F491936

General Info

Members Datasets Scaffolds Average Seq Length
1226 399 1170 737

Family's Representative Sequence

Representative Sequence 3300053177|Ga0500636_0001727|Ga0500636_0001727_1957_4290
Length 777
Sequence MIAARRRTGHNRWASRDHGCARDPIEPPSADQTGANERKNEMDAVTDGSPLSDPSKEPAALRTLLGRTNRDWWPNHLSLDILHQKGISGNPMGDDFDYAKEFKSLDLAAVKRDLTALMTDSQPWWPADYGHYGPFFIRMAWHSAGTYRTGDGRGGANAGQQRFAPLNSWPDNGNLDKARRLLWPIKAKYGRKLSWADLMILAGNVAIESMGGPVFGFGGGREDVWEPERDIYWGTEQEWVGSADSKTRIDEESGRALESPLAAIQMGLIYVNPEGPGGVPDPLKSARDIRETFYRMGMNDEETAALTAGGHTFGKAHGAGDASLVGAEPEGADIAQQGLGWQSGHESGIGDHAITSGIEGAWTPTPITWDMTFFDMLLDHDYELVRSPAGAKQWQPVGNPDDTLAPKAHTPGVRVPTMMTTADMALKMDPEYRKVMEKFRADPAYFGDTFARAWFKLCHRDMGPKARYLGADVPAEDLIWQDPIPAGPTLSDGDVVTLKGKIAASGLSVAQLVRTAWASAATWRGSDHRGGANGARLRLAPQKDWDVNEPAELAKVLQVYEGIQADFGGTAKVSIADLIVLGGNVGVEQAAKAAGRSVTVPFTGGRGDASAEQTDAEGFGVLEPRADGFRNYLQVKFNVPTEELLVDRAQLLGLSAPEMTVLVGGLRVLGANHAGSKHGVFTDRPGQLTNDFFLNLLDMATAWRQIDDSADEEFEGNDRHTGQRKWTGTRTDLVFGSNSQLRALSEVYASADAGDQFVADFVKVWAKVMNADRYDLA

Samples

Sample ID Description Type Environment
1 2537561728 Pectobacterium wasabiae CFBP 3304 Isolate Rhizoplane
2 2643221560 Sphingopyxis sp. Root1497 Isolate Unclassified
3 2643221563 Sphingopyxis sp. Root154 Isolate Unclassified
4 2643221574 Brevundimonas sp. Root608 Isolate Unclassified
5 2643221588 Altererythrobacter sp. Root672 Isolate Unclassified
6 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified
7 2643221608 Sphingopyxis sp. Root214 Isolate Unclassified
8 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
9 2643221622 Sphingomonas sp. Root241 Isolate Unclassified
10 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
11 2643221663 Brevundimonas sp. Root1279 Isolate Unclassified
12 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
13 2643221699 Brevundimonas sp. Root1423 Isolate Unclassified
14 2738541275 Novosphingobium sp. GV027 Isolate Unclassified
15 2738541301 Novosphingobium sp. GV079 Isolate Unclassified
16 2738541304 Novosphingobium sp. GV061 Isolate Unclassified
17 2738543022 Novosphingobium sp. GV055 Isolate Unclassified
18 2738543033 Novosphingobium sp. GV064 Isolate Unclassified
19 2775507255 Sphingobium indicum B90A Isolate Rhizosphere
20 2818991438 Novosphingobium barchaimii 1192 Isolate Unclassified
21 2830075706 Sphingomonas jinjuensis DSM 21457 Isolate Rhizosphere
22 2834578030 Paracoccus thiocyanatus SST Isolate Unclassified
23 2848297114 Croceibacterium ferulae EGI 63111 Isolate Unclassified
24 2852653556 Sphingopyxis sp. JAI108 Isolate Rhizosphere
25 2852680915 Sphingopyxis sp. JAI128 Isolate Rhizosphere
26 2855195626 Pectobacterium atrosepticum SS26 Isolate Stem Tuber
27 2858466076 Pectobacterium polaris SS28 Isolate Stem Tuber
28 2871272651 Pectobacterium carotovorum SS96 Isolate Stem Tuber
29 2871282230 Pectobacterium parmentieri SS90 Isolate Stem Tuber
30 2882806704 Pelagerythrobacter rhizovicinus AY-3R Isolate Rhizosphere
31 2885427238 Sphingomonas mesophila SYSUP0001 Isolate Stem Tuber
32 2885429604 Sphingomonas sp. WZY 27 Isolate Rhizosphere
33 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
34 2896184354 Aurantiacibacter suaedae GH3-15 Isolate Rhizosphere
35 2896253425 Aurantiacibacter rhizosphaerae GH3-10 Isolate Rhizosphere
36 2896429255 Sphingomonas rhizophila KACC 19189 Isolate Rhizosphere
37 2900051742 Pectobacterium zantedeschiae 2M Isolate Stem Tuber
38 2919493220 Aeromonas salmonicida salmonicida 3466 Isolate Unclassified
39 2919543075 Aeromonas salmonicida masoucida 4076 Isolate Unclassified
40 2919679072 Pseudotabrizicola sp. 4114 Isolate Unclassified
41 2928027323 Sphingomonas sp. 1185 Isolate Unclassified
42 2928100450 Novosphingobium sp. 1529 Isolate Rhizosphere
43 2928959182 Novosphingobium capsulatum 1057 Isolate Unclassified
44 2929199973 Roseomonas sp. R-73070 Hybrid assembly Isolate Unclassified
45 2941485952 Brevundimonas faecalis 2814 Isolate Rhizosphere
46 2946787523 Sphingomonas faeni W4I17 Isolate Rhizosphere
47 2984555340 Sphingomonas sp. SORGH_AS789 Isolate Aerial Root
48 2984564862 Sphingomonas sp. SORGH_AS870 Isolate Aerial Root
49 2990265787 Sphingomonas sp. SORGH_AS802 Isolate Aerial Root
50 2993356040 Sphingomonas sp. SORGH_AS742 Isolate Aerial Root
51 2993693658 Sphingomonas sp. SORGH_AS438 Isolate Aerial Root
52 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
53 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
54 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
55 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
56 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
57 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
58 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
59 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
60 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
61 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
62 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
63 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
64 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
65 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
66 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
67 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
68 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
69 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
70 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
71 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
72 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
73 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
74 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
75 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
76 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
77 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
78 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
79 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
80 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
81 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
82 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
83 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
84 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
85 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
86 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
87 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
88 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
89 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
90 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
91 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
92 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
93 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
94 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
95 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
96 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
97 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
98 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
99 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
100 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
101 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
102 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
103 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
104 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
105 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
106 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
107 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
108 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
109 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
110 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
111 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
112 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
113 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
114 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
115 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
116 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
117 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
118 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
119 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
120 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
121 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
122 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
123 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
124 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
125 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
126 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
127 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
128 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
129 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
130 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
131 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
132 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
133 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
134 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
135 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
136 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
137 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
138 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
139 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
140 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
141 3300009978 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG Metagenome Rhizosphere
142 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
143 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
144 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
145 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
146 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
147 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
148 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
149 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
150 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
151 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
152 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
153 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
154 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
155 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
156 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
157 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
158 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
159 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
160 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
161 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
162 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
163 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
164 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
165 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
166 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
167 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
168 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
169 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
170 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
171 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
172 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
173 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
174 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
175 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
176 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
177 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
178 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
179 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
231 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
234 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
235 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
236 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
237 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
238 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
239 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
240 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
241 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
242 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
243 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
244 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
245 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
246 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
247 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
248 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
249 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
250 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
251 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
252 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
253 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
254 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
255 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
256 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
257 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
258 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
259 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
260 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
261 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
262 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
263 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
264 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
265 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
266 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
267 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
268 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
269 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
270 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
271 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
272 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
273 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
274 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
275 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
276 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
277 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
278 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
279 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
280 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
281 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
282 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
283 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
284 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
285 3300039145 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 Metagenome Unclassified
286 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
287 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
288 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
289 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
290 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
291 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
292 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
293 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
294 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
295 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
296 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
297 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
298 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
299 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
300 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
301 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
302 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
303 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
304 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
305 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
306 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
307 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
308 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
309 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
310 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
311 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
312 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
313 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
314 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
315 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
316 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
317 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
318 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
319 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
320 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
321 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
322 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
323 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
324 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
325 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
326 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
327 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
328 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
329 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
330 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
331 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
332 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
333 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
334 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
335 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
336 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
337 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
338 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
339 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
340 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
341 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
342 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
343 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
344 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
345 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
346 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
347 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
348 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
349 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
350 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
351 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
352 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
353 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
354 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
355 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
356 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
357 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
358 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
359 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
360 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
361 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
362 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
363 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
364 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
365 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
366 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
367 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
368 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
369 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
370 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
371 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
372 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
373 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
374 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
375 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
376 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
377 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
378 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
379 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
380 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
381 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
382 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
383 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
384 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
385 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
386 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
387 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
388 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
389 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
390 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
391 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
392 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
393 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
394 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
395 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
396 8002745576 Marinomonas spartinae USM8 Isolate Rhizosphere
397 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
398 8055225921 Achromobacter panacis KCTC 42751 Isolate Rhizosphere
399 8055909800 Plastoroseomonas hellenica LMG 31523 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 93.15
Metatranscriptomes 2.28
Isolates 4.57

Biome Distribution

Category Percentage (%)
Aerial Root 0.41
Bulb 0
Endosphere 8.48
Nodule 0
Rhizoplane 3.83
Rhizosphere 80.02
Stem 0
Stem Tuber 0.49
Unclassified 6.77

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1000182 3300001915 Bacteria 18224
2 JGI24741J21665_1000588 3300001915 Bacteria 11007
3 JGI24741J21665_1000905 3300001915 Bacteria 8936
4 JGI24740J21852_10000388 3300001979 Bacteria 18881
5 JGI24740J21852_10000708 3300001979 Bacteria 14454
6 JGI24740J21852_10006720 3300001979 Bacteria 4737
7 JGI24739J22299_10000974 3300001989 Bacteria 10650
8 JGI24739J22299_10003523 3300001989 Bacteria 5979
9 JGI24737J22298_10000083 3300001990 Bacteria 27631
10 JGI24737J22298_10000489 3300001990 Bacteria 13756
11 JGI24737J22298_10000515 3300001990 Bacteria 13560
12 JGI24737J22298_10001102 3300001990 Bacteria 9496
13 JGI24737J22298_10004715 3300001990 Bacteria 4737
14 JGI24737J22298_10005298 3300001990 Bacteria 4459
15 JGI24735J21928_10000952 3300002067 Bacteria 10337
16 JGI24735J21928_10002829 3300002067 Bacteria 5988
17 JGI24735J21928_10006042 3300002067 Bacteria 3999
18 JGI24738J21930_10000137 3300002075 Bacteria 17884
19 JGI24738J21930_10000658 3300002075 Bacteria 10012
20 JGI25150J39212_1000177 3300002774 Bacteria 35741
21 JGI25153J46596_10000021 3300003215 Bacteria 252651
22 JGI25153J46596_10000153 3300003215 Bacteria 69588
23 JGI25153J46596_10017152 3300003215 Bacteria 2866
24 Ga0055525_1000012 3300003759 Bacteria 486564
25 Ga0055542_1000355 3300003762 Bacteria 48043
26 Ga0055529_1000045 3300003763 Bacteria 209617
27 Ga0055537_1000510 3300003773 Bacteria 23185
28 Ga0055537_1003328 3300003773 Bacteria 4972
29 Ga0055536_1000632 3300003781 Bacteria 23942
30 Ga0055536_1000877 3300003781 Bacteria 19539
31 Ga0055536_1002159 3300003781 Bacteria 11209
32 Ga0055530_10000135 3300003791 Bacteria 65036
33 Ga0055530_10000625 3300003791 Bacteria 30581
34 Ga0055530_10000667 3300003791 Bacteria 29254
35 Ga0055540_1000762 3300003792 Bacteria 21885
36 Ga0055531_10000648 3300003794 Bacteria 30031
37 Ga0055531_10007871 3300003794 Bacteria 5729
38 Ga0055531_10008445 3300003794 Bacteria 5428
39 Ga0065165_1000412 3300005262 Bacteria 68242
40 Ga0065165_1006275 3300005262 Bacteria 6305
41 Ga0065715_10000404 3300005293 Bacteria 15507
42 Ga0070658_10000130 3300005327 Bacteria 66295
43 Ga0070658_10003302 3300005327 Bacteria 13307
44 Ga0070658_10004041 3300005327 Bacteria 12020
45 Ga0070658_10008670 3300005327 Bacteria 8169
46 Ga0070658_10019336 3300005327 Bacteria 5455
47 Ga0070658_10042471 3300005327 Bacteria 3672
48 Ga0070676_10000972 3300005328 Bacteria 14233
49 Ga0070676_10017476 3300005328 Bacteria 3970
50 Ga0070683_100003807 3300005329 Bacteria 12325
51 Ga0070683_100022590 3300005329 Bacteria 5624
52 Ga0070690_100000975 3300005330 Bacteria 14573
53 Ga0070690_100006079 3300005330 Bacteria 6831
54 Ga0070670_100000021 3300005331 Bacteria 202776
55 Ga0070670_100001793 3300005331 Bacteria 17481
56 Ga0070670_100006906 3300005331 Bacteria 9620
57 Ga0070670_100009865 3300005331 Bacteria 8154
58 Ga0070670_100021575 3300005331 Bacteria 5538
59 Ga0070677_10000317 3300005333 Bacteria 16850
60 Ga0070666_10000413 3300005335 Bacteria 26576
61 Ga0070666_10000841 3300005335 Bacteria 18619
62 Ga0070680_100002095 3300005336 Bacteria 14733
63 Ga0070680_100004105 3300005336 Bacteria 10908
64 Ga0070680_100028219 3300005336 Bacteria 4500
65 Ga0070680_100029151 3300005336 Bacteria 4433
66 Ga0070680_100031955 3300005336 Bacteria 4233
67 Ga0070682_100016386 3300005337 Bacteria 4307
68 Ga0068868_100000007 3300005338 Bacteria 123028
69 Ga0068868_100000103 3300005338 Bacteria 52264
70 Ga0068868_100000237 3300005338 Bacteria 37449
71 Ga0068868_100004297 3300005338 Bacteria 9976
72 Ga0068868_100029622 3300005338 Bacteria 4193
73 Ga0070660_100000292 3300005339 Bacteria 33415
74 Ga0070660_100000391 3300005339 Bacteria 29107
75 Ga0070660_100000830 3300005339 Bacteria 20537
76 Ga0070660_100002676 3300005339 Bacteria 12241
77 Ga0070660_100003832 3300005339 Bacteria 10389
78 Ga0070660_100005728 3300005339 Bacteria 8604
79 Ga0070660_100012640 3300005339 Bacteria 6033
80 Ga0070660_100026206 3300005339 Bacteria 4339
81 Ga0070660_100030306 3300005339 Bacteria 4058
82 Ga0070660_100039484 3300005339 Bacteria 3588
83 Ga0070660_100042147 3300005339 Bacteria 3483
84 Ga0070661_100000064 3300005344 Bacteria 84753
85 Ga0070661_100000206 3300005344 Bacteria 48811
86 Ga0070661_100006011 3300005344 Bacteria 8354
87 Ga0070661_100010905 3300005344 Bacteria 6329
88 Ga0070661_100010999 3300005344 Bacteria 6307
89 Ga0070661_100033475 3300005344 Bacteria 3722
90 Ga0070692_10032337 3300005345 Bacteria 2630
91 Ga0070668_100000045 3300005347 Bacteria 77362
92 Ga0070668_100002166 3300005347 Bacteria 14379
93 Ga0070668_100007089 3300005347 Bacteria 8304
94 Ga0070668_100012919 3300005347 Bacteria 6220
95 Ga0070668_100013706 3300005347 Bacteria 6055
96 Ga0070668_100023312 3300005347 Bacteria 4681
97 Ga0070668_100032639 3300005347 Bacteria 3962
98 Ga0070669_100000324 3300005353 Bacteria 37381
99 Ga0070669_100000870 3300005353 Bacteria 21987
100 Ga0070669_100011776 3300005353 Bacteria 6206
101 Ga0070669_100027880 3300005353 Bacteria 4066
102 Ga0070675_100005993 3300005354 Bacteria 9317
103 Ga0070675_100006070 3300005354 Bacteria 9255
104 Ga0070675_100037261 3300005354 Bacteria 3961
105 Ga0070675_100064532 3300005354 Bacteria 3027
106 Ga0070671_100001277 3300005355 Bacteria 18890
107 Ga0070671_100002146 3300005355 Bacteria 15236
108 Ga0070671_100004611 3300005355 Bacteria 10927
109 Ga0070671_100017649 3300005355 Bacteria 5782
110 Ga0070671_100028527 3300005355 Bacteria 4596
111 Ga0070671_100039349 3300005355 Bacteria 3925
112 Ga0070671_100040623 3300005355 Bacteria 3864
113 Ga0070671_100050958 3300005355 Bacteria 3443
114 Ga0070671_100059318 3300005355 Bacteria 3184
115 Ga0070671_100072524 3300005355 Bacteria 2876
116 Ga0070674_100005180 3300005356 Bacteria 7493
117 Ga0070673_100000336 3300005364 Bacteria 24639
118 Ga0070673_100000995 3300005364 Bacteria 16070
119 Ga0070673_100008886 3300005364 Bacteria 6713
120 Ga0070673_100028355 3300005364 Bacteria 4163
121 Ga0070659_100000004 3300005366 Bacteria 267958
122 Ga0070659_100000817 3300005366 Bacteria 22741
123 Ga0070659_100000884 3300005366 Bacteria 21912
124 Ga0070659_100004165 3300005366 Bacteria 10308
125 Ga0070659_100010818 3300005366 Bacteria 6729
126 Ga0070659_100010961 3300005366 Bacteria 6693
127 Ga0070659_100012273 3300005366 Bacteria 6353
128 Ga0070659_100014354 3300005366 Bacteria 5919
129 Ga0070659_100017370 3300005366 Bacteria 5413
130 Ga0070659_100020008 3300005366 Bacteria 5081
131 Ga0070659_100020644 3300005366 Bacteria 5007
132 Ga0070659_100056243 3300005366 Bacteria 3102
133 Ga0070667_100000361 3300005367 Bacteria 49412
134 Ga0070667_100001053 3300005367 Bacteria 25196
135 Ga0070667_100002719 3300005367 Bacteria 15312
136 Ga0070667_100003055 3300005367 Bacteria 14387
137 Ga0070667_100003548 3300005367 Bacteria 13295
138 Ga0070667_100004119 3300005367 Bacteria 12292
139 Ga0070667_100017180 3300005367 Bacteria 5993
140 Ga0070667_100043507 3300005367 Bacteria 3769
141 Ga0070667_100062163 3300005367 Bacteria 3163
142 Ga0070667_100077146 3300005367 Bacteria 2845
143 Ga0070714_100008944 3300005435 Bacteria 7838
144 Ga0070714_100023913 3300005435 Bacteria 5025
145 Ga0070713_100007630 3300005436 Bacteria 7614
146 Ga0070694_100005307 3300005444 Bacteria 7794
147 Ga0070663_100001970 3300005455 Bacteria 11459
148 Ga0070663_100002583 3300005455 Bacteria 10225
149 Ga0070663_100003200 3300005455 Bacteria 9403
150 Ga0070663_100011037 3300005455 Bacteria 5654
151 Ga0070663_100011736 3300005455 Bacteria 5513
152 Ga0070663_100018251 3300005455 Bacteria 4595
153 Ga0070663_100019984 3300005455 Bacteria 4424
154 Ga0070662_100000107 3300005457 Bacteria 46051
155 Ga0070662_100000140 3300005457 Bacteria 40842
156 Ga0070662_100001710 3300005457 Bacteria 13501
157 Ga0070662_100001767 3300005457 Bacteria 13295
158 Ga0070662_100015856 3300005457 Bacteria 5054
159 Ga0070662_100037732 3300005457 Bacteria 3427
160 Ga0070662_100042864 3300005457 Bacteria 3234
161 Ga0070681_10085353 3300005458 Bacteria 3109
162 Ga0068867_100000319 3300005459 Bacteria 31796
163 Ga0068867_100003291 3300005459 Bacteria 11370
164 Ga0068867_100010357 3300005459 Bacteria 6578
165 Ga0070679_100000015 3300005530 Bacteria 142672
166 Ga0070679_100020767 3300005530 Bacteria 6406
167 Ga0070679_100043189 3300005530 Bacteria 4490
168 Ga0070679_100051608 3300005530 Bacteria 4096
169 Ga0070684_100002809 3300005535 Bacteria 12917
170 Ga0070684_100008971 3300005535 Bacteria 7855
171 Ga0070684_100057578 3300005535 Bacteria 3394
172 Ga0068853_100000172 3300005539 Bacteria 45090
173 Ga0068853_100000360 3300005539 Bacteria 31342
174 Ga0068853_100000679 3300005539 Bacteria 23420
175 Ga0068853_100006073 3300005539 Bacteria 9560
176 Ga0068853_100012931 3300005539 Bacteria 6803
177 Ga0068853_100017593 3300005539 Bacteria 5900
178 Ga0068853_100023202 3300005539 Bacteria 5192
179 Ga0068853_100053807 3300005539 Bacteria 3467
180 Ga0068853_100058189 3300005539 Bacteria 3336
181 Ga0070672_100000388 3300005543 Bacteria 25468
182 Ga0070672_100001617 3300005543 Bacteria 14007
183 Ga0070672_100010641 3300005543 Bacteria 6388
184 Ga0070672_100040593 3300005543 Bacteria 3571
185 Ga0070686_100001399 3300005544 Bacteria 13609
186 Ga0070686_100033497 3300005544 Bacteria 3157
187 Ga0070695_100015950 3300005545 Bacteria 4542
188 Ga0070696_100008440 3300005546 Bacteria 6895
189 Ga0070665_100000021 3300005548 Bacteria 389668
190 Ga0070665_100000605 3300005548 Bacteria 49400
191 Ga0070665_100001031 3300005548 Bacteria 34955
192 Ga0070665_100001570 3300005548 Bacteria 26346
193 Ga0070665_100001716 3300005548 Bacteria 25115
194 Ga0070665_100004175 3300005548 Bacteria 15195
195 Ga0070665_100011489 3300005548 Bacteria 8955
196 Ga0070665_100012999 3300005548 Bacteria 8384
197 Ga0070665_100013480 3300005548 Bacteria 8223
198 Ga0068855_100000640 3300005563 Bacteria 42846
199 Ga0068855_100006629 3300005563 Bacteria 14062
200 Ga0068855_100009305 3300005563 Bacteria 11862
201 Ga0068855_100015023 3300005563 Bacteria 9325
202 Ga0068855_100030831 3300005563 Bacteria 6410
203 Ga0068855_100039918 3300005563 Bacteria 5572
204 Ga0068855_100073730 3300005563 Bacteria 3965
205 Ga0068855_100074034 3300005563 Bacteria 3956
206 Ga0068855_100109259 3300005563 Bacteria 3176
207 Ga0068855_100131037 3300005563 Bacteria 2864
208 Ga0070664_100000032 3300005564 Bacteria 88298
209 Ga0070664_100001892 3300005564 Bacteria 16800
210 Ga0070664_100004751 3300005564 Bacteria 10894
211 Ga0070664_100007489 3300005564 Bacteria 8813
212 Ga0070664_100027820 3300005564 Bacteria 4701
213 Ga0070664_100033810 3300005564 Bacteria 4286
214 Ga0070664_100058481 3300005564 Bacteria 3279
215 Ga0068857_100000727 3300005577 Bacteria 24565
216 Ga0068857_100002020 3300005577 Bacteria 16453
217 Ga0068857_100007161 3300005577 Bacteria 9609
218 Ga0068857_100007759 3300005577 Bacteria 9247
219 Ga0068857_100030002 3300005577 Bacteria 4798
220 Ga0068857_100079808 3300005577 Bacteria 2921
221 Ga0068854_100000197 3300005578 Bacteria 40599
222 Ga0068854_100002482 3300005578 Bacteria 11417
223 Ga0068854_100007242 3300005578 Bacteria 7083
224 Ga0068854_100023772 3300005578 Bacteria 4189
225 Ga0068856_100000364 3300005614 Bacteria 49715
226 Ga0068856_100002287 3300005614 Bacteria 19767
227 Ga0068856_100006488 3300005614 Bacteria 11473
228 Ga0068856_100015239 3300005614 Bacteria 7428
229 Ga0068852_100000673 3300005616 Bacteria 22422
230 Ga0068852_100000780 3300005616 Bacteria 20902
231 Ga0068852_100003430 3300005616 Bacteria 11074
232 Ga0068852_100003915 3300005616 Bacteria 10462
233 Ga0068852_100009011 3300005616 Bacteria 7384
234 Ga0068852_100015299 3300005616 Bacteria 5941
235 Ga0068852_100017741 3300005616 Bacteria 5592
236 Ga0068852_100020821 3300005616 Bacteria 5219
237 Ga0068852_100034726 3300005616 Bacteria 4199
238 Ga0068852_100047517 3300005616 Bacteria 3662
239 Ga0068859_100003376 3300005617 Bacteria 16233
240 Ga0068859_100011644 3300005617 Bacteria 8841
241 Ga0068859_100012911 3300005617 Bacteria 8391
242 Ga0068859_100029265 3300005617 Bacteria 5526
243 Ga0068859_100042054 3300005617 Bacteria 4590
244 Ga0068864_100000004 3300005618 Bacteria 489341
245 Ga0068864_100000331 3300005618 Bacteria 41699
246 Ga0068864_100000716 3300005618 Bacteria 27804
247 Ga0068864_100007189 3300005618 Bacteria 9146
248 Ga0068864_100012194 3300005618 Bacteria 7105
249 Ga0068864_100030568 3300005618 Bacteria 4565
250 Ga0068864_100035670 3300005618 Bacteria 4235
251 Ga0068861_100000008 3300005719 Bacteria 85041
252 Ga0068863_100000002 3300005841 Bacteria 489510
253 Ga0068863_100000168 3300005841 Bacteria 70935
254 Ga0068863_100001961 3300005841 Bacteria 20447
255 Ga0068863_100004037 3300005841 Bacteria 14491
256 Ga0068863_100006196 3300005841 Bacteria 11733
257 Ga0068863_100006250 3300005841 Bacteria 11700
258 Ga0068863_100012561 3300005841 Bacteria 8171
259 Ga0068863_100029716 3300005841 Bacteria 5218
260 Ga0068863_100056512 3300005841 Bacteria 3715
261 Ga0068863_100056757 3300005841 Bacteria 3707
262 Ga0068858_100000642 3300005842 Bacteria 36408
263 Ga0068858_100001633 3300005842 Bacteria 22876
264 Ga0068858_100002219 3300005842 Bacteria 19651
265 Ga0068858_100004459 3300005842 Bacteria 13721
266 Ga0068858_100009762 3300005842 Bacteria 9139
267 Ga0068858_100048480 3300005842 Bacteria 3935
268 Ga0068858_100058539 3300005842 Bacteria 3563
269 Ga0068860_100000928 3300005843 Bacteria 32413
270 Ga0068860_100002891 3300005843 Bacteria 17805
271 Ga0068860_100018191 3300005843 Bacteria 6840
272 Ga0068860_100035018 3300005843 Bacteria 4817
273 Ga0068860_100035787 3300005843 Bacteria 4761
274 Ga0068862_100000002 3300005844 Bacteria 489341
275 Ga0068862_100000023 3300005844 Bacteria 203389
276 Ga0068862_100000031 3300005844 Bacteria 180203
277 Ga0068862_100001236 3300005844 Bacteria 24103
278 Ga0068862_100004740 3300005844 Bacteria 11445
279 Ga0068862_100006166 3300005844 Bacteria 9980
280 Ga0068862_100008200 3300005844 Bacteria 8637
281 Ga0068862_100013388 3300005844 Bacteria 6786
282 Ga0068862_100063157 3300005844 Bacteria 3186
283 Ga0081539_10032179 3300005985 Bacteria 3217
284 Ga0070717_10002889 3300006028 Bacteria 12195
285 Ga0075368_10000113 3300006042 Bacteria 21119
286 Ga0075364_10016817 3300006051 Bacteria 4556
287 Ga0075364_10061981 3300006051 Bacteria 2454
288 Ga0075362_10003370 3300006177 Bacteria 5571
289 Ga0075367_10013278 3300006178 Bacteria 4423
290 Ga0075369_10014979 3300006186 Bacteria 3105
291 Ga0075431_100050200 3300006847 Bacteria 4302
292 Ga0068865_100001962 3300006881 Bacteria 12131
293 Ga0068865_100002931 3300006881 Bacteria 10171
294 Ga0097620_100003376 3300006931 Bacteria 16233
295 Ga0097620_100011643 3300006931 Bacteria 8841
296 Ga0097620_100012911 3300006931 Bacteria 8391
297 Ga0097620_100029264 3300006931 Bacteria 5526
298 Ga0097620_100042050 3300006931 Bacteria 4590
299 Ga0105251_10001985 3300009011 Bacteria 16647
300 Ga0105251_10002485 3300009011 Bacteria 14449
301 Ga0105240_10050742 3300009093 Bacteria 5228
302 Ga0105240_10065704 3300009093 Bacteria 4502
303 Ga0111539_10036206 3300009094 Bacteria 5968
304 Ga0105245_10000407 3300009098 Bacteria 39932
305 Ga0105245_10007826 3300009098 Bacteria 9361
306 Ga0105247_10032892 3300009101 Bacteria 3152
307 Ga0105243_10001895 3300009148 Bacteria 17842
308 Ga0105241_10000683 3300009174 Bacteria 25584
309 Ga0105241_10005152 3300009174 Bacteria 9643
310 Ga0105242_10029287 3300009176 Bacteria 4391
311 Ga0105248_10000016 3300009177 Bacteria 308151
312 Ga0105248_10000238 3300009177 Bacteria 63658
313 Ga0105248_10001772 3300009177 Bacteria 24028
314 Ga0105248_10003172 3300009177 Bacteria 18218
315 Ga0105248_10006448 3300009177 Bacteria 12876
316 Ga0105248_10008090 3300009177 Bacteria 11542
317 Ga0105248_10019117 3300009177 Bacteria 7577
318 Ga0105248_10034417 3300009177 Bacteria 5664
319 Ga0105248_10037463 3300009177 Bacteria 5426
320 Ga0105248_10069470 3300009177 Bacteria 3955
321 Ga0105248_10113526 3300009177 Bacteria 3055
322 Ga0105248_10124434 3300009177 Bacteria 2909
323 Ga0105237_10014995 3300009545 Bacteria 8077
324 Ga0105237_10019897 3300009545 Bacteria 6929
325 Ga0105238_10010961 3300009551 Bacteria 9115
326 Ga0105249_10000004 3300009553 Bacteria 368014
327 Ga0105249_10006822 3300009553 Bacteria 9955
328 Ga0105148_100123 3300009978 Bacteria 11843
329 Ga0105246_10004677 3300011119 Bacteria 8333
330 Ga0157373_10011750 3300013100 Bacteria 6433
331 Ga0157373_10018089 3300013100 Bacteria 5132
332 Ga0157371_10000032 3300013102 Bacteria 230252
333 Ga0157371_10001390 3300013102 Bacteria 25250
334 Ga0157371_10002868 3300013102 Bacteria 16118
335 Ga0157371_10047179 3300013102 Bacteria 3063
336 Ga0157370_10009438 3300013104 Bacteria 10423
337 Ga0157370_10028584 3300013104 Bacteria 5482
338 Ga0157369_10011815 3300013105 Bacteria 9917
339 Ga0157369_10069116 3300013105 Bacteria 3795
340 Ga0157369_10080069 3300013105 Bacteria 3498
341 Ga0157378_10021008 3300013297 Bacteria 5743
342 Ga0163162_10016498 3300013306 Bacteria 7216
343 Ga0163162_10095295 3300013306 Bacteria 3063
344 Ga0157372_10044687 3300013307 Bacteria 4910
345 Ga0157372_10053884 3300013307 Bacteria 4485
346 Ga0157372_10160078 3300013307 Bacteria 2602
347 Ga0157375_10000628 3300013308 Bacteria 31364
348 Ga0157375_10002416 3300013308 Bacteria 16176
349 Ga0157375_10005662 3300013308 Bacteria 10873
350 Ga0157375_10175704 3300013308 Bacteria 2291
351 Ga0163163_10000543 3300014325 Bacteria 33382
352 Ga0163163_10001581 3300014325 Bacteria 19174
353 Ga0163163_10017559 3300014325 Bacteria 6678
354 Ga0157380_10006064 3300014326 Bacteria 8471
355 Ga0157379_10006904 3300014968 Bacteria 9818
356 Ga0183363_1004 3300015690 Bacteria 416766
357 Ga0163161_10001269 3300017792 Bacteria 18855
358 Ga0163161_10007999 3300017792 Bacteria 7312
359 Ga0197907_11355757 3300020069 Bacteria 2726
360 Ga0206353_10159478 3300020082 Bacteria 3457
361 Ga0213873_10000019 3300021358 Bacteria 122085
362 Ga0213876_10000075 3300021384 Bacteria 120068
363 Ga0213876_10000801 3300021384 Bacteria 21296
364 Ga0213876_10001285 3300021384 Bacteria 15837
365 Ga0213875_10003717 3300021388 Bacteria 8598
366 Ga0224712_10015010 3300022467 Bacteria 2511
367 Ga0209147_101082 3300025229 Bacteria 11458
368 Ga0209563_100030 3300025230 Bacteria 489259
369 Ga0207425_1000019 3300025245 Bacteria 399942
370 Ga0207425_1007497 3300025245 Bacteria 2872
371 Ga0209026_1001260 3300025250 Bacteria 11550
372 Ga0209677_100495 3300025253 Bacteria 22160
373 Ga0209677_104606 3300025253 Bacteria 3906
374 Ga0209148_1000011 3300025254 Bacteria 1196503
375 Ga0209129_1002069 3300025258 Bacteria 10341
376 Ga0209565_1000030 3300025263 Bacteria 325058
377 Ga0209565_1000166 3300025263 Bacteria 85898
378 Ga0209455_1000006 3300025272 Bacteria 1196503
379 Ga0209676_1000217 3300025292 Bacteria 125740
380 Ga0209676_1000421 3300025292 Bacteria 74706
381 Ga0209676_1001128 3300025292 Bacteria 29355
382 Ga0209676_1001159 3300025292 Bacteria 28678
383 Ga0209025_1000304 3300025294 Bacteria 109508
384 Ga0209025_1012768 3300025294 Bacteria 5347
385 Ga0209564_1001819 3300025295 Bacteria 19600
386 Ga0209564_1018738 3300025295 Bacteria 2623
387 Ga0209758_1000019 3300025297 Bacteria 743682
388 Ga0209758_1000023 3300025297 Bacteria 612453
389 Ga0209758_1000682 3300025297 Bacteria 50599
390 Ga0209758_1010231 3300025297 Bacteria 5653
391 Ga0209050_1000001 3300025298 Bacteria 3563507
392 Ga0209050_1000039 3300025298 Bacteria 410069
393 Ga0209050_1000112 3300025298 Bacteria 210320
394 Ga0209050_1000141 3300025298 Bacteria 173116
395 Ga0209050_1000279 3300025298 Bacteria 109034
396 Ga0209050_1003282 3300025298 Bacteria 12151
397 Ga0209050_1006916 3300025298 Bacteria 6556
398 Ga0209050_1015836 3300025298 Bacteria 3131
399 Ga0209256_1000046 3300025299 Bacteria 325040
400 Ga0209051_1000309 3300025303 Bacteria 76449
401 Ga0209257_1000051 3300025304 Bacteria 434166
402 Ga0209257_1000230 3300025304 Bacteria 132032
403 Ga0209257_1000250 3300025304 Bacteria 124024
404 Ga0209257_1000288 3300025304 Bacteria 111141
405 Ga0209257_1000600 3300025304 Bacteria 59824
406 Ga0209257_1001776 3300025304 Bacteria 23847
407 Ga0209257_1001845 3300025304 Bacteria 23059
408 Ga0209257_1002508 3300025304 Bacteria 18077
409 Ga0209257_1004436 3300025304 Bacteria 10874
410 Ga0207697_10000104 3300025315 Bacteria 38619
411 Ga0207656_10000558 3300025321 Bacteria 12341
412 Ga0207713_1002842 3300025735 Bacteria 12182
413 Ga0207682_10000624 3300025893 Bacteria 16451
414 Ga0207682_10002072 3300025893 Bacteria 9083
415 Ga0207688_10001426 3300025901 Bacteria 12466
416 Ga0207688_10005488 3300025901 Bacteria 6897
417 Ga0207680_10001311 3300025903 Bacteria 11747
418 Ga0207680_10001354 3300025903 Bacteria 11610
419 Ga0207647_10002253 3300025904 Bacteria 14695
420 Ga0207647_10003746 3300025904 Bacteria 11363
421 Ga0207647_10004175 3300025904 Bacteria 10711
422 Ga0207647_10009369 3300025904 Bacteria 6959
423 Ga0207699_10006940 3300025906 Bacteria 5514
424 Ga0207645_10005343 3300025907 Bacteria 9337
425 Ga0207705_10000200 3300025909 Bacteria 60434
426 Ga0207705_10000949 3300025909 Bacteria 23673
427 Ga0207705_10001531 3300025909 Bacteria 18346
428 Ga0207705_10001569 3300025909 Bacteria 18152
429 Ga0207705_10002942 3300025909 Bacteria 13015
430 Ga0207705_10004522 3300025909 Bacteria 10510
431 Ga0207705_10009479 3300025909 Bacteria 7084
432 Ga0207705_10010079 3300025909 Bacteria 6878
433 Ga0207705_10013854 3300025909 Bacteria 5813
434 Ga0207705_10028878 3300025909 Bacteria 3953
435 Ga0207705_10045167 3300025909 Bacteria 3166
436 Ga0207707_10010810 3300025912 Bacteria 7932
437 Ga0207707_10099499 3300025912 Bacteria 2541
438 Ga0207695_10006756 3300025913 Bacteria 14796
439 Ga0207695_10014624 3300025913 Bacteria 9282
440 Ga0207695_10027280 3300025913 Bacteria 6362
441 Ga0207695_10051482 3300025913 Bacteria 4324
442 Ga0207671_10008295 3300025914 Bacteria 8833
443 Ga0207671_10025900 3300025914 Bacteria 4401
444 Ga0207660_10000486 3300025917 Bacteria 26452
445 Ga0207660_10004335 3300025917 Bacteria 9252
446 Ga0207660_10020010 3300025917 Bacteria 4485
447 Ga0207657_10000123 3300025919 Bacteria 77348
448 Ga0207657_10000468 3300025919 Bacteria 42779
449 Ga0207657_10000643 3300025919 Bacteria 37091
450 Ga0207657_10000962 3300025919 Bacteria 30503
451 Ga0207657_10001203 3300025919 Bacteria 27541
452 Ga0207657_10002144 3300025919 Bacteria 21379
453 Ga0207657_10002853 3300025919 Bacteria 18578
454 Ga0207657_10003915 3300025919 Bacteria 15799
455 Ga0207657_10006099 3300025919 Bacteria 12535
456 Ga0207657_10006400 3300025919 Bacteria 12224
457 Ga0207657_10006837 3300025919 Bacteria 11767
458 Ga0207657_10008062 3300025919 Bacteria 10741
459 Ga0207657_10008544 3300025919 Bacteria 10382
460 Ga0207657_10008661 3300025919 Bacteria 10301
461 Ga0207657_10009276 3300025919 Bacteria 9912
462 Ga0207657_10009943 3300025919 Bacteria 9519
463 Ga0207657_10013729 3300025919 Bacteria 7928
464 Ga0207657_10014819 3300025919 Bacteria 7589
465 Ga0207657_10019531 3300025919 Bacteria 6432
466 Ga0207657_10020802 3300025919 Bacteria 6191
467 Ga0207657_10026132 3300025919 Bacteria 5371
468 Ga0207657_10048276 3300025919 Bacteria 3717
469 Ga0207657_10051377 3300025919 Bacteria 3583
470 Ga0207657_10075023 3300025919 Bacteria 2855
471 Ga0207649_10000102 3300025920 Bacteria 70205
472 Ga0207649_10000362 3300025920 Bacteria 34070
473 Ga0207649_10001739 3300025920 Bacteria 12503
474 Ga0207649_10002556 3300025920 Bacteria 10121
475 Ga0207649_10013902 3300025920 Bacteria 4502
476 Ga0207649_10017964 3300025920 Bacteria 4012
477 Ga0207649_10018070 3300025920 Bacteria 4003
478 Ga0207652_10000021 3300025921 Bacteria 159712
479 Ga0207652_10001035 3300025921 Bacteria 25477
480 Ga0207652_10004394 3300025921 Bacteria 11481
481 Ga0207652_10030832 3300025921 Bacteria 4495
482 Ga0207681_10000253 3300025923 Bacteria 40735
483 Ga0207681_10001506 3300025923 Bacteria 15035
484 Ga0207681_10014333 3300025923 Bacteria 4924
485 Ga0207681_10031221 3300025923 Bacteria 3478
486 Ga0207694_10000827 3300025924 Bacteria 27549
487 Ga0207694_10021780 3300025924 Bacteria 4858
488 Ga0207694_10026849 3300025924 Bacteria 4384
489 Ga0207694_10043607 3300025924 Bacteria 3462
490 Ga0207650_10000130 3300025925 Bacteria 92561
491 Ga0207650_10000818 3300025925 Bacteria 23885
492 Ga0207650_10002394 3300025925 Bacteria 13057
493 Ga0207650_10003491 3300025925 Bacteria 10800
494 Ga0207650_10013727 3300025925 Bacteria 5615
495 Ga0207659_10001512 3300025926 Bacteria 13838
496 Ga0207659_10004971 3300025926 Bacteria 8056
497 Ga0207659_10005659 3300025926 Bacteria 7603
498 Ga0207659_10018163 3300025926 Bacteria 4606
499 Ga0207659_10025015 3300025926 Bacteria 4007
500 Ga0207687_10004014 3300025927 Bacteria 9860
501 Ga0207687_10009023 3300025927 Bacteria 6518
502 Ga0207664_10009182 3300025929 Bacteria 6929
503 Ga0207644_10000084 3300025931 Bacteria 69209
504 Ga0207644_10000683 3300025931 Bacteria 21431
505 Ga0207644_10000855 3300025931 Bacteria 19268
506 Ga0207644_10001603 3300025931 Bacteria 14603
507 Ga0207644_10003126 3300025931 Bacteria 10659
508 Ga0207644_10003168 3300025931 Bacteria 10585
509 Ga0207644_10011802 3300025931 Bacteria 5785
510 Ga0207690_10000001 3300025932 Bacteria 807539
511 Ga0207690_10000002 3300025932 Bacteria 807473
512 Ga0207690_10000003 3300025932 Bacteria 783011
513 Ga0207690_10000004 3300025932 Bacteria 746138
514 Ga0207690_10000062 3300025932 Bacteria 96511
515 Ga0207690_10000557 3300025932 Bacteria 24372
516 Ga0207690_10001552 3300025932 Bacteria 14381
517 Ga0207690_10003253 3300025932 Bacteria 9747
518 Ga0207690_10007430 3300025932 Bacteria 6504
519 Ga0207690_10010263 3300025932 Bacteria 5562
520 Ga0207690_10012904 3300025932 Bacteria 5007
521 Ga0207690_10015007 3300025932 Bacteria 4690
522 Ga0207706_10000211 3300025933 Bacteria 63984
523 Ga0207706_10000346 3300025933 Bacteria 50165
524 Ga0207706_10000840 3300025933 Bacteria 31741
525 Ga0207706_10000866 3300025933 Bacteria 31146
526 Ga0207706_10000971 3300025933 Bacteria 29268
527 Ga0207706_10001130 3300025933 Bacteria 27174
528 Ga0207706_10002307 3300025933 Bacteria 18608
529 Ga0207706_10003540 3300025933 Bacteria 14913
530 Ga0207706_10014052 3300025933 Bacteria 7260
531 Ga0207706_10014698 3300025933 Bacteria 7091
532 Ga0207706_10053907 3300025933 Bacteria 3550
533 Ga0207709_10007647 3300025935 Bacteria 5996
534 Ga0207669_10000734 3300025937 Bacteria 14208
535 Ga0207669_10002314 3300025937 Bacteria 8104
536 Ga0207691_10000592 3300025940 Bacteria 36163
537 Ga0207691_10000705 3300025940 Bacteria 33075
538 Ga0207691_10001025 3300025940 Bacteria 27647
539 Ga0207691_10007200 3300025940 Bacteria 10732
540 Ga0207691_10012322 3300025940 Bacteria 8197
541 Ga0207691_10028701 3300025940 Bacteria 5206
542 Ga0207691_10045385 3300025940 Bacteria 4040
543 Ga0207691_10055329 3300025940 Bacteria 3617
544 Ga0207691_10104690 3300025940 Bacteria 2521
545 Ga0207711_10000022 3300025941 Bacteria 340441
546 Ga0207711_10000044 3300025941 Bacteria 157113
547 Ga0207711_10000567 3300025941 Bacteria 37685
548 Ga0207711_10000826 3300025941 Bacteria 30270
549 Ga0207711_10001518 3300025941 Bacteria 21567
550 Ga0207711_10001908 3300025941 Bacteria 18939
551 Ga0207711_10008075 3300025941 Bacteria 8810
552 Ga0207711_10013496 3300025941 Bacteria 6783
553 Ga0207711_10023910 3300025941 Bacteria 5113
554 Ga0207711_10028625 3300025941 Bacteria 4691
555 Ga0207711_10066032 3300025941 Bacteria 3128
556 Ga0207689_10000033 3300025942 Bacteria 95815
557 Ga0207689_10005042 3300025942 Bacteria 11903
558 Ga0207661_10007618 3300025944 Bacteria 7700
559 Ga0207661_10010702 3300025944 Bacteria 6610
560 Ga0207661_10025242 3300025944 Bacteria 4515
561 Ga0207661_10063469 3300025944 Bacteria 2992
562 Ga0207679_10000506 3300025945 Bacteria 26758
563 Ga0207679_10004140 3300025945 Bacteria 9011
564 Ga0207679_10005182 3300025945 Bacteria 8167
565 Ga0207679_10021965 3300025945 Bacteria 4338
566 Ga0207679_10025609 3300025945 Bacteria 4059
567 Ga0207679_10029682 3300025945 Bacteria 3809
568 Ga0207679_10044115 3300025945 Bacteria 3215
569 Ga0207679_10054256 3300025945 Bacteria 2950
570 Ga0207667_10000002 3300025949 Bacteria 895662
571 Ga0207667_10006936 3300025949 Bacteria 13691
572 Ga0207667_10011406 3300025949 Bacteria 10329
573 Ga0207667_10015816 3300025949 Bacteria 8551
574 Ga0207667_10024660 3300025949 Bacteria 6598
575 Ga0207667_10035526 3300025949 Bacteria 5345
576 Ga0207667_10061301 3300025949 Bacteria 3935
577 Ga0207651_10000139 3300025960 Bacteria 31720
578 Ga0207651_10001251 3300025960 Bacteria 11431
579 Ga0207651_10002016 3300025960 Bacteria 9545
580 Ga0207651_10010122 3300025960 Bacteria 5207
581 Ga0207651_10026797 3300025960 Bacteria 3609
582 Ga0207712_10000008 3300025961 Bacteria 527957
583 Ga0207712_10001742 3300025961 Bacteria 14549
584 Ga0207712_10003387 3300025961 Bacteria 10081
585 Ga0207668_10000103 3300025972 Bacteria 60096
586 Ga0207668_10000150 3300025972 Bacteria 48022
587 Ga0207668_10000729 3300025972 Bacteria 20122
588 Ga0207668_10003245 3300025972 Bacteria 9538
589 Ga0207668_10003398 3300025972 Bacteria 9332
590 Ga0207668_10008524 3300025972 Bacteria 6114
591 Ga0207668_10009773 3300025972 Bacteria 5763
592 Ga0207668_10015464 3300025972 Bacteria 4741
593 Ga0207668_10023921 3300025972 Bacteria 3935
594 Ga0207668_10051233 3300025972 Bacteria 2850
595 Ga0207640_10000560 3300025981 Bacteria 22254
596 Ga0207640_10000853 3300025981 Bacteria 17297
597 Ga0207640_10001764 3300025981 Bacteria 11618
598 Ga0207640_10008683 3300025981 Bacteria 5650
599 Ga0207658_10001378 3300025986 Bacteria 18972
600 Ga0207658_10002222 3300025986 Bacteria 14414
601 Ga0207658_10003278 3300025986 Bacteria 11498
602 Ga0207658_10003798 3300025986 Bacteria 10633
603 Ga0207658_10004749 3300025986 Bacteria 9408
604 Ga0207658_10005167 3300025986 Bacteria 8992
605 Ga0207658_10007159 3300025986 Bacteria 7602
606 Ga0207658_10036623 3300025986 Bacteria 3519
607 Ga0207677_10000014 3300026023 Bacteria 181712
608 Ga0207677_10000472 3300026023 Bacteria 26482
609 Ga0207677_10000612 3300026023 Bacteria 21892
610 Ga0207703_10001323 3300026035 Bacteria 22741
611 Ga0207703_10002164 3300026035 Bacteria 17262
612 Ga0207703_10052030 3300026035 Bacteria 3323
613 Ga0207639_10000532 3300026041 Bacteria 26198
614 Ga0207639_10000695 3300026041 Bacteria 23164
615 Ga0207639_10000895 3300026041 Bacteria 20198
616 Ga0207639_10000990 3300026041 Bacteria 19349
617 Ga0207639_10012242 3300026041 Bacteria 5971
618 Ga0207639_10033310 3300026041 Bacteria 3800
619 Ga0207639_10047964 3300026041 Bacteria 3230
620 Ga0207678_10001250 3300026067 Bacteria 23447
621 Ga0207678_10001933 3300026067 Bacteria 18903
622 Ga0207678_10002765 3300026067 Bacteria 15882
623 Ga0207678_10003048 3300026067 Bacteria 15159
624 Ga0207678_10003985 3300026067 Bacteria 13281
625 Ga0207678_10004613 3300026067 Bacteria 12380
626 Ga0207678_10007964 3300026067 Bacteria 9345
627 Ga0207678_10016860 3300026067 Bacteria 6414
628 Ga0207678_10021371 3300026067 Bacteria 5675
629 Ga0207678_10022702 3300026067 Bacteria 5496
630 Ga0207678_10023365 3300026067 Bacteria 5406
631 Ga0207678_10041105 3300026067 Bacteria 4008
632 Ga0207702_10001280 3300026078 Bacteria 25252
633 Ga0207702_10005445 3300026078 Bacteria 11137
634 Ga0207702_10006008 3300026078 Bacteria 10538
635 Ga0207702_10025380 3300026078 Bacteria 4918
636 Ga0207702_10045548 3300026078 Bacteria 3689
637 Ga0207702_10110673 3300026078 Bacteria 2441
638 Ga0207641_10000002 3300026088 Bacteria 981004
639 Ga0207641_10000241 3300026088 Bacteria 71027
640 Ga0207641_10000695 3300026088 Bacteria 36221
641 Ga0207641_10004258 3300026088 Bacteria 12455
642 Ga0207641_10004609 3300026088 Bacteria 11901
643 Ga0207641_10005321 3300026088 Bacteria 10989
644 Ga0207641_10006678 3300026088 Bacteria 9679
645 Ga0207641_10008031 3300026088 Bacteria 8747
646 Ga0207641_10008748 3300026088 Bacteria 8364
647 Ga0207641_10010261 3300026088 Bacteria 7705
648 Ga0207648_10000554 3300026089 Bacteria 41815
649 Ga0207648_10000889 3300026089 Bacteria 33700
650 Ga0207648_10001898 3300026089 Bacteria 22839
651 Ga0207648_10002898 3300026089 Bacteria 18154
652 Ga0207648_10010776 3300026089 Bacteria 8638
653 Ga0207676_10000040 3300026095 Bacteria 167947
654 Ga0207676_10000439 3300026095 Bacteria 35156
655 Ga0207676_10003029 3300026095 Bacteria 11987
656 Ga0207676_10006599 3300026095 Bacteria 8208
657 Ga0207676_10008763 3300026095 Bacteria 7197
658 Ga0207674_10000104 3300026116 Bacteria 96273
659 Ga0207674_10000410 3300026116 Bacteria 55768
660 Ga0207674_10000641 3300026116 Bacteria 45504
661 Ga0207674_10002803 3300026116 Bacteria 21702
662 Ga0207674_10005074 3300026116 Bacteria 15715
663 Ga0207674_10005803 3300026116 Bacteria 14650
664 Ga0207674_10015759 3300026116 Bacteria 8291
665 Ga0207674_10016432 3300026116 Bacteria 8102
666 Ga0207674_10020766 3300026116 Bacteria 7088
667 Ga0207674_10064242 3300026116 Bacteria 3703
668 Ga0207674_10099471 3300026116 Bacteria 2891
669 Ga0207675_100000105 3300026118 Bacteria 67191
670 Ga0207683_10003325 3300026121 Bacteria 14012
671 Ga0207683_10003836 3300026121 Bacteria 13025
672 Ga0207698_10000336 3300026142 Bacteria 27862
673 Ga0207698_10000958 3300026142 Bacteria 16760
674 Ga0207698_10002149 3300026142 Bacteria 11646
675 Ga0207698_10016631 3300026142 Bacteria 4967
676 Ga0207698_10020965 3300026142 Bacteria 4511
677 Ga0207698_10039815 3300026142 Bacteria 3485
678 Ga0207698_10063171 3300026142 Bacteria 2896
679 Ga0209974_10001035 3300027876 Bacteria 9826
680 Ga0268266_10000015 3300028379 Bacteria 630629
681 Ga0268266_10000394 3300028379 Bacteria 66190
682 Ga0268266_10000534 3300028379 Bacteria 53027
683 Ga0268266_10001840 3300028379 Bacteria 23953
684 Ga0268266_10011379 3300028379 Bacteria 7738
685 Ga0268266_10022526 3300028379 Bacteria 5368
686 Ga0268266_10040623 3300028379 Bacteria 3965
687 Ga0268265_10000003 3300028380 Bacteria 949201
688 Ga0268265_10000035 3300028380 Bacteria 207267
689 Ga0268265_10000118 3300028380 Bacteria 99496
690 Ga0268265_10004178 3300028380 Bacteria 10114
691 Ga0268265_10006020 3300028380 Bacteria 8253
692 Ga0268265_10007842 3300028380 Bacteria 7205
693 Ga0268265_10015688 3300028380 Bacteria 5189
694 Ga0268265_10019528 3300028380 Bacteria 4713
695 Ga0268265_10026689 3300028380 Bacteria 4111
696 Ga0268264_10000338 3300028381 Bacteria 72206
697 Ga0268264_10002127 3300028381 Bacteria 17671
698 Ga0268264_10002226 3300028381 Bacteria 17195
699 Ga0268264_10003559 3300028381 Bacteria 13411
700 Ga0268264_10005389 3300028381 Bacteria 10830
701 Ga0268264_10006757 3300028381 Bacteria 9640
702 Ga0268264_10033409 3300028381 Bacteria 4225
703 Ga0268264_10060108 3300028381 Bacteria 3185
704 Ga0307517_10046716 3300028786 Bacteria 4508
705 Ga0265328_10003967 3300031239 Bacteria 6506
706 Ga0265331_10004114 3300031250 Bacteria 9130
707 Ga0265327_10007474 3300031251 Bacteria 8427
708 Ga0265327_10019076 3300031251 Bacteria 4230
709 Ga0265316_10068018 3300031344 Bacteria 2753
710 Ga0307513_10015216 3300031456 Bacteria 9338
711 Ga0307408_100000644 3300031548 Bacteria 29299
712 Ga0307408_100010788 3300031548 Bacteria 6028
713 Ga0307408_100022427 3300031548 Bacteria 4290
714 Ga0307508_10018261 3300031616 Bacteria 6375
715 Ga0316575_10004496 3300031665 Bacteria 4910
716 Ga0316579_10000213 3300031691 Bacteria 17409
717 Ga0316579_10004493 3300031691 Bacteria 5545
718 Ga0316576_10000335 3300031727 Bacteria 21175
719 Ga0316576_10004605 3300031727 Bacteria 8293
720 Ga0316576_10026539 3300031727 Bacteria 4065
721 Ga0316576_10027433 3300031727 Bacteria 4005
722 Ga0316576_10054220 3300031727 Bacteria 2924
723 Ga0316576_10059386 3300031727 Bacteria 2799
724 Ga0316576_10061790 3300031727 Bacteria 2746
725 Ga0316578_10003505 3300031728 Bacteria 7201
726 Ga0316578_10004141 3300031728 Bacteria 6787
727 Ga0316578_10005752 3300031728 Bacteria 6049
728 Ga0316578_10005915 3300031728 Bacteria 5986
729 Ga0316578_10009370 3300031728 Bacteria 5035
730 Ga0316578_10009549 3300031728 Bacteria 4991
731 Ga0316578_10010822 3300031728 Bacteria 4749
732 Ga0316578_10055392 3300031728 Bacteria 2327
733 Ga0307405_10002714 3300031731 Bacteria 7912
734 Ga0316577_10006270 3300031733 Bacteria 6273
735 Ga0316577_10013476 3300031733 Bacteria 4470
736 Ga0316577_10017860 3300031733 Bacteria 3919
737 Ga0316577_10022425 3300031733 Bacteria 3506
738 Ga0307413_10000766 3300031824 Bacteria 11113
739 Ga0307413_10001150 3300031824 Bacteria 9706
740 Ga0307413_10001884 3300031824 Bacteria 8290
741 Ga0307413_10002440 3300031824 Bacteria 7555
742 Ga0307413_10013207 3300031824 Bacteria 4141
743 Ga0307413_10018030 3300031824 Bacteria 3692
744 Ga0307413_10026246 3300031824 Bacteria 3208
745 Ga0307413_10030487 3300031824 Bacteria 3030
746 Ga0307410_10000510 3300031852 Bacteria 15775
747 Ga0307410_10003142 3300031852 Bacteria 8209
748 Ga0307410_10006197 3300031852 Bacteria 6428
749 Ga0307410_10007851 3300031852 Bacteria 5874
750 Ga0307410_10010220 3300031852 Bacteria 5304
751 Ga0307410_10025004 3300031852 Bacteria 3739
752 Ga0307410_10032104 3300031852 Bacteria 3375
753 Ga0307410_10032515 3300031852 Bacteria 3358
754 Ga0307410_10069861 3300031852 Bacteria 2431
755 Ga0307406_10001489 3300031901 Bacteria 12934
756 Ga0307406_10004678 3300031901 Bacteria 7458
757 Ga0307406_10010811 3300031901 Bacteria 5157
758 Ga0307406_10012186 3300031901 Bacteria 4898
759 Ga0307406_10055222 3300031901 Bacteria 2538
760 Ga0307407_10001719 3300031903 Bacteria 8148
761 Ga0307407_10004977 3300031903 Bacteria 5715
762 Ga0307407_10026399 3300031903 Bacteria 3074
763 Ga0307407_10050161 3300031903 Bacteria 2386
764 Ga0307412_10000429 3300031911 Bacteria 25435
765 Ga0307412_10004047 3300031911 Bacteria 8173
766 Ga0307412_10006370 3300031911 Bacteria 6671
767 Ga0307412_10042015 3300031911 Bacteria 2967
768 Ga0307409_100001147 3300031995 Bacteria 12609
769 Ga0307409_100001531 3300031995 Bacteria 11461
770 Ga0307409_100004296 3300031995 Bacteria 7970
771 Ga0307409_100012001 3300031995 Bacteria 5497
772 Ga0307409_100019945 3300031995 Bacteria 4555
773 Ga0307409_100065466 3300031995 Bacteria 2860
774 Ga0307416_100003206 3300032002 Bacteria 9587
775 Ga0307416_100005971 3300032002 Bacteria 7566
776 Ga0307416_100011388 3300032002 Bacteria 5927
777 Ga0307416_100012314 3300032002 Bacteria 5757
778 Ga0307416_100035946 3300032002 Bacteria 3791
779 Ga0307414_10000969 3300032004 Bacteria 14624
780 Ga0307414_10001501 3300032004 Bacteria 12107
781 Ga0307414_10002696 3300032004 Bacteria 9339
782 Ga0307414_10003222 3300032004 Bacteria 8689
783 Ga0307414_10007969 3300032004 Bacteria 5982
784 Ga0307414_10018451 3300032004 Bacteria 4296
785 Ga0307414_10021077 3300032004 Bacteria 4079
786 Ga0307414_10035843 3300032004 Bacteria 3305
787 Ga0307414_10038872 3300032004 Bacteria 3200
788 Ga0307411_10001432 3300032005 Bacteria 9741
789 Ga0307411_10003411 3300032005 Bacteria 7367
790 Ga0307411_10003651 3300032005 Bacteria 7198
791 Ga0307411_10005351 3300032005 Bacteria 6292
792 Ga0307411_10009241 3300032005 Bacteria 5168
793 Ga0307411_10013333 3300032005 Bacteria 4532
794 Ga0307411_10021516 3300032005 Bacteria 3776
795 Ga0307411_10024232 3300032005 Bacteria 3614
796 Ga0307411_10025905 3300032005 Bacteria 3521
797 Ga0307411_10026657 3300032005 Bacteria 3483
798 Ga0307411_10039918 3300032005 Bacteria 2973
799 Ga0307415_100003613 3300032126 Bacteria 7902
800 Ga0307415_100003658 3300032126 Bacteria 7862
801 Ga0307415_100004366 3300032126 Bacteria 7326
802 Ga0307415_100005776 3300032126 Bacteria 6602
803 Ga0307415_100034223 3300032126 Bacteria 3305
804 Ga0307415_100045748 3300032126 Bacteria 2937
805 Ga0316583_10005660 3300032133 Bacteria 4493
806 Ga0316585_10000656 3300032137 Bacteria 8561
807 Ga0316580_10002178 3300032139 Bacteria 5336
808 Ga0316580_10002940 3300032139 Bacteria 4779
809 Ga0316580_10009904 3300032139 Bacteria 2869
810 Ga0316593_10001634 3300032168 Bacteria 5026
811 Ga0316593_10002833 3300032168 Bacteria 4199
812 Ga0316593_10003447 3300032168 Bacteria 3924
813 Ga0316593_10006961 3300032168 Bacteria 3080
814 Ga0316593_10007037 3300032168 Bacteria 3069
815 Ga0316593_10014156 3300032168 Bacteria 2374
816 Ga0316593_10017049 3300032168 Bacteria 2211
817 Ga0307510_10023559 3300033180 Bacteria 7135
818 Ga0316592_1002701 3300033524 Bacteria 3098
819 Ga0316592_1002974 3300033524 Bacteria 2995
820 Ga0316592_1003805 3300033524 Bacteria 2761
821 Ga0316592_1005316 3300033524 Bacteria 2440
822 Ga0316586_1001778 3300033527 Bacteria 2565
823 Ga0316588_1000422 3300033528 Bacteria 5639
824 Ga0316588_1004812 3300033528 Bacteria 2586
825 Ga0316588_1005392 3300033528 Bacteria 2487
826 Ga0316587_1002280 3300033529 Bacteria 2541
827 Ga0316596_1000497 3300033541 Bacteria 6694
828 Ga0316596_1000747 3300033541 Bacteria 5939
829 Ga0316596_1002201 3300033541 Bacteria 4131
830 Ga0316596_1002254 3300033541 Bacteria 4087
831 Ga0316596_1002732 3300033541 Bacteria 3796
832 Ga0316596_1005079 3300033541 Bacteria 2990
833 Ga0316596_1005122 3300033541 Bacteria 2980
834 Ga0316596_1007868 3300033541 Bacteria 2526
835 Ga0316596_1010318 3300033541 Bacteria 2257
836 Ga0373943_0032318 3300035170 Bacteria 2487
837 Ga0316574_0002715 3300035398 Bacteria 8959
838 Ga0316574_0008491 3300035398 Bacteria 5707
839 Ga0316574_0030155 3300035398 Bacteria 3282
840 Ga0316574_0031062 3300035398 Bacteria 3238
841 Ga0373931_0004625 3300035691 Bacteria 6293
842 Ga0373933_0063894 3300035724 Bacteria 2226
843 Ga0316582_0000505 3300036647 Bacteria 14723
844 Ga0316582_0001731 3300036647 Bacteria 9815
845 Ga0316582_0012637 3300036647 Bacteria 4720
846 Ga0316584_0000934 3300036712 Bacteria 16623
847 Ga0316584_0012265 3300036712 Bacteria 6041
848 Ga0316584_0016170 3300036712 Bacteria 5346
849 Ga0316584_0016562 3300036712 Bacteria 5285
850 Ga0316584_0019159 3300036712 Bacteria 4944
851 Ga0395899_0000103 3300037312 Bacteria 147274
852 Ga0395899_0001385 3300037312 Bacteria 20802
853 Ga0395899_0002564 3300037312 Bacteria 14694
854 Ga0395899_0009719 3300037312 Bacteria 7381
855 Ga0395900_0000093 3300037418 Bacteria 166505
856 Ga0395900_0000862 3300037418 Bacteria 40012
857 Ga0395900_0006570 3300037418 Bacteria 12115
858 Ga0395900_0007490 3300037418 Bacteria 11275
859 Ga0395900_0012443 3300037418 Bacteria 8701
860 Ga0395900_0017044 3300037418 Bacteria 7416
861 Ga0395900_0023881 3300037418 Bacteria 6256
862 Ga0395900_0024293 3300037418 Bacteria 6206
863 Ga0395900_0027054 3300037418 Bacteria 5871
864 Ga0395900_0028388 3300037418 Bacteria 5730
865 Ga0395900_0031712 3300037418 Bacteria 5432
866 Ga0395900_0033030 3300037418 Bacteria 5326
867 Ga0395900_0050442 3300037418 Bacteria 4286
868 Ga0395900_0054359 3300037418 Bacteria 4123
869 Ga0395900_0102411 3300037418 Bacteria 2941
870 Ga0395898_0000053 3300037466 Bacteria 279600
871 Ga0395898_0002184 3300037466 Bacteria 23910
872 Ga0395898_0007670 3300037466 Bacteria 11460
873 Ga0395898_0007743 3300037466 Bacteria 11404
874 Ga0395898_0008057 3300037466 Bacteria 11167
875 Ga0395898_0022845 3300037466 Bacteria 6326
876 Ga0395898_0024413 3300037466 Bacteria 6097
877 Ga0395898_0028006 3300037466 Bacteria 5649
878 Ga0395898_0053371 3300037466 Bacteria 3948
879 Ga0395898_0066302 3300037466 Bacteria 3498
880 Ga0395898_0096768 3300037466 Bacteria 2835
881 Ga0395905_0000031 3300037471 Bacteria 286757
882 Ga0395905_0000298 3300037471 Bacteria 72500
883 Ga0395905_0000501 3300037471 Bacteria 53793
884 Ga0395905_0001302 3300037471 Bacteria 30624
885 Ga0395905_0001393 3300037471 Bacteria 29331
886 Ga0395905_0001433 3300037471 Bacteria 28692
887 Ga0395905_0003189 3300037471 Bacteria 17660
888 Ga0395905_0003199 3300037471 Bacteria 17636
889 Ga0395905_0005682 3300037471 Bacteria 12680
890 Ga0395905_0006394 3300037471 Bacteria 11865
891 Ga0395905_0008961 3300037471 Bacteria 9819
892 Ga0395905_0010035 3300037471 Bacteria 9233
893 Ga0395905_0013358 3300037471 Bacteria 7869
894 Ga0395905_0018559 3300037471 Bacteria 6600
895 Ga0395905_0021522 3300037471 Bacteria 6097
896 Ga0395905_0027864 3300037471 Bacteria 5327
897 Ga0395905_0045943 3300037471 Bacteria 4096
898 Ga0395905_0055007 3300037471 Bacteria 3724
899 Ga0395905_0055694 3300037471 Bacteria 3701
900 Ga0395905_0060952 3300037471 Bacteria 3528
901 Ga0395905_0062146 3300037471 Bacteria 3493
902 Ga0395905_0065124 3300037471 Bacteria 3411
903 Ga0395905_0067429 3300037471 Bacteria 3352
904 Ga0395905_0110444 3300037471 Bacteria 2582
905 Ga0316581_0001229 3300037588 Bacteria 5649
906 Ga0316581_0001804 3300037588 Bacteria 4958
907 Ga0436364_0142050 3300037853 Bacteria 28809
908 Ga0395901_0000163 3300038443 Bacteria 87103
909 Ga0395901_0002476 3300038443 Bacteria 18740
910 Ga0395901_0002602 3300038443 Bacteria 18273
911 Ga0395901_0004299 3300038443 Bacteria 14365
912 Ga0395901_0007270 3300038443 Bacteria 11175
913 Ga0395901_0007987 3300038443 Bacteria 10679
914 Ga0395901_0012229 3300038443 Bacteria 8711
915 Ga0395901_0013469 3300038443 Bacteria 8314
916 Ga0395901_0056126 3300038443 Bacteria 4097
917 Ga0395901_0106410 3300038443 Bacteria 2944
918 Ga0395901_0140661 3300038443 Bacteria 2536
919 Ga0395901_0162552 3300038443 Bacteria 2345
920 Ga0237819_00223 3300038705 Bacteria 20561
921 Ga0400488_12823 3300038741 Bacteria 2004
922 Ga0400489_16736 3300039093 Bacteria 3025
923 Ga0400487_17453 3300039110 Bacteria 32736
924 Ga0237816_00361 3300039145 Bacteria 3839
925 Ga0436365_0561345 3300039437 Bacteria 61690
926 Ga0436365_1058137 3300039437 Bacteria 63934
927 Ga0436365_1189040 3300039437 Bacteria 29791
928 Ga0436365_1282680 3300039437 Bacteria 7043
929 Ga0436362_0592983 3300039453 Bacteria 296966
930 Ga0439461_0000719 3300041410 Bacteria 4818
931 Ga0439465_0000162 3300041413 Bacteria 16888
932 Ga0439448_0000322 3300042005 Bacteria 10611
933 Ga0439448_0005343 3300042005 Bacteria 3660
934 Ga0439432_000280 3300042006 Bacteria 18433
935 Ga0439455_0001011 3300042012 Bacteria 4425
936 Ga0439462_0000118 3300042015 Bacteria 12485
937 Ga0439462_0006122 3300042015 Bacteria 2982
938 Ga0450889_000016 3300042144 Bacteria 15020
939 Ga0439458_0000133 3300042157 Bacteria 15728
940 Ga0439458_0000234 3300042157 Bacteria 13258
941 Ga0439458_0000630 3300042157 Bacteria 9139
942 Ga0439434_0002047 3300042435 Bacteria 5830
943 Ga0439435_0008364 3300042436 Bacteria 2398
944 Ga0466969_0000621 3300044656 Bacteria 19186
945 Ga0466966_0000007 3300044684 Bacteria 155702
946 Ga0466966_0008485 3300044684 Bacteria 6802
947 Ga0466966_0029669 3300044684 Bacteria 3556
948 Ga0466961_0009637 3300044693 Bacteria 6149
949 Ga0466963_0029758 3300044694 Bacteria 3518
950 Ga0466963_0075007 3300044694 Bacteria 2282
951 Ga0453684_0040560 3300044712 Bacteria 6318
952 Ga0453684_0055215 3300044712 Bacteria 5165
953 Ga0466971_0006485 3300044719 Bacteria 5085
954 Ga0466971_0008923 3300044719 Bacteria 4382
955 Ga0466968_0001195 3300044735 Bacteria 9182
956 Ga0466968_0016087 3300044735 Bacteria 2973
957 Ga0466970_0014937 3300044765 Bacteria 3992
958 Ga0466957_0002504 3300044842 Bacteria 9881
959 Ga0466960_0009949 3300044901 Bacteria 3936
960 Ga0466959_0013314 3300045049 Bacteria 5960
961 Ga0466959_0016786 3300045049 Bacteria 5357
962 Ga0451576_0000017 3300045051 Bacteria 558261
963 Ga0451576_0000169 3300045051 Bacteria 164329
964 Ga0466958_0001865 3300045836 Bacteria 10293
965 Ga0466967_0002551 3300045976 Bacteria 11415
966 Ga0466967_0003894 3300045976 Bacteria 9905
967 Ga0466967_0018472 3300045976 Bacteria 5574
968 Ga0466967_0039130 3300045976 Bacteria 4074
969 Ga0466967_0041505 3300045976 Bacteria 3967
970 Ga0495617_005789 3300046452 Bacteria 4364
971 Ga0495627_000113 3300046453 Bacteria 100542
972 Ga0495629_0049306 3300046459 Bacteria 2951
973 Ga0495638_0000613 3300046460 Bacteria 39830
974 Ga0495650_0000302 3300046471 Bacteria 89516
975 Ga0495585_0045117 3300046492 Bacteria 2461
976 Ga0495596_0007694 3300046500 Bacteria 4843
977 Ga0495583_0001733 3300046506 Bacteria 20909
978 Ga0495583_0002071 3300046506 Bacteria 18127
979 Ga0495583_0004184 3300046506 Bacteria 10509
980 Ga0495606_0002050 3300046507 Bacteria 24677
981 Ga0495606_0013282 3300046507 Bacteria 6525
982 Ga0495610_0007358 3300046512 Bacteria 7351
983 Ga0495632_0000001 3300046519 Bacteria 873295
984 Ga0495637_0000809 3300046520 Bacteria 20718
985 Ga0495637_0010498 3300046520 Bacteria 4475
986 Ga0495643_0000006 3300046522 Bacteria 419524
987 Ga0495643_0002309 3300046522 Bacteria 15381
988 Ga0495648_0000143 3300046524 Bacteria 85539
989 Ga0495648_0066443 3300046524 Bacteria 2114
990 Ga0495663_0000002 3300046525 Bacteria 495384
991 Ga0495663_0006931 3300046525 Bacteria 3126
992 Ga0495663_0010419 3300046525 Bacteria 2586
993 Ga0495621_0000439 3300046539 Bacteria 10283
994 Ga0495621_0000495 3300046539 Bacteria 9726
995 Ga0495621_0001156 3300046539 Bacteria 6828
996 Ga0495621_0003826 3300046539 Bacteria 4180
997 Ga0495621_0004893 3300046539 Bacteria 3804
998 Ga0495633_0000053 3300046558 Bacteria 152374
999 Ga0495633_0000160 3300046558 Bacteria 88116
1000 Ga0495633_0001909 3300046558 Bacteria 15173
1001 Ga0495633_0003123 3300046558 Bacteria 11226
1002 Ga0495668_0000002 3300046616 Bacteria 763179
1003 Ga0495668_0000016 3300046616 Bacteria 438197
1004 Ga0495668_0010783 3300046616 Bacteria 5514
1005 Ga0495668_0017406 3300046616 Bacteria 4168
1006 Ga0495668_0047737 3300046616 Bacteria 2377
1007 Ga0495668_0053253 3300046616 Bacteria 2237
1008 Ga0495625_0000150 3300046660 Bacteria 106314
1009 Ga0495625_0001486 3300046660 Bacteria 28280
1010 Ga0495625_0017581 3300046660 Bacteria 5595
1011 Ga0495625_0018802 3300046660 Bacteria 5382
1012 Ga0495625_0019758 3300046660 Bacteria 5216
1013 Ga0495669_0000050 3300046684 Bacteria 80688
1014 Ga0495669_0000442 3300046684 Bacteria 19636
1015 Ga0495669_0002160 3300046684 Bacteria 8075
1016 Ga0495669_0002633 3300046684 Bacteria 7342
1017 Ga0495669_0005918 3300046684 Bacteria 5097
1018 Ga0495669_0012805 3300046684 Bacteria 3571
1019 Ga0495669_0021215 3300046684 Bacteria 2817
1020 Ga0495669_0022698 3300046684 Bacteria 2727
1021 Ga0495669_0025360 3300046684 Bacteria 2585
1022 Ga0495670_0000006 3300046691 Bacteria 255322
1023 Ga0495670_0005311 3300046691 Bacteria 6339
1024 Ga0495670_0006360 3300046691 Bacteria 5801
1025 Ga0495670_0018215 3300046691 Bacteria 3458
1026 Ga0495671_0000008 3300046692 Bacteria 419524
1027 Ga0495671_0016684 3300046692 Bacteria 3917
1028 Ga0495649_0000171 3300046694 Bacteria 56672
1029 Ga0495674_0001917 3300047319 Bacteria 20530
1030 Ga0495683_0002781 3300047323 Bacteria 10402
1031 Ga0495687_000648 3300047443 Bacteria 39841
1032 Ga0495687_000694 3300047443 Bacteria 38010
1033 Ga0495677_0003278 3300047445 Bacteria 6310
1034 Ga0495677_0012279 3300047445 Bacteria 3126
1035 Ga0495681_0000050 3300047470 Bacteria 109433
1036 Ga0495681_0003230 3300047470 Bacteria 11364
1037 Ga0495686_0000179 3300047472 Bacteria 121257
1038 Ga0495686_0000392 3300047472 Bacteria 69702
1039 Ga0495686_0000650 3300047472 Bacteria 47482
1040 Ga0495686_0005288 3300047472 Bacteria 10238
1041 Ga0495686_0012436 3300047472 Bacteria 5953
1042 Ga0495615_0000076 3300048090 Bacteria 30172
1043 Ga0496101_0000651 3300048904 Bacteria 20945
1044 Ga0496101_0069842 3300048904 Bacteria 2571
1045 Ga0496102_0000199 3300048905 Bacteria 81435
1046 Ga0496103_0000131 3300048906 Bacteria 79787
1047 Ga0496103_0007392 3300048906 Bacteria 6546
1048 Ga0496105_0000344 3300048908 Bacteria 30542
1049 Ga0496106_0007914 3300048909 Bacteria 7856
1050 Ga0496107_0000593 3300048910 Bacteria 20196
1051 Ga0496107_0021466 3300048910 Bacteria 4563
1052 Ga0496107_0038468 3300048910 Bacteria 3431
1053 Ga0496108_0000396 3300048911 Bacteria 35971
1054 Ga0496108_0002584 3300048911 Bacteria 14509
1055 Ga0496108_0016347 3300048911 Bacteria 6051
1056 Ga0496108_0030374 3300048911 Bacteria 4478
1057 Ga0496108_0035240 3300048911 Bacteria 4159
1058 Ga0496109_0002022 3300048912 Bacteria 16815
1059 Ga0496109_0009994 3300048912 Bacteria 8101
1060 Ga0496109_0042862 3300048912 Bacteria 4101
1061 Ga0496109_0047356 3300048912 Bacteria 3909
1062 Ga0496109_0047604 3300048912 Bacteria 3899
1063 Ga0496110_0014790 3300048913 Bacteria 6484
1064 Ga0496110_0025153 3300048913 Bacteria 5084
1065 Ga0496110_0028508 3300048913 Bacteria 4796
1066 Ga0496110_0058528 3300048913 Bacteria 3394
1067 Ga0496111_0010477 3300048914 Bacteria 6223
1068 Ga0496111_0016029 3300048914 Bacteria 5158
1069 Ga0496111_0049639 3300048914 Bacteria 3026
1070 Ga0496111_0053906 3300048914 Bacteria 2906
1071 Ga0496112_0029832 3300048915 Bacteria 5277
1072 Ga0496112_0030457 3300048915 Bacteria 5223
1073 Ga0496112_0062812 3300048915 Bacteria 3664
1074 Ga0496112_0081476 3300048915 Bacteria 3200
1075 Ga0496112_0157170 3300048915 Bacteria 2240
1076 Ga0496113_0000477 3300048916 Bacteria 19609
1077 Ga0496113_0007008 3300048916 Bacteria 7208
1078 Ga0496113_0013585 3300048916 Bacteria 5524
1079 Ga0496113_0061157 3300048916 Bacteria 2841
1080 Ga0496113_0084965 3300048916 Bacteria 2430
1081 Ga0496114_0000092 3300048917 Bacteria 64974
1082 Ga0496114_0013412 3300048917 Bacteria 6571
1083 Ga0496114_0030365 3300048917 Bacteria 4446
1084 Ga0496114_0035091 3300048917 Bacteria 4140
1085 Ga0496114_0042458 3300048917 Bacteria 3770
1086 Ga0496115_0000133 3300048918 Bacteria 67951
1087 Ga0496115_0002045 3300048918 Bacteria 14436
1088 Ga0496115_0003182 3300048918 Bacteria 11797
1089 Ga0496116_0000017 3300048919 Bacteria 554463
1090 Ga0496116_0003641 3300048919 Bacteria 15131
1091 Ga0496116_0013395 3300048919 Bacteria 6615
1092 Ga0496116_0022513 3300048919 Bacteria 4720
1093 Ga0496117_0000352 3300048920 Bacteria 81089
1094 Ga0496117_0004720 3300048920 Bacteria 14802
1095 Ga0496117_0008967 3300048920 Bacteria 9415
1096 Ga0496118_0000092 3300048921 Bacteria 169106
1097 Ga0496118_0001340 3300048921 Bacteria 37345
1098 Ga0496118_0002576 3300048921 Bacteria 24214
1099 Ga0496118_0037161 3300048921 Bacteria 3924
1100 Ga0496119_0003652 3300048922 Bacteria 15795
1101 Ga0496121_0000228 3300048924 Bacteria 120653
1102 Ga0496121_0000374 3300048924 Bacteria 92048
1103 Ga0496121_0001506 3300048924 Bacteria 39141
1104 Ga0496121_0003439 3300048924 Bacteria 22622
1105 Ga0496121_0007129 3300048924 Bacteria 13564
1106 Ga0496121_0009645 3300048924 Bacteria 11058
1107 Ga0496122_0002967 3300048925 Bacteria 23120
1108 Ga0496122_0020255 3300048925 Bacteria 6023
1109 Ga0496122_0023346 3300048925 Bacteria 5456
1110 Ga0496123_0003732 3300048926 Bacteria 16728
1111 Ga0496123_0025339 3300048926 Bacteria 4474
1112 Ga0496123_0079374 3300048926 Bacteria 2006
1113 Ga0496124_0000081 3300048927 Bacteria 208413
1114 Ga0496124_0002197 3300048927 Bacteria 26029
1115 Ga0496124_0009954 3300048927 Bacteria 9713
1116 Ga0496125_0000980 3300048928 Bacteria 44624
1117 Ga0496125_0001397 3300048928 Bacteria 35315
1118 Ga0496125_0006782 3300048928 Bacteria 12294
1119 Ga0496125_0059025 3300048928 Bacteria 3094
1120 Ga0496126_0000283 3300048929 Bacteria 107129
1121 Ga0496126_0001541 3300048929 Bacteria 35452
1122 Ga0496126_0084747 3300048929 Bacteria 2795
1123 Ga0495678_022554 3300049459 Bacteria 2750
1124 Ga0495678_024362 3300049459 Bacteria 2614
1125 Ga0501074_0073123 3300049590 Bacteria 2463
1126 Ga0501223_000003 3300049663 Bacteria 145549
1127 Ga0501225_0000002 3300049705 Bacteria 147414
1128 Ga0501225_0000629 3300049705 Bacteria 10996
1129 Ga0501280_000262 3300049776 Bacteria 13332
1130 Ga0501044_0008496 3300049823 Bacteria 11252
1131 Ga0501044_0046791 3300049823 Bacteria 4478
1132 Ga0501044_0126968 3300049823 Bacteria 2547
1133 nmdc:mga00v17_2701_c1 3300050491 Bacteria 9102
1134 nmdc:mga0k408_32410_c1 3300050493 Bacteria 2986
1135 nmdc:mga06z11_614_c1 3300050494 Bacteria 13001
1136 nmdc:mga04h51_890_c1 3300050495 Bacteria 6875
1137 nmdc:mga07m45_15_c1 3300050496 Bacteria 152740
1138 nmdc:mga07m45_34424_c1 3300050496 Bacteria 2815
1139 nmdc:mga07m45_71288_c1 3300050496 Bacteria 1977
1140 nmdc:mga06r32_42891_c1 3300050510 Bacteria 4304
1141 nmdc:mga08y16_22426_c1 3300050511 Bacteria 6664
1142 Ga0500610_0000139 3300053079 Bacteria 21725
1143 Ga0500643_000001 3300053087 Bacteria 1440111
1144 Ga0500643_001566 3300053087 Bacteria 12947
1145 Ga0500643_004123 3300053087 Bacteria 6683
1146 Ga0500643_008226 3300053087 Bacteria 4121
1147 Ga0500643_022509 3300053087 Bacteria 2027
1148 Ga0500566_0000177 3300053094 Bacteria 32478
1149 Ga0500556_0000014 3300053104 Bacteria 232989
1150 Ga0500595_001258 3300053119 Bacteria 13946
1151 Ga0500607_000001 3300053121 Bacteria 185408
1152 Ga0500607_001148 3300053121 Bacteria 24635
1153 Ga0500642_0000001 3300053130 Bacteria 1468402
1154 Ga0500642_0001585 3300053130 Bacteria 6557
1155 Ga0500658_0000177 3300053134 Bacteria 30497
1156 Ga0500658_0005757 3300053134 Bacteria 4618
1157 Ga0500568_0001623 3300053139 Bacteria 14174
1158 Ga0500568_0004798 3300053139 Bacteria 7145
1159 Ga0500573_0000072 3300053140 Bacteria 57990
1160 Ga0500604_0000018 3300053151 Bacteria 78699
1161 Ga0500616_0000419 3300053153 Bacteria 56812
1162 Ga0500616_0000726 3300053153 Bacteria 38087
1163 Ga0500616_0012205 3300053153 Bacteria 5033
1164 Ga0500622_0000795 3300053156 Bacteria 27284
1165 Ga0500627_0000006 3300053158 Bacteria 165989
1166 Ga0500636_0001727 3300053177 Bacteria 11962
1167 Ga0500645_000221 3300053730 Bacteria 43327
1168 Ga0500645_001072 3300053730 Bacteria 15122
1169 Ga0500645_006389 3300053730 Bacteria 4212
1170 Ga0466962_0006109 3300061719 Bacteria 5788

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046616 Ga0495668_0047737 Ga0495668_0047737_435_2354 622
2 3300050496 nmdc:mga07m45_71288_c1 nmdc:mga07m45_71288_c1_17_1945 622
3 3300039093 Ga0400489_16736 Ga0400489_16736_61_1950 624
4 3300048915 Ga0496112_0029832 Ga0496112_0029832_17_1966 627
5 3300038741 Ga0400488_12823 Ga0400488_12823_84_1982 629
6 3300046660 Ga0495625_0018802 Ga0495625_0018802_3430_5352 631
7 3300048906 Ga0496103_0007392 Ga0496103_0007392_46_2001 631
8 3300048914 Ga0496111_0049639 Ga0496111_0049639_14_1990 632
9 3300046524 Ga0495648_0066443 Ga0495648_0066443_185_2092 634
10 3300048926 Ga0496123_0079374 Ga0496123_0079374_57_1973 636
11 3300031239 Ga0265328_10003967 Ga0265328_100039675 637
12 3300031250 Ga0265331_10004114 Ga0265331_100041146 637
13 3300031251 Ga0265327_10007474 Ga0265327_100074746 637
14 3300031344 Ga0265316_10068018 Ga0265316_100680183 637
15 3300046520 Ga0495637_0010498 Ga0495637_0010498_2531_4447 637
16 3300031727 Ga0316576_10054220 Ga0316576_100542202 647
17 3300053087 Ga0500643_022509 Ga0500643_022509_11_1990 654
18 3300035724 Ga0373933_0063894 Ga0373933_0063894_62_2185 655
19 3300033528 Ga0316588_1004812 Ga0316588_10048122 662
20 3300013308 Ga0157375_10175704 Ga0157375_101757042 672
21 3300048917 Ga0496114_0035091 Ga0496114_0035091_17_2104 677
22 3300048904 Ga0496101_0069842 Ga0496101_0069842_458_2548 678
23 3300037471 Ga0395905_0045943 Ga0395905_0045943_14_2107 679
24 3300046684 Ga0495669_0025360 Ga0495669_0025360_460_2553 679
25 3300048916 Ga0496113_0061157 Ga0496113_0061157_736_2829 679
26 3300050496 nmdc:mga07m45_34424_c1 nmdc:mga07m45_34424_c1_28_2073 679
27 3300031691 Ga0316579_10004493 Ga0316579_100044934 684
28 3300031728 Ga0316578_10010822 Ga0316578_100108224 684
29 3300031733 Ga0316577_10017860 Ga0316577_100178602 684
30 3300032133 Ga0316583_10005660 Ga0316583_100056602 684
31 3300032137 Ga0316585_10000656 Ga0316585_100006564 684
32 3300032168 Ga0316593_10006961 Ga0316593_100069612 684
33 3300033524 Ga0316592_1002701 Ga0316592_10027012 684
34 3300033527 Ga0316586_1001778 Ga0316586_10017781 684
35 3300033529 Ga0316587_1002280 Ga0316587_10022801 684
36 3300036712 Ga0316584_0012265 Ga0316584_0012265_1291_3459 684
37 3300037588 Ga0316581_0001804 Ga0316581_0001804_533_2701 684
38 3300047323 Ga0495683_0002781 Ga0495683_0002781_33_2093 685
39 3300046459 Ga0495629_0049306 Ga0495629_0049306_210_2297 693
40 3300047319 Ga0495674_0001917 Ga0495674_0001917_16934_19021 693
41 3300048915 Ga0496112_0157170 Ga0496112_0157170_79_2223 693
42 3300047472 Ga0495686_0000179 Ga0495686_0000179_83568_85736 694
43 3300042436 Ga0439435_0008364 Ga0439435_0008364_242_2350 698
44 3300044712 Ga0453684_0040560 Ga0453684_0040560_3783_5897 698
45 3300044712 Ga0453684_0055215 Ga0453684_0055215_377_2491 698
46 3300045051 Ga0451576_0000169 Ga0451576_0000169_83399_85513 698
47 3300025935 Ga0207709_10007647 Ga0207709_100076473 701
48 3300037471 Ga0395905_0110444 Ga0395905_0110444_14_2230 702
49 3300005327 Ga0070658_10008670 Ga0070658_100086709 704
50 3300005548 Ga0070665_100013480 Ga0070665_1000134802 704
51 3300005616 Ga0068852_100015299 Ga0068852_1000152994 704
52 3300005843 Ga0068860_100018191 Ga0068860_1000181917 704
53 3300005844 Ga0068862_100001236 Ga0068862_1000012368 704
54 3300025940 Ga0207691_10012322 Ga0207691_100123222 704
55 3300026089 Ga0207648_10001898 Ga0207648_1000189814 704
56 3300028381 Ga0268264_10005389 Ga0268264_100053895 704
57 3300025919 Ga0207657_10013729 Ga0207657_100137295 706
58 3300026116 Ga0207674_10002803 Ga0207674_1000280316 706
59 3300036712 Ga0316584_0016562 Ga0316584_0016562_2819_4951 706
60 3300036712 Ga0316584_0019159 Ga0316584_0019159_1951_4083 706
61 3300049776 Ga0501280_000262 Ga0501280_000262_11167_13299 706
62 3300005457 Ga0070662_100001710 Ga0070662_1000017103 707
63 3300005543 Ga0070672_100001617 Ga0070672_1000016178 707
64 3300005564 Ga0070664_100004751 Ga0070664_1000047519 707
65 3300005841 Ga0068863_100012561 Ga0068863_10001256110 707
66 3300005842 Ga0068858_100004459 Ga0068858_10000445910 707
67 3300013308 Ga0157375_10000628 Ga0157375_100006288 707
68 3300025931 Ga0207644_10003168 Ga0207644_1000316813 707
69 3300025933 Ga0207706_10000866 Ga0207706_1000086628 707
70 3300025940 Ga0207691_10001025 Ga0207691_1000102529 707
71 3300025945 Ga0207679_10025609 Ga0207679_100256091 707
72 3300025960 Ga0207651_10002016 Ga0207651_100020163 707
73 3300026095 Ga0207676_10003029 Ga0207676_100030296 707
74 3300026121 Ga0207683_10003836 Ga0207683_100038368 707
75 3300048911 Ga0496108_0002584 Ga0496108_0002584_3814_6057 707
76 3300048913 Ga0496110_0028508 Ga0496110_0028508_115_2358 707
77 iso_pu_bacteria 8055225921 8055227192 707
78 3300025253 Ga0209677_100495 Ga0209677_10049519 708
79 3300005535 Ga0070684_100008971 Ga0070684_1000089715 709
80 3300020069 Ga0197907_11355757 Ga0197907_113557571 709
81 3300026142 Ga0207698_10063171 Ga0207698_100631712 709
82 3300037312 Ga0395899_0000103 Ga0395899_0000103_108333_110597 709
83 3300037312 Ga0395899_0001385 Ga0395899_0001385_1416_3680 709
84 3300037312 Ga0395899_0009719 Ga0395899_0009719_4692_6932 709
85 3300037418 Ga0395900_0000093 Ga0395900_0000093_162934_165198 709
86 3300037418 Ga0395900_0024293 Ga0395900_0024293_3998_6184 709
87 3300037418 Ga0395900_0027054 Ga0395900_0027054_3610_5850 709
88 3300037418 Ga0395900_0050442 Ga0395900_0050442_1159_3423 709
89 3300037466 Ga0395898_0000053 Ga0395898_0000053_162934_165198 709
90 3300037466 Ga0395898_0066302 Ga0395898_0066302_1139_3403 709
91 3300037471 Ga0395905_0000031 Ga0395905_0000031_121560_123824 709
92 3300037471 Ga0395905_0013358 Ga0395905_0013358_2688_4952 709
93 3300037471 Ga0395905_0067429 Ga0395905_0067429_308_2572 709
94 3300038443 Ga0395901_0000163 Ga0395901_0000163_82376_84640 709
95 3300005455 Ga0070663_100011037 Ga0070663_1000110375 710
96 3300005578 Ga0068854_100002482 Ga0068854_10000248210 710
97 3300005578 Ga0068854_100023772 Ga0068854_1000237723 710
98 3300025940 Ga0207691_10055329 Ga0207691_100553292 710
99 3300025960 Ga0207651_10026797 Ga0207651_100267972 710
100 3300025981 Ga0207640_10001764 Ga0207640_1000176410 710
101 3300025981 Ga0207640_10008683 Ga0207640_100086833 710
102 3300026067 Ga0207678_10021371 Ga0207678_100213715 710
103 3300032168 Ga0316593_10017049 Ga0316593_100170491 710
104 3300033541 Ga0316596_1010318 Ga0316596_10103181 710
105 3300038443 Ga0395901_0162552 Ga0395901_0162552_10_2196 710
106 3300005328 Ga0070676_10000972 Ga0070676_100009722 711
107 3300005330 Ga0070690_100006079 Ga0070690_1000060792 711
108 3300005335 Ga0070666_10000413 Ga0070666_100004138 711
109 3300005338 Ga0068868_100000237 Ga0068868_10000023714 711
110 3300005367 Ga0070667_100001053 Ga0070667_10000105321 711
111 3300005459 Ga0068867_100003291 Ga0068867_1000032918 711
112 3300005543 Ga0070672_100040593 Ga0070672_1000405932 711
113 3300005544 Ga0070686_100033497 Ga0070686_1000334972 711
114 3300005842 Ga0068858_100002219 Ga0068858_10000221923 711
115 3300025903 Ga0207680_10001311 Ga0207680_1000131111 711
116 3300025904 Ga0207647_10009369 Ga0207647_100093694 711
117 3300025941 Ga0207711_10000826 Ga0207711_1000082614 711
118 3300025972 Ga0207668_10000150 Ga0207668_1000015034 711
119 3300025986 Ga0207658_10005167 Ga0207658_100051674 711
120 3300026023 Ga0207677_10000612 Ga0207677_1000061219 711
121 3300026035 Ga0207703_10002164 Ga0207703_1000216420 711
122 3300031727 Ga0316576_10026539 Ga0316576_100265392 711
123 3300031728 Ga0316578_10005752 Ga0316578_100057522 711
124 3300032139 Ga0316580_10002940 Ga0316580_100029402 711
125 3300037418 Ga0395900_0102411 Ga0395900_0102411_509_2758 711
126 3300037471 Ga0395905_0062146 Ga0395905_0062146_947_3196 711
127 iso_pu_bacteria 2834578030 2834581919 711
128 3300005548 Ga0070665_100011489 Ga0070665_1000114893 712
129 3300031727 Ga0316576_10027433 Ga0316576_100274333 712
130 3300031727 Ga0316576_10059386 Ga0316576_100593861 712
131 3300031727 Ga0316576_10061790 Ga0316576_100617901 712
132 3300031728 Ga0316578_10004141 Ga0316578_100041412 712
133 3300031728 Ga0316578_10009549 Ga0316578_100095493 712
134 3300031728 Ga0316578_10055392 Ga0316578_100553921 712
135 3300031733 Ga0316577_10006270 Ga0316577_100062704 712
136 3300031733 Ga0316577_10022425 Ga0316577_100224251 712
137 3300032139 Ga0316580_10009904 Ga0316580_100099041 712
138 3300032168 Ga0316593_10003447 Ga0316593_100034472 712
139 3300033541 Ga0316596_1002254 Ga0316596_10022541 712
140 3300033541 Ga0316596_1007868 Ga0316596_10078681 712
141 3300035398 Ga0316574_0008491 Ga0316574_0008491_2880_5030 712
142 3300035398 Ga0316574_0030155 Ga0316574_0030155_503_2659 712
143 3300035398 Ga0316574_0031062 Ga0316574_0031062_49_2205 712
144 3300036647 Ga0316582_0012637 Ga0316582_0012637_2318_4474 712
145 3300036712 Ga0316584_0000934 Ga0316584_0000934_11962_14118 712
146 3300031251 Ga0265327_10019076 Ga0265327_100190762 713
147 iso_pu_bacteria 2537561728 2538426770 713
148 iso_pu_bacteria 2855195626 2855196018 713
149 iso_pu_bacteria 2858466076 2858468896 713
150 iso_pu_bacteria 2871272651 2871272705 713
151 iso_pu_bacteria 2871282230 2871286259 713
152 iso_pu_bacteria 2900051742 2900052644 713
153 iso_pu_bacteria 2919679072 2919680798 713
154 iso_pu_bacteria 2928100450 2928102260 713
155 iso_pu_bacteria 2928959182 2928961237 713
156 iso_pu_bacteria 8005658619 8005662122 713
157 3300005336 Ga0070680_100031955 Ga0070680_1000319552 714
158 3300005339 Ga0070660_100042147 Ga0070660_1000421472 714
159 3300005563 Ga0068855_100073730 Ga0068855_1000737302 714
160 3300005616 Ga0068852_100003430 Ga0068852_10000343012 714
161 3300025919 Ga0207657_10051377 Ga0207657_100513772 714
162 3300026142 Ga0207698_10000336 Ga0207698_1000033626 714
163 3300026142 Ga0207698_10020965 Ga0207698_100209652 714
164 3300039110 Ga0400487_17453 Ga0400487_17453_880_3042 714
165 3300044719 Ga0466971_0008923 Ga0466971_0008923_17_2302 714
166 iso_pu_bacteria 2919493220 2919495155 714
167 iso_pu_bacteria 2919543075 2919545424 714
168 3300005336 Ga0070680_100002095 Ga0070680_1000020956 715
169 3300005345 Ga0070692_10032337 Ga0070692_100323372 715
170 3300005354 Ga0070675_100064532 Ga0070675_1000645322 715
171 3300005355 Ga0070671_100040623 Ga0070671_1000406233 715
172 3300005548 Ga0070665_100001570 Ga0070665_10000157017 715
173 3300005618 Ga0068864_100000716 Ga0068864_1000007168 715
174 3300013102 Ga0157371_10047179 Ga0157371_100471792 715
175 3300014968 Ga0157379_10006904 Ga0157379_100069046 715
176 3300025917 Ga0207660_10000486 Ga0207660_100004863 715
177 3300026088 Ga0207641_10005321 Ga0207641_100053218 715
178 3300026095 Ga0207676_10006599 Ga0207676_100065996 715
179 3300028379 Ga0268266_10001840 Ga0268266_100018402 715
180 3300032168 Ga0316593_10002833 Ga0316593_100028332 715
181 3300032168 Ga0316593_10007037 Ga0316593_100070372 715
182 3300033541 Ga0316596_1005079 Ga0316596_10050792 715
183 3300036647 Ga0316582_0001731 Ga0316582_0001731_7556_9751 715
184 3300037588 Ga0316581_0001229 Ga0316581_0001229_2974_5139 715
185 3300046525 Ga0495663_0006931 Ga0495663_0006931_555_2756 715
186 3300047472 Ga0495686_0005288 Ga0495686_0005288_7936_10149 715
187 3300048090 Ga0495615_0000076 Ga0495615_0000076_26717_28912 715
188 3300053104 Ga0500556_0000014 Ga0500556_0000014_224097_226304 715
189 3300013306 Ga0163162_10095295 Ga0163162_100952951 716
190 3300046506 Ga0495583_0002071 Ga0495583_0002071_2417_4570 716
191 3300046660 Ga0495625_0019758 Ga0495625_0019758_2825_4978 716
192 3300047445 Ga0495677_0003278 Ga0495677_0003278_1550_3703 716
193 3300005367 Ga0070667_100003055 Ga0070667_10000305515 717
194 3300025986 Ga0207658_10002222 Ga0207658_100022221 717
195 3300028381 Ga0268264_10060108 Ga0268264_100601081 717
196 3300031665 Ga0316575_10004496 Ga0316575_100044964 717
197 3300031691 Ga0316579_10000213 Ga0316579_100002134 717
198 3300031727 Ga0316576_10000335 Ga0316576_100003353 717
199 3300031727 Ga0316576_10004605 Ga0316576_100046054 717
200 3300031728 Ga0316578_10003505 Ga0316578_100035054 717
201 3300031728 Ga0316578_10005915 Ga0316578_100059153 717
202 3300031728 Ga0316578_10009370 Ga0316578_100093704 717
203 3300031733 Ga0316577_10013476 Ga0316577_100134761 717
204 3300032139 Ga0316580_10002178 Ga0316580_100021783 717
205 3300032168 Ga0316593_10001634 Ga0316593_100016344 717
206 3300032168 Ga0316593_10014156 Ga0316593_100141561 717
207 3300033524 Ga0316592_1002974 Ga0316592_10029741 717
208 3300033524 Ga0316592_1003805 Ga0316592_10038051 717
209 3300033524 Ga0316592_1005316 Ga0316592_10053161 717
210 3300033528 Ga0316588_1000422 Ga0316588_10004222 717
211 3300033528 Ga0316588_1005392 Ga0316588_10053921 717
212 3300033541 Ga0316596_1000497 Ga0316596_10004971 717
213 3300033541 Ga0316596_1000747 Ga0316596_10007474 717
214 3300033541 Ga0316596_1002201 Ga0316596_10022013 717
215 3300033541 Ga0316596_1002732 Ga0316596_10027321 717
216 3300033541 Ga0316596_1005122 Ga0316596_10051222 717
217 3300035398 Ga0316574_0002715 Ga0316574_0002715_4472_6646 717
218 3300036647 Ga0316582_0000505 Ga0316582_0000505_8149_10323 717
219 3300036712 Ga0316584_0016170 Ga0316584_0016170_393_2567 717
220 3300037418 Ga0395900_0033030 Ga0395900_0033030_2993_5227 717
221 3300037471 Ga0395905_0001302 Ga0395905_0001302_1882_4116 717
222 3300048918 Ga0496115_0002045 Ga0496115_0002045_11_2188 717
223 3300048918 Ga0496115_0003182 Ga0496115_0003182_5603_7813 717
224 iso_pu_bacteria 2643221588 2643951698 717
225 iso_pu_bacteria 2885427238 2885429415 717
226 3300042005 Ga0439448_0005343 Ga0439448_0005343_1381_3597 718
227 3300042012 Ga0439455_0001011 Ga0439455_0001011_173_2389 718
228 3300042157 Ga0439458_0000234 Ga0439458_0000234_954_3170 718
229 3300046519 Ga0495632_0000001 Ga0495632_0000001_353258_355417 718
230 3300046520 Ga0495637_0000809 Ga0495637_0000809_591_2750 718
231 3300046522 Ga0495643_0000006 Ga0495643_0000006_43406_45565 718
232 3300046525 Ga0495663_0000002 Ga0495663_0000002_351588_353747 718
233 3300046558 Ga0495633_0000160 Ga0495633_0000160_61159_63318 718
234 3300046692 Ga0495671_0000008 Ga0495671_0000008_43406_45565 718
235 3300048915 Ga0496112_0081476 Ga0496112_0081476_418_2631 718
236 3300053139 Ga0500568_0001623 Ga0500568_0001623_8119_10296 718
237 3300053151 Ga0500604_0000018 Ga0500604_0000018_24865_27039 718
238 3300053153 Ga0500616_0000419 Ga0500616_0000419_30330_32507 718
239 iso_pu_bacteria 2896253425 2896254227 718
240 iso_pu_bacteria 2896429255 2896430912 718
241 3300003781 Ga0055536_1000632 Ga0055536_10006324 719
242 3300005355 Ga0070671_100039349 Ga0070671_1000393491 719
243 3300005535 Ga0070684_100057578 Ga0070684_1000575783 719
244 3300017792 Ga0163161_10007999 Ga0163161_100079995 719
245 3300025292 Ga0209676_1000421 Ga0209676_100042153 719
246 3300025304 Ga0209257_1004436 Ga0209257_10044368 719
247 3300037418 Ga0395900_0023881 Ga0395900_0023881_442_2655 719
248 3300048912 Ga0496109_0047356 Ga0496109_0047356_352_2523 719
249 3300048913 Ga0496110_0058528 Ga0496110_0058528_196_2367 719
250 3300048914 Ga0496111_0016029 Ga0496111_0016029_1700_3871 719
251 3300048915 Ga0496112_0062812 Ga0496112_0062812_1078_3306 719
252 3300048917 Ga0496114_0000092 Ga0496114_0000092_57514_59727 719
253 3300048917 Ga0496114_0030365 Ga0496114_0030365_380_2551 719
254 3300005339 Ga0070660_100026206 Ga0070660_1000262063 720
255 3300005366 Ga0070659_100004165 Ga0070659_1000041652 720
256 3300005530 Ga0070679_100051608 Ga0070679_1000516084 720
257 3300005563 Ga0068855_100074034 Ga0068855_1000740342 720
258 3300005564 Ga0070664_100058481 Ga0070664_1000584812 720
259 3300005841 Ga0068863_100029716 Ga0068863_1000297162 720
260 3300009177 Ga0105248_10001772 Ga0105248_1000177218 720
261 3300013104 Ga0157370_10028584 Ga0157370_100285842 720
262 3300021388 Ga0213875_10003717 Ga0213875_100037173 720
263 3300025919 Ga0207657_10020802 Ga0207657_100208022 720
264 3300025933 Ga0207706_10003540 Ga0207706_1000354010 720
265 3300025941 Ga0207711_10001908 Ga0207711_1000190814 720
266 3300025949 Ga0207667_10061301 Ga0207667_100613012 720
267 3300026088 Ga0207641_10010261 Ga0207641_100102613 720
268 3300037418 Ga0395900_0000862 Ga0395900_0000862_23362_25575 720
269 3300037471 Ga0395905_0000501 Ga0395905_0000501_49462_51675 720
270 3300037853 Ga0436364_0142050 Ga0436364_0142050_5916_8135 720
271 3300046684 Ga0495669_0012805 Ga0495669_0012805_1126_3366 720
272 3300048909 Ga0496106_0007914 Ga0496106_0007914_3551_5791 720
273 3300048910 Ga0496107_0021466 Ga0496107_0021466_2259_4499 720
274 3300048912 Ga0496109_0002022 Ga0496109_0002022_5471_7711 720
275 3300048913 Ga0496110_0025153 Ga0496110_0025153_1808_4048 720
276 3300048916 Ga0496113_0013585 Ga0496113_0013585_3064_5304 720
277 3300053121 Ga0500607_001148 Ga0500607_001148_14604_16799 720
278 iso_pu_bacteria 2643221560 2643821188 720
279 3300001990 JGI24737J22298_10000083 JGI24737J22298_1000008316 721
280 3300002067 JGI24735J21928_10006042 JGI24735J21928_100060424 721
281 3300002075 JGI24738J21930_10000137 JGI24738J21930_1000013713 721
282 3300005338 Ga0068868_100000103 Ga0068868_10000010329 721
283 3300005344 Ga0070661_100010999 Ga0070661_1000109991 721
284 3300005353 Ga0070669_100000870 Ga0070669_10000087024 721
285 3300005355 Ga0070671_100072524 Ga0070671_1000725242 721
286 3300005364 Ga0070673_100000336 Ga0070673_1000003369 721
287 3300005366 Ga0070659_100000817 Ga0070659_10000081716 721
288 3300005457 Ga0070662_100000140 Ga0070662_10000014038 721
289 3300005459 Ga0068867_100000319 Ga0068867_10000031910 721
290 3300005539 Ga0068853_100000360 Ga0068853_10000036010 721
291 3300005543 Ga0070672_100000388 Ga0070672_10000038821 721
292 3300005563 Ga0068855_100000640 Ga0068855_10000064010 721
293 3300005577 Ga0068857_100000727 Ga0068857_10000072718 721
294 3300005578 Ga0068854_100000197 Ga0068854_10000019711 721
295 3300005616 Ga0068852_100000673 Ga0068852_10000067316 721
296 3300005618 Ga0068864_100000331 Ga0068864_10000033145 721
297 3300005841 Ga0068863_100006196 Ga0068863_10000619611 721
298 3300005843 Ga0068860_100002891 Ga0068860_10000289111 721
299 3300005844 Ga0068862_100013388 Ga0068862_1000133883 721
300 3300006881 Ga0068865_100001962 Ga0068865_1000019622 721
301 3300009098 Ga0105245_10000407 Ga0105245_1000040717 721
302 3300011119 Ga0105246_10004677 Ga0105246_100046777 721
303 3300013100 Ga0157373_10011750 Ga0157373_100117502 721
304 3300013102 Ga0157371_10001390 Ga0157371_100013907 721
305 3300013307 Ga0157372_10160078 Ga0157372_101600781 721
306 3300025315 Ga0207697_10000104 Ga0207697_100001045 721
307 3300025901 Ga0207688_10001426 Ga0207688_100014268 721
308 3300025909 Ga0207705_10000949 Ga0207705_1000094911 721
309 3300025919 Ga0207657_10009943 Ga0207657_100099439 721
310 3300025920 Ga0207649_10018070 Ga0207649_100180701 721
311 3300025923 Ga0207681_10014333 Ga0207681_100143333 721
312 3300025932 Ga0207690_10001552 Ga0207690_100015525 721
313 3300025933 Ga0207706_10000346 Ga0207706_1000034616 721
314 3300025940 Ga0207691_10000592 Ga0207691_1000059233 721
315 3300025942 Ga0207689_10000033 Ga0207689_1000003373 721
316 3300025945 Ga0207679_10021965 Ga0207679_100219653 721
317 3300025960 Ga0207651_10000139 Ga0207651_1000013914 721
318 3300025981 Ga0207640_10000853 Ga0207640_100008539 721
319 3300026023 Ga0207677_10000472 Ga0207677_1000047211 721
320 3300026088 Ga0207641_10004609 Ga0207641_100046093 721
321 3300026089 Ga0207648_10000554 Ga0207648_100005549 721
322 3300026095 Ga0207676_10000439 Ga0207676_1000043925 721
323 3300026116 Ga0207674_10000104 Ga0207674_1000010448 721
324 3300026142 Ga0207698_10002149 Ga0207698_1000214911 721
325 3300028381 Ga0268264_10002226 Ga0268264_100022265 721
326 3300037471 Ga0395905_0065124 Ga0395905_0065124_407_2629 721
327 3300048911 Ga0496108_0035240 Ga0496108_0035240_1658_3895 721
328 3300053087 Ga0500643_000001 Ga0500643_000001_312694_314892 721
329 3300053153 Ga0500616_0000726 Ga0500616_0000726_21765_23954 721
330 iso_pu_bacteria 2643221563 2643832693 721
331 iso_pu_bacteria 2643221608 2644053512 721
332 iso_pu_bacteria 2852653556 2852657032 721
333 iso_pu_bacteria 2852680915 2852683729 721
334 iso_pu_bacteria 2896184354 2896187311 721
335 iso_pu_bacteria 2928027323 2928027876 721
336 iso_pu_bacteria 2984555340 2984558748 721
337 iso_pu_bacteria 2984564862 2984566746 721
338 iso_pu_bacteria 2993356040 2993357934 721
339 3300005548 Ga0070665_100004175 Ga0070665_1000041757 722
340 3300048916 Ga0496113_0007008 Ga0496113_0007008_3929_6193 722
341 iso_pu_bacteria 2882806704 2882809587 722
342 iso_pu_bacteria 2895880812 2895884741 722
343 3300005327 Ga0070658_10003302 Ga0070658_100033025 723
344 3300005339 Ga0070660_100000830 Ga0070660_10000083012 723
345 3300005563 Ga0068855_100131037 Ga0068855_1001310372 723
346 3300025909 Ga0207705_10013854 Ga0207705_100138543 723
347 3300025919 Ga0207657_10003915 Ga0207657_1000391512 723
348 3300031824 Ga0307413_10030487 Ga0307413_100304871 723
349 3300032005 Ga0307411_10039918 Ga0307411_100399182 723
350 3300032126 Ga0307415_100034223 Ga0307415_1000342233 723
351 3300045976 Ga0466967_0018472 Ga0466967_0018472_2149_4377 723
352 3300049823 Ga0501044_0008496 Ga0501044_0008496_2885_5062 723
353 iso_pu_bacteria 2848297114 2848298929 723
354 iso_pu_bacteria 2885429604 2885430528 723
355 3300002774 JGI25150J39212_1000177 JGI25150J39212_100017727 724
356 3300003215 JGI25153J46596_10000153 JGI25153J46596_1000015361 724
357 3300003773 Ga0055537_1003328 Ga0055537_10033281 724
358 3300003792 Ga0055540_1000762 Ga0055540_100076218 724
359 3300005330 Ga0070690_100000975 Ga0070690_1000009757 724
360 3300005338 Ga0068868_100004297 Ga0068868_1000042975 724
361 3300005355 Ga0070671_100050958 Ga0070671_1000509582 724
362 3300005367 Ga0070667_100004119 Ga0070667_1000041193 724
363 3300005457 Ga0070662_100001767 Ga0070662_10000176710 724
364 3300005459 Ga0068867_100010357 Ga0068867_1000103578 724
365 3300005614 Ga0068856_100006488 Ga0068856_1000064883 724
366 3300005617 Ga0068859_100003376 Ga0068859_1000033764 724
367 3300005618 Ga0068864_100007189 Ga0068864_1000071895 724
368 3300005841 Ga0068863_100001961 Ga0068863_10000196123 724
369 3300005842 Ga0068858_100000642 Ga0068858_1000006428 724
370 3300006881 Ga0068865_100002931 Ga0068865_10000293113 724
371 3300006931 Ga0097620_100003376 Ga0097620_1000033764 724
372 3300009177 Ga0105248_10034417 Ga0105248_100344171 724
373 3300014325 Ga0163163_10001581 Ga0163163_1000158114 724
374 3300025245 Ga0207425_1000019 Ga0207425_1000019332 724
375 3300025258 Ga0209129_1002069 Ga0209129_10020697 724
376 3300025263 Ga0209565_1000166 Ga0209565_100016693 724
377 3300025292 Ga0209676_1001128 Ga0209676_100112830 724
378 3300025294 Ga0209025_1000304 Ga0209025_100030451 724
379 3300025294 Ga0209025_1012768 Ga0209025_10127681 724
380 3300025295 Ga0209564_1001819 Ga0209564_10018195 724
381 3300025295 Ga0209564_1018738 Ga0209564_10187381 724
382 3300025297 Ga0209758_1000019 Ga0209758_1000019255 724
383 3300025298 Ga0209050_1000001 Ga0209050_10000011320 724
384 3300025298 Ga0209050_1003282 Ga0209050_10032828 724
385 3300025303 Ga0209051_1000309 Ga0209051_100030931 724
386 3300025304 Ga0209257_1000250 Ga0209257_100025011 724
387 3300025304 Ga0209257_1001776 Ga0209257_100177612 724
388 3300025304 Ga0209257_1001845 Ga0209257_100184513 724
389 3300025904 Ga0207647_10002253 Ga0207647_100022538 724
390 3300025919 Ga0207657_10008544 Ga0207657_100085443 724
391 3300025924 Ga0207694_10026849 Ga0207694_100268492 724
392 3300025931 Ga0207644_10000855 Ga0207644_100008551 724
393 3300025933 Ga0207706_10000840 Ga0207706_1000084023 724
394 3300025940 Ga0207691_10000705 Ga0207691_1000070527 724
395 3300025941 Ga0207711_10000044 Ga0207711_10000044158 724
396 3300026078 Ga0207702_10025380 Ga0207702_100253803 724
397 3300026089 Ga0207648_10002898 Ga0207648_1000289818 724
398 3300026121 Ga0207683_10003325 Ga0207683_1000332514 724
399 3300028380 Ga0268265_10019528 Ga0268265_100195283 724
400 3300028381 Ga0268264_10000338 Ga0268264_100003388 724
401 3300031548 Ga0307408_100010788 Ga0307408_1000107884 724
402 3300031824 Ga0307413_10013207 Ga0307413_100132073 724
403 3300031824 Ga0307413_10026246 Ga0307413_100262462 724
404 3300031901 Ga0307406_10004678 Ga0307406_100046784 724
405 3300031911 Ga0307412_10004047 Ga0307412_100040475 724
406 3300032002 Ga0307416_100003206 Ga0307416_1000032065 724
407 3300032126 Ga0307415_100003613 Ga0307415_1000036135 724
408 3300039437 Ga0436365_1282680 Ga0436365_1282680_1266_3509 724
409 3300045976 Ga0466967_0041505 Ga0466967_0041505_1521_3752 724
410 3300046539 Ga0495621_0000439 Ga0495621_0000439_113_2356 724
411 3300046616 Ga0495668_0000002 Ga0495668_0000002_272669_274852 724
412 3300046691 Ga0495670_0005311 Ga0495670_0005311_112_2355 724
413 3300048904 Ga0496101_0000651 Ga0496101_0000651_7203_9446 724
414 3300048910 Ga0496107_0000593 Ga0496107_0000593_12083_14326 724
415 3300048911 Ga0496108_0000396 Ga0496108_0000396_23033_25276 724
416 3300048911 Ga0496108_0016347 Ga0496108_0016347_1374_3548 724
417 3300048916 Ga0496113_0084965 Ga0496113_0084965_40_2283 724
418 3300048919 Ga0496116_0022513 Ga0496116_0022513_1948_4122 724
419 3300048924 Ga0496121_0001506 Ga0496121_0001506_17391_19565 724
420 3300053087 Ga0500643_008226 Ga0500643_008226_119_2317 724
421 3300053130 Ga0500642_0000001 Ga0500642_0000001_848191_850389 724
422 3300053158 Ga0500627_0000006 Ga0500627_0000006_117549_119732 724
423 3300053730 Ga0500645_001072 Ga0500645_001072_3664_5862 724
424 3300003781 Ga0055536_1002159 Ga0055536_10021598 725
425 3300003791 Ga0055530_10000667 Ga0055530_1000066726 725
426 3300003794 Ga0055531_10008445 Ga0055531_100084453 725
427 3300005293 Ga0065715_10000404 Ga0065715_100004049 725
428 3300005331 Ga0070670_100001793 Ga0070670_10000179314 725
429 3300005333 Ga0070677_10000317 Ga0070677_100003178 725
430 3300005347 Ga0070668_100002166 Ga0070668_1000021668 725
431 3300005354 Ga0070675_100006070 Ga0070675_1000060705 725
432 3300005355 Ga0070671_100028527 Ga0070671_1000285272 725
433 3300005364 Ga0070673_100000995 Ga0070673_1000009959 725
434 3300005545 Ga0070695_100015950 Ga0070695_1000159503 725
435 3300005546 Ga0070696_100008440 Ga0070696_1000084407 725
436 3300009011 Ga0105251_10001985 Ga0105251_1000198514 725
437 3300009094 Ga0111539_10036206 Ga0111539_100362064 725
438 3300009177 Ga0105248_10037463 Ga0105248_100374634 725
439 3300014326 Ga0157380_10006064 Ga0157380_100060643 725
440 3300025292 Ga0209676_1001159 Ga0209676_100115919 725
441 3300025298 Ga0209050_1000112 Ga0209050_100011261 725
442 3300025304 Ga0209257_1000600 Ga0209257_10006001 725
443 3300025893 Ga0207682_10000624 Ga0207682_100006248 725
444 3300025909 Ga0207705_10045167 Ga0207705_100451673 725
445 3300025923 Ga0207681_10001506 Ga0207681_100015068 725
446 3300025925 Ga0207650_10000818 Ga0207650_1000081817 725
447 3300025925 Ga0207650_10003491 Ga0207650_100034919 725
448 3300025926 Ga0207659_10001512 Ga0207659_100015127 725
449 3300025929 Ga0207664_10009182 Ga0207664_100091825 725
450 3300025933 Ga0207706_10001130 Ga0207706_1000113018 725
451 3300025937 Ga0207669_10002314 Ga0207669_100023141 725
452 3300025945 Ga0207679_10005182 Ga0207679_100051826 725
453 3300025960 Ga0207651_10001251 Ga0207651_100012517 725
454 3300025972 Ga0207668_10000729 Ga0207668_100007299 725
455 3300025986 Ga0207658_10036623 Ga0207658_100366232 725
456 3300026089 Ga0207648_10010776 Ga0207648_100107763 725
457 3300028380 Ga0268265_10004178 Ga0268265_100041784 725
458 3300031824 Ga0307413_10001150 Ga0307413_100011509 725
459 3300031852 Ga0307410_10000510 Ga0307410_1000051015 725
460 3300031852 Ga0307410_10007851 Ga0307410_100078515 725
461 3300031901 Ga0307406_10010811 Ga0307406_100108114 725
462 3300031901 Ga0307406_10055222 Ga0307406_100552222 725
463 3300031903 Ga0307407_10004977 Ga0307407_100049773 725
464 3300031995 Ga0307409_100004296 Ga0307409_1000042963 725
465 3300031995 Ga0307409_100012001 Ga0307409_1000120014 725
466 3300032002 Ga0307416_100005971 Ga0307416_1000059713 725
467 3300032002 Ga0307416_100035946 Ga0307416_1000359463 725
468 3300032004 Ga0307414_10001501 Ga0307414_100015019 725
469 3300032005 Ga0307411_10001432 Ga0307411_100014328 725
470 3300032005 Ga0307411_10003651 Ga0307411_100036513 725
471 3300032005 Ga0307411_10025905 Ga0307411_100259052 725
472 3300032126 Ga0307415_100005776 Ga0307415_1000057765 725
473 3300032126 Ga0307415_100045748 Ga0307415_1000457482 725
474 3300042144 Ga0450889_000016 Ga0450889_000016_5918_8152 725
475 3300045051 Ga0451576_0000017 Ga0451576_0000017_427652_429850 725
476 3300046525 Ga0495663_0010419 Ga0495663_0010419_210_2447 725
477 3300046539 Ga0495621_0000495 Ga0495621_0000495_2084_4327 725
478 3300046539 Ga0495621_0003826 Ga0495621_0003826_954_3191 725
479 3300046616 Ga0495668_0053253 Ga0495668_0053253_21_2204 725
480 3300046660 Ga0495625_0001486 Ga0495625_0001486_10950_13151 725
481 3300046684 Ga0495669_0002160 Ga0495669_0002160_117_2300 725
482 3300046684 Ga0495669_0021215 Ga0495669_0021215_622_2805 725
483 3300046684 Ga0495669_0022698 Ga0495669_0022698_118_2361 725
484 3300047445 Ga0495677_0012279 Ga0495677_0012279_821_3058 725
485 3300048924 Ga0496121_0009645 Ga0496121_0009645_508_2685 725
486 3300048925 Ga0496122_0023346 Ga0496122_0023346_160_2337 725
487 3300048926 Ga0496123_0025339 Ga0496123_0025339_17_2194 725
488 3300050511 nmdc:mga08y16_22426_c1 nmdc:mga08y16_22426_c1_2548_4782 725
489 3300053139 Ga0500568_0004798 Ga0500568_0004798_240_2438 725
490 iso_pu_bacteria 8002745576 8002748525 725
491 3300001915 JGI24741J21665_1000905 JGI24741J21665_10009058 726
492 3300001979 JGI24740J21852_10000708 JGI24740J21852_1000070812 726
493 3300001990 JGI24737J22298_10000515 JGI24737J22298_1000051510 726
494 3300001990 JGI24737J22298_10005298 JGI24737J22298_100052982 726
495 3300002067 JGI24735J21928_10000952 JGI24735J21928_1000095211 726
496 3300005327 Ga0070658_10042471 Ga0070658_100424713 726
497 3300005328 Ga0070676_10017476 Ga0070676_100174762 726
498 3300005329 Ga0070683_100022590 Ga0070683_1000225903 726
499 3300005331 Ga0070670_100006906 Ga0070670_1000069068 726
500 3300005331 Ga0070670_100009865 Ga0070670_1000098654 726
501 3300005331 Ga0070670_100021575 Ga0070670_1000215753 726
502 3300005336 Ga0070680_100028219 Ga0070680_1000282193 726
503 3300005336 Ga0070680_100029151 Ga0070680_1000291513 726
504 3300005338 Ga0068868_100000007 Ga0068868_100000007119 726
505 3300005339 Ga0070660_100002676 Ga0070660_10000267611 726
506 3300005339 Ga0070660_100005728 Ga0070660_1000057287 726
507 3300005339 Ga0070660_100012640 Ga0070660_1000126402 726
508 3300005339 Ga0070660_100030306 Ga0070660_1000303063 726
509 3300005344 Ga0070661_100006011 Ga0070661_1000060118 726
510 3300005347 Ga0070668_100023312 Ga0070668_1000233124 726
511 3300005354 Ga0070675_100037261 Ga0070675_1000372612 726
512 3300005355 Ga0070671_100002146 Ga0070671_10000214610 726
513 3300005355 Ga0070671_100004611 Ga0070671_10000461112 726
514 3300005364 Ga0070673_100008886 Ga0070673_1000088865 726
515 3300005366 Ga0070659_100000004 Ga0070659_100000004123 726
516 3300005366 Ga0070659_100012273 Ga0070659_1000122734 726
517 3300005366 Ga0070659_100020008 Ga0070659_1000200083 726
518 3300005366 Ga0070659_100020644 Ga0070659_1000206444 726
519 3300005367 Ga0070667_100077146 Ga0070667_1000771462 726
520 3300005455 Ga0070663_100011736 Ga0070663_1000117364 726
521 3300005455 Ga0070663_100019984 Ga0070663_1000199843 726
522 3300005457 Ga0070662_100042864 Ga0070662_1000428642 726
523 3300005458 Ga0070681_10085353 Ga0070681_100853532 726
524 3300005530 Ga0070679_100043189 Ga0070679_1000431892 726
525 3300005539 Ga0068853_100017593 Ga0068853_1000175934 726
526 3300005539 Ga0068853_100053807 Ga0068853_1000538071 726
527 3300005539 Ga0068853_100058189 Ga0068853_1000581892 726
528 3300005543 Ga0070672_100010641 Ga0070672_1000106415 726
529 3300005548 Ga0070665_100012999 Ga0070665_1000129992 726
530 3300005563 Ga0068855_100039918 Ga0068855_1000399182 726
531 3300005563 Ga0068855_100109259 Ga0068855_1001092592 726
532 3300005564 Ga0070664_100007489 Ga0070664_1000074892 726
533 3300005564 Ga0070664_100033810 Ga0070664_1000338102 726
534 3300005577 Ga0068857_100030002 Ga0068857_1000300022 726
535 3300005578 Ga0068854_100007242 Ga0068854_1000072422 726
536 3300005616 Ga0068852_100017741 Ga0068852_1000177414 726
537 3300005616 Ga0068852_100020821 Ga0068852_1000208215 726
538 3300005616 Ga0068852_100034726 Ga0068852_1000347263 726
539 3300005617 Ga0068859_100011644 Ga0068859_1000116442 726
540 3300005618 Ga0068864_100030568 Ga0068864_1000305682 726
541 3300005841 Ga0068863_100056757 Ga0068863_1000567573 726
542 3300005844 Ga0068862_100063157 Ga0068862_1000631572 726
543 3300006931 Ga0097620_100011643 Ga0097620_1000116432 726
544 3300009177 Ga0105248_10003172 Ga0105248_1000317218 726
545 3300009177 Ga0105248_10113526 Ga0105248_101135262 726
546 3300009177 Ga0105248_10124434 Ga0105248_101244342 726
547 3300013105 Ga0157369_10011815 Ga0157369_100118153 726
548 3300013105 Ga0157369_10080069 Ga0157369_100800692 726
549 3300013297 Ga0157378_10021008 Ga0157378_100210082 726
550 3300013306 Ga0163162_10016498 Ga0163162_100164988 726
551 3300013307 Ga0157372_10044687 Ga0157372_100446873 726
552 3300013308 Ga0157375_10002416 Ga0157375_100024162 726
553 3300013308 Ga0157375_10005662 Ga0157375_100056627 726
554 3300014325 Ga0163163_10017559 Ga0163163_100175593 726
555 3300021384 Ga0213876_10001285 Ga0213876_1000128512 726
556 3300025298 Ga0209050_1000279 Ga0209050_100027928 726
557 3300025901 Ga0207688_10005488 Ga0207688_100054882 726
558 3300025904 Ga0207647_10004175 Ga0207647_1000417510 726
559 3300025906 Ga0207699_10006940 Ga0207699_100069403 726
560 3300025907 Ga0207645_10005343 Ga0207645_100053432 726
561 3300025909 Ga0207705_10004522 Ga0207705_100045229 726
562 3300025909 Ga0207705_10010079 Ga0207705_100100795 726
563 3300025912 Ga0207707_10010810 Ga0207707_100108102 726
564 3300025917 Ga0207660_10020010 Ga0207660_100200103 726
565 3300025919 Ga0207657_10000123 Ga0207657_100001232 726
566 3300025919 Ga0207657_10000468 Ga0207657_1000046840 726
567 3300025919 Ga0207657_10002144 Ga0207657_100021449 726
568 3300025919 Ga0207657_10002853 Ga0207657_100028538 726
569 3300025919 Ga0207657_10006099 Ga0207657_100060992 726
570 3300025919 Ga0207657_10006837 Ga0207657_1000683710 726
571 3300025919 Ga0207657_10009276 Ga0207657_100092768 726
572 3300025919 Ga0207657_10014819 Ga0207657_100148195 726
573 3300025919 Ga0207657_10019531 Ga0207657_100195316 726
574 3300025919 Ga0207657_10026132 Ga0207657_100261322 726
575 3300025919 Ga0207657_10048276 Ga0207657_100482763 726
576 3300025920 Ga0207649_10017964 Ga0207649_100179642 726
577 3300025921 Ga0207652_10004394 Ga0207652_100043942 726
578 3300025921 Ga0207652_10030832 Ga0207652_100308322 726
579 3300025925 Ga0207650_10002394 Ga0207650_1000239412 726
580 3300025925 Ga0207650_10013727 Ga0207650_100137272 726
581 3300025926 Ga0207659_10004971 Ga0207659_100049717 726
582 3300025931 Ga0207644_10000683 Ga0207644_100006838 726
583 3300025931 Ga0207644_10003126 Ga0207644_100031268 726
584 3300025932 Ga0207690_10000001 Ga0207690_10000001462 726
585 3300025932 Ga0207690_10000002 Ga0207690_10000002462 726
586 3300025932 Ga0207690_10000003 Ga0207690_10000003462 726
587 3300025932 Ga0207690_10000004 Ga0207690_10000004462 726
588 3300025932 Ga0207690_10007430 Ga0207690_100074304 726
589 3300025933 Ga0207706_10000971 Ga0207706_1000097122 726
590 3300025933 Ga0207706_10002307 Ga0207706_100023078 726
591 3300025933 Ga0207706_10053907 Ga0207706_100539072 726
592 3300025940 Ga0207691_10007200 Ga0207691_100072008 726
593 3300025940 Ga0207691_10028701 Ga0207691_100287013 726
594 3300025940 Ga0207691_10045385 Ga0207691_100453851 726
595 3300025941 Ga0207711_10023910 Ga0207711_100239102 726
596 3300025944 Ga0207661_10025242 Ga0207661_100252422 726
597 3300025945 Ga0207679_10004140 Ga0207679_100041408 726
598 3300025945 Ga0207679_10054256 Ga0207679_100542562 726
599 3300025949 Ga0207667_10024660 Ga0207667_100246605 726
600 3300025972 Ga0207668_10003245 Ga0207668_100032453 726
601 3300025972 Ga0207668_10015464 Ga0207668_100154643 726
602 3300025986 Ga0207658_10003798 Ga0207658_100037985 726
603 3300026023 Ga0207677_10000014 Ga0207677_10000014114 726
604 3300026041 Ga0207639_10012242 Ga0207639_100122422 726
605 3300026041 Ga0207639_10047964 Ga0207639_100479642 726
606 3300026067 Ga0207678_10003985 Ga0207678_100039859 726
607 3300026067 Ga0207678_10016860 Ga0207678_100168602 726
608 3300026067 Ga0207678_10023365 Ga0207678_100233653 726
609 3300026067 Ga0207678_10041105 Ga0207678_100411052 726
610 3300026088 Ga0207641_10008031 Ga0207641_100080313 726
611 3300026089 Ga0207648_10000889 Ga0207648_1000088928 726
612 3300026116 Ga0207674_10000410 Ga0207674_1000041054 726
613 3300026116 Ga0207674_10099471 Ga0207674_100994713 726
614 3300028379 Ga0268266_10011379 Ga0268266_100113795 726
615 3300028379 Ga0268266_10040623 Ga0268266_100406232 726
616 3300028380 Ga0268265_10015688 Ga0268265_100156884 726
617 3300031824 Ga0307413_10001884 Ga0307413_100018842 726
618 3300031852 Ga0307410_10010220 Ga0307410_100102204 726
619 3300031852 Ga0307410_10025004 Ga0307410_100250041 726
620 3300031911 Ga0307412_10006370 Ga0307412_100063704 726
621 3300031995 Ga0307409_100001531 Ga0307409_1000015312 726
622 3300031995 Ga0307409_100019945 Ga0307409_1000199451 726
623 3300032002 Ga0307416_100011388 Ga0307416_1000113882 726
624 3300032004 Ga0307414_10002696 Ga0307414_100026967 726
625 3300032004 Ga0307414_10007969 Ga0307414_100079692 726
626 3300032005 Ga0307411_10013333 Ga0307411_100133331 726
627 3300035170 Ga0373943_0032318 Ga0373943_0032318_107_2356 726
628 3300037418 Ga0395900_0012443 Ga0395900_0012443_4923_7160 726
629 3300037418 Ga0395900_0028388 Ga0395900_0028388_2371_4605 726
630 3300037418 Ga0395900_0031712 Ga0395900_0031712_988_3222 726
631 3300037466 Ga0395898_0008057 Ga0395898_0008057_1660_3894 726
632 3300037466 Ga0395898_0053371 Ga0395898_0053371_1134_3368 726
633 3300037471 Ga0395905_0001433 Ga0395905_0001433_9250_11484 726
634 3300037471 Ga0395905_0005682 Ga0395905_0005682_4900_7131 726
635 3300037471 Ga0395905_0006394 Ga0395905_0006394_6807_9044 726
636 3300037471 Ga0395905_0010035 Ga0395905_0010035_5472_7706 726
637 3300037471 Ga0395905_0021522 Ga0395905_0021522_2095_4332 726
638 3300037471 Ga0395905_0027864 Ga0395905_0027864_2476_4725 726
639 3300037471 Ga0395905_0055007 Ga0395905_0055007_58_2295 726
640 3300037471 Ga0395905_0055694 Ga0395905_0055694_1447_3681 726
641 3300037471 Ga0395905_0060952 Ga0395905_0060952_759_2993 726
642 3300038443 Ga0395901_0012229 Ga0395901_0012229_910_3144 726
643 3300038443 Ga0395901_0013469 Ga0395901_0013469_3181_5415 726
644 3300038443 Ga0395901_0056126 Ga0395901_0056126_1756_3987 726
645 3300039437 Ga0436365_1058137 Ga0436365_1058137_18570_20807 726
646 3300042005 Ga0439448_0000322 Ga0439448_0000322_6684_8918 726
647 3300042015 Ga0439462_0006122 Ga0439462_0006122_492_2735 726
648 3300042157 Ga0439458_0000133 Ga0439458_0000133_12367_14601 726
649 3300044694 Ga0466963_0075007 Ga0466963_0075007_22_2262 726
650 3300045976 Ga0466967_0003894 Ga0466967_0003894_3205_5445 726
651 3300046539 Ga0495621_0001156 Ga0495621_0001156_4296_6530 726
652 3300046539 Ga0495621_0004893 Ga0495621_0004893_271_2517 726
653 3300046558 Ga0495633_0001909 Ga0495633_0001909_2670_4904 726
654 3300046616 Ga0495668_0017406 Ga0495668_0017406_1671_3908 726
655 3300046684 Ga0495669_0002633 Ga0495669_0002633_2935_5169 726
656 3300046684 Ga0495669_0005918 Ga0495669_0005918_2343_4529 726
657 3300046691 Ga0495670_0006360 Ga0495670_0006360_1906_4140 726
658 3300048913 Ga0496110_0014790 Ga0496110_0014790_20_2254 726
659 3300048914 Ga0496111_0053906 Ga0496111_0053906_559_2793 726
660 3300048915 Ga0496112_0030457 Ga0496112_0030457_2954_5203 726
661 3300048919 Ga0496116_0000017 Ga0496116_0000017_162872_165223 726
662 3300048924 Ga0496121_0003439 Ga0496121_0003439_790_3021 726
663 3300048925 Ga0496122_0002967 Ga0496122_0002967_4861_7212 726
664 3300048926 Ga0496123_0003732 Ga0496123_0003732_11552_13903 726
665 3300048927 Ga0496124_0002197 Ga0496124_0002197_1749_4100 726
666 3300048927 Ga0496124_0009954 Ga0496124_0009954_6675_9029 726
667 3300048928 Ga0496125_0006782 Ga0496125_0006782_8360_10711 726
668 3300049823 Ga0501044_0046791 Ga0501044_0046791_1703_3919 726
669 3300049823 Ga0501044_0126968 Ga0501044_0126968_129_2345 726
670 iso_pu_bacteria 2643221598 2644000753 726
671 iso_pu_bacteria 2643221614 2644085840 726
672 iso_pu_bacteria 2643221622 2644128539 726
673 iso_pu_bacteria 2643221661 2644344984 726
674 iso_pu_bacteria 2643221666 2644369258 726
675 iso_pu_bacteria 2818991438 2819550874 726
676 3300001990 JGI24737J22298_10000489 JGI24737J22298_100004899 727
677 3300002075 JGI24738J21930_10000658 JGI24738J21930_100006583 727
678 3300005327 Ga0070658_10000130 Ga0070658_1000013030 727
679 3300005335 Ga0070666_10000841 Ga0070666_1000084116 727
680 3300005339 Ga0070660_100000391 Ga0070660_1000003918 727
681 3300005339 Ga0070660_100039484 Ga0070660_1000394843 727
682 3300005344 Ga0070661_100000206 Ga0070661_10000020630 727
683 3300005344 Ga0070661_100010905 Ga0070661_1000109052 727
684 3300005347 Ga0070668_100007089 Ga0070668_1000070893 727
685 3300005353 Ga0070669_100027880 Ga0070669_1000278803 727
686 3300005354 Ga0070675_100005993 Ga0070675_1000059934 727
687 3300005355 Ga0070671_100001277 Ga0070671_10000127716 727
688 3300005366 Ga0070659_100000884 Ga0070659_1000008848 727
689 3300005366 Ga0070659_100014354 Ga0070659_1000143543 727
690 3300005366 Ga0070659_100056243 Ga0070659_1000562432 727
691 3300005367 Ga0070667_100003548 Ga0070667_1000035488 727
692 3300005367 Ga0070667_100062163 Ga0070667_1000621632 727
693 3300005436 Ga0070713_100007630 Ga0070713_1000076304 727
694 3300005455 Ga0070663_100002583 Ga0070663_1000025834 727
695 3300005455 Ga0070663_100003200 Ga0070663_1000032006 727
696 3300005455 Ga0070663_100018251 Ga0070663_1000182513 727
697 3300005457 Ga0070662_100000107 Ga0070662_10000010734 727
698 3300005539 Ga0068853_100000172 Ga0068853_10000017224 727
699 3300005539 Ga0068853_100006073 Ga0068853_1000060735 727
700 3300005539 Ga0068853_100023202 Ga0068853_1000232022 727
701 3300005548 Ga0070665_100001716 Ga0070665_10000171620 727
702 3300005563 Ga0068855_100006629 Ga0068855_1000066298 727
703 3300005564 Ga0070664_100000032 Ga0070664_1000000328 727
704 3300005564 Ga0070664_100001892 Ga0070664_1000018923 727
705 3300005577 Ga0068857_100002020 Ga0068857_10000202014 727
706 3300005577 Ga0068857_100007759 Ga0068857_1000077593 727
707 3300005614 Ga0068856_100000364 Ga0068856_10000036429 727
708 3300005614 Ga0068856_100015239 Ga0068856_1000152395 727
709 3300005616 Ga0068852_100000780 Ga0068852_1000007803 727
710 3300005616 Ga0068852_100003915 Ga0068852_1000039154 727
711 3300005616 Ga0068852_100009011 Ga0068852_1000090116 727
712 3300005616 Ga0068852_100047517 Ga0068852_1000475172 727
713 3300005617 Ga0068859_100042054 Ga0068859_1000420542 727
714 3300005618 Ga0068864_100035670 Ga0068864_1000356702 727
715 3300005841 Ga0068863_100000168 Ga0068863_1000001688 727
716 3300005841 Ga0068863_100056512 Ga0068863_1000565121 727
717 3300005842 Ga0068858_100009762 Ga0068858_1000097622 727
718 3300005842 Ga0068858_100048480 Ga0068858_1000484802 727
719 3300005842 Ga0068858_100058539 Ga0068858_1000585393 727
720 3300005985 Ga0081539_10032179 Ga0081539_100321793 727
721 3300006028 Ga0070717_10002889 Ga0070717_1000288913 727
722 3300006931 Ga0097620_100042050 Ga0097620_1000420502 727
723 3300009093 Ga0105240_10065704 Ga0105240_100657043 727
724 3300009177 Ga0105248_10000238 Ga0105248_1000023829 727
725 3300009177 Ga0105248_10008090 Ga0105248_100080908 727
726 3300009177 Ga0105248_10069470 Ga0105248_100694703 727
727 3300009545 Ga0105237_10014995 Ga0105237_100149953 727
728 3300009551 Ga0105238_10010961 Ga0105238_100109612 727
729 3300013100 Ga0157373_10018089 Ga0157373_100180892 727
730 3300013102 Ga0157371_10002868 Ga0157371_100028686 727
731 3300013105 Ga0157369_10069116 Ga0157369_100691162 727
732 3300013307 Ga0157372_10053884 Ga0157372_100538842 727
733 3300014325 Ga0163163_10000543 Ga0163163_100005438 727
734 3300025903 Ga0207680_10001354 Ga0207680_100013543 727
735 3300025909 Ga0207705_10000200 Ga0207705_1000020065 727
736 3300025909 Ga0207705_10009479 Ga0207705_100094796 727
737 3300025912 Ga0207707_10099499 Ga0207707_100994991 727
738 3300025914 Ga0207671_10025900 Ga0207671_100259002 727
739 3300025919 Ga0207657_10000643 Ga0207657_100006438 727
740 3300025919 Ga0207657_10001203 Ga0207657_100012032 727
741 3300025919 Ga0207657_10075023 Ga0207657_100750232 727
742 3300025920 Ga0207649_10000362 Ga0207649_1000036221 727
743 3300025920 Ga0207649_10013902 Ga0207649_100139022 727
744 3300025924 Ga0207694_10000827 Ga0207694_1000082728 727
745 3300025924 Ga0207694_10021780 Ga0207694_100217802 727
746 3300025926 Ga0207659_10005659 Ga0207659_100056592 727
747 3300025926 Ga0207659_10025015 Ga0207659_100250151 727
748 3300025927 Ga0207687_10004014 Ga0207687_100040143 727
749 3300025932 Ga0207690_10000062 Ga0207690_1000006229 727
750 3300025932 Ga0207690_10012904 Ga0207690_100129043 727
751 3300025932 Ga0207690_10015007 Ga0207690_100150073 727
752 3300025933 Ga0207706_10000211 Ga0207706_1000021129 727
753 3300025941 Ga0207711_10001518 Ga0207711_100015182 727
754 3300025941 Ga0207711_10008075 Ga0207711_100080753 727
755 3300025944 Ga0207661_10007618 Ga0207661_100076185 727
756 3300025945 Ga0207679_10000506 Ga0207679_1000050624 727
757 3300025945 Ga0207679_10044115 Ga0207679_100441152 727
758 3300025949 Ga0207667_10006936 Ga0207667_100069368 727
759 3300025972 Ga0207668_10008524 Ga0207668_100085243 727
760 3300025986 Ga0207658_10004749 Ga0207658_100047495 727
761 3300026035 Ga0207703_10052030 Ga0207703_100520302 727
762 3300026041 Ga0207639_10000532 Ga0207639_1000053223 727
763 3300026041 Ga0207639_10000990 Ga0207639_100009906 727
764 3300026067 Ga0207678_10001933 Ga0207678_1000193320 727
765 3300026067 Ga0207678_10002765 Ga0207678_1000276513 727
766 3300026067 Ga0207678_10022702 Ga0207678_100227023 727
767 3300026078 Ga0207702_10001280 Ga0207702_100012809 727
768 3300026088 Ga0207641_10000241 Ga0207641_1000024168 727
769 3300026116 Ga0207674_10000641 Ga0207674_1000064154 727
770 3300026116 Ga0207674_10005803 Ga0207674_100058039 727
771 3300026116 Ga0207674_10020766 Ga0207674_100207663 727
772 3300026116 Ga0207674_10064242 Ga0207674_100642422 727
773 3300026142 Ga0207698_10000958 Ga0207698_100009589 727
774 3300026142 Ga0207698_10039815 Ga0207698_100398152 727
775 3300028381 Ga0268264_10033409 Ga0268264_100334091 727
776 3300031548 Ga0307408_100022427 Ga0307408_1000224273 727
777 3300031824 Ga0307413_10000766 Ga0307413_100007662 727
778 3300031824 Ga0307413_10018030 Ga0307413_100180302 727
779 3300031852 Ga0307410_10006197 Ga0307410_100061975 727
780 3300031852 Ga0307410_10032104 Ga0307410_100321042 727
781 3300031852 Ga0307410_10069861 Ga0307410_100698611 727
782 3300031903 Ga0307407_10026399 Ga0307407_100263991 727
783 3300031903 Ga0307407_10050161 Ga0307407_100501611 727
784 3300031995 Ga0307409_100065466 Ga0307409_1000654662 727
785 3300032004 Ga0307414_10003222 Ga0307414_100032227 727
786 3300032004 Ga0307414_10021077 Ga0307414_100210772 727
787 3300032005 Ga0307411_10003411 Ga0307411_100034112 727
788 3300032005 Ga0307411_10021516 Ga0307411_100215163 727
789 3300032005 Ga0307411_10026657 Ga0307411_100266572 727
790 3300032126 Ga0307415_100004366 Ga0307415_1000043666 727
791 3300033180 Ga0307510_10023559 Ga0307510_100235595 727
792 3300035691 Ga0373931_0004625 Ga0373931_0004625_1308_3512 727
793 3300037418 Ga0395900_0054359 Ga0395900_0054359_417_2654 727
794 3300037466 Ga0395898_0028006 Ga0395898_0028006_580_2820 727
795 3300037471 Ga0395905_0000298 Ga0395905_0000298_25809_28046 727
796 3300037471 Ga0395905_0001393 Ga0395905_0001393_26847_29084 727
797 3300038443 Ga0395901_0007987 Ga0395901_0007987_2118_4358 727
798 3300042157 Ga0439458_0000630 Ga0439458_0000630_3135_5372 727
799 3300044901 Ga0466960_0009949 Ga0466960_0009949_1182_3419 727
800 3300046616 Ga0495668_0010783 Ga0495668_0010783_2876_5062 727
801 3300048910 Ga0496107_0038468 Ga0496107_0038468_864_3143 727
802 3300048911 Ga0496108_0030374 Ga0496108_0030374_2167_4446 727
803 3300048912 Ga0496109_0009994 Ga0496109_0009994_2541_4820 727
804 3300048914 Ga0496111_0010477 Ga0496111_0010477_2541_4820 727
805 3300048916 Ga0496113_0000477 Ga0496113_0000477_7573_9852 727
806 3300049590 Ga0501074_0073123 Ga0501074_0073123_154_2388 727
807 3300053134 Ga0500658_0000177 Ga0500658_0000177_2480_4666 727
808 3300005331 Ga0070670_100000021 Ga0070670_1000000219 728
809 3300005339 Ga0070660_100003832 Ga0070660_1000038323 728
810 3300005344 Ga0070661_100000064 Ga0070661_10000006450 728
811 3300005347 Ga0070668_100000045 Ga0070668_10000004555 728
812 3300005353 Ga0070669_100000324 Ga0070669_1000003246 728
813 3300005353 Ga0070669_100011776 Ga0070669_1000117763 728
814 3300005355 Ga0070671_100059318 Ga0070671_1000593182 728
815 3300005366 Ga0070659_100010818 Ga0070659_1000108187 728
816 3300005366 Ga0070659_100017370 Ga0070659_1000173701 728
817 3300005367 Ga0070667_100002719 Ga0070667_10000271914 728
818 3300005435 Ga0070714_100008944 Ga0070714_1000089443 728
819 3300005457 Ga0070662_100015856 Ga0070662_1000158561 728
820 3300005530 Ga0070679_100000015 Ga0070679_10000001595 728
821 3300005563 Ga0068855_100015023 Ga0068855_1000150235 728
822 3300005564 Ga0070664_100027820 Ga0070664_1000278202 728
823 3300005617 Ga0068859_100012911 Ga0068859_1000129114 728
824 3300005618 Ga0068864_100000004 Ga0068864_100000004346 728
825 3300005618 Ga0068864_100012194 Ga0068864_1000121942 728
826 3300005841 Ga0068863_100000002 Ga0068863_100000002347 728
827 3300005841 Ga0068863_100006250 Ga0068863_1000062505 728
828 3300005843 Ga0068860_100000928 Ga0068860_1000009289 728
829 3300005844 Ga0068862_100000002 Ga0068862_100000002155 728
830 3300005844 Ga0068862_100000023 Ga0068862_100000023126 728
831 3300005844 Ga0068862_100000031 Ga0068862_10000003151 728
832 3300005844 Ga0068862_100008200 Ga0068862_1000082004 728
833 3300006847 Ga0075431_100050200 Ga0075431_1000502003 728
834 3300006931 Ga0097620_100012911 Ga0097620_1000129114 728
835 3300009011 Ga0105251_10002485 Ga0105251_100024855 728
836 3300009093 Ga0105240_10050742 Ga0105240_100507425 728
837 3300009177 Ga0105248_10000016 Ga0105248_100000163 728
838 3300009177 Ga0105248_10019117 Ga0105248_100191175 728
839 3300009553 Ga0105249_10000004 Ga0105249_10000004244 728
840 3300009553 Ga0105249_10006822 Ga0105249_100068223 728
841 3300021358 Ga0213873_10000019 Ga0213873_1000001977 728
842 3300021384 Ga0213876_10000075 Ga0213876_1000007574 728
843 3300025735 Ga0207713_1002842 Ga0207713_10028421 728
844 3300025893 Ga0207682_10002072 Ga0207682_100020725 728
845 3300025909 Ga0207705_10001531 Ga0207705_1000153117 728
846 3300025913 Ga0207695_10027280 Ga0207695_100272805 728
847 3300025913 Ga0207695_10051482 Ga0207695_100514823 728
848 3300025919 Ga0207657_10008062 Ga0207657_100080628 728
849 3300025920 Ga0207649_10000102 Ga0207649_1000010239 728
850 3300025920 Ga0207649_10001739 Ga0207649_100017395 728
851 3300025921 Ga0207652_10000021 Ga0207652_1000002135 728
852 3300025923 Ga0207681_10000253 Ga0207681_1000025330 728
853 3300025925 Ga0207650_10000130 Ga0207650_100001309 728
854 3300025926 Ga0207659_10018163 Ga0207659_100181634 728
855 3300025931 Ga0207644_10000084 Ga0207644_1000008462 728
856 3300025932 Ga0207690_10010263 Ga0207690_100102631 728
857 3300025941 Ga0207711_10000022 Ga0207711_100000223 728
858 3300025941 Ga0207711_10000567 Ga0207711_100005676 728
859 3300025945 Ga0207679_10029682 Ga0207679_100296822 728
860 3300025949 Ga0207667_10015816 Ga0207667_1001581610 728
861 3300025961 Ga0207712_10000008 Ga0207712_10000008375 728
862 3300025961 Ga0207712_10001742 Ga0207712_1000174211 728
863 3300025972 Ga0207668_10000103 Ga0207668_1000010326 728
864 3300025972 Ga0207668_10009773 Ga0207668_100097733 728
865 3300025981 Ga0207640_10000560 Ga0207640_100005601 728
866 3300025986 Ga0207658_10001378 Ga0207658_1000137818 728
867 3300026067 Ga0207678_10003048 Ga0207678_100030484 728
868 3300026078 Ga0207702_10045548 Ga0207702_100455482 728
869 3300026078 Ga0207702_10110673 Ga0207702_101106731 728
870 3300026088 Ga0207641_10000002 Ga0207641_10000002827 728
871 3300026088 Ga0207641_10000695 Ga0207641_1000069528 728
872 3300026088 Ga0207641_10004258 Ga0207641_100042589 728
873 3300026095 Ga0207676_10000040 Ga0207676_1000004022 728
874 3300026095 Ga0207676_10008763 Ga0207676_100087632 728
875 3300026142 Ga0207698_10016631 Ga0207698_100166313 728
876 3300028380 Ga0268265_10000003 Ga0268265_10000003163 728
877 3300028380 Ga0268265_10000035 Ga0268265_10000035120 728
878 3300028380 Ga0268265_10000118 Ga0268265_10000118100 728
879 3300028380 Ga0268265_10007842 Ga0268265_100078423 728
880 3300028381 Ga0268264_10003559 Ga0268264_100035595 728
881 3300031824 Ga0307413_10002440 Ga0307413_100024407 728
882 3300031852 Ga0307410_10032515 Ga0307410_100325151 728
883 3300031911 Ga0307412_10042015 Ga0307412_100420152 728
884 3300031995 Ga0307409_100001147 Ga0307409_10000114713 728
885 3300032004 Ga0307414_10000969 Ga0307414_100009693 728
886 3300032005 Ga0307411_10005351 Ga0307411_100053515 728
887 3300037418 Ga0395900_0007490 Ga0395900_0007490_1995_4262 728
888 3300037418 Ga0395900_0017044 Ga0395900_0017044_381_2621 728
889 3300037466 Ga0395898_0007670 Ga0395898_0007670_6040_8280 728
890 3300037466 Ga0395898_0024413 Ga0395898_0024413_1405_3612 728
891 3300037466 Ga0395898_0096768 Ga0395898_0096768_111_2309 728
892 3300037471 Ga0395905_0003199 Ga0395905_0003199_5547_7787 728
893 3300037471 Ga0395905_0008961 Ga0395905_0008961_4234_6501 728
894 3300037471 Ga0395905_0018559 Ga0395905_0018559_4041_6281 728
895 3300038443 Ga0395901_0007270 Ga0395901_0007270_5200_7440 728
896 3300039437 Ga0436365_0561345 Ga0436365_0561345_57707_59950 728
897 3300039453 Ga0436362_0592983 Ga0436362_0592983_175579_177822 728
898 3300044656 Ga0466969_0000621 Ga0466969_0000621_4364_6562 728
899 3300044684 Ga0466966_0000007 Ga0466966_0000007_110457_112694 728
900 3300044684 Ga0466966_0008485 Ga0466966_0008485_1833_4031 728
901 3300044693 Ga0466961_0009637 Ga0466961_0009637_2288_4486 728
902 3300044694 Ga0466963_0029758 Ga0466963_0029758_1018_3216 728
903 3300044719 Ga0466971_0006485 Ga0466971_0006485_1283_3481 728
904 3300044842 Ga0466957_0002504 Ga0466957_0002504_4659_6857 728
905 3300045049 Ga0466959_0013314 Ga0466959_0013314_1678_3876 728
906 3300045836 Ga0466958_0001865 Ga0466958_0001865_3098_5296 728
907 3300046684 Ga0495669_0000442 Ga0495669_0000442_5786_7978 728
908 3300047472 Ga0495686_0000392 Ga0495686_0000392_66709_68952 728
909 3300048912 Ga0496109_0047604 Ga0496109_0047604_447_2687 728
910 3300048917 Ga0496114_0042458 Ga0496114_0042458_201_2420 728
911 3300048920 Ga0496117_0008967 Ga0496117_0008967_3611_5854 728
912 3300048921 Ga0496118_0002576 Ga0496118_0002576_19662_21905 728
913 3300048929 Ga0496126_0001541 Ga0496126_0001541_31170_33389 728
914 3300050510 nmdc:mga06r32_42891_c1 nmdc:mga06r32_42891_c1_1234_3489 728
915 3300053153 Ga0500616_0012205 Ga0500616_0012205_209_2455 728
916 3300061719 Ga0466962_0006109 Ga0466962_0006109_3082_5280 728
917 3300001989 JGI24739J22299_10003523 JGI24739J22299_100035231 729
918 3300005338 Ga0068868_100029622 Ga0068868_1000296221 729
919 3300005347 Ga0070668_100012919 Ga0070668_1000129191 729
920 3300005367 Ga0070667_100000361 Ga0070667_10000036133 729
921 3300005367 Ga0070667_100043507 Ga0070667_1000435072 729
922 3300005444 Ga0070694_100005307 Ga0070694_1000053074 729
923 3300005539 Ga0068853_100012931 Ga0068853_1000129315 729
924 3300005577 Ga0068857_100079808 Ga0068857_1000798081 729
925 3300005617 Ga0068859_100029265 Ga0068859_1000292652 729
926 3300005843 Ga0068860_100035018 Ga0068860_1000350182 729
927 3300005844 Ga0068862_100004740 Ga0068862_1000047403 729
928 3300006931 Ga0097620_100029264 Ga0097620_1000292642 729
929 3300009176 Ga0105242_10029287 Ga0105242_100292873 729
930 3300020082 Ga0206353_10159478 Ga0206353_101594782 729
931 3300025932 Ga0207690_10003253 Ga0207690_100032534 729
932 3300025940 Ga0207691_10104690 Ga0207691_101046902 729
933 3300025942 Ga0207689_10005042 Ga0207689_1000504212 729
934 3300025961 Ga0207712_10003387 Ga0207712_100033874 729
935 3300025972 Ga0207668_10023921 Ga0207668_100239212 729
936 3300025986 Ga0207658_10003278 Ga0207658_100032789 729
937 3300026041 Ga0207639_10033310 Ga0207639_100333101 729
938 3300027876 Ga0209974_10001035 Ga0209974_100010358 729
939 3300028380 Ga0268265_10006020 Ga0268265_100060208 729
940 3300028380 Ga0268265_10026689 Ga0268265_100266892 729
941 3300028381 Ga0268264_10006757 Ga0268264_100067572 729
942 3300031731 Ga0307405_10002714 Ga0307405_100027142 729
943 3300031852 Ga0307410_10003142 Ga0307410_100031421 729
944 3300031901 Ga0307406_10012186 Ga0307406_100121862 729
945 3300031903 Ga0307407_10001719 Ga0307407_100017198 729
946 3300032004 Ga0307414_10018451 Ga0307414_100184512 729
947 3300032126 Ga0307415_100003658 Ga0307415_1000036582 729
948 3300037466 Ga0395898_0022845 Ga0395898_0022845_370_2577 729
949 3300044735 Ga0466968_0001195 Ga0466968_0001195_1321_3588 729
950 3300044765 Ga0466970_0014937 Ga0466970_0014937_1265_3532 729
951 3300045049 Ga0466959_0016786 Ga0466959_0016786_12_2276 729
952 3300046500 Ga0495596_0007694 Ga0495596_0007694_1438_3654 729
953 3300046507 Ga0495606_0002050 Ga0495606_0002050_14431_16626 729
954 3300053094 Ga0500566_0000177 Ga0500566_0000177_5358_7556 729
955 iso_pu_bacteria 2643221699 2644549253 729
956 iso_pu_bacteria 2929199973 2929206842 729
957 iso_pu_bacteria 8055909800 8055911896 729
958 3300003215 JGI25153J46596_10017152 JGI25153J46596_100171522 730
959 3300003773 Ga0055537_1000510 Ga0055537_10005108 730
960 3300003791 Ga0055530_10000625 Ga0055530_1000062522 730
961 3300003794 Ga0055531_10000648 Ga0055531_1000064824 730
962 3300005262 Ga0065165_1006275 Ga0065165_10062753 730
963 3300005347 Ga0070668_100013706 Ga0070668_1000137062 730
964 3300005844 Ga0068862_100006166 Ga0068862_1000061663 730
965 3300025245 Ga0207425_1007497 Ga0207425_10074971 730
966 3300025263 Ga0209565_1000030 Ga0209565_100003025 730
967 3300025297 Ga0209758_1010231 Ga0209758_10102315 730
968 3300025298 Ga0209050_1000039 Ga0209050_100003994 730
969 3300025298 Ga0209050_1006916 Ga0209050_10069165 730
970 3300025299 Ga0209256_1000046 Ga0209256_1000046260 730
971 3300025304 Ga0209257_1000051 Ga0209257_100005194 730
972 3300025304 Ga0209257_1002508 Ga0209257_100250814 730
973 3300025923 Ga0207681_10031221 Ga0207681_100312212 730
974 3300025941 Ga0207711_10066032 Ga0207711_100660321 730
975 3300025972 Ga0207668_10051233 Ga0207668_100512331 730
976 3300041410 Ga0439461_0000719 Ga0439461_0000719_2568_4775 730
977 3300041413 Ga0439465_0000162 Ga0439465_0000162_451_2658 730
978 3300042006 Ga0439432_000280 Ga0439432_000280_5804_8011 730
979 3300042015 Ga0439462_0000118 Ga0439462_0000118_3720_5927 730
980 3300042435 Ga0439434_0002047 Ga0439434_0002047_1219_3426 730
981 3300046558 Ga0495633_0000053 Ga0495633_0000053_28530_30725 730
982 3300046691 Ga0495670_0000006 Ga0495670_0000006_144422_146626 730
983 3300048920 Ga0496117_0004720 Ga0496117_0004720_93_2294 730
984 3300048921 Ga0496118_0001340 Ga0496118_0001340_10043_12244 730
985 3300053134 Ga0500658_0005757 Ga0500658_0005757_2004_4211 730
986 3300037466 Ga0395898_0007743 Ga0395898_0007743_6837_9089 731
987 3300037471 Ga0395905_0003189 Ga0395905_0003189_11745_13997 731
988 3300038443 Ga0395901_0002602 Ga0395901_0002602_3552_5804 731
989 iso_pu_bacteria 2830075706 2830076599 731
990 iso_pu_bacteria 2990265787 2990267899 731
991 iso_pu_bacteria 2993693658 2993697083 731
992 3300005841 Ga0068863_100004037 Ga0068863_1000040373 732
993 3300017792 Ga0163161_10001269 Ga0163161_100012692 732
994 3300021384 Ga0213876_10000801 Ga0213876_1000080116 732
995 3300025919 Ga0207657_10008661 Ga0207657_100086614 732
996 3300026088 Ga0207641_10008748 Ga0207641_100087485 732
997 3300039437 Ga0436365_1189040 Ga0436365_1189040_10731_12935 732
998 3300049459 Ga0495678_024362 Ga0495678_024362_351_2552 732
999 3300053087 Ga0500643_001566 Ga0500643_001566_10317_12518 732
1000 3300053087 Ga0500643_004123 Ga0500643_004123_430_2631 732
1001 3300053730 Ga0500645_006389 Ga0500645_006389_125_2395 732
1002 iso_pu_bacteria 2738541275 2738708983 732
1003 iso_pu_bacteria 2738541301 2738847408 732
1004 iso_pu_bacteria 2738541304 2738863137 732
1005 iso_pu_bacteria 2738543022 2739295655 732
1006 iso_pu_bacteria 2738543033 2739357333 732
1007 iso_pu_bacteria 2941485952 2941488116 732
1008 iso_pu_bacteria 2946787523 2946789413 732
1009 3300005327 Ga0070658_10019336 Ga0070658_100193364 733
1010 3300005329 Ga0070683_100003807 Ga0070683_1000038078 733
1011 3300005336 Ga0070680_100004105 Ga0070680_1000041058 733
1012 3300005337 Ga0070682_100016386 Ga0070682_1000163863 733
1013 3300005344 Ga0070661_100033475 Ga0070661_1000334753 733
1014 3300005347 Ga0070668_100032639 Ga0070668_1000326393 733
1015 3300005367 Ga0070667_100017180 Ga0070667_1000171805 733
1016 3300005435 Ga0070714_100023913 Ga0070714_1000239132 733
1017 3300005535 Ga0070684_100002809 Ga0070684_1000028098 733
1018 3300005544 Ga0070686_100001399 Ga0070686_1000013991 733
1019 3300005548 Ga0070665_100000605 Ga0070665_10000060531 733
1020 3300005548 Ga0070665_100001031 Ga0070665_1000010314 733
1021 3300005577 Ga0068857_100007161 Ga0068857_1000071613 733
1022 3300005843 Ga0068860_100035787 Ga0068860_1000357872 733
1023 3300009101 Ga0105247_10032892 Ga0105247_100328921 733
1024 3300025229 Ga0209147_101082 Ga0209147_1010828 733
1025 3300025909 Ga0207705_10028878 Ga0207705_100288782 733
1026 3300025917 Ga0207660_10004335 Ga0207660_100043358 733
1027 3300025919 Ga0207657_10006400 Ga0207657_1000640013 733
1028 3300025931 Ga0207644_10001603 Ga0207644_1000160314 733
1029 3300025941 Ga0207711_10013496 Ga0207711_100134967 733
1030 3300025944 Ga0207661_10010702 Ga0207661_100107023 733
1031 3300025972 Ga0207668_10003398 Ga0207668_100033984 733
1032 3300025986 Ga0207658_10007159 Ga0207658_100071597 733
1033 3300026067 Ga0207678_10007964 Ga0207678_100079648 733
1034 3300026088 Ga0207641_10006678 Ga0207641_100066785 733
1035 3300026116 Ga0207674_10005074 Ga0207674_100050748 733
1036 3300028379 Ga0268266_10000394 Ga0268266_1000039411 733
1037 3300028379 Ga0268266_10000534 Ga0268266_1000053433 733
1038 3300028381 Ga0268264_10002127 Ga0268264_1000212712 733
1039 3300038443 Ga0395901_0002476 Ga0395901_0002476_1766_4048 733
1040 3300038443 Ga0395901_0106410 Ga0395901_0106410_359_2641 733
1041 3300044684 Ga0466966_0029669 Ga0466966_0029669_760_3021 733
1042 3300045976 Ga0466967_0002551 Ga0466967_0002551_3600_5864 733
1043 3300046452 Ga0495617_005789 Ga0495617_005789_255_2459 733
1044 3300046453 Ga0495627_000113 Ga0495627_000113_54239_56461 733
1045 3300046512 Ga0495610_0007358 Ga0495610_0007358_4789_6993 733
1046 3300047470 Ga0495681_0000050 Ga0495681_0000050_32822_35026 733
1047 3300047472 Ga0495686_0012436 Ga0495686_0012436_2904_5108 733
1048 3300048921 Ga0496118_0037161 Ga0496118_0037161_68_2272 733
1049 3300048924 Ga0496121_0007129 Ga0496121_0007129_8383_10593 733
1050 3300049459 Ga0495678_022554 Ga0495678_022554_179_2383 733
1051 iso_pu_bacteria 2643221574 2643882306 733
1052 iso_pu_bacteria 2643221663 2644353096 733
1053 iso_pu_bacteria 2643221699 2644548703 733
1054 3300003781 Ga0055536_1000877 Ga0055536_100087713 734
1055 3300025292 Ga0209676_1000217 Ga0209676_100021731 734
1056 3300025298 Ga0209050_1015836 Ga0209050_10158362 734
1057 3300025304 Ga0209257_1000230 Ga0209257_100023063 734
1058 3300031901 Ga0307406_10001489 Ga0307406_100014892 734
1059 3300031911 Ga0307412_10000429 Ga0307412_1000042923 734
1060 3300032004 Ga0307414_10038872 Ga0307414_100388722 734
1061 3300048929 Ga0496126_0084747 Ga0496126_0084747_118_2325 734
1062 3300053121 Ga0500607_000001 Ga0500607_000001_162867_165092 734
1063 3300001915 JGI24741J21665_1000588 JGI24741J21665_10005887 735
1064 3300001979 JGI24740J21852_10006720 JGI24740J21852_100067202 735
1065 3300001990 JGI24737J22298_10004715 JGI24737J22298_100047154 735
1066 3300003215 JGI25153J46596_10000021 JGI25153J46596_10000021233 735
1067 3300003759 Ga0055525_1000012 Ga0055525_1000012351 735
1068 3300003762 Ga0055542_1000355 Ga0055542_10003557 735
1069 3300003763 Ga0055529_1000045 Ga0055529_1000045137 735
1070 3300005327 Ga0070658_10004041 Ga0070658_100040417 735
1071 3300005356 Ga0070674_100005180 Ga0070674_1000051803 735
1072 3300005364 Ga0070673_100028355 Ga0070673_1000283551 735
1073 3300005457 Ga0070662_100037732 Ga0070662_1000377322 735
1074 3300005548 Ga0070665_100000021 Ga0070665_1000000212 735
1075 3300005719 Ga0068861_100000008 Ga0068861_10000000854 735
1076 3300009148 Ga0105243_10001895 Ga0105243_100018958 735
1077 3300009174 Ga0105241_10000683 Ga0105241_1000068321 735
1078 3300009177 Ga0105248_10006448 Ga0105248_1000644811 735
1079 3300013102 Ga0157371_10000032 Ga0157371_10000032108 735
1080 3300025230 Ga0209563_100030 Ga0209563_10003099 735
1081 3300025253 Ga0209677_104606 Ga0209677_1046063 735
1082 3300025254 Ga0209148_1000011 Ga0209148_1000011628 735
1083 3300025272 Ga0209455_1000006 Ga0209455_1000006565 735
1084 3300025297 Ga0209758_1000023 Ga0209758_100002351 735
1085 3300025321 Ga0207656_10000558 Ga0207656_100005584 735
1086 3300025909 Ga0207705_10001569 Ga0207705_100015693 735
1087 3300025913 Ga0207695_10006756 Ga0207695_1000675611 735
1088 3300025914 Ga0207671_10008295 Ga0207671_100082957 735
1089 3300025920 Ga0207649_10002556 Ga0207649_100025567 735
1090 3300025932 Ga0207690_10000557 Ga0207690_1000055725 735
1091 3300025933 Ga0207706_10014052 Ga0207706_100140524 735
1092 3300025937 Ga0207669_10000734 Ga0207669_100007348 735
1093 3300025949 Ga0207667_10000002 Ga0207667_10000002358 735
1094 3300025960 Ga0207651_10010122 Ga0207651_100101224 735
1095 3300026078 Ga0207702_10006008 Ga0207702_100060088 735
1096 3300026116 Ga0207674_10015759 Ga0207674_100157591 735
1097 3300026118 Ga0207675_100000105 Ga0207675_10000010552 735
1098 3300028379 Ga0268266_10000015 Ga0268266_10000015449 735
1099 3300028786 Ga0307517_10046716 Ga0307517_100467162 735
1100 3300031456 Ga0307513_10015216 Ga0307513_100152169 735
1101 3300046471 Ga0495650_0000302 Ga0495650_0000302_34259_36469 735
1102 3300046492 Ga0495585_0045117 Ga0495585_0045117_119_2329 735
1103 3300046506 Ga0495583_0001733 Ga0495583_0001733_16128_18338 735
1104 3300046506 Ga0495583_0004184 Ga0495583_0004184_6326_8536 735
1105 3300046507 Ga0495606_0013282 Ga0495606_0013282_4287_6497 735
1106 3300046522 Ga0495643_0002309 Ga0495643_0002309_12974_15184 735
1107 3300046524 Ga0495648_0000143 Ga0495648_0000143_65545_67755 735
1108 3300046558 Ga0495633_0003123 Ga0495633_0003123_1858_4068 735
1109 3300046616 Ga0495668_0000016 Ga0495668_0000016_320423_322633 735
1110 3300046660 Ga0495625_0017581 Ga0495625_0017581_1261_3471 735
1111 3300046684 Ga0495669_0000050 Ga0495669_0000050_35076_37286 735
1112 3300046691 Ga0495670_0018215 Ga0495670_0018215_948_3176 735
1113 3300046694 Ga0495649_0000171 Ga0495649_0000171_6536_8779 735
1114 3300047443 Ga0495687_000648 Ga0495687_000648_15138_17348 735
1115 3300047443 Ga0495687_000694 Ga0495687_000694_20866_23076 735
1116 3300047470 Ga0495681_0003230 Ga0495681_0003230_6691_8901 735
1117 3300047472 Ga0495686_0000650 Ga0495686_0000650_23155_25365 735
1118 3300048905 Ga0496102_0000199 Ga0496102_0000199_39143_41353 735
1119 3300048906 Ga0496103_0000131 Ga0496103_0000131_65527_67737 735
1120 3300048908 Ga0496105_0000344 Ga0496105_0000344_6620_8830 735
1121 3300048917 Ga0496114_0013412 Ga0496114_0013412_2815_5025 735
1122 3300048918 Ga0496115_0000133 Ga0496115_0000133_292_2502 735
1123 3300048919 Ga0496116_0003641 Ga0496116_0003641_4324_6534 735
1124 3300048919 Ga0496116_0013395 Ga0496116_0013395_2660_4873 735
1125 3300048920 Ga0496117_0000352 Ga0496117_0000352_40011_42221 735
1126 3300048921 Ga0496118_0000092 Ga0496118_0000092_127844_130054 735
1127 3300048922 Ga0496119_0003652 Ga0496119_0003652_9667_11877 735
1128 3300048924 Ga0496121_0000228 Ga0496121_0000228_77396_79606 735
1129 3300048924 Ga0496121_0000374 Ga0496121_0000374_73197_75407 735
1130 3300048925 Ga0496122_0020255 Ga0496122_0020255_2402_4612 735
1131 3300048927 Ga0496124_0000081 Ga0496124_0000081_78288_80498 735
1132 3300048928 Ga0496125_0000980 Ga0496125_0000980_40102_42312 735
1133 3300048928 Ga0496125_0001397 Ga0496125_0001397_25973_28186 735
1134 3300048929 Ga0496126_0000283 Ga0496126_0000283_39061_41271 735
1135 3300053079 Ga0500610_0000139 Ga0500610_0000139_6909_9119 735
1136 3300053119 Ga0500595_001258 Ga0500595_001258_934_3144 735
1137 3300053130 Ga0500642_0001585 Ga0500642_0001585_3679_5889 735
1138 3300053140 Ga0500573_0000072 Ga0500573_0000072_34019_36265 735
1139 3300053177 Ga0500636_0001727 Ga0500636_0001727_1957_4290 735
1140 3300053730 Ga0500645_000221 Ga0500645_000221_39751_41961 735
1141 3300003791 Ga0055530_10000135 Ga0055530_100001358 736
1142 3300003794 Ga0055531_10007871 Ga0055531_100078714 736
1143 3300005262 Ga0065165_1000412 Ga0065165_10004123 736
1144 3300015690 Ga0183363_1004 Ga0183363_1004265 736
1145 3300025250 Ga0209026_1001260 Ga0209026_10012601 736
1146 3300025297 Ga0209758_1000682 Ga0209758_10006824 736
1147 3300025298 Ga0209050_1000141 Ga0209050_1000141108 736
1148 3300025304 Ga0209257_1000288 Ga0209257_100028849 736
1149 3300032004 Ga0307414_10035843 Ga0307414_100358432 736
1150 3300032005 Ga0307411_10024232 Ga0307411_100242322 736
1151 3300038705 Ga0237819_00223 Ga0237819_00223_155_2374 736
1152 3300039145 Ga0237816_00361 Ga0237816_00361_868_3087 736
1153 3300045976 Ga0466967_0039130 Ga0466967_0039130_831_3095 736
1154 3300046660 Ga0495625_0000150 Ga0495625_0000150_19895_22108 736
1155 iso_pu_bacteria 2775507255 2778127030 736
1156 3300005339 Ga0070660_100000292 Ga0070660_10000029238 738
1157 3300005530 Ga0070679_100020767 Ga0070679_1000207673 738
1158 3300005539 Ga0068853_100000679 Ga0068853_1000006796 738
1159 3300005563 Ga0068855_100009305 Ga0068855_1000093058 738
1160 3300025909 Ga0207705_10002942 Ga0207705_100029422 738
1161 3300025919 Ga0207657_10000962 Ga0207657_100009623 738
1162 3300025921 Ga0207652_10001035 Ga0207652_1000103523 738
1163 3300025941 Ga0207711_10028625 Ga0207711_100286254 738
1164 3300025944 Ga0207661_10063469 Ga0207661_100634692 738
1165 3300025949 Ga0207667_10011406 Ga0207667_100114067 738
1166 3300026041 Ga0207639_10000695 Ga0207639_100006956 738
1167 3300026067 Ga0207678_10004613 Ga0207678_100046132 738
1168 3300028379 Ga0268266_10022526 Ga0268266_100225264 738
1169 3300037312 Ga0395899_0002564 Ga0395899_0002564_11040_13313 738
1170 3300037418 Ga0395900_0006570 Ga0395900_0006570_7735_10008 738
1171 3300037466 Ga0395898_0002184 Ga0395898_0002184_17328_19601 738
1172 3300038443 Ga0395901_0004299 Ga0395901_0004299_963_3236 738
1173 3300038443 Ga0395901_0140661 Ga0395901_0140661_56_2329 738
1174 3300005355 Ga0070671_100017649 Ga0070671_1000176493 739
1175 3300005842 Ga0068858_100001633 Ga0068858_10000163320 739
1176 3300006042 Ga0075368_10000113 Ga0075368_1000011315 739
1177 3300006051 Ga0075364_10061981 Ga0075364_100619811 739
1178 3300006177 Ga0075362_10003370 Ga0075362_100033704 739
1179 3300006178 Ga0075367_10013278 Ga0075367_100132783 739
1180 3300009098 Ga0105245_10007826 Ga0105245_100078266 739
1181 3300009978 Ga0105148_100123 Ga0105148_1001234 739
1182 3300025927 Ga0207687_10009023 Ga0207687_100090237 739
1183 3300025931 Ga0207644_10011802 Ga0207644_100118022 739
1184 3300026035 Ga0207703_10001323 Ga0207703_100013238 739
1185 3300046460 Ga0495638_0000613 Ga0495638_0000613_35956_38184 739
1186 3300046692 Ga0495671_0016684 Ga0495671_0016684_497_2725 739
1187 3300048912 Ga0496109_0042862 Ga0496109_0042862_1368_3617 739
1188 3300048928 Ga0496125_0059025 Ga0496125_0059025_315_2564 739
1189 3300049663 Ga0501223_000003 Ga0501223_000003_91749_93998 739
1190 3300049705 Ga0501225_0000002 Ga0501225_0000002_69036_71285 739
1191 3300049705 Ga0501225_0000629 Ga0501225_0000629_7059_9308 739
1192 3300050493 nmdc:mga0k408_32410_c1 nmdc:mga0k408_32410_c1_345_2585 739
1193 3300050494 nmdc:mga06z11_614_c1 nmdc:mga06z11_614_c1_769_3009 739
1194 3300050495 nmdc:mga04h51_890_c1 nmdc:mga04h51_890_c1_3918_6158 739
1195 3300050496 nmdc:mga07m45_15_c1 nmdc:mga07m45_15_c1_127056_129296 739
1196 3300001915 JGI24741J21665_1000182 JGI24741J21665_10001828 740
1197 3300001979 JGI24740J21852_10000388 JGI24740J21852_100003887 740
1198 3300001989 JGI24739J22299_10000974 JGI24739J22299_100009743 740
1199 3300001990 JGI24737J22298_10001102 JGI24737J22298_100011024 740
1200 3300002067 JGI24735J21928_10002829 JGI24735J21928_100028295 740
1201 3300005366 Ga0070659_100010961 Ga0070659_1000109614 740
1202 3300005455 Ga0070663_100001970 Ga0070663_1000019706 740
1203 3300005563 Ga0068855_100030831 Ga0068855_1000308314 740
1204 3300005614 Ga0068856_100002287 Ga0068856_10000228713 740
1205 3300006051 Ga0075364_10016817 Ga0075364_100168172 740
1206 3300006186 Ga0075369_10014979 Ga0075369_100149791 740
1207 3300009174 Ga0105241_10005152 Ga0105241_100051524 740
1208 3300009545 Ga0105237_10019897 Ga0105237_100198976 740
1209 3300013104 Ga0157370_10009438 Ga0157370_100094383 740
1210 3300022467 Ga0224712_10015010 Ga0224712_100150101 740
1211 3300025904 Ga0207647_10003746 Ga0207647_100037464 740
1212 3300025913 Ga0207695_10014624 Ga0207695_100146245 740
1213 3300025924 Ga0207694_10043607 Ga0207694_100436072 740
1214 3300025933 Ga0207706_10014698 Ga0207706_100146982 740
1215 3300025949 Ga0207667_10035526 Ga0207667_100355262 740
1216 3300026041 Ga0207639_10000895 Ga0207639_1000089514 740
1217 3300026067 Ga0207678_10001250 Ga0207678_100012508 740
1218 3300026078 Ga0207702_10005445 Ga0207702_100054456 740
1219 3300026116 Ga0207674_10016432 Ga0207674_100164326 740
1220 3300031548 Ga0307408_100000644 Ga0307408_1000006449 740
1221 3300031616 Ga0307508_10018261 Ga0307508_100182611 740
1222 3300032002 Ga0307416_100012314 Ga0307416_1000123143 740
1223 3300032005 Ga0307411_10009241 Ga0307411_100092414 740
1224 3300044735 Ga0466968_0016087 Ga0466968_0016087_106_2370 740
1225 3300050491 nmdc:mga00v17_2701_c1 nmdc:mga00v17_2701_c1_2028_4268 740
1226 3300053156 Ga0500622_0000795 Ga0500622_0000795_9784_12042 740

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00141

peroxidase

Peroxidase

110

442

0.86

PF00141

peroxidase

Peroxidase

448

751

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
1u2j-assembly3.cif.gz_C crystal structure of the c-terminal domain from the catalase-peroxidase katg of escherichia coli (p21 21 21) 0.9731 437 738
1u2j-assembly3.cif.gz_C crystal structure of the c-terminal domain from the catalase-peroxidase katg of escherichia coli (p21 21 21) 0.9667 437 738
3vlm-assembly1.cif.gz_A crystal structure analysis of the met244ala variant of katg from haloarcula marismortui 0.9561 35 735
3vlm-assembly1.cif.gz_A crystal structure analysis of the met244ala variant of katg from haloarcula marismortui 0.9519 35 735
7jz6-assembly1.cif.gz_A the cryo-em structure of the catalase-peroxidase from escherichia coli 0.9487 33 737
ID Description Score Start End Superfamily
3wnuA04 Mainly Alpha;Orthogonal Bundle;Peroxidase; domain 2;Peroxidase, domain 2 0.992 592 714 1.10.420.10
3wnuA04 Mainly Alpha;Orthogonal Bundle;Peroxidase; domain 2;Peroxidase, domain 2 0.976 592 714 1.10.420.10
af_P13029_443_573_1.10.520.10 Mainly Alpha;Orthogonal Bundle;Peroxidase; domain 1; 0.9646 447 586 1.10.520.10
5jhzA04 Mainly Alpha;Orthogonal Bundle;Peroxidase; domain 2;Peroxidase, domain 2 0.9575 592 712 1.10.420.10
af_P13029_443_573_1.10.520.10 Mainly Alpha;Orthogonal Bundle;Peroxidase; domain 1; 0.9574 447 586 1.10.520.10
ID Description Score Start End GO Terms
AF-A0A439KR47-F1-model_v4 Catalase-peroxidase 1.001 607 738 GO:0004096
GO:0005829
GO:0020037
GO:0042744
GO:0070301
AF-A0A2D7NVV7-F1-model_v4 Catalase-peroxidase 0.9999 618 738 GO:0004096
GO:0005829
GO:0020037
GO:0042744
GO:0070301
AF-A0A4V3MB00-F1-model_v4 deleted 0.9993 437 528
AF-A0A525D3M5-F1-model_v4 Catalase-peroxidase 0.9985 624 738 GO:0004096
GO:0005829
GO:0020037
GO:0042744
GO:0070301
AF-A0A3C0ITM8-F1-model_v4 Catalase-peroxidase 0.998 468 587 GO:0004096
GO:0005829
GO:0020037
GO:0042744
GO:0070301

Feature Viewer

pLDDT pTM Quality
87.68 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map