1000104	Ga0209130_10001041	353
629	3300025284	Ga0209130_1001248	Ga0209130_100124815	353
630	3300025291	Ga0209675_1000010	Ga0209675_100001049	353
631	3300025291	Ga0209675_1000099	Ga0209675_100009963	353
632	3300025292	Ga0209676_1000023	Ga0209676_1000023401	353
633	3300025292	Ga0209676_1008286	Ga0209676_10082861	353
634	3300025294	Ga0209025_1004318	Ga0209025_10043181	353
635	3300025294	Ga0209025_1008169	Ga0209025_10081697	353
636	3300025294	Ga0209025_1019436	Ga0209025_10194365	353
637	3300025295	Ga0209564_1000349	Ga0209564_100034925	353
638	3300025295	Ga0209564_1000543	Ga0209564_100054321	353
639	3300025295	Ga0209564_1001769	Ga0209564_100176917	353
640	3300025297	Ga0209758_1000339	Ga0209758_100033956	353
641	3300025297	Ga0209758_1001209	Ga0209758_100120913	353
642	3300025298	Ga0209050_1000022	Ga0209050_1000022383	353
643	3300025298	Ga0209050_1003402	Ga0209050_10034024	353
644	3300025298	Ga0209050_1011963	Ga0209050_10119635	353
645	3300025299	Ga0209256_1000001	Ga0209256_10000011869	353
646	3300025302	Ga0207426_1000156	Ga0207426_10001565	353
647	3300025302	Ga0207426_1001899	Ga0207426_10018994	353
648	3300025303	Ga0209051_1000013	Ga0209051_1000013383	353
649	3300025303	Ga0209051_1007172	Ga0209051_10071725	353
650	3300025304	Ga0209257_1000033	Ga0209257_1000033479	353
651	3300025304	Ga0209257_1000042	Ga0209257_1000042104	353
652	3300025899	Ga0207642_10002100	Ga0207642_100021006	353
653	3300025913	Ga0207695_10002079	Ga0207695_1000207924	353
654	3300025914	Ga0207671_10092484	Ga0207671_100924842	353
655	3300025920	Ga0207649_10003219	Ga0207649_100032195	353
656	3300025923	Ga0207681_10000420	Ga0207681_1000042019	353
657	3300025923	Ga0207681_10007568	Ga0207681_100075683	353
658	3300025925	Ga0207650_10000553	Ga0207650_1000055320	353
659	3300025925	Ga0207650_10001006	Ga0207650_1000100616	353
660	3300025926	Ga0207659_10001264	Ga0207659_1000126411	353
661	3300025927	Ga0207687_10048321	Ga0207687_100483211	353
662	3300025932	Ga0207690_10005140	Ga0207690_100051406	353
663	3300025933	Ga0207706_10004957	Ga0207706_100049578	353
664	3300025933	Ga0207706_10037247	Ga0207706_100372471	353
665	3300025934	Ga0207686_10042706	Ga0207686_100427062	353
666	3300025937	Ga0207669_10018523	Ga0207669_100185233	353
667	3300025939	Ga0207665_10012383	Ga0207665_100123834	353
668	3300025942	Ga0207689_10005334	Ga0207689_1000533411	353
669	3300025942	Ga0207689_10017773	Ga0207689_100177734	353
670	3300025945	Ga0207679_10001217	Ga0207679_100012172	353
671	3300025945	Ga0207679_10025836	Ga0207679_100258361	353
672	3300025949	Ga0207667_10000043	Ga0207667_10000043228	353
673	3300025960	Ga0207651_10004767	Ga0207651_100047674	353
674	3300025972	Ga0207668_10017137	Ga0207668_100171375	353
675	3300025972	Ga0207668_10091941	Ga0207668_100919412	353
676	3300025981	Ga0207640_10082276	Ga0207640_100822761	353
677	3300025986	Ga0207658_10000212	Ga0207658_1000021217	353
678	3300026075	Ga0207708_10077478	Ga0207708_100774782	353
679	3300026088	Ga0207641_10001060	Ga0207641_1000106015	353
680	3300026095	Ga0207676_10010713	Ga0207676_100107132	353
681	3300026116	Ga0207674_10136133	Ga0207674_101361333	353
682	3300026118	Ga0207675_100008476	Ga0207675_1000084769	353
683	3300026118	Ga0207675_100026415	Ga0207675_1000264154	353
684	3300026121	Ga0207683_10133007	Ga0207683_101330072	353
685	3300026142	Ga0207698_10090752	Ga0207698_100907522	353
686	3300027471	Ga0209995_1009093	Ga0209995_10090931	353
687	3300027666	Ga0209282_1000362	Ga0209282_10003625	353
688	3300027671	Ga0209588_1000820	Ga0209588_10008204	353
689	3300027876	Ga0209974_10027722	Ga0209974_100277222	353
690	3300028381	Ga0268264_10001043	Ga0268264_1000104315	353
691	3300028666	Ga0265336_10000822	Ga0265336_1000082210	353
692	3300028786	Ga0307517_10012331	Ga0307517_1001233110	353
693	3300028794	Ga0307515_10000139	Ga0307515_1000013981	353
694	3300028794	Ga0307515_10006898	Ga0307515_100068988	353
695	3300028794	Ga0307515_10010714	Ga0307515_1001071411	353
696	3300028794	Ga0307515_10018130	Ga0307515_100181309	353
697	3300028794	Ga0307515_10093591	Ga0307515_100935912	353
698	3300028800	Ga0265338_10110469	Ga0265338_101104692	353
699	3300029957	Ga0265324_10002038	Ga0265324_100020388	353
700	3300031238	Ga0265332_10000292	Ga0265332_1000029234	353
701	3300031241	Ga0265325_10010371	Ga0265325_100103715	353
702	3300031251	Ga0265327_10000247	Ga0265327_1000024733	353
703	3300031344	Ga0265316_10000069	Ga0265316_1000006969	353
704	3300031344	Ga0265316_10045333	Ga0265316_100453332	353
705	3300031456	Ga0307513_10000029	Ga0307513_10000029132	353
706	3300031456	Ga0307513_10000038	Ga0307513_1000003887	353
707	3300031456	Ga0307513_10019952	Ga0307513_100199526	353
708	3300031456	Ga0307513_10043294	Ga0307513_100432942	353
709	3300031507	Ga0307509_10001647	Ga0307509_1000164722	353
710	3300031507	Ga0307509_10006706	Ga0307509_100067061	353
711	3300031507	Ga0307509_10029240	Ga0307509_100292406	353
712	3300031548	Ga0307408_100000016	Ga0307408_100000016131	353
713	3300031548	Ga0307408_100141436	Ga0307408_1001414361	353
714	3300031616	Ga0307508_10000028	Ga0307508_1000002896	353
715	3300031616	Ga0307508_10000212	Ga0307508_1000021222	353
716	3300031616	Ga0307508_10001377	Ga0307508_1000137716	353
717	3300031616	Ga0307508_10045147	Ga0307508_100451474	353
718	3300031649	Ga0307514_10003041	Ga0307514_100030418	353
719	3300031730	Ga0307516_10001817	Ga0307516_1000181722	353
720	3300031730	Ga0307516_10002006	Ga0307516_1000200624	353
721	3300031730	Ga0307516_10007489	Ga0307516_100074898	353
722	3300031730	Ga0307516_10164984	Ga0307516_101649841	353
723	3300031731	Ga0307405_10014639	Ga0307405_100146394	353
724	3300031731	Ga0307405_10129156	Ga0307405_101291561	353
725	3300031731	Ga0307405_10194634	Ga0307405_101946341	353
726	3300031852	Ga0307410_10022173	Ga0307410_100221731	353
727	3300031901	Ga0307406_10012755	Ga0307406_100127555	353
728	3300031911	Ga0307412_10007399	Ga0307412_100073994	353
729	3300031995	Ga0307409_100000528	Ga0307409_10000052815	353
730	3300032002	Ga0307416_100002866	Ga0307416_1000028668	353
731	3300032005	Ga0307411_10000207	Ga0307411_100002074	353
732	3300032005	Ga0307411_10022548	Ga0307411_100225483	353
733	3300032005	Ga0307411_10023117	Ga0307411_100231172	353
734	3300032005	Ga0307411_10102467	Ga0307411_101024672	353
735	3300032126	Ga0307415_100000956	Ga0307415_10000095610	353
736	3300033180	Ga0307510_10001817	Ga0307510_1000181720	353
737	3300033180	Ga0307510_10014828	Ga0307510_100148288	353
738	3300033180	Ga0307510_10059773	Ga0307510_100597734	353
739	3300035089	Ga0373944_0019985	Ga0373944_0019985_565_1746	353
740	3300035092	Ga0373952_0002609	Ga0373952_0002609_1590_2756	353
741	3300035113	Ga0373936_0002768	Ga0373936_0002768_3817_4998	353
742	3300035114	Ga0373939_0000115	Ga0373939_0000115_18167_19348	353
743	3300035117	Ga0373953_0001403	Ga0373953_0001403_3793_4974	353
744	3300035118	Ga0373954_0018111	Ga0373954_0018111_1656_2837	353
745	3300035120	Ga0373957_0009453	Ga0373957_0009453_1767_2948	353
746	3300035121	Ga0373960_0000107	Ga0373960_0000107_2297_3478	353
747	3300035171	Ga0373946_0012927	Ga0373946_0012927_652_1833	353
748	3300035410	Ga0373924_0006400	Ga0373924_0006400_2640_3821	353
749	3300035691	Ga0373931_0000152	Ga0373931_0000152_13328_14509	353
750	3300035691	Ga0373931_0017494	Ga0373931_0017494_1384_2565	353
751	3300035691	Ga0373931_0037570	Ga0373931_0037570_1305_2468	353
752	3300035692	Ga0373935_0049667	Ga0373935_0049667_954_2135	353
753	3300035695	Ga0373927_0027042	Ga0373927_0027042_684_1865	353
754	3300035724	Ga0373933_0074738	Ga0373933_0074738_766_1947	353
755	3300036401	Ga0373937_0042897	Ga0373937_0042897_2827_4008	353
756	3300036401	Ga0373937_0147047	Ga0373937_0147047_422_1642	353
757	3300037068	Ga0373925_0006928	Ga0373925_0006928_1945_3126	353
758	3300037068	Ga0373925_0016010	Ga0373925_0016010_3733_4914	353
759	3300037312	Ga0395899_0000329	Ga0395899_0000329_23834_25027	353
760	3300037471	Ga0395905_0001494	Ga0395905_0001494_3949_5130	353
761	3300039447	Ga0436361_0027627	Ga0436361_0027627_1668_2837	353
762	3300039447	Ga0436361_0043634	Ga0436361_0043634_15543_16706	353
763	3300039447	Ga0436361_0653054	Ga0436361_0653054_8032_9213	353
764	3300039447	Ga0436361_0756295	Ga0436361_0756295_342_1511	353
765	3300039447	Ga0436361_0891393	Ga0436361_0891393_36574_37743	353
766	3300042115	Ga0450911_000644	Ga0450911_000644_3755_4936	353
767	3300042130	Ga0450892_000175	Ga0450892_000175_4586_5767	353
768	3300042876	Ga0451577_0052775	Ga0451577_0052775_1044_2207	353
769	3300044683	Ga0466965_0009545	Ga0466965_0009545_1422_2603	353
770	3300044684	Ga0466966_0006925	Ga0466966_0006925_875_2044	353
771	3300044693	Ga0466961_0000371	Ga0466961_0000371_23246_24415	353
772	3300044712	Ga0453684_0002735	Ga0453684_0002735_38838_40001	353
773	3300044712	Ga0453684_0366164	Ga0453684_0366164_352_1533	353
774	3300044765	Ga0466970_0053949	Ga0466970_0053949_807_1976	353
775	3300045049	Ga0466959_0030903	Ga0466959_0030903_805_1974	353
776	3300046454	Ga0495592_0004208	Ga0495592_0004208_3355_4536	353
777	3300046454	Ga0495592_0007024	Ga0495592_0007024_3200_4381	353
778	3300046454	Ga0495592_0221010	Ga0495592_0221010_28_1209	353
779	3300046461	Ga0495641_0022971	Ga0495641_0022971_1237_2418	353
780	3300046462	Ga0495651_0011936	Ga0495651_0011936_1223_2404	353
781	3300046462	Ga0495651_0057791	Ga0495651_0057791_327_1487	353
782	3300046463	Ga0495653_0002451	Ga0495653_0002451_3795_4976	353
783	3300046473	Ga0495582_0061872	Ga0495582_0061872_505_1686	353
784	3300046475	Ga0495639_0001353	Ga0495639_0001353_922_2103	353
785	3300046476	Ga0495662_0016770	Ga0495662_0016770_1147_2328	353
786	3300046499	Ga0495594_0058091	Ga0495594_0058091_80_1261	353
787	3300046511	Ga0495608_0011241	Ga0495608_0011241_903_2084	353
788	3300046514	Ga0495618_0153032	Ga0495618_0153032_138_1298	353
789	3300046516	Ga0495628_0009168	Ga0495628_0009168_1794_2975	353
790	3300046516	Ga0495628_0010917	Ga0495628_0010917_5237_6397	353
791	3300046516	Ga0495628_0017800	Ga0495628_0017800_3689_4870	353
792	3300046516	Ga0495628_0029195	Ga0495628_0029195_381_1562	353
793	3300046529	Ga0495652_0034109	Ga0495652_0034109_2394_3575	353
794	3300046529	Ga0495652_0093956	Ga0495652_0093956_312_1493	353
795	3300046529	Ga0495652_0097826	Ga0495652_0097826_841_2022	353
796	3300046529	Ga0495652_0231475	Ga0495652_0231475_21_1181	353
797	3300046531	Ga0495665_0044874	Ga0495665_0044874_527_1708	353
798	3300046535	Ga0495586_0022098	Ga0495586_0022098_129_1310	353
799	3300046536	Ga0495587_0015066	Ga0495587_0015066_1861_3042	353
800	3300046543	Ga0495645_0000366	Ga0495645_0000366_3784_4965	353
801	3300046557	Ga0495622_0027921	Ga0495622_0027921_1370_2551	353
802	3300046557	Ga0495622_0028370	Ga0495622_0028370_644_1825	353
803	3300046660	Ga0495625_0001007	Ga0495625_0001007_9355_10536	353
804	3300046660	Ga0495625_0003200	Ga0495625_0003200_1817_3049	353
805	3300046663	Ga0495635_0018406	Ga0495635_0018406_3159_4340	353
806	3300046675	Ga0495657_0008873	Ga0495657_0008873_3659_4840	353
807	3300046678	Ga0495599_0001911	Ga0495599_0001911_1185_2366	353
808	3300046678	Ga0495599_0005546	Ga0495599_0005546_382_1563	353
809	3300046679	Ga0495623_0034322	Ga0495623_0034322_1604_2764	353
810	3300046681	Ga0495647_0001901	Ga0495647_0001901_1173_2354	353
811	3300046689	Ga0495613_0030162	Ga0495613_0030162_1057_2238	353
812	3300046690	Ga0495624_0033172	Ga0495624_0033172_1126_2307	353
813	3300046809	Ga0495600_0025844	Ga0495600_0025844_1485_2666	353
814	3300047317	Ga0495604_0026850	Ga0495604_0026850_229_1410	353
815	3300047321	Ga0495676_0050045	Ga0495676_0050045_641_1822	353
816	3300047443	Ga0495687_000890	Ga0495687_000890_6076_7257	353
817	3300047443	Ga0495687_023652	Ga0495687_023652_1222_2403	353
818	3300047444	Ga0495675_0008550	Ga0495675_0008550_3373_4554	353
819	3300047471	Ga0495684_0025638	Ga0495684_0025638_3227_4408	353
820	3300048904	Ga0496101_0092416	Ga0496101_0092416_536_1741	353
821	3300048919	Ga0496116_0026635	Ga0496116_0026635_1060_2238	353
822	3300048924	Ga0496121_0203299	Ga0496121_0203299_88_1266	353
823	3300048925	Ga0496122_0000612	Ga0496122_0000612_12657_13838	353
824	3300048925	Ga0496122_0003378	Ga0496122_0003378_1170_2333	353
825	3300048926	Ga0496123_0000274	Ga0496123_0000274_87958_89139	353
826	3300048926	Ga0496123_0000916	Ga0496123_0000916_23168_24331	353
827	3300048928	Ga0496125_0004656	Ga0496125_0004656_13610_14788	353
828	3300049570	Ga0501033_0007045	Ga0501033_0007045_3601_4785	353
829	3300049571	Ga0501034_0042191	Ga0501034_0042191_1639_2823	353
830	3300049580	Ga0501046_0000051	Ga0501046_0000051_104325_105506	353
831	3300049581	Ga0501047_0000003	Ga0501047_0000003_402898_404079	353
832	3300049582	Ga0501048_0023957	Ga0501048_0023957_2088_3269	353
833	3300049589	Ga0501073_0152505	Ga0501073_0152505_362_1546	353
834	3300049658	Ga0501211_000837	Ga0501211_000837_1737_2918	353
835	3300049704	Ga0501221_007635	Ga0501221_007635_521_1702	353
836	3300049742	Ga0501080_0185057	Ga0501080_0185057_528_1712	353
837	3300049757	Ga0501232_001808	Ga0501232_001808_544_1725	353
838	3300049823	Ga0501044_0021562	Ga0501044_0021562_2411_3595	353
839	3300050489	nmdc:mga03683_11342_c1	nmdc:mga03683_11342_c1_1466_2647	353
840	3300050491	nmdc:mga00v17_13579_c1	nmdc:mga00v17_13579_c1_1247_2461	353
841	3300050491	nmdc:mga00v17_62026_c1	nmdc:mga00v17_62026_c1_876_2057	353
842	3300050493	nmdc:mga0k408_19633_c1	nmdc:mga0k408_19633_c1_1389_2570	353
843	3300050493	nmdc:mga0k408_29749_c1	nmdc:mga0k408_29749_c1_1253_2434	353
844	3300050493	nmdc:mga0k408_4953_c1	nmdc:mga0k408_4953_c1_1646_2827	353
845	3300050496	nmdc:mga07m45_12903_c1	nmdc:mga07m45_12903_c1_1132_2313	353
846	3300050496	nmdc:mga07m45_2117_c1	nmdc:mga07m45_2117_c1_6228_7409	353
847	3300050496	nmdc:mga07m45_2148_c1	nmdc:mga07m45_2148_c1_2174_3355	353
848	3300050496	nmdc:mga07m45_4744_c1	nmdc:mga07m45_4744_c1_5302_6483	353
849	3300050516	nmdc:mga0sz30_18909_c1	nmdc:mga0sz30_18909_c1_1209_2390	353
850	3300053077	Ga0495601_0003328	Ga0495601_0003328_3681_4862	353
851	3300053077	Ga0495601_0024437	Ga0495601_0024437_2455_3636	353
852	3300053084	Ga0495595_0002687	Ga0495595_0002687_97_1278	353
853	3300053085	Ga0495619_0003760	Ga0495619_0003760_1091_2272	353
854	3300053093	Ga0500651_0034223	Ga0500651_0034223_1617_2900	353
855	3300053131	Ga0500652_000663	Ga0500652_000663_8160_9443	353
856	3300053134	Ga0500658_0002762	Ga0500658_0002762_3885_5066	353
857	3300053136	Ga0500559_0000133	Ga0500559_0000133_6939_8120	353
858	3300053156	Ga0500622_0000307	Ga0500622_0000307_46387_47670	353
859	3300053156	Ga0500622_0041807	Ga0500622_0041807_619_1800	353
860	3300053730	Ga0500645_001732	Ga0500645_001732_5864_7048	353
861	iso_pu_bacteria	2510065045	2510252968	353
862	iso_pu_bacteria	2939631187	2939634086	353
863	3300001979	JGI24740J21852_10013967	JGI24740J21852_100139674	354
864	3300002704	JGI25155J39150_1000403	JGI25155J39150_10004035	354
865	3300002704	JGI25155J39150_1000671	JGI25155J39150_10006715	354
866	3300002705	JGI25156J39149_1001439	JGI25156J39149_10014395	354
867	3300002738	JGI25154J39366_1000107	JGI25154J39366_100010775	354
868	3300002774	JGI25150J39212_1001018	JGI25150J39212_10010183	354
869	3300003187	JGI25151J46595_10011710	JGI25151J46595_100117103	354
870	3300003751	Ga0055538_1000085	Ga0055538_100008530	354
871	3300003752	Ga0055539_1000126	Ga0055539_100012630	354
872	3300003756	Ga0055533_1000133	Ga0055533_100013330	354
873	3300003759	Ga0055525_1000054	Ga0055525_1000054158	354
874	3300003759	Ga0055525_1000174	Ga0055525_100017430	354
875	3300003761	Ga0055535_1000286	Ga0055535_100028645	354
876	3300003762	Ga0055542_1000080	Ga0055542_100008045	354
877	3300003775	Ga0055524_1000950	Ga0055524_10009503	354
878	3300003791	Ga0055530_10005015	Ga0055530_100050151	354
879	3300003792	Ga0055540_1000280	Ga0055540_100028021	354
880	3300003794	Ga0055531_10008413	Ga0055531_100084131	354
881	3300003841	Ga0055541_1000085	Ga0055541_100008547	354
882	3300005333	Ga0070677_10076458	Ga0070677_100764581	354
883	3300005539	Ga0068853_100009229	Ga0068853_1000092293	354
884	3300005539	Ga0068853_100042632	Ga0068853_1000426324	354
885	3300005548	Ga0070665_100035834	Ga0070665_1000358343	354
886	3300005563	Ga0068855_100298212	Ga0068855_1002982122	354
887	3300005578	Ga0068854_100002477	Ga0068854_1000024773	354
888	3300005618	Ga0068864_100007242	Ga0068864_1000072424	354
889	3300005618	Ga0068864_100008061	Ga0068864_1000080613	354
890	3300005834	Ga0068851_10016446	Ga0068851_100164462	354
891	3300006051	Ga0075364_10009882	Ga0075364_100098826	354
892	3300006175	Ga0070712_100012658	Ga0070712_1000126587	354
893	3300006177	Ga0075362_10019779	Ga0075362_100197792	354
894	3300006946	Ga0079104_1000016	Ga0079104_100001681	354
895	3300006946	Ga0079104_1000053	Ga0079104_1000053104	354
896	3300006946	Ga0079104_1006366	Ga0079104_10063661	354
897	3300009036	Ga0105244_10002827	Ga0105244_100028276	354
898	3300009036	Ga0105244_10056709	Ga0105244_100567091	354
899	3300009093	Ga0105240_10106158	Ga0105240_101061582	354
900	3300009148	Ga0105243_10009190	Ga0105243_100091905	354
901	3300009177	Ga0105248_10005965	Ga0105248_100059659	354
902	3300009545	Ga0105237_10018091	Ga0105237_100180917	354
903	3300009545	Ga0105237_10155782	Ga0105237_101557821	354
904	3300009551	Ga0105238_10000038	Ga0105238_1000003831	354
905	3300009551	Ga0105238_10098567	Ga0105238_100985671	354
906	3300010375	Ga0105239_10004364	Ga0105239_100043646	354
907	3300013105	Ga0157369_10002892	Ga0157369_1000289215	354
908	3300014968	Ga0157379_10025849	Ga0157379_100258495	354
909	3300015683	Ga0183362_10003	Ga0183362_10003673	354
910	3300017792	Ga0163161_10010750	Ga0163161_100107505	354
911	3300021361	Ga0213872_10000167	Ga0213872_1000016715	354
912	3300021361	Ga0213872_10000982	Ga0213872_1000098212	354
913	3300021361	Ga0213872_10007693	Ga0213872_100076935	354
914	3300025206	Ga0209435_100711	Ga0209435_1007115	354
915	3300025224	Ga0209784_100021	Ga0209784_10002177	354
916	3300025225	Ga0209566_100039	Ga0209566_10003978	354
917	3300025226	Ga0209674_100036	Ga0209674_10003677	354
918	3300025229	Ga0209147_100450	Ga0209147_10045016	354
919	3300025230	Ga0209563_100040	Ga0209563_10004077	354
920	3300025230	Ga0209563_100075	Ga0209563_10007538	354
921	3300025242	Ga0209258_100093	Ga0209258_10009366	354
922	3300025245	Ga0207425_1001026	Ga0207425_10010265	354
923	3300025246	Ga0209646_1000191	Ga0209646_100019120	354
924	3300025250	Ga0209026_1002225	Ga0209026_10022255	354
925	3300025253	Ga0209677_100023	Ga0209677_10002377	354
926	3300025254	Ga0209148_1000007	Ga0209148_10000071033	354
927	3300025256	Ga0209759_1000072	Ga0209759_100007249	354
928	3300025258	Ga0209129_1000024	Ga0209129_100002444	354
929	3300025263	Ga0209565_1013293	Ga0209565_10132931	354
930	3300025284	Ga0209130_1000757	Ga0209130_100075724	354
931	3300025284	Ga0209130_1001429	Ga0209130_100142912	354
932	3300025291	Ga0209675_1000695	Ga0209675_100069520	354
933	3300025291	Ga0209675_1001131	Ga0209675_100113114	354
934	3300025291	Ga0209675_1004911	Ga0209675_10049116	354
935	3300025292	Ga0209676_1000028	Ga0209676_1000028314	354
936	3300025292	Ga0209676_1000317	Ga0209676_100031728	354
937	3300025292	Ga0209676_1001130	Ga0209676_10011309	354
938	3300025294	Ga0209025_1000776	Ga0209025_100077652	354
939	3300025294	Ga0209025_1001526	Ga0209025_100152625	354
940	3300025294	Ga0209025_1004675	Ga0209025_10046755	354
941	3300025295	Ga0209564_1001505	Ga0209564_100150520	354
942	3300025295	Ga0209564_1002447	Ga0209564_10024471	354
943	3300025297	Ga0209758_1000510	Ga0209758_10005106	354
944	3300025297	Ga0209758_1018820	Ga0209758_10188202	354
945	3300025298	Ga0209050_1000072	Ga0209050_100007270	354
946	3300025298	Ga0209050_1000786	Ga0209050_100078623	354
947	3300025299	Ga0209256_1000045	Ga0209256_1000045149	354
948	3300025299	Ga0209256_1000151	Ga0209256_1000151122	354
949	3300025299	Ga0209256_1000256	Ga0209256_10002561	354
950	3300025302	Ga0207426_1000049	Ga0207426_1000049361	354
951	3300025302	Ga0207426_1000315	Ga0207426_10003151	354
952	3300025303	Ga0209051_1000004	Ga0209051_10000041050	354
953	3300025303	Ga0209051_1000015	Ga0209051_1000015243	354
954	3300025303	Ga0209051_1000056	Ga0209051_1000056157	354
955	3300025303	Ga0209051_1000392	Ga0209051_100039239	354
956	3300025303	Ga0209051_1017524	Ga0209051_10175243	354
957	3300025304	Ga0209257_1000037	Ga0209257_1000037502	354
958	3300025304	Ga0209257_1000315	Ga0209257_100031523	354
959	3300025711	Ga0207696_1002531	Ga0207696_10025312	354
960	3300025728	Ga0207655_1002097	Ga0207655_100209714	354
961	3300025913	Ga0207695_10000979	Ga0207695_100009796	354
962	3300025913	Ga0207695_10016069	Ga0207695_100160698	354
963	3300025914	Ga0207671_10001710	Ga0207671_1000171012	354
964	3300025914	Ga0207671_10003773	Ga0207671_1000377315	354
965	3300025914	Ga0207671_10076784	Ga0207671_100767842	354
966	3300025915	Ga0207693_10020549	Ga0207693_100205491	354
967	3300025924	Ga0207694_10000069	Ga0207694_1000006976	354
968	3300025924	Ga0207694_10042314	Ga0207694_100423141	354
969	3300025924	Ga0207694_10086456	Ga0207694_100864562	354
970	3300025934	Ga0207686_10052447	Ga0207686_100524472	354
971	3300025935	Ga0207709_10000117	Ga0207709_1000011771	354
972	3300025935	Ga0207709_10000955	Ga0207709_100009558	354
973	3300025941	Ga0207711_10025563	Ga0207711_100255634	354
974	3300025949	Ga0207667_10009925	Ga0207667_1000992510	354
975	3300025949	Ga0207667_10025668	Ga0207667_100256681	354
976	3300025949	Ga0207667_10030751	Ga0207667_100307512	354
977	3300025981	Ga0207640_10051251	Ga0207640_100512513	354
978	3300026035	Ga0207703_10200691	Ga0207703_102006912	354
979	3300026041	Ga0207639_10142630	Ga0207639_101426302	354
980	3300026088	Ga0207641_10137768	Ga0207641_101377681	354
981	3300026095	Ga0207676_10101148	Ga0207676_101011482	354
982	3300026116	Ga0207674_10099453	Ga0207674_100994532	354
983	3300027111	Ga0209281_1000017	Ga0209281_100001791	354
984	3300027111	Ga0209281_1000147	Ga0209281_1000147104	354
985	3300028379	Ga0268266_10013661	Ga0268266_100136615	354
986	3300028794	Ga0307515_10000096	Ga0307515_1000009657	354
987	3300028794	Ga0307515_10070862	Ga0307515_100708624	354
988	3300030521	Ga0307511_10004057	Ga0307511_100040574	354
989	3300030732	Ga0316176_1060699	Ga0316176_10606992	354
990	3300031235	Ga0265330_10000091	Ga0265330_1000009141	354
991	3300031238	Ga0265332_10000028	Ga0265332_10000028151	354
992	3300031240	Ga0265320_10064983	Ga0265320_100649831	354
993	3300031241	Ga0265325_10009426	Ga0265325_100094265	354
994	3300031247	Ga0265340_10021521	Ga0265340_100215211	354
995	3300031251	Ga0265327_10000364	Ga0265327_100003649	354
996	3300031251	Ga0265327_10006673	Ga0265327_100066735	354
997	3300031507	Ga0307509_10000127	Ga0307509_1000012716	354
998	3300031507	Ga0307509_10000500	Ga0307509_1000050029	354
999	3300031548	Ga0307408_100000263	Ga0307408_1000002639	354
1000	3300031649	Ga0307514_10000369	Ga0307514_1000036938	354
1001	3300031711	Ga0265314_10000054	Ga0265314_10000054151	354
1002	3300031727	Ga0316576_10000452	Ga0316576_1000045212	354
1003	3300031728	Ga0316578_10000723	Ga0316578_100007232	354
1004	3300031731	Ga0307405_10013156	Ga0307405_100131562	354
1005	3300031731	Ga0307405_10022795	Ga0307405_100227951	354
1006	3300031733	Ga0316577_10004626	Ga0316577_100046265	354
1007	3300031824	Ga0307413_10014573	Ga0307413_100145731	354
1008	3300031911	Ga0307412_10089028	Ga0307412_100890282	354
1009	3300031995	Ga0307409_100210644	Ga0307409_1002106442	354
1010	3300032002	Ga0307416_100004470	Ga0307416_1000044702	354
1011	3300032005	Ga0307411_10063927	Ga0307411_100639271	354
1012	3300032005	Ga0307411_10088880	Ga0307411_100888802	354
1013	3300032137	Ga0316585_10000662	Ga0316585_100006623	354
1014	3300032139	Ga0316580_10000392	Ga0316580_100003927	354
1015	3300033179	Ga0307507_10074188	Ga0307507_100741882	354
1016	3300033541	Ga0316596_1005806	Ga0316596_10058063	354
1017	3300035398	Ga0316574_0000224	Ga0316574_0000224_16661_17827	354
1018	3300036401	Ga0373937_0115378	Ga0373937_0115378_255_1442	354
1019	3300036647	Ga0316582_0000019	Ga0316582_0000019_16369_17535	354
1020	3300036712	Ga0316584_0006785	Ga0316584_0006785_2263_3429	354
1021	3300037418	Ga0395900_0005802	Ga0395900_0005802_8181_9374	354
1022	3300037418	Ga0395900_0036767	Ga0395900_0036767_3681_4844	354
1023	3300037471	Ga0395905_0000181	Ga0395905_0000181_60532_61773	354
1024	3300038443	Ga0395901_0001622	Ga0395901_0001622_21960_23123	354
1025	3300039447	Ga0436361_0046388	Ga0436361_0046388_17499_18845	354
1026	3300039447	Ga0436361_0224146	Ga0436361_0224146_579_1802	354
1027	3300039447	Ga0436361_0375867	Ga0436361_0375867_741_1904	354
1028	3300039447	Ga0436361_0447230	Ga0436361_0447230_10193_11383	354
1029	3300039447	Ga0436361_0540776	Ga0436361_0540776_740_1921	354
1030	3300039447	Ga0436361_0940884	Ga0436361_0940884_211_1395	354
1031	3300041456	Ga0451795_0441351	Ga0451795_0441351_414_1598	354
1032	3300042007	Ga0439449_0000718	Ga0439449_0000718_5214_6440	354
1033	3300042007	Ga0439449_0020437	Ga0439449_0020437_1112_2338	354
1034	3300042876	Ga0451577_0000388	Ga0451577_0000388_2017_3201	354
1035	3300042876	Ga0451577_0000489	Ga0451577_0000489_63574_64740	354
1036	3300042876	Ga0451577_0002438	Ga0451577_0002438_17396_18583	354
1037	3300042876	Ga0451577_0007943	Ga0451577_0007943_7696_8877	354
1038	3300042876	Ga0451577_0073590	Ga0451577_0073590_510_1676	354
1039	3300044658	Ga0466972_0000345	Ga0466972_0000345_15731_16894	354
1040	3300044673	Ga0453683_0003537	Ga0453683_0003537_704_1885	354
1041	3300044706	Ga0466964_0065737	Ga0466964_0065737_251_1462	354
1042	3300044712	Ga0453684_0000014	Ga0453684_0000014_434540_435706	354
1043	3300044712	Ga0453684_0000187	Ga0453684_0000187_2919_4103	354
1044	3300044712	Ga0453684_0000731	Ga0453684_0000731_1822_2988	354
1045	3300044712	Ga0453684_0000826	Ga0453684_0000826_1373_2539	354
1046	3300044712	Ga0453684_0001597	Ga0453684_0001597_38871_40049	354
1047	3300044712	Ga0453684_0032472	Ga0453684_0032472_4404_5585	354
1048	3300045051	Ga0451576_0000140	Ga0451576_0000140_117531_118697	354
1049	3300045051	Ga0451576_0000272	Ga0451576_0000272_68009_69187	354
1050	3300045051	Ga0451576_0000925	Ga0451576_0000925_2127_3296	354
1051	3300045051	Ga0451576_0002279	Ga0451576_0002279_22330_23517	354
1052	3300045051	Ga0451576_0016220	Ga0451576_0016220_1729_2895	354
1053	3300045051	Ga0451576_0060769	Ga0451576_0060769_2532_3713	354
1054	3300045051	Ga0451576_0078095	Ga0451576_0078095_1228_2394	354
1055	3300046501	Ga0495607_0000331	Ga0495607_0000331_46569_47735	354
1056	3300046501	Ga0495607_0065782	Ga0495607_0065782_767_1936	354
1057	3300046513	Ga0495616_0000072	Ga0495616_0000072_46023_47189	354
1058	3300046615	Ga0495656_0000173	Ga0495656_0000173_6198_7394	354
1059	3300046615	Ga0495656_0036119	Ga0495656_0036119_291_1457	354
1060	3300047472	Ga0495686_0004536	Ga0495686_0004536_4514_5695	354
1061	3300048905	Ga0496102_0006260	Ga0496102_0006260_7774_8955	354
1062	3300048915	Ga0496112_0046123	Ga0496112_0046123_1901_3064	354
1063	3300048917	Ga0496114_0000554	Ga0496114_0000554_23229_24413	354
1064	3300048917	Ga0496114_0003037	Ga0496114_0003037_10208_11371	354
1065	3300048928	Ga0496125_0012566	Ga0496125_0012566_6442_7605	354
1066	3300048929	Ga0496126_0037081	Ga0496126_0037081_1543_2790	354
1067	3300049571	Ga0501034_0003833	Ga0501034_0003833_8030_9241	354
1068	3300049744	Ga0501083_0181112	Ga0501083_0181112_174_1355	354
1069	3300050491	nmdc:mga00v17_3027_c1	nmdc:mga00v17_3027_c1_3028_4302	354
1070	3300050514	nmdc:mga08x19_124191_c1	nmdc:mga08x19_124191_c1_50_1237	354
1071	3300053093	Ga0500651_0000057	Ga0500651_0000057_26439_27674	354
1072	3300053125	Ga0500618_001130	Ga0500618_001130_10868_12031	354
1073	3300053134	Ga0500658_0000652	Ga0500658_0000652_5863_7098	354
1074	3300001989	JGI24739J22299_10034097	JGI24739J22299_100340972	355
1075	3300003763	Ga0055529_1000854	Ga0055529_100085416	355
1076	3300003790	Ga0055528_1002298	Ga0055528_10022988	355
1077	3300003856	Ga0058692_1000274	Ga0058692_100027428	355
1078	3300005289	Ga0065704_10144622	Ga0065704_101446222	355
1079	3300005334	Ga0068869_100078771	Ga0068869_1000787711	355
1080	3300005337	Ga0070682_100012848	Ga0070682_1000128483	355
1081	3300005337	Ga0070682_100069855	Ga0070682_1000698552	355
1082	3300005339	Ga0070660_100000015	Ga0070660_10000001528	355
1083	3300005354	Ga0070675_100178564	Ga0070675_1001785641	355
1084	3300005366	Ga0070659_100001479	Ga0070659_10000147910	355
1085	3300005367	Ga0070667_100057125	Ga0070667_1000571252	355
1086	3300005440	Ga0070705_100027052	Ga0070705_1000270522	355
1087	3300005455	Ga0070663_100000938	Ga0070663_10000093811	355
1088	3300005456	Ga0070678_100048641	Ga0070678_1000486412	355
1089	3300005459	Ga0068867_100037438	Ga0068867_1000374383	355
1090	3300005543	Ga0070672_100164844	Ga0070672_1001648442	355
1091	3300005544	Ga0070686_100045497	Ga0070686_1000454972	355
1092	3300005563	Ga0068855_100011808	Ga0068855_1000118082	355
1093	3300005564	Ga0070664_100048490	Ga0070664_1000484902	355
1094	3300005937	Ga0081455_10008233	Ga0081455_100082338	355
1095	3300006051	Ga0075364_10000449	Ga0075364_100004495	355
1096	3300006178	Ga0075367_10034518	Ga0075367_100345183	355
1097	3300006237	Ga0097621_100031866	Ga0097621_1000318662	355
1098	3300006358	Ga0068871_100225008	Ga0068871_1002250081	355
1099	3300009101	Ga0105247_10014533	Ga0105247_100145333	355
1100	3300009174	Ga0105241_10048545	Ga0105241_100485452	355
1101	3300009176	Ga0105242_10016919	Ga0105242_100169192	355
1102	3300013297	Ga0157378_10006496	Ga0157378_100064967	355
1103	3300014326	Ga0157380_10322343	Ga0157380_103223431	355
1104	3300014969	Ga0157376_10007505	Ga0157376_100075053	355
1105	3300025228	Ga0209672_100071	Ga0209672_100071110	355
1106	3300025229	Ga0209147_100364	Ga0209147_10036429	355
1107	3300025242	Ga0209258_100207	Ga0209258_100207110	355
1108	3300025254	Ga0209148_1000134	Ga0209148_100013460	355
1109	3300025263	Ga0209565_1006663	Ga0209565_10066632	355
1110	3300025272	Ga0209455_1000241	Ga0209455_100024157	355
1111	3300025273	Ga0209673_1000102	Ga0209673_1000102112	355
1112	3300025291	Ga0209675_1014408	Ga0209675_10144081	355
1113	3300025292	Ga0209676_1007885	Ga0209676_10078855	355
1114	3300025295	Ga0209564_1006257	Ga0209564_10062577	355
1115	3300025315	Ga0207697_10054065	Ga0207697_100540652	355
1116	3300025908	Ga0207643_10006194	Ga0207643_100061942	355
1117	3300025919	Ga0207657_10000039	Ga0207657_1000003990	355
1118	3300025932	Ga0207690_10000010	Ga0207690_1000001028	355
1119	3300025937	Ga0207669_10034823	Ga0207669_100348232	355
1120	3300025939	Ga0207665_10054058	Ga0207665_100540582	355
1121	3300025940	Ga0207691_10031874	Ga0207691_100318743	355
1122	3300025941	Ga0207711_10066916	Ga0207711_100669163	355
1123	3300025986	Ga0207658_10092356	Ga0207658_100923562	355
1124	3300026067	Ga0207678_10000032	Ga0207678_1000003288	355
1125	3300026089	Ga0207648_10080728	Ga0207648_100807282	355
1126	3300026121	Ga0207683_10002129	Ga0207683_100021295	355
1127	3300027312	Ga0209371_1000145	Ga0209371_1000145105	355
1128	3300028800	Ga0265338_10000258	Ga0265338_1000025820	355
1129	3300030500	Ga0268256_1000128	Ga0268256_10001284	355
1130	3300037471	Ga0395905_0064505	Ga0395905_0064505_132_1298	355
1131	3300039447	Ga0436361_0542450	Ga0436361_0542450_963_2141	355
1132	3300042876	Ga0451577_0146747	Ga0451577_0146747_927_2105	355
1133	3300046472	Ga0495580_0057124	Ga0495580_0057124_1467_2633	355
1134	3300046499	Ga0495594_0025720	Ga0495594_0025720_882_2048	355
1135	3300046542	Ga0495597_0000542	Ga0495597_0000542_2078_3262	355
1136	3300046648	Ga0495611_0025136	Ga0495611_0025136_291_1457	355
1137	3300046660	Ga0495625_0003215	Ga0495625_0003215_1257_2489	355
1138	3300046660	Ga0495625_0012242	Ga0495625_0012242_622_1806	355
1139	3300047469	Ga0495673_0000185	Ga0495673_0000185_51113_52315	355
1140	3300047472	Ga0495686_0000728	Ga0495686_0000728_11344_12513	355
1141	3300047472	Ga0495686_0048151	Ga0495686_0048151_401_1585	355
1142	3300048904	Ga0496101_0010759	Ga0496101_0010759_830_2062	355
1143	3300048905	Ga0496102_0010420	Ga0496102_0010420_902_2134	355
1144	3300048906	Ga0496103_0059009	Ga0496103_0059009_956_2188	355
1145	3300048907	Ga0496104_0108344	Ga0496104_0108344_1345_2577	355
1146	3300048908	Ga0496105_0046822	Ga0496105_0046822_1066_2298	355
1147	3300048909	Ga0496106_0012425	Ga0496106_0012425_3815_5047	355
1148	3300048910	Ga0496107_0036208	Ga0496107_0036208_1467_2699	355
1149	3300048917	Ga0496114_0016554	Ga0496114_0016554_1659_2891	355
1150	3300050491	nmdc:mga00v17_44196_c1	nmdc:mga00v17_44196_c1_952_2124	355
1151	3300006844	Ga0075428_100002843	Ga0075428_10000284312	356
1152	3300006847	Ga0075431_100000015	Ga0075431_10000001558	356
1153	3300006880	Ga0075429_100003856	Ga0075429_10000385610	356
1154	3300027907	Ga0207428_10006938	Ga0207428_100069389	356
1155	3300039437	Ga0436365_1366251	Ga0436365_1366251_94_1284	356
1156	3300050508	nmdc:mga09592_156_c1	nmdc:mga09592_156_c1_17665_18852	356
1157	3300050510	nmdc:mga06r32_9_c1	nmdc:mga06r32_9_c1_22282_23469	356
1158	3300050511	nmdc:mga08y16_2769_c1	nmdc:mga08y16_2769_c1_16515_17702	356
1159	3300046455	Ga0495603_0015200	Ga0495603_0015200_1354_2583	357
1160	3300046678	Ga0495599_0066787	Ga0495599_0066787_100_1428	357
1161	3300005344	Ga0070661_100015606	Ga0070661_1000156062	358
1162	3300005458	Ga0070681_10002448	Ga0070681_100024485	358
1163	3300005530	Ga0070679_100002206	Ga0070679_1000022066	358
1164	3300005530	Ga0070679_100098525	Ga0070679_1000985252	358
1165	3300005539	Ga0068853_100002617	Ga0068853_1000026174	358
1166	3300005563	Ga0068855_100177195	Ga0068855_1001771952	358
1167	3300005577	Ga0068857_100068797	Ga0068857_1000687972	358
1168	3300013100	Ga0157373_10014586	Ga0157373_100145864	358
1169	3300013104	Ga0157370_10014341	Ga0157370_100143414	358
1170	3300013307	Ga0157372_10036326	Ga0157372_100363265	358
1171	3300025912	Ga0207707_10004221	Ga0207707_100042215	358
1172	3300025920	Ga0207649_10003790	Ga0207649_100037903	358
1173	3300025921	Ga0207652_10048484	Ga0207652_100484844	358
1174	3300025921	Ga0207652_10306096	Ga0207652_103060962	358
1175	3300026041	Ga0207639_10003687	Ga0207639_100036877	358
1176	3300026116	Ga0207674_10052901	Ga0207674_100529013	358
1177	3300049583	Ga0501067_0036556	Ga0501067_0036556_1125_2327	358
1178	3300049586	Ga0501070_0001514	Ga0501070_0001514_18396_19598	358
1179	3300049589	Ga0501073_0005171	Ga0501073_0005171_2674_3876	358
1180	3300049590	Ga0501074_0075756	Ga0501074_0075756_148_1350	358
1181	3300049742	Ga0501080_0057134	Ga0501080_0057134_2368_3570	358
1182	3300049742	Ga0501080_0085111	Ga0501080_0085111_583_1785	358
1183	3300049744	Ga0501083_0021601	Ga0501083_0021601_2055_3257	358
1184	3300005334	Ga0068869_100119660	Ga0068869_1001196601	359
1185	iso_pu_bacteria	2596583598	2597029240	359
1186	iso_pu_bacteria	2599185178	2599447545	359
1187	iso_pu_bacteria	2885266251	2885269987	359
1188	iso_pu_bacteria	2900577576	2900578303	359
1189	iso_pu_bacteria	2928058823	2928060920	359
1190	3300048927	Ga0496124_0003531	Ga0496124_0003531_3506_4720	361
1191	3300001915	JGI24741J21665_1000147	JGI24741J21665_10001478	363
1192	3300002705	JGI25156J39149_1007927	JGI25156J39149_10079272	363
1193	3300002738	JGI25154J39366_1000419	JGI25154J39366_100041922	363
1194	3300003578	Ga0006562J51391_1006175	Ga0006562J51391_10061752	363
1195	3300003751	Ga0055538_1003227	Ga0055538_10032272	363
1196	3300003752	Ga0055539_1000056	Ga0055539_100005627	363
1197	3300003756	Ga0055533_1002042	Ga0055533_10020424	363
1198	3300003758	Ga0055532_1000111	Ga0055532_100011153	363
1199	3300003759	Ga0055525_1000834	Ga0055525_10008347	363
1200	3300003761	Ga0055535_1000114	Ga0055535_100011453	363
1201	3300003762	Ga0055542_1001089	Ga0055542_10010899	363
1202	3300003762	Ga0055542_1001355	Ga0055542_100135510	363
1203	3300003763	Ga0055529_1000179	Ga0055529_100017953	363
1204	3300003841	Ga0055541_1000355	Ga0055541_10003556	363
1205	3300005344	Ga0070661_100000173	Ga0070661_10000017350	363
1206	3300005366	Ga0070659_100000670	Ga0070659_10000067010	363
1207	3300005455	Ga0070663_100000021	Ga0070663_10000002149	363
1208	3300005564	Ga0070664_100000021	Ga0070664_10000002149	363
1209	3300005577	Ga0068857_100004966	Ga0068857_1000049664	363
1210	3300005578	Ga0068854_100000011	Ga0068854_10000001159	363
1211	3300005614	Ga0068856_100000127	Ga0068856_10000012756	363
1212	3300009093	Ga0105240_10236090	Ga0105240_102360902	363
1213	3300009978	Ga0105148_101101	Ga0105148_1011011	363
1214	3300013100	Ga0157373_10004822	Ga0157373_100048225	363
1215	3300013102	Ga0157371_10000072	Ga0157371_1000007296	363
1216	3300013104	Ga0157370_10000219	Ga0157370_1000021945	363
1217	3300013105	Ga0157369_10006494	Ga0157369_100064943	363
1218	3300013307	Ga0157372_10000201	Ga0157372_100002019	363
1219	3300020610	Ga0154015_1516177	Ga0154015_151617713	363
1220	3300025224	Ga0209784_100006	Ga0209784_100006562	363
1221	3300025224	Ga0209784_100369	Ga0209784_10036917	363
1222	3300025225	Ga0209566_100002	Ga0209566_100002562	363
1223	3300025225	Ga0209566_100459	Ga0209566_1004596	363
1224	3300025226	Ga0209674_100010	Ga0209674_100010575	363
1225	3300025226	Ga0209674_100098	Ga0209674_10009839	363
1226	3300025228	Ga0209672_100467	Ga0209672_1004674	363
1227	3300025229	Ga0209147_100015	Ga0209147_10001550	363
1228	3300025230	Ga0209563_100109	Ga0209563_10010993	363
1229	3300025242	Ga0209258_100021	Ga0209258_10002150	363
1230	3300025246	Ga0209646_1000082	Ga0209646_1000082136	363
1231	3300025253	Ga0209677_100007	Ga0209677_100007562	363
1232	3300025254	Ga0209148_1000190	Ga0209148_100019068	363
1233	3300025256	Ga0209759_1002510	Ga0209759_10025105	363
1234	3300025256	Ga0209759_1003697	Ga0209759_10036972	363
1235	3300025272	Ga0209455_1000028	Ga0209455_100002850	363
1236	3300025913	Ga0207695_10004413	Ga0207695_100044135	363
1237	3300025920	Ga0207649_10000157	Ga0207649_100001574	363
1238	3300025932	Ga0207690_10002613	Ga0207690_100026134	363
1239	3300025945	Ga0207679_10000007	Ga0207679_10000007389	363
1240	3300025981	Ga0207640_10000012	Ga0207640_1000001256	363
1241	3300026067	Ga0207678_10000050	Ga0207678_1000005027	363
1242	3300026116	Ga0207674_10000679	Ga0207674_1000067926	363
1243	3300037418	Ga0395900_0000555	Ga0395900_0000555_49627_50844	363
1244	3300053149	Ga0500600_0093424	Ga0500600_0093424_333_1544	363
1245	3300059643	Ga0587072_003092	Ga0587072_003092_747_1964	363

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02773

S-AdoMet_synt_C

S-adenosylmethionine synthetase, C-terminal domain

280

419

0.99 PF00438

S-AdoMet_synt_N

S-adenosylmethionine synthetase, N-terminal domain

73

141

0.98 PF02772

S-AdoMet_synt_M

S-adenosylmethionine synthetase, central domain

156

278

0.94 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
5h9u-assembly1.cif.gz_D	crystal structure of a thermostable methionine adenosyltransferase	0.8865	17	353
7ock-assembly1.cif.gz_H	mat in complex with samh	0.8842	18	355
8p4h-assembly2.cif.gz_C	crystal structure of human methionine adenosyltransferase 2a (mat2a) in complex with sam and allosteric compound ideaya cmpd a	0.8813	18	344
8bb1-assembly1.cif.gz_D	t3 sam lyase in complex with s-adenosylmethionine synthase	0.8803	18	355
8jzg-assembly1.cif.gz_B	c. glutamicum s-adenosylmethionine synthase co-crystallized with adenosine, triphosphate, and sam	0.877	18	355

ID	Description	Score	Start	End	Superfamily
af_Q58EF9_292_361_3.30.300.10	Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;	0.9809	241	308	3.30.300.10
2p02A03	Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;	0.9564	100	344	3.30.300.10
af_B4FIE9_281_392_3.30.300.10	Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;	0.9562	241	343	3.30.300.10
af_Q2G1W4_285_396_3.30.300.10	Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;	0.9526	241	351	3.30.300.10
1fugB01	Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;	0.9452	97	354	3.30.300.10

ID	Description	Score	Start	End	GO Terms
AF-X0V8T3-F1-model_v4	S-adenosylmethionine synthetase C-terminal domain-containing protein	0.9792	245	354	GO:0004478 GO:0005524 GO:0006556 GO:0006730 GO:0046872
AF-H3KHF5-F1-model_v4	S-adenosylmethionine synthetase domain protein	0.9786	245	354	GO:0004478 GO:0005524 GO:0006556 GO:0006730 GO:0046872
AF-A0A521U7F7-F1-model_v4	Methionine adenosyltransferase (EC 2.5.1.6)	0.9775	249	354	GO:0004478 GO:0005524 GO:0006556 GO:0006730 GO:0046872
AF-A0A1V6EDV8-F1-model_v4	S-adenosylmethionine synthase (EC 2.5.1.6)	0.9774	241	355	GO:0004478 GO:0005524 GO:0006556 GO:0006730 GO:0046872
AF-A0A3D4YSU2-F1-model_v4	deleted	0.9732	249	353

Feature Viewer

pLDDT	pTM	Quality
72.71	0.78	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F492128

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF02773

S-AdoMet_synt_C

S-adenosylmethionine synthetase, C-terminal domain

280

419

0.99

PF00438

S-AdoMet_synt_N

S-adenosylmethionine synthetase, N-terminal domain

73

141

0.98

PF02772

S-AdoMet_synt_M

S-adenosylmethionine synthetase, central domain

156

278

0.94

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map