F491797
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1216 | 521 | 1212 | 155 |
Family's Representative Sequence
| Representative Sequence | 3300046516|Ga0495628_0482464|Ga0495628_0482464_162_632 |
| Length | 156 |
| Sequence | MKTLSREKLKVVAARADASEQGSYVLDEQAGFLMRVAMQRHTSIFTSRMLEGLTRTQFAALAKLYEVGPCSQNHLGRLIYLDAATIKGVVDRLHLRGFVTALSDPNDRRRPVALTERGRQVTEAAMLVAAEITAATLTPLTADEQRMIAKLLRKLG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2209111006 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 | Metagenome | Rhizosphere |
| 2 | 2602042107 | Bradyrhizobium sp. NFR13 | Isolate | Rhizoplane |
| 3 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 4 | 2893066018 | Tardiphaga sp. P9-11 | Isolate | Unclassified |
| 5 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 6 | 3300000041 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere | Metagenome | Rhizosphere |
| 7 | 3300000042 | Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young | Metagenome | Rhizosphere |
| 8 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 9 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 10 | 3300000045 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere | Metagenome | Rhizosphere |
| 11 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 12 | 3300001430 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 | Metagenome | Rhizosphere |
| 13 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 14 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 15 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 16 | 3300001978 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 | Metagenome | Rhizosphere |
| 17 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 18 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 19 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 20 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 21 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 22 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 23 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 24 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 25 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 26 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 27 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 28 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 29 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 30 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 31 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 35 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 38 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 42 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 44 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 55 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 59 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 62 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 66 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 67 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 72 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 73 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 74 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 75 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 76 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 77 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 78 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 79 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 81 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 82 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 86 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 87 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 89 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 90 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 91 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 92 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 93 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 94 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 95 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 96 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 97 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 98 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 99 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 100 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 101 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 102 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 103 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 104 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 105 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 106 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 107 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 108 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 109 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 110 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 111 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 112 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 113 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 114 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 115 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 116 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 117 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 118 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 120 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 121 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 122 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 123 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 124 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 125 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 126 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 128 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 129 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 137 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 138 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 139 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 140 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 141 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 142 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 143 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 144 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 145 | 3300012476 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.yng.070610 | Metagenome | Rhizosphere |
| 146 | 3300012492 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 | Metagenome | Rhizosphere |
| 147 | 3300012494 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 | Metagenome | Rhizosphere |
| 148 | 3300012497 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 | Metagenome | Rhizosphere |
| 149 | 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Metagenome | Rhizosphere |
| 150 | 3300012502 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 | Metagenome | Rhizosphere |
| 151 | 3300012503 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R | Metagenome | Rhizosphere |
| 152 | 3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Metagenome | Rhizosphere |
| 153 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 155 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 156 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 157 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 158 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 159 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 160 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 161 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 162 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 163 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 164 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 165 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 166 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 167 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 168 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 169 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 170 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 171 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 172 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 173 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 174 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 175 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 177 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 178 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 179 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300027424 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 254 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 258 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 259 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 260 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 261 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 262 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 263 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 264 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 265 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 266 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 267 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 268 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 269 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 270 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 271 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 272 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 273 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 274 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 275 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 276 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 277 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 278 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 279 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 280 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 281 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 282 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 283 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 284 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 285 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 286 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 287 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 288 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 289 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 290 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 291 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 292 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 293 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 294 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 295 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 296 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 297 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 298 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 299 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 300 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 301 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 302 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 303 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 304 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 305 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 306 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 307 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 308 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 309 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 310 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 311 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 312 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 313 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 314 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 315 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 316 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 317 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 318 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 319 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 320 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 321 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 322 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 323 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 324 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 325 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 326 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 327 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 328 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 329 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 330 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 331 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 332 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 333 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 334 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 335 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 336 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 337 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 338 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 339 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 410 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 411 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 412 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 413 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 414 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 415 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 416 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 417 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 418 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 419 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 420 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 421 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 422 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 423 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 424 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 425 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 426 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 427 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 428 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 429 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 430 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 431 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 432 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 433 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 434 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 435 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 436 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 437 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 438 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 439 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 440 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 441 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 442 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 443 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 444 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 445 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 446 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 447 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 448 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 449 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 450 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 451 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 452 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 453 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 454 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 455 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 456 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 457 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 458 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 459 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 460 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 461 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 462 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 463 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 464 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 465 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 466 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 467 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 468 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 469 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 470 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 471 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 472 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 473 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 474 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 475 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 476 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 477 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 478 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 479 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 480 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 481 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 482 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 483 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 484 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 485 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 486 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 487 | 3300053089 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere | Metagenome | Endosphere |
| 488 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 489 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 490 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 491 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 492 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 493 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 494 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 495 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 496 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 497 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 498 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 499 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 500 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 501 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 502 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 503 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 504 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 505 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 506 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 507 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 508 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 509 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 510 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 511 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 512 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 513 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 514 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 515 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 516 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 517 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 518 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 519 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 520 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 521 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.59 |
| Metatranscriptomes | 0.08 |
| Isolates | 0.33 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.47 |
| Nodule | 0 |
| Rhizoplane | 5.02 |
| Rhizosphere | 82.73 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.78 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | 2214800760 | 2209111006 | Bacteria | 10890 |
| 2 | ARcpr5oldR_c000187 | 3300000041 | Bacteria | 10789 |
| 3 | ARSoilYngRDRAFT_c00132 | 3300000042 | Bacteria | 12557 |
| 4 | ARcpr5yngRDRAFT_c000643 | 3300000043 | Bacteria | 4372 |
| 5 | ARSoilOldRDRAFT_c000044 | 3300000044 | Bacteria | 26451 |
| 6 | ARCol0oldRDRAFT_c00484 | 3300000045 | Bacteria | 3716 |
| 7 | ARCol0yngRDRAFT_1000153 | 3300000652 | Bacteria | 12275 |
| 8 | JGI24032J14994_101472 | 3300001430 | Bacteria | 974 |
| 9 | JGI24741J21665_1025315 | 3300001915 | Bacteria | 907 |
| 10 | JGI24752J21851_1016260 | 3300001976 | Bacteria | 968 |
| 11 | JGI24746J21847_1005317 | 3300001977 | Bacteria | 2011 |
| 12 | JGI24747J21853_1014220 | 3300001978 | Bacteria | 827 |
| 13 | JGI24739J22299_10024622 | 3300001989 | Bacteria | 2122 |
| 14 | JGI24737J22298_10006807 | 3300001990 | Bacteria | 3884 |
| 15 | JGI24737J22298_10007788 | 3300001990 | Bacteria | 3611 |
| 16 | JGI24737J22298_10024518 | 3300001990 | Unclassified | 1910 |
| 17 | JGI24745J21846_1002155 | 3300002073 | Bacteria | 1981 |
| 18 | JGI24738J21930_10016553 | 3300002075 | Bacteria | 1556 |
| 19 | JGI24749J21850_1004742 | 3300002076 | Bacteria | 1905 |
| 20 | JGI24749J21850_1005739 | 3300002076 | Bacteria | 1732 |
| 21 | JGI24035J26624_1001878 | 3300002126 | Bacteria | 1959 |
| 22 | JGI24033J26618_1016316 | 3300002155 | Bacteria | 922 |
| 23 | JGI24034J26672_10012906 | 3300002239 | Bacteria | 1264 |
| 24 | JGI24742J22300_10002556 | 3300002244 | Bacteria | 2906 |
| 25 | JGI25153J46596_10003982 | 3300003215 | Bacteria | 8074 |
| 26 | rootH1_10113021 | 3300003323 | Bacteria | 1620 |
| 27 | Ga0065165_1059454 | 3300005262 | Bacteria | 1052 |
| 28 | Ga0065165_1104001 | 3300005262 | Bacteria | 707 |
| 29 | Ga0065712_10073820 | 3300005290 | Bacteria | 4269 |
| 30 | Ga0065715_10096283 | 3300005293 | Bacteria | 3910 |
| 31 | Ga0070658_10072899 | 3300005327 | Bacteria | 2815 |
| 32 | Ga0070658_10080660 | 3300005327 | Bacteria | 2672 |
| 33 | Ga0070676_10000985 | 3300005328 | Bacteria | 14158 |
| 34 | Ga0070676_10039981 | 3300005328 | Bacteria | 2714 |
| 35 | Ga0070683_100001244 | 3300005329 | Bacteria | 19370 |
| 36 | Ga0070683_100553405 | 3300005329 | Bacteria | 1100 |
| 37 | Ga0070683_100645113 | 3300005329 | Bacteria | 1014 |
| 38 | Ga0070690_100012869 | 3300005330 | Bacteria | 4930 |
| 39 | Ga0070690_100021460 | 3300005330 | Bacteria | 3944 |
| 40 | Ga0070690_100026138 | 3300005330 | Bacteria | 3598 |
| 41 | Ga0070690_100506992 | 3300005330 | Bacteria | 904 |
| 42 | Ga0070670_100012785 | 3300005331 | Bacteria | 7182 |
| 43 | Ga0070670_101789424 | 3300005331 | Unclassified | 565 |
| 44 | Ga0070677_10006769 | 3300005333 | Bacteria | 3814 |
| 45 | Ga0068869_100027806 | 3300005334 | Bacteria | 3946 |
| 46 | Ga0068869_100198362 | 3300005334 | Unclassified | 1581 |
| 47 | Ga0068869_100953368 | 3300005334 | Bacteria | 745 |
| 48 | Ga0070666_10054336 | 3300005335 | Bacteria | 2702 |
| 49 | Ga0070666_10178291 | 3300005335 | Bacteria | 1490 |
| 50 | Ga0070666_10481090 | 3300005335 | Bacteria | 899 |
| 51 | Ga0070680_100044451 | 3300005336 | Bacteria | 3609 |
| 52 | Ga0070680_100058826 | 3300005336 | Bacteria | 3144 |
| 53 | Ga0070680_100066695 | 3300005336 | Bacteria | 2951 |
| 54 | Ga0070680_100113040 | 3300005336 | Bacteria | 2261 |
| 55 | Ga0070680_100511712 | 3300005336 | Bacteria | 1028 |
| 56 | Ga0070680_100892790 | 3300005336 | Bacteria | 767 |
| 57 | Ga0070682_100029667 | 3300005337 | Bacteria | 3294 |
| 58 | Ga0070682_100115799 | 3300005337 | Bacteria | 1793 |
| 59 | Ga0070682_100341631 | 3300005337 | Bacteria | 1113 |
| 60 | Ga0070682_100547156 | 3300005337 | Bacteria | 905 |
| 61 | Ga0068868_100004160 | 3300005338 | Bacteria | 10113 |
| 62 | Ga0068868_100390300 | 3300005338 | Bacteria | 1199 |
| 63 | Ga0068868_100605743 | 3300005338 | Bacteria | 971 |
| 64 | Ga0070660_100000525 | 3300005339 | Bacteria | 25536 |
| 65 | Ga0070660_100030675 | 3300005339 | Bacteria | 4033 |
| 66 | Ga0070660_100059117 | 3300005339 | Bacteria | 2972 |
| 67 | Ga0070660_100797671 | 3300005339 | Bacteria | 794 |
| 68 | Ga0070660_100989190 | 3300005339 | Bacteria | 711 |
| 69 | Ga0070689_100002898 | 3300005340 | Bacteria | 11283 |
| 70 | Ga0070689_100135170 | 3300005340 | Bacteria | 1980 |
| 71 | Ga0070689_100746381 | 3300005340 | Unclassified | 858 |
| 72 | Ga0070689_101706795 | 3300005340 | Bacteria | 573 |
| 73 | Ga0070691_10002569 | 3300005341 | Bacteria | 8092 |
| 74 | Ga0070691_10179444 | 3300005341 | Bacteria | 1102 |
| 75 | Ga0070687_100082377 | 3300005343 | Bacteria | 1759 |
| 76 | Ga0070687_100171850 | 3300005343 | Bacteria | 1291 |
| 77 | Ga0070687_100833700 | 3300005343 | Bacteria | 656 |
| 78 | Ga0070661_100004361 | 3300005344 | Bacteria | 9758 |
| 79 | Ga0070661_100086436 | 3300005344 | Bacteria | 2318 |
| 80 | Ga0070661_100809478 | 3300005344 | Bacteria | 769 |
| 81 | Ga0070692_10009575 | 3300005345 | Bacteria | 4373 |
| 82 | Ga0070692_10017346 | 3300005345 | Bacteria | 3440 |
| 83 | Ga0070668_100015096 | 3300005347 | Bacteria | 5771 |
| 84 | Ga0070668_100112572 | 3300005347 | Bacteria | 2167 |
| 85 | Ga0070668_100250077 | 3300005347 | Bacteria | 1471 |
| 86 | Ga0070669_100002142 | 3300005353 | Bacteria | 14279 |
| 87 | Ga0070669_100012165 | 3300005353 | Bacteria | 6108 |
| 88 | Ga0070669_100128259 | 3300005353 | Bacteria | 1943 |
| 89 | Ga0070675_100053131 | 3300005354 | Bacteria | 3332 |
| 90 | Ga0070675_100328970 | 3300005354 | Bacteria | 1351 |
| 91 | Ga0070675_100696796 | 3300005354 | Bacteria | 925 |
| 92 | Ga0070671_100005408 | 3300005355 | Bacteria | 10186 |
| 93 | Ga0070671_101230595 | 3300005355 | Bacteria | 659 |
| 94 | Ga0070674_100001208 | 3300005356 | Bacteria | 13557 |
| 95 | Ga0070674_100602417 | 3300005356 | Bacteria | 928 |
| 96 | Ga0070673_100006682 | 3300005364 | Bacteria | 7519 |
| 97 | Ga0070673_100331008 | 3300005364 | Bacteria | 1348 |
| 98 | Ga0070688_100000970 | 3300005365 | Bacteria | 14364 |
| 99 | Ga0070688_100001615 | 3300005365 | Bacteria | 11287 |
| 100 | Ga0070688_100002125 | 3300005365 | Bacteria | 9989 |
| 101 | Ga0070688_100926366 | 3300005365 | Unclassified | 688 |
| 102 | Ga0070659_100442858 | 3300005366 | Bacteria | 1101 |
| 103 | Ga0070659_100452047 | 3300005366 | Bacteria | 1090 |
| 104 | Ga0070659_100623816 | 3300005366 | Unclassified | 928 |
| 105 | Ga0070659_100983227 | 3300005366 | Unclassified | 740 |
| 106 | Ga0070667_100018716 | 3300005367 | Bacteria | 5744 |
| 107 | Ga0070667_100027679 | 3300005367 | Bacteria | 4717 |
| 108 | Ga0070667_100041879 | 3300005367 | Bacteria | 3841 |
| 109 | Ga0070667_100902466 | 3300005367 | Bacteria | 823 |
| 110 | Ga0070703_10018531 | 3300005406 | Bacteria | 2014 |
| 111 | Ga0070703_10108693 | 3300005406 | Bacteria | 989 |
| 112 | Ga0070709_10040154 | 3300005434 | Bacteria | 2875 |
| 113 | Ga0070709_10137388 | 3300005434 | Bacteria | 1676 |
| 114 | Ga0070709_10203545 | 3300005434 | Bacteria | 1403 |
| 115 | Ga0070709_10465381 | 3300005434 | Bacteria | 955 |
| 116 | Ga0070714_100006637 | 3300005435 | Bacteria | 8954 |
| 117 | Ga0070714_100155738 | 3300005435 | Bacteria | 2062 |
| 118 | Ga0070714_100667074 | 3300005435 | Bacteria | 1002 |
| 119 | Ga0070714_100788788 | 3300005435 | Bacteria | 920 |
| 120 | Ga0070714_101649337 | 3300005435 | Bacteria | 626 |
| 121 | Ga0070713_100014447 | 3300005436 | Bacteria | 5866 |
| 122 | Ga0070713_100277870 | 3300005436 | Bacteria | 1535 |
| 123 | Ga0070713_100452867 | 3300005436 | Bacteria | 1205 |
| 124 | Ga0070713_100696588 | 3300005436 | Bacteria | 970 |
| 125 | Ga0070710_10017052 | 3300005437 | Bacteria | 3709 |
| 126 | Ga0070710_10036006 | 3300005437 | Bacteria | 2703 |
| 127 | Ga0070710_10139034 | 3300005437 | Bacteria | 1487 |
| 128 | Ga0070701_10000532 | 3300005438 | Bacteria | 13106 |
| 129 | Ga0070711_100008900 | 3300005439 | Bacteria | 6161 |
| 130 | Ga0070711_100043265 | 3300005439 | Bacteria | 3049 |
| 131 | Ga0070711_100104380 | 3300005439 | Bacteria | 2067 |
| 132 | Ga0070705_100006339 | 3300005440 | Bacteria | 5795 |
| 133 | Ga0070705_100150389 | 3300005440 | Unclassified | 1544 |
| 134 | Ga0070705_101508158 | 3300005440 | Bacteria | 563 |
| 135 | Ga0070700_100031664 | 3300005441 | Bacteria | 3171 |
| 136 | Ga0070694_100001428 | 3300005444 | Bacteria | 13999 |
| 137 | Ga0070694_100002143 | 3300005444 | Bacteria | 11698 |
| 138 | Ga0070708_100046627 | 3300005445 | Bacteria | 3824 |
| 139 | Ga0070708_100328671 | 3300005445 | Bacteria | 1440 |
| 140 | Ga0070663_100046288 | 3300005455 | Bacteria | 3077 |
| 141 | Ga0070663_100085578 | 3300005455 | Bacteria | 2327 |
| 142 | Ga0070663_100173614 | 3300005455 | Bacteria | 1668 |
| 143 | Ga0070663_100219923 | 3300005455 | Bacteria | 1491 |
| 144 | Ga0070678_100026205 | 3300005456 | Bacteria | 3937 |
| 145 | Ga0070678_100056901 | 3300005456 | Bacteria | 2862 |
| 146 | Ga0070678_100138354 | 3300005456 | Bacteria | 1945 |
| 147 | Ga0070662_100034625 | 3300005457 | Bacteria | 3562 |
| 148 | Ga0070681_10017611 | 3300005458 | Bacteria | 7140 |
| 149 | Ga0070681_10109594 | 3300005458 | Bacteria | 2701 |
| 150 | Ga0070681_10120499 | 3300005458 | Bacteria | 2558 |
| 151 | Ga0070681_10133801 | 3300005458 | Bacteria | 2410 |
| 152 | Ga0070681_10277579 | 3300005458 | Bacteria | 1587 |
| 153 | Ga0070681_10295426 | 3300005458 | Bacteria | 1530 |
| 154 | Ga0070681_11234113 | 3300005458 | Bacteria | 670 |
| 155 | Ga0068867_100007122 | 3300005459 | Bacteria | 7900 |
| 156 | Ga0068867_100090816 | 3300005459 | Bacteria | 2318 |
| 157 | Ga0068867_100384372 | 3300005459 | Bacteria | 1180 |
| 158 | Ga0070685_10006338 | 3300005466 | Bacteria | 6029 |
| 159 | Ga0070685_10010065 | 3300005466 | Bacteria | 4905 |
| 160 | Ga0070707_101332321 | 3300005468 | Bacteria | 684 |
| 161 | Ga0070679_100008193 | 3300005530 | Bacteria | 9826 |
| 162 | Ga0070679_100057917 | 3300005530 | Bacteria | 3861 |
| 163 | Ga0070679_100058535 | 3300005530 | Bacteria | 3839 |
| 164 | Ga0070679_100153842 | 3300005530 | Bacteria | 2276 |
| 165 | Ga0070679_100186809 | 3300005530 | Bacteria | 2043 |
| 166 | Ga0070679_100339329 | 3300005530 | Bacteria | 1451 |
| 167 | Ga0070679_100474175 | 3300005530 | Bacteria | 1196 |
| 168 | Ga0070679_100505201 | 3300005530 | Bacteria | 1153 |
| 169 | Ga0070679_100505526 | 3300005530 | Bacteria | 1152 |
| 170 | Ga0070679_100594718 | 3300005530 | Bacteria | 1050 |
| 171 | Ga0070679_100602214 | 3300005530 | Bacteria | 1042 |
| 172 | Ga0070679_100612729 | 3300005530 | Bacteria | 1032 |
| 173 | Ga0070679_100931253 | 3300005530 | Unclassified | 812 |
| 174 | Ga0070684_100090107 | 3300005535 | Bacteria | 2727 |
| 175 | Ga0070684_100135689 | 3300005535 | Bacteria | 2223 |
| 176 | Ga0070684_100227057 | 3300005535 | Bacteria | 1704 |
| 177 | Ga0070684_100666844 | 3300005535 | Bacteria | 969 |
| 178 | Ga0070697_101145666 | 3300005536 | Unclassified | 693 |
| 179 | Ga0068853_100032736 | 3300005539 | Bacteria | 4406 |
| 180 | Ga0068853_100833033 | 3300005539 | Bacteria | 884 |
| 181 | Ga0068853_101176117 | 3300005539 | Bacteria | 740 |
| 182 | Ga0070672_100000940 | 3300005543 | Bacteria | 17505 |
| 183 | Ga0070686_100003535 | 3300005544 | Bacteria | 8573 |
| 184 | Ga0070686_100004740 | 3300005544 | Bacteria | 7501 |
| 185 | Ga0070686_101165750 | 3300005544 | Unclassified | 639 |
| 186 | Ga0070695_100007876 | 3300005545 | Bacteria | 6310 |
| 187 | Ga0070695_100014616 | 3300005545 | Bacteria | 4733 |
| 188 | Ga0070696_100783602 | 3300005546 | Bacteria | 784 |
| 189 | Ga0070693_100027001 | 3300005547 | Bacteria | 3105 |
| 190 | Ga0070693_100209343 | 3300005547 | Bacteria | 1271 |
| 191 | Ga0070665_100215246 | 3300005548 | Bacteria | 1922 |
| 192 | Ga0070665_100281953 | 3300005548 | Unclassified | 1664 |
| 193 | Ga0070704_100001579 | 3300005549 | Bacteria | 12300 |
| 194 | Ga0070704_100579013 | 3300005549 | Bacteria | 984 |
| 195 | Ga0068855_100023093 | 3300005563 | Bacteria | 7453 |
| 196 | Ga0068855_100128657 | 3300005563 | Bacteria | 2893 |
| 197 | Ga0068855_100279388 | 3300005563 | Bacteria | 1855 |
| 198 | Ga0068855_100630157 | 3300005563 | Bacteria | 1154 |
| 199 | Ga0068855_100666786 | 3300005563 | Bacteria | 1116 |
| 200 | Ga0070664_100687532 | 3300005564 | Bacteria | 952 |
| 201 | Ga0068857_100009322 | 3300005577 | Bacteria | 8522 |
| 202 | Ga0068857_100224548 | 3300005577 | Bacteria | 1716 |
| 203 | Ga0068857_100255515 | 3300005577 | Bacteria | 1607 |
| 204 | Ga0068857_100467783 | 3300005577 | Bacteria | 1180 |
| 205 | Ga0068854_100090300 | 3300005578 | Bacteria | 2278 |
| 206 | Ga0068854_100229222 | 3300005578 | Unclassified | 1474 |
| 207 | Ga0068856_100022760 | 3300005614 | Bacteria | 6093 |
| 208 | Ga0068856_100045729 | 3300005614 | Bacteria | 4311 |
| 209 | Ga0068856_100055386 | 3300005614 | Bacteria | 3914 |
| 210 | Ga0068856_100503178 | 3300005614 | Bacteria | 1233 |
| 211 | Ga0068856_100503931 | 3300005614 | Bacteria | 1232 |
| 212 | Ga0068856_101114309 | 3300005614 | Bacteria | 806 |
| 213 | Ga0070702_100031454 | 3300005615 | Bacteria | 2904 |
| 214 | Ga0070702_100629261 | 3300005615 | Unclassified | 809 |
| 215 | Ga0068852_100003198 | 3300005616 | Bacteria | 11433 |
| 216 | Ga0068852_100058916 | 3300005616 | Bacteria | 3328 |
| 217 | Ga0068852_100134350 | 3300005616 | Bacteria | 2283 |
| 218 | Ga0068852_100260531 | 3300005616 | Bacteria | 1665 |
| 219 | Ga0068852_100381048 | 3300005616 | Bacteria | 1384 |
| 220 | Ga0068859_100096576 | 3300005617 | Unclassified | 3007 |
| 221 | Ga0068859_100525799 | 3300005617 | Bacteria | 1278 |
| 222 | Ga0068864_100003045 | 3300005618 | Bacteria | 13839 |
| 223 | Ga0068864_100016705 | 3300005618 | Bacteria | 6115 |
| 224 | Ga0068866_10000410 | 3300005718 | Bacteria | 20000 |
| 225 | Ga0068866_10091486 | 3300005718 | Bacteria | 1658 |
| 226 | Ga0068866_10487672 | 3300005718 | Bacteria | 813 |
| 227 | Ga0068861_100009022 | 3300005719 | Bacteria | 6875 |
| 228 | Ga0068861_100040082 | 3300005719 | Bacteria | 3500 |
| 229 | Ga0068851_10490689 | 3300005834 | Unclassified | 735 |
| 230 | Ga0068870_10000215 | 3300005840 | Bacteria | 20886 |
| 231 | Ga0068870_10588744 | 3300005840 | Bacteria | 754 |
| 232 | Ga0068863_100484261 | 3300005841 | Bacteria | 1217 |
| 233 | Ga0068858_100005681 | 3300005842 | Bacteria | 12193 |
| 234 | Ga0068858_100049473 | 3300005842 | Bacteria | 3893 |
| 235 | Ga0068858_100087583 | 3300005842 | Bacteria | 2896 |
| 236 | Ga0068858_100216226 | 3300005842 | Bacteria | 1814 |
| 237 | Ga0068858_100445845 | 3300005842 | Bacteria | 1247 |
| 238 | Ga0068860_100009344 | 3300005843 | Bacteria | 9741 |
| 239 | Ga0068860_100084361 | 3300005843 | Bacteria | 3022 |
| 240 | Ga0068860_100147618 | 3300005843 | Bacteria | 2263 |
| 241 | Ga0068862_100015662 | 3300005844 | Bacteria | 6299 |
| 242 | Ga0068862_100044125 | 3300005844 | Bacteria | 3803 |
| 243 | Ga0081455_10000012 | 3300005937 | Bacteria | 201668 |
| 244 | Ga0081455_10323975 | 3300005937 | Bacteria | 1097 |
| 245 | Ga0081539_10021800 | 3300005985 | Bacteria | 4264 |
| 246 | Ga0070717_10066769 | 3300006028 | Bacteria | 2992 |
| 247 | Ga0070717_10131054 | 3300006028 | Bacteria | 2156 |
| 248 | Ga0075365_10054599 | 3300006038 | Bacteria | 2650 |
| 249 | Ga0075365_10171638 | 3300006038 | Bacteria | 1514 |
| 250 | Ga0075368_10057624 | 3300006042 | Bacteria | 1551 |
| 251 | Ga0075363_100025836 | 3300006048 | Bacteria | 2999 |
| 252 | Ga0075363_100103010 | 3300006048 | Bacteria | 1581 |
| 253 | Ga0075364_10012460 | 3300006051 | Bacteria | 5202 |
| 254 | Ga0075364_10113903 | 3300006051 | Bacteria | 1807 |
| 255 | Ga0075364_10269518 | 3300006051 | Unclassified | 1158 |
| 256 | Ga0075364_10362153 | 3300006051 | Bacteria | 989 |
| 257 | Ga0075364_10403479 | 3300006051 | Bacteria | 933 |
| 258 | Ga0075432_10298429 | 3300006058 | Bacteria | 668 |
| 259 | Ga0070715_10088100 | 3300006163 | Bacteria | 1422 |
| 260 | Ga0070715_10167979 | 3300006163 | Bacteria | 1090 |
| 261 | Ga0070716_100070371 | 3300006173 | Bacteria | 2054 |
| 262 | Ga0070716_101102772 | 3300006173 | Unclassified | 633 |
| 263 | Ga0070712_100044771 | 3300006175 | Bacteria | 3053 |
| 264 | Ga0070712_100062276 | 3300006175 | Bacteria | 2637 |
| 265 | Ga0070712_100390343 | 3300006175 | Bacteria | 1147 |
| 266 | Ga0070712_100403531 | 3300006175 | Bacteria | 1129 |
| 267 | Ga0070712_100551581 | 3300006175 | Bacteria | 971 |
| 268 | Ga0070712_100941022 | 3300006175 | Bacteria | 746 |
| 269 | Ga0070712_101834221 | 3300006175 | Bacteria | 531 |
| 270 | Ga0075362_10055834 | 3300006177 | Bacteria | 1776 |
| 271 | Ga0075367_10102936 | 3300006178 | Bacteria | 1747 |
| 272 | Ga0075367_10107828 | 3300006178 | Bacteria | 1707 |
| 273 | Ga0075367_10112312 | 3300006178 | Bacteria | 1674 |
| 274 | Ga0075367_10249295 | 3300006178 | Bacteria | 1114 |
| 275 | Ga0075369_10124732 | 3300006186 | Bacteria | 1167 |
| 276 | Ga0075366_10038723 | 3300006195 | Bacteria | 2816 |
| 277 | Ga0075366_10042179 | 3300006195 | Bacteria | 2701 |
| 278 | Ga0075366_10501080 | 3300006195 | Bacteria | 751 |
| 279 | Ga0097621_100003185 | 3300006237 | Bacteria | 11280 |
| 280 | Ga0097621_100020982 | 3300006237 | Bacteria | 5042 |
| 281 | Ga0075370_10150533 | 3300006353 | Bacteria | 1364 |
| 282 | Ga0075370_10305990 | 3300006353 | Bacteria | 946 |
| 283 | Ga0075370_10625550 | 3300006353 | Bacteria | 653 |
| 284 | Ga0068871_100002188 | 3300006358 | Bacteria | 13277 |
| 285 | Ga0068871_100236587 | 3300006358 | Bacteria | 1587 |
| 286 | Ga0075431_100854608 | 3300006847 | Bacteria | 881 |
| 287 | Ga0075433_10145737 | 3300006852 | Bacteria | 2105 |
| 288 | Ga0075434_100072114 | 3300006871 | Bacteria | 3445 |
| 289 | Ga0075434_100655384 | 3300006871 | Bacteria | 1068 |
| 290 | Ga0068865_100002213 | 3300006881 | Bacteria | 11451 |
| 291 | Ga0075436_101151660 | 3300006914 | Unclassified | 585 |
| 292 | Ga0097620_100096573 | 3300006931 | Unclassified | 3007 |
| 293 | Ga0097620_100525784 | 3300006931 | Bacteria | 1278 |
| 294 | Ga0075435_100890253 | 3300007076 | Unclassified | 776 |
| 295 | Ga0075435_101178911 | 3300007076 | Bacteria | 670 |
| 296 | Ga0099795_10255076 | 3300007788 | Bacteria | 758 |
| 297 | Ga0105244_10076572 | 3300009036 | Bacteria | 1661 |
| 298 | Ga0105250_10021032 | 3300009092 | Bacteria | 2634 |
| 299 | Ga0105240_10175571 | 3300009093 | Bacteria | 2533 |
| 300 | Ga0105240_10205018 | 3300009093 | Bacteria | 2309 |
| 301 | Ga0105240_10222888 | 3300009093 | Bacteria | 2196 |
| 302 | Ga0105240_12104437 | 3300009093 | Bacteria | 586 |
| 303 | Ga0111539_10000114 | 3300009094 | Bacteria | 88757 |
| 304 | Ga0111539_10046475 | 3300009094 | Bacteria | 5192 |
| 305 | Ga0111539_10048105 | 3300009094 | Bacteria | 5094 |
| 306 | Ga0105245_10014117 | 3300009098 | Bacteria | 6959 |
| 307 | Ga0105245_10064510 | 3300009098 | Bacteria | 3310 |
| 308 | Ga0105245_11666629 | 3300009098 | Unclassified | 690 |
| 309 | Ga0105247_10004602 | 3300009101 | Bacteria | 8793 |
| 310 | Ga0105247_10124830 | 3300009101 | Unclassified | 1672 |
| 311 | Ga0105247_10766609 | 3300009101 | Unclassified | 733 |
| 312 | Ga0114129_10196645 | 3300009147 | Bacteria | 2734 |
| 313 | Ga0114129_10467764 | 3300009147 | Bacteria | 1652 |
| 314 | Ga0114129_11177876 | 3300009147 | Bacteria | 956 |
| 315 | Ga0105243_10017428 | 3300009148 | Bacteria | 5430 |
| 316 | Ga0105243_10068746 | 3300009148 | Bacteria | 2855 |
| 317 | Ga0105241_10007805 | 3300009174 | Bacteria | 7868 |
| 318 | Ga0105241_10174331 | 3300009174 | Bacteria | 1778 |
| 319 | Ga0105241_10967710 | 3300009174 | Bacteria | 794 |
| 320 | Ga0105242_10011497 | 3300009176 | Bacteria | 6805 |
| 321 | Ga0105242_10045137 | 3300009176 | Bacteria | 3570 |
| 322 | Ga0105242_10421769 | 3300009176 | Bacteria | 1250 |
| 323 | Ga0105248_10015424 | 3300009177 | Bacteria | 8423 |
| 324 | Ga0105248_10015952 | 3300009177 | Bacteria | 8273 |
| 325 | Ga0105248_10033034 | 3300009177 | Bacteria | 5779 |
| 326 | Ga0105248_11219054 | 3300009177 | Bacteria | 851 |
| 327 | Ga0105248_11677516 | 3300009177 | Unclassified | 720 |
| 328 | Ga0105237_10020483 | 3300009545 | Bacteria | 6814 |
| 329 | Ga0105238_10057443 | 3300009551 | Bacteria | 3901 |
| 330 | Ga0105238_10094621 | 3300009551 | Bacteria | 2975 |
| 331 | Ga0105249_10019102 | 3300009553 | Bacteria | 6113 |
| 332 | Ga0105249_10317131 | 3300009553 | Bacteria | 1569 |
| 333 | Ga0105249_10617774 | 3300009553 | Bacteria | 1139 |
| 334 | Ga0105239_10039524 | 3300010375 | Bacteria | 5169 |
| 335 | Ga0105239_10172932 | 3300010375 | Bacteria | 2416 |
| 336 | Ga0105239_10553397 | 3300010375 | Bacteria | 1310 |
| 337 | Ga0105246_10006910 | 3300011119 | Bacteria | 6943 |
| 338 | Ga0105246_10014551 | 3300011119 | Bacteria | 4949 |
| 339 | Ga0105246_12582018 | 3300011119 | Bacteria | 501 |
| 340 | Ga0157344_1003626 | 3300012476 | Unclassified | 881 |
| 341 | Ga0157335_1024583 | 3300012492 | Unclassified | 596 |
| 342 | Ga0157341_1010202 | 3300012494 | Unclassified | 794 |
| 343 | Ga0157319_1024004 | 3300012497 | Unclassified | 614 |
| 344 | Ga0157345_1008648 | 3300012498 | Unclassified | 855 |
| 345 | Ga0157347_1006947 | 3300012502 | Bacteria | 1119 |
| 346 | Ga0157313_1001104 | 3300012503 | Unclassified | 1397 |
| 347 | Ga0157342_1013783 | 3300012507 | Unclassified | 867 |
| 348 | Ga0157373_10112032 | 3300013100 | Bacteria | 1918 |
| 349 | Ga0157373_10264708 | 3300013100 | Bacteria | 1217 |
| 350 | Ga0157373_10334246 | 3300013100 | Bacteria | 1079 |
| 351 | Ga0157371_10100708 | 3300013102 | Bacteria | 2049 |
| 352 | Ga0157371_10116284 | 3300013102 | Bacteria | 1900 |
| 353 | Ga0157370_10230672 | 3300013104 | Bacteria | 1714 |
| 354 | Ga0157370_10246969 | 3300013104 | Bacteria | 1651 |
| 355 | Ga0157370_10293164 | 3300013104 | Bacteria | 1502 |
| 356 | Ga0157370_10421031 | 3300013104 | Bacteria | 1229 |
| 357 | Ga0157369_10051616 | 3300013105 | Bacteria | 4450 |
| 358 | Ga0157369_10711585 | 3300013105 | Bacteria | 1034 |
| 359 | Ga0157374_10039734 | 3300013296 | Bacteria | 4330 |
| 360 | Ga0157374_10148788 | 3300013296 | Bacteria | 2276 |
| 361 | Ga0157374_10771956 | 3300013296 | Unclassified | 976 |
| 362 | Ga0157378_10085000 | 3300013297 | Bacteria | 2866 |
| 363 | Ga0163162_10012152 | 3300013306 | Bacteria | 8405 |
| 364 | Ga0163162_10043605 | 3300013306 | Bacteria | 4492 |
| 365 | Ga0163162_10315316 | 3300013306 | Bacteria | 1696 |
| 366 | Ga0163162_10631073 | 3300013306 | Bacteria | 1196 |
| 367 | Ga0157372_10244952 | 3300013307 | Unclassified | 2080 |
| 368 | Ga0157375_10034225 | 3300013308 | Bacteria | 4838 |
| 369 | Ga0157375_10155208 | 3300013308 | Bacteria | 2427 |
| 370 | Ga0157375_10168269 | 3300013308 | Bacteria | 2338 |
| 371 | Ga0163163_10007836 | 3300014325 | Bacteria | 9443 |
| 372 | Ga0163163_10042146 | 3300014325 | Bacteria | 4469 |
| 373 | Ga0163163_10089185 | 3300014325 | Bacteria | 3096 |
| 374 | Ga0163163_11243048 | 3300014325 | Unclassified | 807 |
| 375 | Ga0163163_11255517 | 3300014325 | Bacteria | 803 |
| 376 | Ga0157380_10520404 | 3300014326 | Bacteria | 1160 |
| 377 | Ga0157380_10887660 | 3300014326 | Bacteria | 917 |
| 378 | Ga0157377_10005046 | 3300014745 | Bacteria | 6163 |
| 379 | Ga0157379_10001743 | 3300014968 | Bacteria | 17988 |
| 380 | Ga0157379_10184364 | 3300014968 | Bacteria | 1886 |
| 381 | Ga0157379_10515085 | 3300014968 | Bacteria | 1110 |
| 382 | Ga0157379_10635299 | 3300014968 | Bacteria | 998 |
| 383 | Ga0157379_11852688 | 3300014968 | Bacteria | 594 |
| 384 | Ga0157376_10004369 | 3300014969 | Bacteria | 9832 |
| 385 | Ga0157376_10805559 | 3300014969 | Bacteria | 952 |
| 386 | Ga0157376_11212177 | 3300014969 | Unclassified | 783 |
| 387 | Ga0182005_1097311 | 3300015265 | Bacteria | 822 |
| 388 | Ga0163161_10078100 | 3300017792 | Bacteria | 2433 |
| 389 | Ga0163161_10231698 | 3300017792 | Bacteria | 1433 |
| 390 | Ga0206356_10418905 | 3300020070 | Bacteria | 2138 |
| 391 | Ga0213872_10036087 | 3300021361 | Bacteria | 2260 |
| 392 | Ga0213874_10105697 | 3300021377 | Bacteria | 941 |
| 393 | Ga0213874_10274349 | 3300021377 | Bacteria | 628 |
| 394 | Ga0213876_10010724 | 3300021384 | Bacteria | 4911 |
| 395 | Ga0213876_10049608 | 3300021384 | Bacteria | 2218 |
| 396 | Ga0213876_10182100 | 3300021384 | Bacteria | 1117 |
| 397 | Ga0213875_10000074 | 3300021388 | Bacteria | 118349 |
| 398 | Ga0213875_10180071 | 3300021388 | Bacteria | 993 |
| 399 | Ga0209233_1004370 | 3300025261 | Bacteria | 4819 |
| 400 | Ga0207666_1000732 | 3300025271 | Bacteria | 3929 |
| 401 | Ga0207666_1000791 | 3300025271 | Bacteria | 3793 |
| 402 | Ga0209564_1000544 | 3300025295 | Bacteria | 60955 |
| 403 | Ga0209564_1016332 | 3300025295 | Bacteria | 2962 |
| 404 | Ga0209758_1000241 | 3300025297 | Bacteria | 113998 |
| 405 | Ga0209758_1002224 | 3300025297 | Bacteria | 20148 |
| 406 | Ga0209758_1023449 | 3300025297 | Bacteria | 2790 |
| 407 | Ga0207426_1073757 | 3300025302 | Bacteria | 943 |
| 408 | Ga0207697_10005124 | 3300025315 | Bacteria | 6132 |
| 409 | Ga0207697_10039255 | 3300025315 | Bacteria | 1942 |
| 410 | Ga0207653_10004024 | 3300025885 | Bacteria | 4625 |
| 411 | Ga0207682_10000071 | 3300025893 | Bacteria | 44843 |
| 412 | Ga0207692_10010941 | 3300025898 | Bacteria | 3841 |
| 413 | Ga0207692_10199649 | 3300025898 | Bacteria | 1175 |
| 414 | Ga0207692_10327005 | 3300025898 | Bacteria | 940 |
| 415 | Ga0207692_10895980 | 3300025898 | Bacteria | 583 |
| 416 | Ga0207642_10002908 | 3300025899 | Bacteria | 5359 |
| 417 | Ga0207710_10004664 | 3300025900 | Bacteria | 5948 |
| 418 | Ga0207710_10030042 | 3300025900 | Bacteria | 2368 |
| 419 | Ga0207688_10004331 | 3300025901 | Bacteria | 7735 |
| 420 | Ga0207688_10050355 | 3300025901 | Bacteria | 2331 |
| 421 | Ga0207680_10010064 | 3300025903 | Bacteria | 4717 |
| 422 | Ga0207680_10334991 | 3300025903 | Bacteria | 1060 |
| 423 | Ga0207647_10002565 | 3300025904 | Bacteria | 13740 |
| 424 | Ga0207647_10008867 | 3300025904 | Bacteria | 7175 |
| 425 | Ga0207685_10004209 | 3300025905 | Bacteria | 3623 |
| 426 | Ga0207685_10097188 | 3300025905 | Bacteria | 1252 |
| 427 | Ga0207699_10004429 | 3300025906 | Bacteria | 6713 |
| 428 | Ga0207699_10053415 | 3300025906 | Bacteria | 2395 |
| 429 | Ga0207699_10092009 | 3300025906 | Bacteria | 1906 |
| 430 | Ga0207645_10037724 | 3300025907 | Bacteria | 3101 |
| 431 | Ga0207643_10000276 | 3300025908 | Bacteria | 35671 |
| 432 | Ga0207705_10102516 | 3300025909 | Bacteria | 2106 |
| 433 | Ga0207705_10484475 | 3300025909 | Bacteria | 960 |
| 434 | Ga0207654_10004277 | 3300025911 | Bacteria | 7204 |
| 435 | Ga0207654_10061393 | 3300025911 | Bacteria | 2199 |
| 436 | Ga0207654_10285765 | 3300025911 | Bacteria | 1117 |
| 437 | Ga0207707_10012946 | 3300025912 | Bacteria | 7262 |
| 438 | Ga0207707_10066546 | 3300025912 | Bacteria | 3139 |
| 439 | Ga0207707_10099789 | 3300025912 | Bacteria | 2537 |
| 440 | Ga0207707_10248930 | 3300025912 | Bacteria | 1544 |
| 441 | Ga0207707_10288818 | 3300025912 | Bacteria | 1419 |
| 442 | Ga0207707_10407929 | 3300025912 | Bacteria | 1166 |
| 443 | Ga0207707_10499064 | 3300025912 | Bacteria | 1038 |
| 444 | Ga0207707_10792262 | 3300025912 | Bacteria | 790 |
| 445 | Ga0207695_10083002 | 3300025913 | Bacteria | 3238 |
| 446 | Ga0207695_10419864 | 3300025913 | Bacteria | 1222 |
| 447 | Ga0207671_10233919 | 3300025914 | Bacteria | 1442 |
| 448 | Ga0207693_10003341 | 3300025915 | Bacteria | 13731 |
| 449 | Ga0207693_10033429 | 3300025915 | Bacteria | 4059 |
| 450 | Ga0207693_10229718 | 3300025915 | Bacteria | 1457 |
| 451 | Ga0207693_10297135 | 3300025915 | Bacteria | 1265 |
| 452 | Ga0207693_10411522 | 3300025915 | Bacteria | 1057 |
| 453 | Ga0207693_10524969 | 3300025915 | Bacteria | 924 |
| 454 | Ga0207693_10815645 | 3300025915 | Bacteria | 719 |
| 455 | Ga0207663_10078055 | 3300025916 | Bacteria | 2157 |
| 456 | Ga0207663_10112407 | 3300025916 | Bacteria | 1850 |
| 457 | Ga0207663_10148579 | 3300025916 | Bacteria | 1641 |
| 458 | Ga0207663_10504720 | 3300025916 | Bacteria | 940 |
| 459 | Ga0207663_10700974 | 3300025916 | Bacteria | 802 |
| 460 | Ga0207660_10000087 | 3300025917 | Bacteria | 49552 |
| 461 | Ga0207660_10031348 | 3300025917 | Bacteria | 3660 |
| 462 | Ga0207660_10032118 | 3300025917 | Bacteria | 3621 |
| 463 | Ga0207660_10150054 | 3300025917 | Bacteria | 1790 |
| 464 | Ga0207660_10168553 | 3300025917 | Bacteria | 1694 |
| 465 | Ga0207660_10862448 | 3300025917 | Bacteria | 739 |
| 466 | Ga0207662_10095222 | 3300025918 | Bacteria | 1837 |
| 467 | Ga0207657_10009053 | 3300025919 | Bacteria | 10053 |
| 468 | Ga0207657_10019619 | 3300025919 | Bacteria | 6412 |
| 469 | Ga0207657_10042193 | 3300025919 | Bacteria | 4027 |
| 470 | Ga0207657_10047331 | 3300025919 | Bacteria | 3761 |
| 471 | Ga0207657_10048561 | 3300025919 | Bacteria | 3705 |
| 472 | Ga0207649_10002302 | 3300025920 | Bacteria | 10744 |
| 473 | Ga0207649_10360715 | 3300025920 | Bacteria | 1078 |
| 474 | Ga0207649_10499333 | 3300025920 | Bacteria | 925 |
| 475 | Ga0207652_10014976 | 3300025921 | Bacteria | 6291 |
| 476 | Ga0207652_10034741 | 3300025921 | Bacteria | 4251 |
| 477 | Ga0207652_10119706 | 3300025921 | Bacteria | 2342 |
| 478 | Ga0207652_10142060 | 3300025921 | Bacteria | 2147 |
| 479 | Ga0207652_10149856 | 3300025921 | Bacteria | 2088 |
| 480 | Ga0207652_10163291 | 3300025921 | Bacteria | 1997 |
| 481 | Ga0207652_10242651 | 3300025921 | Bacteria | 1624 |
| 482 | Ga0207652_10274304 | 3300025921 | Bacteria | 1521 |
| 483 | Ga0207681_10002160 | 3300025923 | Bacteria | 12529 |
| 484 | Ga0207681_10039030 | 3300025923 | Bacteria | 3150 |
| 485 | Ga0207681_10072458 | 3300025923 | Bacteria | 2406 |
| 486 | Ga0207694_10012607 | 3300025924 | Bacteria | 6371 |
| 487 | Ga0207694_10116921 | 3300025924 | Bacteria | 2125 |
| 488 | Ga0207650_10019228 | 3300025925 | Bacteria | 4797 |
| 489 | Ga0207650_10712331 | 3300025925 | Unclassified | 848 |
| 490 | Ga0207659_10001604 | 3300025926 | Bacteria | 13419 |
| 491 | Ga0207659_10215754 | 3300025926 | Bacteria | 1540 |
| 492 | Ga0207687_10038314 | 3300025927 | Bacteria | 3276 |
| 493 | Ga0207687_10552116 | 3300025927 | Bacteria | 967 |
| 494 | Ga0207700_10044269 | 3300025928 | Bacteria | 3275 |
| 495 | Ga0207700_10245931 | 3300025928 | Bacteria | 1526 |
| 496 | Ga0207700_10685985 | 3300025928 | Bacteria | 914 |
| 497 | Ga0207664_10029948 | 3300025929 | Bacteria | 4152 |
| 498 | Ga0207664_10075575 | 3300025929 | Bacteria | 2724 |
| 499 | Ga0207664_10226888 | 3300025929 | Bacteria | 1622 |
| 500 | Ga0207664_10240895 | 3300025929 | Bacteria | 1575 |
| 501 | Ga0207664_10578297 | 3300025929 | Bacteria | 1008 |
| 502 | Ga0207644_10009341 | 3300025931 | Bacteria | 6440 |
| 503 | Ga0207644_10048605 | 3300025931 | Bacteria | 3034 |
| 504 | Ga0207644_10842020 | 3300025931 | Bacteria | 768 |
| 505 | Ga0207690_10007427 | 3300025932 | Bacteria | 6506 |
| 506 | Ga0207690_10223308 | 3300025932 | Bacteria | 1442 |
| 507 | Ga0207690_10366720 | 3300025932 | Bacteria | 1142 |
| 508 | Ga0207706_10006428 | 3300025933 | Bacteria | 10915 |
| 509 | Ga0207706_10065125 | 3300025933 | Bacteria | 3209 |
| 510 | Ga0207686_10002664 | 3300025934 | Bacteria | 9686 |
| 511 | Ga0207686_10033863 | 3300025934 | Bacteria | 3052 |
| 512 | Ga0207709_10004315 | 3300025935 | Bacteria | 8237 |
| 513 | Ga0207709_10148526 | 3300025935 | Bacteria | 1620 |
| 514 | Ga0207709_10209918 | 3300025935 | Bacteria | 1397 |
| 515 | Ga0207709_11003067 | 3300025935 | Bacteria | 682 |
| 516 | Ga0207670_10000486 | 3300025936 | Bacteria | 21952 |
| 517 | Ga0207670_10000886 | 3300025936 | Bacteria | 15786 |
| 518 | Ga0207670_10054370 | 3300025936 | Bacteria | 2701 |
| 519 | Ga0207670_10118200 | 3300025936 | Bacteria | 1922 |
| 520 | Ga0207670_11471753 | 3300025936 | Bacteria | 579 |
| 521 | Ga0207669_10018860 | 3300025937 | Bacteria | 3578 |
| 522 | Ga0207669_10236375 | 3300025937 | Bacteria | 1352 |
| 523 | Ga0207669_10649893 | 3300025937 | Unclassified | 862 |
| 524 | Ga0207704_10025289 | 3300025938 | Bacteria | 3236 |
| 525 | Ga0207704_10308701 | 3300025938 | Bacteria | 1215 |
| 526 | Ga0207665_10124325 | 3300025939 | Bacteria | 1825 |
| 527 | Ga0207665_10161578 | 3300025939 | Bacteria | 1612 |
| 528 | Ga0207665_10161603 | 3300025939 | Bacteria | 1611 |
| 529 | Ga0207665_10620394 | 3300025939 | Bacteria | 846 |
| 530 | Ga0207691_10007048 | 3300025940 | Bacteria | 10845 |
| 531 | Ga0207691_10856808 | 3300025940 | Bacteria | 762 |
| 532 | Ga0207711_10099289 | 3300025941 | Bacteria | 2573 |
| 533 | Ga0207711_10121039 | 3300025941 | Bacteria | 2336 |
| 534 | Ga0207689_10008107 | 3300025942 | Bacteria | 9162 |
| 535 | Ga0207661_10008272 | 3300025944 | Bacteria | 7432 |
| 536 | Ga0207661_10105082 | 3300025944 | Bacteria | 2379 |
| 537 | Ga0207661_10907086 | 3300025944 | Bacteria | 811 |
| 538 | Ga0207679_10000131 | 3300025945 | Bacteria | 61363 |
| 539 | Ga0207679_10309521 | 3300025945 | Bacteria | 1364 |
| 540 | Ga0207679_10658481 | 3300025945 | Bacteria | 948 |
| 541 | Ga0207667_10056364 | 3300025949 | Bacteria | 4128 |
| 542 | Ga0207667_10066210 | 3300025949 | Bacteria | 3766 |
| 543 | Ga0207667_10076624 | 3300025949 | Bacteria | 3470 |
| 544 | Ga0207667_11104269 | 3300025949 | Bacteria | 776 |
| 545 | Ga0207651_10001949 | 3300025960 | Bacteria | 9701 |
| 546 | Ga0207651_10358402 | 3300025960 | Bacteria | 1230 |
| 547 | Ga0207712_10023188 | 3300025961 | Bacteria | 4094 |
| 548 | Ga0207712_10369772 | 3300025961 | Bacteria | 1197 |
| 549 | Ga0207668_10000655 | 3300025972 | Bacteria | 21225 |
| 550 | Ga0207668_10137107 | 3300025972 | Bacteria | 1876 |
| 551 | Ga0207668_10232112 | 3300025972 | Bacteria | 1488 |
| 552 | Ga0207640_10032911 | 3300025981 | Bacteria | 3219 |
| 553 | Ga0207640_10370960 | 3300025981 | Bacteria | 1156 |
| 554 | Ga0207658_10018697 | 3300025986 | Bacteria | 4790 |
| 555 | Ga0207658_10336803 | 3300025986 | Bacteria | 1310 |
| 556 | Ga0207658_10476519 | 3300025986 | Bacteria | 1108 |
| 557 | Ga0207677_10003214 | 3300026023 | Bacteria | 8618 |
| 558 | Ga0207677_10059304 | 3300026023 | Bacteria | 2639 |
| 559 | Ga0207703_10003628 | 3300026035 | Bacteria | 12867 |
| 560 | Ga0207703_10045633 | 3300026035 | Bacteria | 3526 |
| 561 | Ga0207703_10052993 | 3300026035 | Bacteria | 3297 |
| 562 | Ga0207639_10006126 | 3300026041 | Bacteria | 8163 |
| 563 | Ga0207639_10039853 | 3300026041 | Bacteria | 3503 |
| 564 | Ga0207639_11028744 | 3300026041 | Bacteria | 772 |
| 565 | Ga0207678_10004081 | 3300026067 | Bacteria | 13135 |
| 566 | Ga0207678_10058646 | 3300026067 | Bacteria | 3312 |
| 567 | Ga0207678_10515794 | 3300026067 | Bacteria | 1043 |
| 568 | Ga0207708_10005844 | 3300026075 | Bacteria | 9104 |
| 569 | Ga0207708_10010299 | 3300026075 | Bacteria | 6943 |
| 570 | Ga0207708_10940798 | 3300026075 | Unclassified | 749 |
| 571 | Ga0207702_10003322 | 3300026078 | Bacteria | 14778 |
| 572 | Ga0207702_10054857 | 3300026078 | Bacteria | 3378 |
| 573 | Ga0207702_10269679 | 3300026078 | Bacteria | 1605 |
| 574 | Ga0207702_11348262 | 3300026078 | Bacteria | 707 |
| 575 | Ga0207641_10001577 | 3300026088 | Bacteria | 22260 |
| 576 | Ga0207648_10190350 | 3300026089 | Bacteria | 1818 |
| 577 | Ga0207648_10774664 | 3300026089 | Bacteria | 892 |
| 578 | Ga0207676_10001374 | 3300026095 | Bacteria | 18087 |
| 579 | Ga0207676_10005788 | 3300026095 | Bacteria | 8741 |
| 580 | Ga0207674_10036528 | 3300026116 | Bacteria | 5116 |
| 581 | Ga0207674_10084893 | 3300026116 | Bacteria | 3163 |
| 582 | Ga0207674_10418858 | 3300026116 | Bacteria | 1294 |
| 583 | Ga0207675_100004272 | 3300026118 | Bacteria | 13806 |
| 584 | Ga0207675_100163461 | 3300026118 | Bacteria | 2125 |
| 585 | Ga0207683_10018680 | 3300026121 | Bacteria | 5915 |
| 586 | Ga0207683_10091160 | 3300026121 | Bacteria | 2715 |
| 587 | Ga0207698_10082289 | 3300026142 | Bacteria | 2602 |
| 588 | Ga0207698_10123944 | 3300026142 | Bacteria | 2193 |
| 589 | Ga0207698_10221202 | 3300026142 | Bacteria | 1711 |
| 590 | Ga0207698_10262304 | 3300026142 | Bacteria | 1588 |
| 591 | Ga0209969_1018346 | 3300027360 | Bacteria | 1034 |
| 592 | Ga0209981_1017743 | 3300027378 | Bacteria | 1006 |
| 593 | Ga0209984_1009741 | 3300027424 | Bacteria | 1225 |
| 594 | Ga0209999_1003958 | 3300027543 | Bacteria | 2667 |
| 595 | Ga0210002_1034988 | 3300027617 | Bacteria | 843 |
| 596 | Ga0209983_1002977 | 3300027665 | Bacteria | 3657 |
| 597 | Ga0209971_1020904 | 3300027682 | Bacteria | 1557 |
| 598 | Ga0209966_1001582 | 3300027695 | Bacteria | 3915 |
| 599 | Ga0209998_10001451 | 3300027717 | Bacteria | 5728 |
| 600 | Ga0209998_10002203 | 3300027717 | Bacteria | 4517 |
| 601 | Ga0207428_10000255 | 3300027907 | Bacteria | 72962 |
| 602 | Ga0207428_10008215 | 3300027907 | Bacteria | 9439 |
| 603 | Ga0207428_10066577 | 3300027907 | Bacteria | 2838 |
| 604 | Ga0268266_10182841 | 3300028379 | Bacteria | 1910 |
| 605 | Ga0268266_10441550 | 3300028379 | Bacteria | 1236 |
| 606 | Ga0268266_10536683 | 3300028379 | Bacteria | 1120 |
| 607 | Ga0268266_10617949 | 3300028379 | Bacteria | 1041 |
| 608 | Ga0268266_11074836 | 3300028379 | Bacteria | 779 |
| 609 | Ga0268266_11311795 | 3300028379 | Bacteria | 699 |
| 610 | Ga0268265_10001553 | 3300028380 | Bacteria | 19032 |
| 611 | Ga0268265_10599609 | 3300028380 | Bacteria | 1052 |
| 612 | Ga0268264_10182973 | 3300028381 | Bacteria | 1905 |
| 613 | Ga0268264_10552344 | 3300028381 | Bacteria | 1129 |
| 614 | Ga0268264_10560450 | 3300028381 | Bacteria | 1122 |
| 615 | Ga0265338_10052834 | 3300028800 | Bacteria | 3641 |
| 616 | Ga0265338_10203324 | 3300028800 | Bacteria | 1492 |
| 617 | Ga0265330_10068599 | 3300031235 | Bacteria | 1535 |
| 618 | Ga0265320_10035321 | 3300031240 | Bacteria | 2535 |
| 619 | Ga0265325_10038950 | 3300031241 | Bacteria | 2506 |
| 620 | Ga0265325_10052164 | 3300031241 | Bacteria | 2101 |
| 621 | Ga0265325_10068906 | 3300031241 | Bacteria | 1780 |
| 622 | Ga0265325_10176622 | 3300031241 | Bacteria | 996 |
| 623 | Ga0265329_10007181 | 3300031242 | Bacteria | 4334 |
| 624 | Ga0265329_10035980 | 3300031242 | Bacteria | 1598 |
| 625 | Ga0265340_10068129 | 3300031247 | Bacteria | 1690 |
| 626 | Ga0265340_10071067 | 3300031247 | Bacteria | 1650 |
| 627 | Ga0265340_10152576 | 3300031247 | Bacteria | 1052 |
| 628 | Ga0265339_10041296 | 3300031249 | Bacteria | 2562 |
| 629 | Ga0265339_10139913 | 3300031249 | Bacteria | 1232 |
| 630 | Ga0265316_10051052 | 3300031344 | Bacteria | 3250 |
| 631 | Ga0265316_10524679 | 3300031344 | Bacteria | 844 |
| 632 | Ga0265313_10156634 | 3300031595 | Bacteria | 970 |
| 633 | Ga0265313_10237970 | 3300031595 | Bacteria | 746 |
| 634 | Ga0316575_10032856 | 3300031665 | Bacteria | 2034 |
| 635 | Ga0316575_10037815 | 3300031665 | Bacteria | 1902 |
| 636 | Ga0316579_10001599 | 3300031691 | Bacteria | 8284 |
| 637 | Ga0265314_10000672 | 3300031711 | Bacteria | 41774 |
| 638 | Ga0265342_10017835 | 3300031712 | Bacteria | 4609 |
| 639 | Ga0265342_10019701 | 3300031712 | Bacteria | 4343 |
| 640 | Ga0265342_10307568 | 3300031712 | Unclassified | 833 |
| 641 | Ga0307406_10866612 | 3300031901 | Bacteria | 767 |
| 642 | Ga0307412_10903371 | 3300031911 | Unclassified | 774 |
| 643 | Ga0307409_100534704 | 3300031995 | Bacteria | 1148 |
| 644 | Ga0307411_10321237 | 3300032005 | Bacteria | 1250 |
| 645 | Ga0316583_10061899 | 3300032133 | Bacteria | 1311 |
| 646 | Ga0373930_0000252 | 3300034816 | Bacteria | 6822 |
| 647 | Ga0373948_0000821 | 3300034817 | Bacteria | 4102 |
| 648 | Ga0373948_0021352 | 3300034817 | Bacteria | 1239 |
| 649 | Ga0373950_0000200 | 3300034818 | Bacteria | 8183 |
| 650 | Ga0373950_0005708 | 3300034818 | Bacteria | 1867 |
| 651 | Ga0373958_0000159 | 3300034819 | Bacteria | 7683 |
| 652 | Ga0373958_0002164 | 3300034819 | Bacteria | 2724 |
| 653 | Ga0373959_0004470 | 3300034820 | Unclassified | 2256 |
| 654 | Ga0373938_0000096 | 3300034957 | Bacteria | 11910 |
| 655 | Ga0373926_0032602 | 3300035083 | Bacteria | 1838 |
| 656 | Ga0373928_0000443 | 3300035084 | Bacteria | 8179 |
| 657 | Ga0373928_0122920 | 3300035084 | Unclassified | 697 |
| 658 | Ga0373929_0000756 | 3300035085 | Bacteria | 6285 |
| 659 | Ga0373940_0000018 | 3300035088 | Bacteria | 19361 |
| 660 | Ga0373944_0048607 | 3300035089 | Unclassified | 1331 |
| 661 | Ga0373949_0000862 | 3300035090 | Bacteria | 9571 |
| 662 | Ga0373949_0005361 | 3300035090 | Bacteria | 2861 |
| 663 | Ga0373951_0000154 | 3300035091 | Bacteria | 25002 |
| 664 | Ga0373951_0075387 | 3300035091 | Unclassified | 865 |
| 665 | Ga0373952_0000790 | 3300035092 | Bacteria | 5689 |
| 666 | Ga0373952_0001040 | 3300035092 | Bacteria | 5060 |
| 667 | Ga0373952_0020743 | 3300035092 | Bacteria | 1380 |
| 668 | Ga0373932_0000155 | 3300035112 | Bacteria | 19871 |
| 669 | Ga0373932_0017117 | 3300035112 | Bacteria | 1857 |
| 670 | Ga0373936_0014185 | 3300035113 | Bacteria | 3044 |
| 671 | Ga0373939_0003369 | 3300035114 | Bacteria | 3751 |
| 672 | Ga0373941_0086549 | 3300035115 | Unclassified | 1067 |
| 673 | Ga0373945_0068147 | 3300035116 | Bacteria | 1341 |
| 674 | Ga0373953_0005812 | 3300035117 | Bacteria | 4033 |
| 675 | Ga0373953_0006532 | 3300035117 | Bacteria | 3849 |
| 676 | Ga0373954_0006933 | 3300035118 | Bacteria | 4946 |
| 677 | Ga0373956_0042945 | 3300035119 | Bacteria | 2011 |
| 678 | Ga0373956_0056820 | 3300035119 | Bacteria | 1767 |
| 679 | Ga0373956_0266313 | 3300035119 | Bacteria | 815 |
| 680 | Ga0373957_0003837 | 3300035120 | Bacteria | 4509 |
| 681 | Ga0373957_0156575 | 3300035120 | Bacteria | 937 |
| 682 | Ga0373960_0000061 | 3300035121 | Bacteria | 14957 |
| 683 | Ga0373960_0029818 | 3300035121 | Bacteria | 1515 |
| 684 | Ga0373943_0045452 | 3300035170 | Bacteria | 2140 |
| 685 | Ga0373943_0266959 | 3300035170 | Bacteria | 964 |
| 686 | Ga0373943_0273836 | 3300035170 | Bacteria | 953 |
| 687 | Ga0373946_0015814 | 3300035171 | Bacteria | 2867 |
| 688 | Ga0373955_0000212 | 3300035172 | Bacteria | 24331 |
| 689 | Ga0373955_0222778 | 3300035172 | Bacteria | 1127 |
| 690 | Ga0373942_0000537 | 3300035207 | Bacteria | 10631 |
| 691 | Ga0373961_0000451 | 3300035241 | Bacteria | 16466 |
| 692 | Ga0373961_0004512 | 3300035241 | Bacteria | 3366 |
| 693 | Ga0373962_0001266 | 3300035242 | Bacteria | 5937 |
| 694 | Ga0373924_0018323 | 3300035410 | Bacteria | 2696 |
| 695 | Ga0373931_0000170 | 3300035691 | Bacteria | 28307 |
| 696 | Ga0373931_0005509 | 3300035691 | Bacteria | 5864 |
| 697 | Ga0373931_0035713 | 3300035691 | Bacteria | 2586 |
| 698 | Ga0373931_0092975 | 3300035691 | Bacteria | 1683 |
| 699 | Ga0373935_0159986 | 3300035692 | Bacteria | 1534 |
| 700 | Ga0373927_0002017 | 3300035695 | Bacteria | 14958 |
| 701 | Ga0373927_0156923 | 3300035695 | Bacteria | 1490 |
| 702 | Ga0373927_0354286 | 3300035695 | Bacteria | 967 |
| 703 | Ga0373933_0005386 | 3300035724 | Bacteria | 6966 |
| 704 | Ga0373933_0013093 | 3300035724 | Bacteria | 4593 |
| 705 | Ga0373947_0028888 | 3300035725 | Bacteria | 3252 |
| 706 | Ga0373947_0037363 | 3300035725 | Bacteria | 2882 |
| 707 | Ga0373947_0037922 | 3300035725 | Bacteria | 2860 |
| 708 | Ga0373937_0008093 | 3300036401 | Bacteria | 9127 |
| 709 | Ga0373937_0032624 | 3300036401 | Bacteria | 4724 |
| 710 | Ga0373937_0158761 | 3300036401 | Bacteria | 2120 |
| 711 | Ga0373925_0004980 | 3300037068 | Bacteria | 9973 |
| 712 | Ga0373925_0149804 | 3300037068 | Bacteria | 1831 |
| 713 | Ga0395899_0004968 | 3300037312 | Bacteria | 10348 |
| 714 | Ga0395899_0016270 | 3300037312 | Bacteria | 5670 |
| 715 | Ga0395900_0007564 | 3300037418 | Bacteria | 11218 |
| 716 | Ga0395900_0247416 | 3300037418 | Unclassified | 1785 |
| 717 | Ga0395900_0306301 | 3300037418 | Bacteria | 1573 |
| 718 | Ga0395900_0510748 | 3300037418 | Bacteria | 1151 |
| 719 | Ga0395898_0007267 | 3300037466 | Bacteria | 11758 |
| 720 | Ga0395898_0039336 | 3300037466 | Bacteria | 4681 |
| 721 | Ga0395898_0058851 | 3300037466 | Bacteria | 3740 |
| 722 | Ga0436364_0454045 | 3300037853 | Bacteria | 1304 |
| 723 | Ga0436364_0708558 | 3300037853 | Bacteria | 7665 |
| 724 | Ga0395901_0021099 | 3300038443 | Bacteria | 6674 |
| 725 | Ga0395901_0028444 | 3300038443 | Bacteria | 5748 |
| 726 | Ga0395901_0147318 | 3300038443 | Bacteria | 2474 |
| 727 | Ga0242420_016608 | 3300038996 | Unclassified | 1283 |
| 728 | Ga0436365_0097464 | 3300039437 | Bacteria | 3738 |
| 729 | Ga0436365_0217897 | 3300039437 | Bacteria | 871 |
| 730 | Ga0436365_0484144 | 3300039437 | Bacteria | 3695 |
| 731 | Ga0436365_0932459 | 3300039437 | Bacteria | 27077 |
| 732 | Ga0436365_1459828 | 3300039437 | Bacteria | 5750 |
| 733 | Ga0436365_1674422 | 3300039437 | Bacteria | 918 |
| 734 | Ga0436365_1717450 | 3300039437 | Bacteria | 1426 |
| 735 | Ga0436365_1804874 | 3300039437 | Bacteria | 4035 |
| 736 | Ga0436360_1161303 | 3300039438 | Bacteria | 1428 |
| 737 | Ga0436361_0531564 | 3300039447 | Bacteria | 3274 |
| 738 | Ga0436361_0575185 | 3300039447 | Bacteria | 1212 |
| 739 | Ga0436361_0713927 | 3300039447 | Bacteria | 2271 |
| 740 | Ga0436361_0912045 | 3300039447 | Bacteria | 877 |
| 741 | Ga0436363_0552664 | 3300039450 | Bacteria | 1053 |
| 742 | Ga0436363_0781422 | 3300039450 | Bacteria | 2462 |
| 743 | Ga0436362_0529917 | 3300039453 | Bacteria | 639 |
| 744 | Ga0436362_0640430 | 3300039453 | Bacteria | 643 |
| 745 | Ga0436362_0900768 | 3300039453 | Bacteria | 1803 |
| 746 | Ga0439453_0118227 | 3300041408 | Bacteria | 605 |
| 747 | Ga0451795_0516035 | 3300041456 | Bacteria | 846 |
| 748 | Ga0439455_0012465 | 3300042012 | Bacteria | 1910 |
| 749 | Ga0450903_071042 | 3300042138 | Bacteria | 503 |
| 750 | Ga0439464_0010836 | 3300042439 | Bacteria | 2410 |
| 751 | Ga0451577_0028715 | 3300042876 | Bacteria | 5030 |
| 752 | Ga0453683_0200606 | 3300044673 | Unclassified | 1267 |
| 753 | Ga0466966_0087561 | 3300044684 | Bacteria | 1935 |
| 754 | Ga0466963_0574791 | 3300044694 | Bacteria | 796 |
| 755 | Ga0466963_0817932 | 3300044694 | Bacteria | 657 |
| 756 | Ga0453684_0545859 | 3300044712 | Bacteria | 1277 |
| 757 | Ga0466971_0177815 | 3300044719 | Bacteria | 1000 |
| 758 | Ga0466971_0202491 | 3300044719 | Bacteria | 937 |
| 759 | Ga0466957_0060008 | 3300044842 | Bacteria | 2332 |
| 760 | Ga0466957_0110387 | 3300044842 | Bacteria | 1743 |
| 761 | Ga0451576_0096377 | 3300045051 | Bacteria | 3077 |
| 762 | Ga0466958_0074137 | 3300045836 | Bacteria | 2085 |
| 763 | Ga0466958_0207992 | 3300045836 | Bacteria | 1246 |
| 764 | Ga0466967_1157226 | 3300045976 | Bacteria | 771 |
| 765 | Ga0495617_036246 | 3300046452 | Bacteria | 1654 |
| 766 | Ga0495592_0011627 | 3300046454 | Bacteria | 6666 |
| 767 | Ga0495592_0028916 | 3300046454 | Bacteria | 4195 |
| 768 | Ga0495592_0053248 | 3300046454 | Bacteria | 3002 |
| 769 | Ga0495603_0132259 | 3300046455 | Bacteria | 1452 |
| 770 | Ga0495629_0005121 | 3300046459 | Bacteria | 9800 |
| 771 | Ga0495629_0088382 | 3300046459 | Bacteria | 2161 |
| 772 | Ga0495629_0172031 | 3300046459 | Bacteria | 1503 |
| 773 | Ga0495638_0008737 | 3300046460 | Bacteria | 7158 |
| 774 | Ga0495638_0420974 | 3300046460 | Bacteria | 688 |
| 775 | Ga0495641_0006685 | 3300046461 | Bacteria | 7409 |
| 776 | Ga0495641_0090630 | 3300046461 | Unclassified | 1366 |
| 777 | Ga0495641_0338412 | 3300046461 | Bacteria | 680 |
| 778 | Ga0495651_0002175 | 3300046462 | Bacteria | 15159 |
| 779 | Ga0495651_0027032 | 3300046462 | Bacteria | 4468 |
| 780 | Ga0495651_0084734 | 3300046462 | Bacteria | 2388 |
| 781 | Ga0495651_0100174 | 3300046462 | Bacteria | 2159 |
| 782 | Ga0495651_0202887 | 3300046462 | Bacteria | 1386 |
| 783 | Ga0495653_0001102 | 3300046463 | Bacteria | 20835 |
| 784 | Ga0495653_0002883 | 3300046463 | Bacteria | 13751 |
| 785 | Ga0495653_0385293 | 3300046463 | Bacteria | 894 |
| 786 | Ga0495580_0012507 | 3300046472 | Bacteria | 6507 |
| 787 | Ga0495580_0294642 | 3300046472 | Bacteria | 1105 |
| 788 | Ga0495582_0149102 | 3300046473 | Bacteria | 1327 |
| 789 | Ga0495605_0073936 | 3300046474 | Bacteria | 1605 |
| 790 | Ga0495639_0000713 | 3300046475 | Bacteria | 15217 |
| 791 | Ga0495639_0156531 | 3300046475 | Bacteria | 1101 |
| 792 | Ga0495662_0000084 | 3300046476 | Bacteria | 33781 |
| 793 | Ga0495662_0013240 | 3300046476 | Bacteria | 4015 |
| 794 | Ga0495662_0148524 | 3300046476 | Bacteria | 1154 |
| 795 | Ga0495664_0065939 | 3300046477 | Bacteria | 2159 |
| 796 | Ga0495584_0063809 | 3300046491 | Bacteria | 1852 |
| 797 | Ga0495584_0188752 | 3300046491 | Bacteria | 1047 |
| 798 | Ga0495584_0195232 | 3300046491 | Bacteria | 1029 |
| 799 | Ga0495585_0004511 | 3300046492 | Bacteria | 9020 |
| 800 | Ga0495585_0279205 | 3300046492 | Bacteria | 826 |
| 801 | Ga0495594_0013840 | 3300046499 | Bacteria | 4218 |
| 802 | Ga0495594_0090706 | 3300046499 | Bacteria | 1712 |
| 803 | Ga0495607_0038927 | 3300046501 | Bacteria | 2844 |
| 804 | Ga0495607_0074547 | 3300046501 | Bacteria | 1883 |
| 805 | Ga0495607_0351159 | 3300046501 | Unclassified | 681 |
| 806 | Ga0495606_0290416 | 3300046507 | Bacteria | 890 |
| 807 | Ga0495608_0023449 | 3300046511 | Bacteria | 4229 |
| 808 | Ga0495610_0132570 | 3300046512 | Bacteria | 1080 |
| 809 | Ga0495618_0001557 | 3300046514 | Bacteria | 15382 |
| 810 | Ga0495618_0007354 | 3300046514 | Bacteria | 6663 |
| 811 | Ga0495618_0157467 | 3300046514 | Unclassified | 1449 |
| 812 | Ga0495620_0055096 | 3300046515 | Bacteria | 1677 |
| 813 | Ga0495628_0007423 | 3300046516 | Bacteria | 9490 |
| 814 | Ga0495628_0013822 | 3300046516 | Bacteria | 6784 |
| 815 | Ga0495628_0466872 | 3300046516 | Bacteria | 915 |
| 816 | Ga0495628_0482464 | 3300046516 | Bacteria | 897 |
| 817 | Ga0495630_0004290 | 3300046517 | Bacteria | 10001 |
| 818 | Ga0495630_0006498 | 3300046517 | Bacteria | 8324 |
| 819 | Ga0495630_0068369 | 3300046517 | Bacteria | 2671 |
| 820 | Ga0495630_0266749 | 3300046517 | Unclassified | 1308 |
| 821 | Ga0495631_0072338 | 3300046518 | Bacteria | 1489 |
| 822 | Ga0495632_0102658 | 3300046519 | Bacteria | 1347 |
| 823 | Ga0495637_0048540 | 3300046520 | Bacteria | 1787 |
| 824 | Ga0495643_0038796 | 3300046522 | Bacteria | 2607 |
| 825 | Ga0495648_0052445 | 3300046524 | Bacteria | 2477 |
| 826 | Ga0495666_0041063 | 3300046526 | Bacteria | 2241 |
| 827 | Ga0495666_0090252 | 3300046526 | Bacteria | 1446 |
| 828 | Ga0495652_0001261 | 3300046529 | Bacteria | 28344 |
| 829 | Ga0495652_0007683 | 3300046529 | Bacteria | 9928 |
| 830 | Ga0495652_0013229 | 3300046529 | Bacteria | 7428 |
| 831 | Ga0495652_0360747 | 3300046529 | Bacteria | 1038 |
| 832 | Ga0495654_0121103 | 3300046530 | Bacteria | 1184 |
| 833 | Ga0495665_0000743 | 3300046531 | Bacteria | 16866 |
| 834 | Ga0495665_0090895 | 3300046531 | Bacteria | 1604 |
| 835 | Ga0495665_0113550 | 3300046531 | Unclassified | 1420 |
| 836 | Ga0495640_0005554 | 3300046533 | Bacteria | 10026 |
| 837 | Ga0495640_0043559 | 3300046533 | Bacteria | 3124 |
| 838 | Ga0495640_0049550 | 3300046533 | Bacteria | 2895 |
| 839 | Ga0495640_0612999 | 3300046533 | Bacteria | 657 |
| 840 | Ga0495586_0099064 | 3300046535 | Bacteria | 1616 |
| 841 | Ga0495587_0002605 | 3300046536 | Bacteria | 12041 |
| 842 | Ga0495587_0019419 | 3300046536 | Bacteria | 4206 |
| 843 | Ga0495645_0005294 | 3300046543 | Bacteria | 8838 |
| 844 | Ga0495645_0211428 | 3300046543 | Bacteria | 1309 |
| 845 | Ga0495645_0356329 | 3300046543 | Bacteria | 941 |
| 846 | Ga0495633_0005344 | 3300046558 | Bacteria | 7875 |
| 847 | Ga0495633_0197438 | 3300046558 | Bacteria | 924 |
| 848 | Ga0495667_0000202 | 3300046559 | Bacteria | 40046 |
| 849 | Ga0495667_0000827 | 3300046559 | Bacteria | 19976 |
| 850 | Ga0495667_0008926 | 3300046559 | Bacteria | 6815 |
| 851 | Ga0495667_0286141 | 3300046559 | Bacteria | 1046 |
| 852 | Ga0495656_0030187 | 3300046615 | Bacteria | 2189 |
| 853 | Ga0495668_0107180 | 3300046616 | Bacteria | 1528 |
| 854 | Ga0495634_0005317 | 3300046642 | Bacteria | 9928 |
| 855 | Ga0495634_0093995 | 3300046642 | Bacteria | 1944 |
| 856 | Ga0495634_0274851 | 3300046642 | Bacteria | 1024 |
| 857 | Ga0495611_0046030 | 3300046648 | Bacteria | 1955 |
| 858 | Ga0495635_0000399 | 3300046663 | Bacteria | 27531 |
| 859 | Ga0495635_0003939 | 3300046663 | Bacteria | 10325 |
| 860 | Ga0495635_0071566 | 3300046663 | Bacteria | 2377 |
| 861 | Ga0495635_0214234 | 3300046663 | Unclassified | 1304 |
| 862 | Ga0495635_0219767 | 3300046663 | Unclassified | 1285 |
| 863 | Ga0495661_0077892 | 3300046665 | Bacteria | 1919 |
| 864 | Ga0495661_0163713 | 3300046665 | Bacteria | 1192 |
| 865 | Ga0495588_0004780 | 3300046674 | Bacteria | 5990 |
| 866 | Ga0495588_0010531 | 3300046674 | Bacteria | 4303 |
| 867 | Ga0495588_0328104 | 3300046674 | Unclassified | 805 |
| 868 | Ga0495657_0001814 | 3300046675 | Bacteria | 18251 |
| 869 | Ga0495657_0070049 | 3300046675 | Bacteria | 2292 |
| 870 | Ga0495657_0081722 | 3300046675 | Bacteria | 2089 |
| 871 | Ga0495599_0003284 | 3300046678 | Bacteria | 9430 |
| 872 | Ga0495599_0021479 | 3300046678 | Bacteria | 4028 |
| 873 | Ga0495623_0002800 | 3300046679 | Bacteria | 11506 |
| 874 | Ga0495623_0033261 | 3300046679 | Bacteria | 3309 |
| 875 | Ga0495646_0003379 | 3300046680 | Bacteria | 9918 |
| 876 | Ga0495646_0006797 | 3300046680 | Bacteria | 7257 |
| 877 | Ga0495646_0447978 | 3300046680 | Bacteria | 667 |
| 878 | Ga0495647_0004774 | 3300046681 | Bacteria | 4423 |
| 879 | Ga0495647_0010507 | 3300046681 | Bacteria | 3154 |
| 880 | Ga0495647_0089419 | 3300046681 | Bacteria | 1260 |
| 881 | Ga0495647_0267295 | 3300046681 | Bacteria | 764 |
| 882 | Ga0495658_0003756 | 3300046683 | Bacteria | 7513 |
| 883 | Ga0495613_0001462 | 3300046689 | Bacteria | 17997 |
| 884 | Ga0495613_0080826 | 3300046689 | Bacteria | 2362 |
| 885 | Ga0495613_0152670 | 3300046689 | Unclassified | 1646 |
| 886 | Ga0495613_0166761 | 3300046689 | Bacteria | 1564 |
| 887 | Ga0495613_0179897 | 3300046689 | Bacteria | 1498 |
| 888 | Ga0495624_0000222 | 3300046690 | Bacteria | 44293 |
| 889 | Ga0495624_0039247 | 3300046690 | Bacteria | 3036 |
| 890 | Ga0495670_0014304 | 3300046691 | Bacteria | 3902 |
| 891 | Ga0495670_0117922 | 3300046691 | Bacteria | 1377 |
| 892 | Ga0495671_0081617 | 3300046692 | Bacteria | 1584 |
| 893 | Ga0495671_0417454 | 3300046692 | Bacteria | 642 |
| 894 | Ga0495600_0003235 | 3300046809 | Bacteria | 9529 |
| 895 | Ga0495600_0003565 | 3300046809 | Bacteria | 9159 |
| 896 | Ga0495600_0387340 | 3300046809 | Bacteria | 871 |
| 897 | Ga0495581_0000145 | 3300047315 | Bacteria | 31255 |
| 898 | Ga0495581_0050717 | 3300047315 | Bacteria | 2397 |
| 899 | Ga0495604_0005816 | 3300047317 | Bacteria | 9782 |
| 900 | Ga0495604_0012054 | 3300047317 | Bacteria | 6873 |
| 901 | Ga0495604_0014609 | 3300047317 | Bacteria | 6258 |
| 902 | Ga0495604_0024966 | 3300047317 | Bacteria | 4765 |
| 903 | Ga0495674_0007404 | 3300047319 | Bacteria | 10489 |
| 904 | Ga0495674_0007467 | 3300047319 | Bacteria | 10440 |
| 905 | Ga0495674_0031760 | 3300047319 | Bacteria | 4794 |
| 906 | Ga0495674_0048018 | 3300047319 | Bacteria | 3780 |
| 907 | Ga0495672_0349822 | 3300047320 | Bacteria | 687 |
| 908 | Ga0495676_0213279 | 3300047321 | Bacteria | 1334 |
| 909 | Ga0495676_0801921 | 3300047321 | Unclassified | 606 |
| 910 | Ga0495680_0002516 | 3300047322 | Bacteria | 18743 |
| 911 | Ga0495680_0004443 | 3300047322 | Bacteria | 13399 |
| 912 | Ga0495680_0041923 | 3300047322 | Bacteria | 3635 |
| 913 | Ga0495675_0174884 | 3300047444 | Bacteria | 1317 |
| 914 | Ga0495684_0000075 | 3300047471 | Bacteria | 67922 |
| 915 | Ga0495684_0038948 | 3300047471 | Bacteria | 3643 |
| 916 | Ga0495686_0025668 | 3300047472 | Bacteria | 3862 |
| 917 | Ga0495593_0000228 | 3300047673 | Bacteria | 30037 |
| 918 | Ga0495602_0008317 | 3300048088 | Bacteria | 10844 |
| 919 | Ga0495602_0319331 | 3300048088 | Unclassified | 1130 |
| 920 | Ga0495614_0013343 | 3300048089 | Bacteria | 3604 |
| 921 | Ga0495614_0190134 | 3300048089 | Bacteria | 926 |
| 922 | Ga0496100_0012706 | 3300048903 | Bacteria | 4837 |
| 923 | Ga0496100_0443960 | 3300048903 | Bacteria | 994 |
| 924 | Ga0496101_0000546 | 3300048904 | Bacteria | 23085 |
| 925 | Ga0496101_0000799 | 3300048904 | Bacteria | 18620 |
| 926 | Ga0496101_0122929 | 3300048904 | Bacteria | 1964 |
| 927 | Ga0496101_0161222 | 3300048904 | Unclassified | 1720 |
| 928 | Ga0496102_0011785 | 3300048905 | Bacteria | 7545 |
| 929 | Ga0496102_0035226 | 3300048905 | Bacteria | 4504 |
| 930 | Ga0496102_0242393 | 3300048905 | Bacteria | 1700 |
| 931 | Ga0496102_0337988 | 3300048905 | Bacteria | 1418 |
| 932 | Ga0496102_0506863 | 3300048905 | Bacteria | 1129 |
| 933 | Ga0496103_0060970 | 3300048906 | Bacteria | 2345 |
| 934 | Ga0496103_0268031 | 3300048906 | Bacteria | 1098 |
| 935 | Ga0496104_0000061 | 3300048907 | Bacteria | 117394 |
| 936 | Ga0496104_0000466 | 3300048907 | Bacteria | 34882 |
| 937 | Ga0496104_0024737 | 3300048907 | Bacteria | 5528 |
| 938 | Ga0496104_0037354 | 3300048907 | Bacteria | 4542 |
| 939 | Ga0496104_0370878 | 3300048907 | Unclassified | 1344 |
| 940 | Ga0496105_0010551 | 3300048908 | Bacteria | 7267 |
| 941 | Ga0496105_0065868 | 3300048908 | Bacteria | 2990 |
| 942 | Ga0496105_0096886 | 3300048908 | Bacteria | 2436 |
| 943 | Ga0496105_0367421 | 3300048908 | Bacteria | 1147 |
| 944 | Ga0496106_0000596 | 3300048909 | Bacteria | 25827 |
| 945 | Ga0496106_0006785 | 3300048909 | Bacteria | 8475 |
| 946 | Ga0496106_0015745 | 3300048909 | Bacteria | 5594 |
| 947 | Ga0496106_0077447 | 3300048909 | Plasmid | 2550 |
| 948 | Ga0496106_0156862 | 3300048909 | Bacteria | 1798 |
| 949 | Ga0496106_0188371 | 3300048909 | Bacteria | 1639 |
| 950 | Ga0496107_0001473 | 3300048910 | Bacteria | 14562 |
| 951 | Ga0496107_0037537 | 3300048910 | Bacteria | 3476 |
| 952 | Ga0496107_0056492 | 3300048910 | Bacteria | 2836 |
| 953 | Ga0496107_1196088 | 3300048910 | Bacteria | 546 |
| 954 | Ga0496108_0085616 | 3300048911 | Bacteria | 2676 |
| 955 | Ga0496108_0354337 | 3300048911 | Bacteria | 1281 |
| 956 | Ga0496109_0001819 | 3300048912 | Bacteria | 17742 |
| 957 | Ga0496109_0049079 | 3300048912 | Bacteria | 3842 |
| 958 | Ga0496109_0229451 | 3300048912 | Bacteria | 1746 |
| 959 | Ga0496109_0260005 | 3300048912 | Bacteria | 1635 |
| 960 | Ga0496110_0038079 | 3300048913 | Bacteria | 4183 |
| 961 | Ga0496110_0073928 | 3300048913 | Bacteria | 3025 |
| 962 | Ga0496111_0041524 | 3300048914 | Bacteria | 3301 |
| 963 | Ga0496111_0314801 | 3300048914 | Unclassified | 1160 |
| 964 | Ga0496111_0874556 | 3300048914 | Bacteria | 648 |
| 965 | Ga0496112_0008772 | 3300048915 | Bacteria | 9071 |
| 966 | Ga0496112_0152055 | 3300048915 | Bacteria | 2282 |
| 967 | Ga0496112_0350430 | 3300048915 | Bacteria | 1419 |
| 968 | Ga0496113_0015822 | 3300048916 | Bacteria | 5198 |
| 969 | Ga0496113_0161068 | 3300048916 | Bacteria | 1774 |
| 970 | Ga0496113_0174348 | 3300048916 | Bacteria | 1704 |
| 971 | Ga0496113_0205665 | 3300048916 | Bacteria | 1566 |
| 972 | Ga0496114_0016139 | 3300048917 | Bacteria | 6010 |
| 973 | Ga0496114_0182841 | 3300048917 | Bacteria | 1831 |
| 974 | Ga0496114_0478593 | 3300048917 | Bacteria | 1102 |
| 975 | Ga0496114_1746096 | 3300048917 | Bacteria | 510 |
| 976 | Ga0496115_0039483 | 3300048918 | Bacteria | 3749 |
| 977 | Ga0496115_0082098 | 3300048918 | Bacteria | 2625 |
| 978 | Ga0496115_0102241 | 3300048918 | Bacteria | 2350 |
| 979 | Ga0496115_0175057 | 3300048918 | Bacteria | 1774 |
| 980 | Ga0496115_1079594 | 3300048918 | Bacteria | 609 |
| 981 | Ga0496116_0035974 | 3300048919 | Bacteria | 3472 |
| 982 | Ga0496117_0247131 | 3300048920 | Bacteria | 975 |
| 983 | Ga0496118_0040442 | 3300048921 | Bacteria | 3707 |
| 984 | Ga0496118_0396055 | 3300048921 | Bacteria | 719 |
| 985 | Ga0496119_0188263 | 3300048922 | Bacteria | 1077 |
| 986 | Ga0496120_0031024 | 3300048923 | Bacteria | 3242 |
| 987 | Ga0496121_0004744 | 3300048924 | Bacteria | 17941 |
| 988 | Ga0496121_0022276 | 3300048924 | Bacteria | 6160 |
| 989 | Ga0496121_0428612 | 3300048924 | Bacteria | 858 |
| 990 | Ga0496122_0045182 | 3300048925 | Bacteria | 3426 |
| 991 | Ga0496122_0045783 | 3300048925 | Bacteria | 3396 |
| 992 | Ga0496123_0014609 | 3300048926 | Bacteria | 6493 |
| 993 | Ga0496123_0056977 | 3300048926 | Bacteria | 2548 |
| 994 | Ga0496124_0050017 | 3300048927 | Bacteria | 3563 |
| 995 | Ga0496125_0000060 | 3300048928 | Bacteria | 264143 |
| 996 | Ga0496125_0002052 | 3300048928 | Bacteria | 27206 |
| 997 | Ga0496125_0003316 | 3300048928 | Bacteria | 19699 |
| 998 | Ga0496125_0047469 | 3300048928 | Bacteria | 3590 |
| 999 | Ga0496125_0198199 | 3300048928 | Bacteria | 1318 |
| 1000 | Ga0496125_0209377 | 3300048928 | Bacteria | 1268 |
| 1001 | Ga0496126_0065875 | 3300048929 | Bacteria | 3240 |
| 1002 | Ga0496126_0273397 | 3300048929 | Bacteria | 1401 |
| 1003 | Ga0496126_0361197 | 3300048929 | Bacteria | 1186 |
| 1004 | Ga0501032_0012085 | 3300049569 | Bacteria | 6181 |
| 1005 | Ga0501032_0041744 | 3300049569 | Bacteria | 3114 |
| 1006 | Ga0501032_0085305 | 3300049569 | Bacteria | 2099 |
| 1007 | Ga0501032_0790571 | 3300049569 | Bacteria | 599 |
| 1008 | Ga0501033_0020592 | 3300049570 | Bacteria | 4984 |
| 1009 | Ga0501033_0195466 | 3300049570 | Bacteria | 1446 |
| 1010 | Ga0501033_0215952 | 3300049570 | Bacteria | 1366 |
| 1011 | Ga0501033_0523432 | 3300049570 | Bacteria | 819 |
| 1012 | Ga0501034_0000439 | 3300049571 | Bacteria | 68932 |
| 1013 | Ga0501034_0019423 | 3300049571 | Bacteria | 6951 |
| 1014 | Ga0501034_0051283 | 3300049571 | Bacteria | 4160 |
| 1015 | Ga0501034_0061673 | 3300049571 | Bacteria | 3765 |
| 1016 | Ga0501034_0143038 | 3300049571 | Bacteria | 2370 |
| 1017 | Ga0501034_0503955 | 3300049571 | Bacteria | 1124 |
| 1018 | Ga0501034_1486216 | 3300049571 | Bacteria | 551 |
| 1019 | Ga0501036_0048401 | 3300049572 | Bacteria | 3599 |
| 1020 | Ga0501036_0197608 | 3300049572 | Bacteria | 1692 |
| 1021 | Ga0501036_0469076 | 3300049572 | Bacteria | 1048 |
| 1022 | Ga0501037_0047256 | 3300049573 | Bacteria | 3155 |
| 1023 | Ga0501037_0079593 | 3300049573 | Bacteria | 2378 |
| 1024 | Ga0501037_0367273 | 3300049573 | Bacteria | 990 |
| 1025 | Ga0501038_0094474 | 3300049574 | Bacteria | 2499 |
| 1026 | Ga0501038_0099256 | 3300049574 | Bacteria | 2427 |
| 1027 | Ga0501038_0116966 | 3300049574 | Bacteria | 2202 |
| 1028 | Ga0501038_0134609 | 3300049574 | Bacteria | 2026 |
| 1029 | Ga0501038_0884992 | 3300049574 | Bacteria | 660 |
| 1030 | Ga0501039_0068228 | 3300049575 | Bacteria | 2761 |
| 1031 | Ga0501039_0099565 | 3300049575 | Bacteria | 2268 |
| 1032 | Ga0501039_0272709 | 3300049575 | Bacteria | 1330 |
| 1033 | Ga0501039_0389967 | 3300049575 | Bacteria | 1094 |
| 1034 | Ga0501043_0023823 | 3300049579 | Bacteria | 4801 |
| 1035 | Ga0501043_0441500 | 3300049579 | Bacteria | 979 |
| 1036 | Ga0501043_0535467 | 3300049579 | Bacteria | 872 |
| 1037 | Ga0501046_0188683 | 3300049580 | Bacteria | 1538 |
| 1038 | Ga0501046_0691082 | 3300049580 | Bacteria | 719 |
| 1039 | Ga0501047_0011147 | 3300049581 | Bacteria | 8507 |
| 1040 | Ga0501047_0027621 | 3300049581 | Bacteria | 5467 |
| 1041 | Ga0501047_0060667 | 3300049581 | Bacteria | 3649 |
| 1042 | Ga0501047_0132797 | 3300049581 | Bacteria | 2369 |
| 1043 | Ga0501047_0168171 | 3300049581 | Bacteria | 2062 |
| 1044 | Ga0501047_0168383 | 3300049581 | Bacteria | 2061 |
| 1045 | Ga0501047_0515332 | 3300049581 | Bacteria | 1022 |
| 1046 | Ga0501047_0744340 | 3300049581 | Bacteria | 796 |
| 1047 | Ga0501048_0426161 | 3300049582 | Bacteria | 949 |
| 1048 | Ga0501067_0105171 | 3300049583 | Bacteria | 1568 |
| 1049 | Ga0501067_0133064 | 3300049583 | Bacteria | 1384 |
| 1050 | Ga0501068_0005601 | 3300049584 | Bacteria | 6878 |
| 1051 | Ga0501068_0099295 | 3300049584 | Bacteria | 1803 |
| 1052 | Ga0501068_0255865 | 3300049584 | Bacteria | 1116 |
| 1053 | Ga0501069_0321422 | 3300049585 | Bacteria | 909 |
| 1054 | Ga0501069_0610966 | 3300049585 | Bacteria | 655 |
| 1055 | Ga0501070_0026384 | 3300049586 | Bacteria | 4874 |
| 1056 | Ga0501070_0031140 | 3300049586 | Bacteria | 4468 |
| 1057 | Ga0501070_0166989 | 3300049586 | Bacteria | 1813 |
| 1058 | Ga0501070_0193436 | 3300049586 | Bacteria | 1671 |
| 1059 | Ga0501070_0322054 | 3300049586 | Bacteria | 1257 |
| 1060 | Ga0501070_0349007 | 3300049586 | Bacteria | 1201 |
| 1061 | Ga0501072_0126150 | 3300049588 | Bacteria | 2039 |
| 1062 | Ga0501072_0405568 | 3300049588 | Bacteria | 1081 |
| 1063 | Ga0501073_0018173 | 3300049589 | Bacteria | 5082 |
| 1064 | Ga0501073_0021921 | 3300049589 | Bacteria | 4602 |
| 1065 | Ga0501073_0066219 | 3300049589 | Bacteria | 2518 |
| 1066 | Ga0501074_0030975 | 3300049590 | Bacteria | 3876 |
| 1067 | Ga0501074_0106764 | 3300049590 | Bacteria | 2004 |
| 1068 | Ga0501074_0178982 | 3300049590 | Bacteria | 1513 |
| 1069 | Ga0501074_0181014 | 3300049590 | Bacteria | 1504 |
| 1070 | Ga0501076_0097685 | 3300049592 | Bacteria | 2366 |
| 1071 | Ga0501077_0060206 | 3300049593 | Bacteria | 2410 |
| 1072 | Ga0501079_0249051 | 3300049741 | Bacteria | 1388 |
| 1073 | Ga0501080_0025570 | 3300049742 | Bacteria | 5481 |
| 1074 | Ga0501080_0048700 | 3300049742 | Bacteria | 3943 |
| 1075 | Ga0501081_0236596 | 3300049743 | Bacteria | 1331 |
| 1076 | Ga0501083_0024300 | 3300049744 | Bacteria | 4199 |
| 1077 | Ga0501083_0260753 | 3300049744 | Bacteria | 1128 |
| 1078 | Ga0501083_0323384 | 3300049744 | Bacteria | 1003 |
| 1079 | Ga0501083_0409323 | 3300049744 | Bacteria | 882 |
| 1080 | Ga0501083_0587899 | 3300049744 | Bacteria | 724 |
| 1081 | Ga0501035_0001020 | 3300049822 | Bacteria | 29508 |
| 1082 | Ga0501035_0040124 | 3300049822 | Bacteria | 4232 |
| 1083 | Ga0501035_0064435 | 3300049822 | Bacteria | 3257 |
| 1084 | Ga0501035_0141678 | 3300049822 | Bacteria | 2090 |
| 1085 | Ga0501035_1126965 | 3300049822 | Bacteria | 612 |
| 1086 | Ga0501035_1375755 | 3300049822 | Bacteria | 542 |
| 1087 | Ga0501044_0051820 | 3300049823 | Bacteria | 4231 |
| 1088 | Ga0501044_0190272 | 3300049823 | Bacteria | 2015 |
| 1089 | Ga0501044_0986273 | 3300049823 | Bacteria | 715 |
| 1090 | Ga0501044_1244775 | 3300049823 | Bacteria | 611 |
| 1091 | nmdc:mga03683_48716_c1 | 3300050489 | Bacteria | 1762 |
| 1092 | nmdc:mga03n38_467087_c1 | 3300050490 | Bacteria | 704 |
| 1093 | nmdc:mga00v17_32752_c1 | 3300050491 | Bacteria | 3074 |
| 1094 | nmdc:mga00v17_497679_c1 | 3300050491 | Bacteria | 790 |
| 1095 | nmdc:mga0yw44_24622_c1 | 3300050492 | Bacteria | 3409 |
| 1096 | nmdc:mga0yw44_261780_c1 | 3300050492 | Bacteria | 1153 |
| 1097 | nmdc:mga0k408_25879_c1 | 3300050493 | Bacteria | 3325 |
| 1098 | nmdc:mga0k408_46093_c1 | 3300050493 | Bacteria | 2517 |
| 1099 | nmdc:mga06z11_249790_c1 | 3300050494 | Bacteria | 1044 |
| 1100 | nmdc:mga06z11_29428_c2 | 3300050494 | Bacteria | 1735 |
| 1101 | nmdc:mga06z11_481779_c1 | 3300050494 | Bacteria | 751 |
| 1102 | nmdc:mga06z11_67121_c1 | 3300050494 | Bacteria | 1887 |
| 1103 | nmdc:mga04h51_54295_c1 | 3300050495 | Bacteria | 1354 |
| 1104 | nmdc:mga07m45_192380_c1 | 3300050496 | Bacteria | 1186 |
| 1105 | nmdc:mga05p37_263038_c1 | 3300050507 | Bacteria | 2064 |
| 1106 | nmdc:mga05p37_6363_c1 | 3300050507 | Bacteria | 13916 |
| 1107 | nmdc:mga05p37_728542_c1 | 3300050507 | Bacteria | 1097 |
| 1108 | nmdc:mga05p37_741212_c1 | 3300050507 | Bacteria | 1084 |
| 1109 | nmdc:mga09592_2569_c1 | 3300050508 | Bacteria | 14701 |
| 1110 | nmdc:mga09592_53150_c1 | 3300050508 | Bacteria | 3419 |
| 1111 | nmdc:mga0qj67_11915_c1 | 3300050509 | Bacteria | 6532 |
| 1112 | nmdc:mga0qj67_1654_c1 | 3300050509 | Bacteria | 15711 |
| 1113 | nmdc:mga06r32_4586_c1 | 3300050510 | Bacteria | 12389 |
| 1114 | nmdc:mga08y16_113197_c1 | 3300050511 | Bacteria | 2825 |
| 1115 | nmdc:mga08y16_11839_c1 | 3300050511 | Bacteria | 9164 |
| 1116 | nmdc:mga08y16_520239_c1 | 3300050511 | Bacteria | 1207 |
| 1117 | nmdc:mga08y16_8011_c1 | 3300050511 | Bacteria | 11053 |
| 1118 | nmdc:mga0n895_2123_c1 | 3300050512 | Bacteria | 15311 |
| 1119 | nmdc:mga0n895_338139_c1 | 3300050512 | Bacteria | 1525 |
| 1120 | nmdc:mga0n895_671956_c1 | 3300050512 | Bacteria | 1033 |
| 1121 | nmdc:mga0rr50_5265_c1 | 3300050513 | Bacteria | 7696 |
| 1122 | nmdc:mga0rr50_702348_c1 | 3300050513 | Bacteria | 863 |
| 1123 | nmdc:mga0rr50_850967_c1 | 3300050513 | Bacteria | 778 |
| 1124 | nmdc:mga08x19_1247946_c1 | 3300050514 | Unclassified | 527 |
| 1125 | nmdc:mga08x19_176190_c1 | 3300050514 | Bacteria | 1458 |
| 1126 | nmdc:mga08x19_335073_c1 | 3300050514 | Bacteria | 1055 |
| 1127 | nmdc:mga0a205_129229_c1 | 3300050515 | Bacteria | 2427 |
| 1128 | nmdc:mga0a205_166376_c1 | 3300050515 | Bacteria | 2101 |
| 1129 | nmdc:mga0a205_54427_c1 | 3300050515 | Bacteria | 3864 |
| 1130 | nmdc:mga0sz30_24362_c1 | 3300050516 | Bacteria | 2469 |
| 1131 | nmdc:mga0sz30_25895_c1 | 3300050516 | Bacteria | 2401 |
| 1132 | Ga0495601_0000153 | 3300053077 | Bacteria | 38651 |
| 1133 | Ga0495601_0002167 | 3300053077 | Bacteria | 11051 |
| 1134 | Ga0495601_0010084 | 3300053077 | Bacteria | 5609 |
| 1135 | Ga0495601_0036305 | 3300053077 | Bacteria | 3077 |
| 1136 | Ga0495601_0046952 | 3300053077 | Bacteria | 2718 |
| 1137 | Ga0495601_0727061 | 3300053077 | Unclassified | 632 |
| 1138 | Ga0495612_0001586 | 3300053078 | Bacteria | 9382 |
| 1139 | Ga0495612_0003368 | 3300053078 | Bacteria | 6620 |
| 1140 | Ga0495612_0010382 | 3300053078 | Bacteria | 3767 |
| 1141 | Ga0495595_0000307 | 3300053084 | Bacteria | 19073 |
| 1142 | Ga0495595_0000328 | 3300053084 | Bacteria | 18520 |
| 1143 | Ga0495595_0000988 | 3300053084 | Bacteria | 10960 |
| 1144 | Ga0495595_0009648 | 3300053084 | Bacteria | 3997 |
| 1145 | Ga0495595_0087243 | 3300053084 | Bacteria | 1494 |
| 1146 | Ga0495619_0000059 | 3300053085 | Bacteria | 92434 |
| 1147 | Ga0495619_0001072 | 3300053085 | Bacteria | 17936 |
| 1148 | Ga0495619_0001117 | 3300053085 | Bacteria | 17612 |
| 1149 | Ga0495619_0001730 | 3300053085 | Bacteria | 14479 |
| 1150 | Ga0495619_0011608 | 3300053085 | Bacteria | 5551 |
| 1151 | Ga0495619_0062365 | 3300053085 | Bacteria | 2481 |
| 1152 | Ga0495619_0073167 | 3300053085 | Bacteria | 2296 |
| 1153 | Ga0495619_0648577 | 3300053085 | Unclassified | 720 |
| 1154 | Ga0500578_0255685 | 3300053086 | Bacteria | 1054 |
| 1155 | Ga0500643_000795 | 3300053087 | Bacteria | 20468 |
| 1156 | Ga0500644_0023522 | 3300053088 | Bacteria | 1872 |
| 1157 | Ga0500581_037329 | 3300053089 | Bacteria | 2489 |
| 1158 | Ga0500646_0041866 | 3300053090 | Bacteria | 1292 |
| 1159 | Ga0500583_0126400 | 3300053092 | Bacteria | 1267 |
| 1160 | Ga0500651_0015153 | 3300053093 | Bacteria | 4726 |
| 1161 | Ga0500651_0046995 | 3300053093 | Bacteria | 2714 |
| 1162 | Ga0500651_0061784 | 3300053093 | Bacteria | 2339 |
| 1163 | Ga0500651_0079963 | 3300053093 | Bacteria | 2025 |
| 1164 | Ga0500651_0127512 | 3300053093 | Bacteria | 1541 |
| 1165 | Ga0500651_0147238 | 3300053093 | Bacteria | 1416 |
| 1166 | Ga0500566_0000471 | 3300053094 | Bacteria | 22436 |
| 1167 | Ga0500641_0008300 | 3300053096 | Bacteria | 3704 |
| 1168 | Ga0500641_0018182 | 3300053096 | Bacteria | 2640 |
| 1169 | Ga0500641_0203678 | 3300053096 | Bacteria | 844 |
| 1170 | Ga0500650_0000278 | 3300053098 | Bacteria | 12391 |
| 1171 | Ga0500650_0233241 | 3300053098 | Bacteria | 830 |
| 1172 | Ga0500556_0000002 | 3300053104 | Bacteria | 773626 |
| 1173 | Ga0500562_051123 | 3300053108 | Bacteria | 1105 |
| 1174 | Ga0500569_031183 | 3300053109 | Bacteria | 1497 |
| 1175 | Ga0500572_102966 | 3300053111 | Bacteria | 914 |
| 1176 | Ga0500593_151956 | 3300053117 | Bacteria | 897 |
| 1177 | Ga0500595_000001 | 3300053119 | Bacteria | 1088438 |
| 1178 | Ga0500595_001355 | 3300053119 | Bacteria | 13187 |
| 1179 | Ga0500595_023565 | 3300053119 | Bacteria | 2161 |
| 1180 | Ga0500595_113317 | 3300053119 | Bacteria | 770 |
| 1181 | Ga0500608_001268 | 3300053122 | Bacteria | 9004 |
| 1182 | Ga0500618_013813 | 3300053125 | Bacteria | 2078 |
| 1183 | Ga0500618_021017 | 3300053125 | Bacteria | 1596 |
| 1184 | Ga0500618_066140 | 3300053125 | Bacteria | 812 |
| 1185 | Ga0500642_0000016 | 3300053130 | Bacteria | 176560 |
| 1186 | Ga0500652_002258 | 3300053131 | Bacteria | 5787 |
| 1187 | Ga0500652_014253 | 3300053131 | Bacteria | 2838 |
| 1188 | Ga0500658_0058211 | 3300053134 | Bacteria | 1600 |
| 1189 | Ga0500559_0000066 | 3300053136 | Bacteria | 84664 |
| 1190 | Ga0500559_0279593 | 3300053136 | Bacteria | 785 |
| 1191 | Ga0500568_0000594 | 3300053139 | Bacteria | 26294 |
| 1192 | Ga0500568_0122205 | 3300053139 | Bacteria | 970 |
| 1193 | Ga0500568_0177653 | 3300053139 | Bacteria | 783 |
| 1194 | Ga0500577_0063126 | 3300053142 | Bacteria | 1431 |
| 1195 | Ga0500588_0199489 | 3300053146 | Bacteria | 741 |
| 1196 | Ga0500590_023132 | 3300053148 | Bacteria | 3229 |
| 1197 | Ga0500604_0065752 | 3300053151 | Bacteria | 1147 |
| 1198 | Ga0500616_0000001 | 3300053153 | Bacteria | 1986011 |
| 1199 | Ga0500616_0000061 | 3300053153 | Bacteria | 249158 |
| 1200 | Ga0500616_0023631 | 3300053153 | Bacteria | 3421 |
| 1201 | Ga0500622_0002843 | 3300053156 | Bacteria | 12132 |
| 1202 | Ga0500627_0164914 | 3300053158 | Bacteria | 999 |
| 1203 | Ga0500633_0108580 | 3300053160 | Bacteria | 1026 |
| 1204 | Ga0500634_0150276 | 3300053161 | Bacteria | 1090 |
| 1205 | Ga0500636_0006653 | 3300053177 | Bacteria | 6646 |
| 1206 | Ga0500637_0536520 | 3300053178 | Bacteria | 570 |
| 1207 | Ga0500645_000015 | 3300053730 | Bacteria | 150140 |
| 1208 | Ga0500645_025271 | 3300053730 | Bacteria | 1812 |
| 1209 | Ga0501084_0557179 | 3300054114 | Bacteria | 968 |
| 1210 | Ga0501082_0089740 | 3300060353 | Bacteria | 2654 |
| 1211 | Ga0466962_0174953 | 3300061719 | Bacteria | 1046 |
| 1212 | Ga0466962_0440700 | 3300061719 | Bacteria | 655 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300050490 | nmdc:mga03n38_467087_c1 | nmdc:mga03n38_467087_c1_127_603 | 140 |
| 2 | 3300007788 | Ga0099795_10255076 | Ga0099795_102550762 | 142 |
| 3 | 3300005355 | Ga0070671_101230595 | Ga0070671_1012305951 | 144 |
| 4 | 3300039438 | Ga0436360_1161303 | Ga0436360_1161303_583_1047 | 144 |
| 5 | 3300021384 | Ga0213876_10010724 | Ga0213876_100107244 | 145 |
| 6 | 3300039437 | Ga0436365_1674422 | Ga0436365_1674422_205_642 | 145 |
| 7 | 3300039437 | Ga0436365_1804874 | Ga0436365_1804874_336_773 | 145 |
| 8 | 3300046491 | Ga0495584_0188752 | Ga0495584_0188752_558_1022 | 145 |
| 9 | 3300049581 | Ga0501047_0515332 | Ga0501047_0515332_162_602 | 145 |
| 10 | 3300005434 | Ga0070709_10465381 | Ga0070709_104653812 | 146 |
| 11 | 3300005435 | Ga0070714_100006637 | Ga0070714_10000663710 | 146 |
| 12 | 3300025929 | Ga0207664_10029948 | Ga0207664_100299483 | 146 |
| 13 | 3300049571 | Ga0501034_0061673 | Ga0501034_0061673_2890_3336 | 146 |
| 14 | 3300049572 | Ga0501036_0197608 | Ga0501036_0197608_130_576 | 146 |
| 15 | 3300049574 | Ga0501038_0884992 | Ga0501038_0884992_37_483 | 146 |
| 16 | 3300049575 | Ga0501039_0272709 | Ga0501039_0272709_722_1168 | 146 |
| 17 | 3300049581 | Ga0501047_0060667 | Ga0501047_0060667_1199_1645 | 146 |
| 18 | 3300049583 | Ga0501067_0105171 | Ga0501067_0105171_450_896 | 146 |
| 19 | 3300049584 | Ga0501068_0099295 | Ga0501068_0099295_495_941 | 146 |
| 20 | 3300049586 | Ga0501070_0166989 | Ga0501070_0166989_466_912 | 146 |
| 21 | 3300049588 | Ga0501072_0405568 | Ga0501072_0405568_440_886 | 146 |
| 22 | 3300049589 | Ga0501073_0021921 | Ga0501073_0021921_3601_4047 | 146 |
| 23 | 3300049590 | Ga0501074_0106764 | Ga0501074_0106764_681_1127 | 146 |
| 24 | 3300049744 | Ga0501083_0323384 | Ga0501083_0323384_477_923 | 146 |
| 25 | 3300049823 | Ga0501044_0190272 | Ga0501044_0190272_397_843 | 146 |
| 26 | iso_pu_bacteria | 2602042107 | 2603856853 | 146 |
| 27 | iso_pu_bacteria | 2857524615 | 2857528318 | 146 |
| 28 | iso_pu_bacteria | 2893066018 | 2893068753 | 146 |
| 29 | iso_pu_bacteria | 2919073203 | 2919075745 | 146 |
| 30 | 3300006038 | Ga0075365_10054599 | Ga0075365_100545992 | 147 |
| 31 | 3300006048 | Ga0075363_100103010 | Ga0075363_1001030102 | 147 |
| 32 | 3300006051 | Ga0075364_10113903 | Ga0075364_101139032 | 147 |
| 33 | 3300006051 | Ga0075364_10403479 | Ga0075364_104034792 | 147 |
| 34 | 3300006353 | Ga0075370_10305990 | Ga0075370_103059902 | 147 |
| 35 | 3300006847 | Ga0075431_100854608 | Ga0075431_1008546082 | 147 |
| 36 | 3300009147 | Ga0114129_10196645 | Ga0114129_101966452 | 147 |
| 37 | 3300021377 | Ga0213874_10105697 | Ga0213874_101056972 | 147 |
| 38 | 3300021384 | Ga0213876_10049608 | Ga0213876_100496082 | 147 |
| 39 | 3300039437 | Ga0436365_0217897 | Ga0436365_0217897_340_789 | 147 |
| 40 | 3300039437 | Ga0436365_1459828 | Ga0436365_1459828_4879_5328 | 147 |
| 41 | 3300039450 | Ga0436363_0552664 | Ga0436363_0552664_442_891 | 147 |
| 42 | 3300039453 | Ga0436362_0640430 | Ga0436362_0640430_137_586 | 147 |
| 43 | 3300050492 | nmdc:mga0yw44_24622_c1 | nmdc:mga0yw44_24622_c1_2836_3282 | 147 |
| 44 | 3300050496 | nmdc:mga07m45_192380_c1 | nmdc:mga07m45_192380_c1_273_719 | 147 |
| 45 | 3300050507 | nmdc:mga05p37_263038_c1 | nmdc:mga05p37_263038_c1_436_888 | 147 |
| 46 | 3300005328 | Ga0070676_10039981 | Ga0070676_100399813 | 148 |
| 47 | 3300005330 | Ga0070690_100021460 | Ga0070690_1000214602 | 148 |
| 48 | 3300005338 | Ga0068868_100390300 | Ga0068868_1003903002 | 148 |
| 49 | 3300005340 | Ga0070689_100002898 | Ga0070689_1000028983 | 148 |
| 50 | 3300005353 | Ga0070669_100128259 | Ga0070669_1001282592 | 148 |
| 51 | 3300005354 | Ga0070675_100328970 | Ga0070675_1003289702 | 148 |
| 52 | 3300005365 | Ga0070688_100000970 | Ga0070688_1000009709 | 148 |
| 53 | 3300005434 | Ga0070709_10203545 | Ga0070709_102035452 | 148 |
| 54 | 3300005435 | Ga0070714_100788788 | Ga0070714_1007887882 | 148 |
| 55 | 3300005456 | Ga0070678_100138354 | Ga0070678_1001383541 | 148 |
| 56 | 3300005530 | Ga0070679_100474175 | Ga0070679_1004741752 | 148 |
| 57 | 3300005563 | Ga0068855_100023093 | Ga0068855_1000230935 | 148 |
| 58 | 3300005614 | Ga0068856_100503931 | Ga0068856_1005039311 | 148 |
| 59 | 3300005617 | Ga0068859_100525799 | Ga0068859_1005257992 | 148 |
| 60 | 3300005618 | Ga0068864_100016705 | Ga0068864_1000167052 | 148 |
| 61 | 3300005718 | Ga0068866_10487672 | Ga0068866_104876721 | 148 |
| 62 | 3300005842 | Ga0068858_100445845 | Ga0068858_1004458451 | 148 |
| 63 | 3300006028 | Ga0070717_10066769 | Ga0070717_100667693 | 148 |
| 64 | 3300006173 | Ga0070716_101102772 | Ga0070716_1011027722 | 148 |
| 65 | 3300006914 | Ga0075436_101151660 | Ga0075436_1011516601 | 148 |
| 66 | 3300006931 | Ga0097620_100525784 | Ga0097620_1005257842 | 148 |
| 67 | 3300007076 | Ga0075435_101178911 | Ga0075435_1011789112 | 148 |
| 68 | 3300009553 | Ga0105249_10617774 | Ga0105249_106177741 | 148 |
| 69 | 3300013306 | Ga0163162_10012152 | Ga0163162_100121522 | 148 |
| 70 | 3300013308 | Ga0157375_10034225 | Ga0157375_100342254 | 148 |
| 71 | 3300014325 | Ga0163163_10007836 | Ga0163163_100078366 | 148 |
| 72 | 3300014968 | Ga0157379_10635299 | Ga0157379_106352991 | 148 |
| 73 | 3300014969 | Ga0157376_10805559 | Ga0157376_108055591 | 148 |
| 74 | 3300017792 | Ga0163161_10231698 | Ga0163161_102316981 | 148 |
| 75 | 3300021388 | Ga0213875_10000074 | Ga0213875_1000007419 | 148 |
| 76 | 3300025315 | Ga0207697_10039255 | Ga0207697_100392552 | 148 |
| 77 | 3300025898 | Ga0207692_10895980 | Ga0207692_108959801 | 148 |
| 78 | 3300025907 | Ga0207645_10037724 | Ga0207645_100377243 | 148 |
| 79 | 3300025911 | Ga0207654_10285765 | Ga0207654_102857651 | 148 |
| 80 | 3300025923 | Ga0207681_10039030 | Ga0207681_100390302 | 148 |
| 81 | 3300025926 | Ga0207659_10215754 | Ga0207659_102157541 | 148 |
| 82 | 3300025935 | Ga0207709_10148526 | Ga0207709_101485262 | 148 |
| 83 | 3300025936 | Ga0207670_10000486 | Ga0207670_100004868 | 148 |
| 84 | 3300025939 | Ga0207665_10161603 | Ga0207665_101616032 | 148 |
| 85 | 3300025940 | Ga0207691_10856808 | Ga0207691_108568082 | 148 |
| 86 | 3300025949 | Ga0207667_10066210 | Ga0207667_100662104 | 148 |
| 87 | 3300026023 | Ga0207677_10059304 | Ga0207677_100593043 | 148 |
| 88 | 3300026078 | Ga0207702_11348262 | Ga0207702_113482622 | 148 |
| 89 | 3300026089 | Ga0207648_10190350 | Ga0207648_101903502 | 148 |
| 90 | 3300026095 | Ga0207676_10005788 | Ga0207676_100057886 | 148 |
| 91 | 3300026121 | Ga0207683_10018680 | Ga0207683_100186806 | 148 |
| 92 | 3300026142 | Ga0207698_10123944 | Ga0207698_101239443 | 148 |
| 93 | 3300035691 | Ga0373931_0005509 | Ga0373931_0005509_4654_5112 | 148 |
| 94 | 3300037418 | Ga0395900_0306301 | Ga0395900_0306301_458_910 | 148 |
| 95 | 3300037853 | Ga0436364_0708558 | Ga0436364_0708558_2400_2849 | 148 |
| 96 | 3300039437 | Ga0436365_1717450 | Ga0436365_1717450_709_1155 | 148 |
| 97 | 3300039453 | Ga0436362_0529917 | Ga0436362_0529917_33_482 | 148 |
| 98 | 3300044694 | Ga0466963_0817932 | Ga0466963_0817932_33_485 | 148 |
| 99 | 3300044719 | Ga0466971_0177815 | Ga0466971_0177815_508_960 | 148 |
| 100 | 3300044842 | Ga0466957_0060008 | Ga0466957_0060008_1521_1973 | 148 |
| 101 | 3300045836 | Ga0466958_0207992 | Ga0466958_0207992_12_464 | 148 |
| 102 | 3300048905 | Ga0496102_0506863 | Ga0496102_0506863_18_476 | 148 |
| 103 | 3300048911 | Ga0496108_0085616 | Ga0496108_0085616_289_747 | 148 |
| 104 | 3300048912 | Ga0496109_0260005 | Ga0496109_0260005_232_690 | 148 |
| 105 | 3300048916 | Ga0496113_0205665 | Ga0496113_0205665_556_1014 | 148 |
| 106 | 3300049585 | Ga0501069_0321422 | Ga0501069_0321422_314_778 | 148 |
| 107 | 3300049586 | Ga0501070_0026384 | Ga0501070_0026384_4079_4543 | 148 |
| 108 | 3300049822 | Ga0501035_0001020 | Ga0501035_0001020_5104_5568 | 148 |
| 109 | 3300049823 | Ga0501044_0986273 | Ga0501044_0986273_198_662 | 148 |
| 110 | 3300050513 | nmdc:mga0rr50_702348_c1 | nmdc:mga0rr50_702348_c1_96_566 | 148 |
| 111 | 3300005262 | Ga0065165_1059454 | Ga0065165_10594542 | 149 |
| 112 | 3300005262 | Ga0065165_1104001 | Ga0065165_11040011 | 149 |
| 113 | 3300005336 | Ga0070680_100892790 | Ga0070680_1008927901 | 149 |
| 114 | 3300005366 | Ga0070659_100623816 | Ga0070659_1006238161 | 149 |
| 115 | 3300005367 | Ga0070667_100902466 | Ga0070667_1009024661 | 149 |
| 116 | 3300005435 | Ga0070714_101649337 | Ga0070714_1016493371 | 149 |
| 117 | 3300005455 | Ga0070663_100219923 | Ga0070663_1002199232 | 149 |
| 118 | 3300005530 | Ga0070679_100505201 | Ga0070679_1005052011 | 149 |
| 119 | 3300005530 | Ga0070679_100594718 | Ga0070679_1005947182 | 149 |
| 120 | 3300006175 | Ga0070712_101834221 | Ga0070712_1018342211 | 149 |
| 121 | 3300006186 | Ga0075369_10124732 | Ga0075369_101247322 | 149 |
| 122 | 3300006353 | Ga0075370_10625550 | Ga0075370_106255501 | 149 |
| 123 | 3300025295 | Ga0209564_1000544 | Ga0209564_100054441 | 149 |
| 124 | 3300025295 | Ga0209564_1016332 | Ga0209564_10163323 | 149 |
| 125 | 3300025917 | Ga0207660_10862448 | Ga0207660_108624482 | 149 |
| 126 | 3300026067 | Ga0207678_10004081 | Ga0207678_100040818 | 149 |
| 127 | 3300028379 | Ga0268266_10182841 | Ga0268266_101828412 | 149 |
| 128 | 3300031247 | Ga0265340_10152576 | Ga0265340_101525761 | 149 |
| 129 | 3300031691 | Ga0316579_10001599 | Ga0316579_100015995 | 149 |
| 130 | 3300037312 | Ga0395899_0004968 | Ga0395899_0004968_3642_4097 | 149 |
| 131 | 3300037312 | Ga0395899_0016270 | Ga0395899_0016270_3870_4325 | 149 |
| 132 | 3300037418 | Ga0395900_0007564 | Ga0395900_0007564_1705_2160 | 149 |
| 133 | 3300037418 | Ga0395900_0247416 | Ga0395900_0247416_401_856 | 149 |
| 134 | 3300037418 | Ga0395900_0510748 | Ga0395900_0510748_683_1138 | 149 |
| 135 | 3300037466 | Ga0395898_0007267 | Ga0395898_0007267_7798_8253 | 149 |
| 136 | 3300037466 | Ga0395898_0039336 | Ga0395898_0039336_1609_2064 | 149 |
| 137 | 3300037466 | Ga0395898_0058851 | Ga0395898_0058851_2696_3151 | 149 |
| 138 | 3300038443 | Ga0395901_0021099 | Ga0395901_0021099_90_545 | 149 |
| 139 | 3300038443 | Ga0395901_0028444 | Ga0395901_0028444_4223_4678 | 149 |
| 140 | 3300038443 | Ga0395901_0147318 | Ga0395901_0147318_198_653 | 149 |
| 141 | 3300041456 | Ga0451795_0516035 | Ga0451795_0516035_353_814 | 149 |
| 142 | 3300044684 | Ga0466966_0087561 | Ga0466966_0087561_106_561 | 149 |
| 143 | 3300044719 | Ga0466971_0202491 | Ga0466971_0202491_382_837 | 149 |
| 144 | 3300044842 | Ga0466957_0110387 | Ga0466957_0110387_610_1065 | 149 |
| 145 | 3300045836 | Ga0466958_0074137 | Ga0466958_0074137_70_525 | 149 |
| 146 | 3300045976 | Ga0466967_1157226 | Ga0466967_1157226_242_697 | 149 |
| 147 | 3300046460 | Ga0495638_0008737 | Ga0495638_0008737_1148_1609 | 149 |
| 148 | 3300046501 | Ga0495607_0074547 | Ga0495607_0074547_800_1261 | 149 |
| 149 | 3300046507 | Ga0495606_0290416 | Ga0495606_0290416_236_697 | 149 |
| 150 | 3300046512 | Ga0495610_0132570 | Ga0495610_0132570_284_745 | 149 |
| 151 | 3300046515 | Ga0495620_0055096 | Ga0495620_0055096_1086_1547 | 149 |
| 152 | 3300046518 | Ga0495631_0072338 | Ga0495631_0072338_785_1246 | 149 |
| 153 | 3300046519 | Ga0495632_0102658 | Ga0495632_0102658_419_880 | 149 |
| 154 | 3300046520 | Ga0495637_0048540 | Ga0495637_0048540_352_813 | 149 |
| 155 | 3300046522 | Ga0495643_0038796 | Ga0495643_0038796_107_568 | 149 |
| 156 | 3300046530 | Ga0495654_0121103 | Ga0495654_0121103_612_1073 | 149 |
| 157 | 3300046558 | Ga0495633_0197438 | Ga0495633_0197438_294_755 | 149 |
| 158 | 3300046616 | Ga0495668_0107180 | Ga0495668_0107180_475_936 | 149 |
| 159 | 3300046665 | Ga0495661_0077892 | Ga0495661_0077892_528_989 | 149 |
| 160 | 3300046691 | Ga0495670_0014304 | Ga0495670_0014304_249_710 | 149 |
| 161 | 3300046692 | Ga0495671_0081617 | Ga0495671_0081617_431_892 | 149 |
| 162 | 3300048903 | Ga0496100_0443960 | Ga0496100_0443960_398_859 | 149 |
| 163 | 3300048909 | Ga0496106_0188371 | Ga0496106_0188371_691_1152 | 149 |
| 164 | 3300048919 | Ga0496116_0035974 | Ga0496116_0035974_2375_2836 | 149 |
| 165 | 3300048920 | Ga0496117_0247131 | Ga0496117_0247131_274_735 | 149 |
| 166 | 3300048921 | Ga0496118_0040442 | Ga0496118_0040442_1710_2171 | 149 |
| 167 | 3300048922 | Ga0496119_0188263 | Ga0496119_0188263_330_791 | 149 |
| 168 | 3300048923 | Ga0496120_0031024 | Ga0496120_0031024_2435_2896 | 149 |
| 169 | 3300048924 | Ga0496121_0022276 | Ga0496121_0022276_874_1335 | 149 |
| 170 | 3300048925 | Ga0496122_0045182 | Ga0496122_0045182_1714_2175 | 149 |
| 171 | 3300048925 | Ga0496122_0045783 | Ga0496122_0045783_1316_1774 | 149 |
| 172 | 3300048926 | Ga0496123_0014609 | Ga0496123_0014609_5087_5548 | 149 |
| 173 | 3300048926 | Ga0496123_0056977 | Ga0496123_0056977_1265_1723 | 149 |
| 174 | 3300048927 | Ga0496124_0050017 | Ga0496124_0050017_53_514 | 149 |
| 175 | 3300048928 | Ga0496125_0002052 | Ga0496125_0002052_7682_8143 | 149 |
| 176 | 3300048928 | Ga0496125_0047469 | Ga0496125_0047469_1680_2141 | 149 |
| 177 | 3300048928 | Ga0496125_0198199 | Ga0496125_0198199_473_931 | 149 |
| 178 | 3300048929 | Ga0496126_0273397 | Ga0496126_0273397_858_1319 | 149 |
| 179 | 3300049569 | Ga0501032_0012085 | Ga0501032_0012085_3093_3554 | 149 |
| 180 | 3300049570 | Ga0501033_0020592 | Ga0501033_0020592_809_1270 | 149 |
| 181 | 3300049571 | Ga0501034_0143038 | Ga0501034_0143038_344_805 | 149 |
| 182 | 3300049573 | Ga0501037_0367273 | Ga0501037_0367273_333_794 | 149 |
| 183 | 3300049574 | Ga0501038_0099256 | Ga0501038_0099256_333_794 | 149 |
| 184 | 3300049575 | Ga0501039_0099565 | Ga0501039_0099565_895_1356 | 149 |
| 185 | 3300049579 | Ga0501043_0023823 | Ga0501043_0023823_3560_4021 | 149 |
| 186 | 3300049580 | Ga0501046_0691082 | Ga0501046_0691082_11_472 | 149 |
| 187 | 3300049581 | Ga0501047_0011147 | Ga0501047_0011147_5008_5469 | 149 |
| 188 | 3300049582 | Ga0501048_0426161 | Ga0501048_0426161_427_888 | 149 |
| 189 | 3300049583 | Ga0501067_0133064 | Ga0501067_0133064_271_732 | 149 |
| 190 | 3300049584 | Ga0501068_0005601 | Ga0501068_0005601_1272_1733 | 149 |
| 191 | 3300049586 | Ga0501070_0031140 | Ga0501070_0031140_3569_4030 | 149 |
| 192 | 3300049589 | Ga0501073_0066219 | Ga0501073_0066219_751_1212 | 149 |
| 193 | 3300049590 | Ga0501074_0030975 | Ga0501074_0030975_1932_2393 | 149 |
| 194 | 3300049742 | Ga0501080_0048700 | Ga0501080_0048700_1195_1656 | 149 |
| 195 | 3300049744 | Ga0501083_0409323 | Ga0501083_0409323_207_668 | 149 |
| 196 | 3300049822 | Ga0501035_0040124 | Ga0501035_0040124_2536_2997 | 149 |
| 197 | 3300049823 | Ga0501044_0051820 | Ga0501044_0051820_1909_2370 | 149 |
| 198 | 3300050491 | nmdc:mga00v17_497679_c1 | nmdc:mga00v17_497679_c1_283_744 | 149 |
| 199 | 3300050492 | nmdc:mga0yw44_261780_c1 | nmdc:mga0yw44_261780_c1_159_620 | 149 |
| 200 | 3300050494 | nmdc:mga06z11_481779_c1 | nmdc:mga06z11_481779_c1_200_661 | 149 |
| 201 | 3300050516 | nmdc:mga0sz30_24362_c1 | nmdc:mga0sz30_24362_c1_880_1341 | 149 |
| 202 | 3300050516 | nmdc:mga0sz30_25895_c1 | nmdc:mga0sz30_25895_c1_1642_2103 | 149 |
| 203 | 3300053084 | Ga0495595_0087243 | Ga0495595_0087243_870_1325 | 149 |
| 204 | 3300053089 | Ga0500581_037329 | Ga0500581_037329_1268_1729 | 149 |
| 205 | 3300053090 | Ga0500646_0041866 | Ga0500646_0041866_256_717 | 149 |
| 206 | 3300053093 | Ga0500651_0061784 | Ga0500651_0061784_1175_1636 | 149 |
| 207 | 3300053093 | Ga0500651_0079963 | Ga0500651_0079963_577_1044 | 149 |
| 208 | 3300053093 | Ga0500651_0127512 | Ga0500651_0127512_147_608 | 149 |
| 209 | 3300053093 | Ga0500651_0147238 | Ga0500651_0147238_651_1109 | 149 |
| 210 | 3300053094 | Ga0500566_0000471 | Ga0500566_0000471_21215_21676 | 149 |
| 211 | 3300053096 | Ga0500641_0008300 | Ga0500641_0008300_1502_1963 | 149 |
| 212 | 3300053098 | Ga0500650_0000278 | Ga0500650_0000278_7808_8269 | 149 |
| 213 | 3300053104 | Ga0500556_0000002 | Ga0500556_0000002_309949_310410 | 149 |
| 214 | 3300053108 | Ga0500562_051123 | Ga0500562_051123_353_814 | 149 |
| 215 | 3300053109 | Ga0500569_031183 | Ga0500569_031183_638_1099 | 149 |
| 216 | 3300053117 | Ga0500593_151956 | Ga0500593_151956_323_784 | 149 |
| 217 | 3300053122 | Ga0500608_001268 | Ga0500608_001268_1980_2441 | 149 |
| 218 | 3300053125 | Ga0500618_013813 | Ga0500618_013813_274_735 | 149 |
| 219 | 3300053125 | Ga0500618_066140 | Ga0500618_066140_36_494 | 149 |
| 220 | 3300053130 | Ga0500642_0000016 | Ga0500642_0000016_5762_6223 | 149 |
| 221 | 3300053131 | Ga0500652_002258 | Ga0500652_002258_2988_3449 | 149 |
| 222 | 3300053134 | Ga0500658_0058211 | Ga0500658_0058211_371_832 | 149 |
| 223 | 3300053136 | Ga0500559_0000066 | Ga0500559_0000066_14503_14964 | 149 |
| 224 | 3300053136 | Ga0500559_0279593 | Ga0500559_0279593_291_749 | 149 |
| 225 | 3300053139 | Ga0500568_0000594 | Ga0500568_0000594_20629_21090 | 149 |
| 226 | 3300053142 | Ga0500577_0063126 | Ga0500577_0063126_224_685 | 149 |
| 227 | 3300053146 | Ga0500588_0199489 | Ga0500588_0199489_25_486 | 149 |
| 228 | 3300053148 | Ga0500590_023132 | Ga0500590_023132_1063_1530 | 149 |
| 229 | 3300053151 | Ga0500604_0065752 | Ga0500604_0065752_366_827 | 149 |
| 230 | 3300053153 | Ga0500616_0000061 | Ga0500616_0000061_119641_120102 | 149 |
| 231 | 3300053156 | Ga0500622_0002843 | Ga0500622_0002843_8151_8612 | 149 |
| 232 | 3300053158 | Ga0500627_0164914 | Ga0500627_0164914_94_555 | 149 |
| 233 | 3300053160 | Ga0500633_0108580 | Ga0500633_0108580_358_819 | 149 |
| 234 | 3300053161 | Ga0500634_0150276 | Ga0500634_0150276_458_916 | 149 |
| 235 | 3300053177 | Ga0500636_0006653 | Ga0500636_0006653_5760_6227 | 149 |
| 236 | 3300053178 | Ga0500637_0536520 | Ga0500637_0536520_76_543 | 149 |
| 237 | 3300053730 | Ga0500645_025271 | Ga0500645_025271_284_745 | 149 |
| 238 | 3300061719 | Ga0466962_0440700 | Ga0466962_0440700_82_537 | 149 |
| 239 | 3300005327 | Ga0070658_10072899 | Ga0070658_100728993 | 150 |
| 240 | 3300005327 | Ga0070658_10080660 | Ga0070658_100806603 | 150 |
| 241 | 3300005336 | Ga0070680_100066695 | Ga0070680_1000666954 | 150 |
| 242 | 3300005336 | Ga0070680_100113040 | Ga0070680_1001130403 | 150 |
| 243 | 3300005337 | Ga0070682_100547156 | Ga0070682_1005471561 | 150 |
| 244 | 3300005339 | Ga0070660_100030675 | Ga0070660_1000306754 | 150 |
| 245 | 3300005339 | Ga0070660_100989190 | Ga0070660_1009891901 | 150 |
| 246 | 3300005344 | Ga0070661_100086436 | Ga0070661_1000864363 | 150 |
| 247 | 3300005347 | Ga0070668_100250077 | Ga0070668_1002500772 | 150 |
| 248 | 3300005366 | Ga0070659_100442858 | Ga0070659_1004428582 | 150 |
| 249 | 3300005458 | Ga0070681_10109594 | Ga0070681_101095942 | 150 |
| 250 | 3300005530 | Ga0070679_100505526 | Ga0070679_1005055262 | 150 |
| 251 | 3300005530 | Ga0070679_100931253 | Ga0070679_1009312532 | 150 |
| 252 | 3300005563 | Ga0068855_100666786 | Ga0068855_1006667862 | 150 |
| 253 | 3300005578 | Ga0068854_100090300 | Ga0068854_1000903003 | 150 |
| 254 | 3300005614 | Ga0068856_100045729 | Ga0068856_1000457294 | 150 |
| 255 | 3300005616 | Ga0068852_100134350 | Ga0068852_1001343502 | 150 |
| 256 | 3300005985 | Ga0081539_10021800 | Ga0081539_100218004 | 150 |
| 257 | 3300006051 | Ga0075364_10362153 | Ga0075364_103621532 | 150 |
| 258 | 3300006175 | Ga0070712_100551581 | Ga0070712_1005515812 | 150 |
| 259 | 3300009093 | Ga0105240_10222888 | Ga0105240_102228882 | 150 |
| 260 | 3300013104 | Ga0157370_10246969 | Ga0157370_102469691 | 150 |
| 261 | 3300013104 | Ga0157370_10421031 | Ga0157370_104210312 | 150 |
| 262 | 3300014326 | Ga0157380_10520404 | Ga0157380_105204042 | 150 |
| 263 | 3300020070 | Ga0206356_10418905 | Ga0206356_104189053 | 150 |
| 264 | 3300025297 | Ga0209758_1002224 | Ga0209758_100222413 | 150 |
| 265 | 3300025909 | Ga0207705_10102516 | Ga0207705_101025162 | 150 |
| 266 | 3300025909 | Ga0207705_10484475 | Ga0207705_104844752 | 150 |
| 267 | 3300025912 | Ga0207707_10066546 | Ga0207707_100665463 | 150 |
| 268 | 3300025912 | Ga0207707_10099789 | Ga0207707_100997892 | 150 |
| 269 | 3300025912 | Ga0207707_10288818 | Ga0207707_102888182 | 150 |
| 270 | 3300025913 | Ga0207695_10419864 | Ga0207695_104198642 | 150 |
| 271 | 3300025915 | Ga0207693_10411522 | Ga0207693_104115222 | 150 |
| 272 | 3300025917 | Ga0207660_10150054 | Ga0207660_101500542 | 150 |
| 273 | 3300025919 | Ga0207657_10019619 | Ga0207657_100196195 | 150 |
| 274 | 3300025919 | Ga0207657_10042193 | Ga0207657_100421932 | 150 |
| 275 | 3300025920 | Ga0207649_10360715 | Ga0207649_103607151 | 150 |
| 276 | 3300025921 | Ga0207652_10142060 | Ga0207652_101420602 | 150 |
| 277 | 3300025921 | Ga0207652_10149856 | Ga0207652_101498563 | 150 |
| 278 | 3300025931 | Ga0207644_10842020 | Ga0207644_108420201 | 150 |
| 279 | 3300025932 | Ga0207690_10223308 | Ga0207690_102233082 | 150 |
| 280 | 3300025949 | Ga0207667_11104269 | Ga0207667_111042691 | 150 |
| 281 | 3300025972 | Ga0207668_10232112 | Ga0207668_102321122 | 150 |
| 282 | 3300026142 | Ga0207698_10221202 | Ga0207698_102212022 | 150 |
| 283 | 3300028379 | Ga0268266_10536683 | Ga0268266_105366832 | 150 |
| 284 | 3300028379 | Ga0268266_11074836 | Ga0268266_110748362 | 150 |
| 285 | 3300028800 | Ga0265338_10203324 | Ga0265338_102033242 | 150 |
| 286 | 3300031240 | Ga0265320_10035321 | Ga0265320_100353213 | 150 |
| 287 | 3300031242 | Ga0265329_10007181 | Ga0265329_100071814 | 150 |
| 288 | 3300031344 | Ga0265316_10524679 | Ga0265316_105246791 | 150 |
| 289 | 3300031711 | Ga0265314_10000672 | Ga0265314_1000067229 | 150 |
| 290 | 3300031712 | Ga0265342_10017835 | Ga0265342_100178354 | 150 |
| 291 | 3300044694 | Ga0466963_0574791 | Ga0466963_0574791_279_731 | 150 |
| 292 | 3300046460 | Ga0495638_0420974 | Ga0495638_0420974_205_669 | 150 |
| 293 | 3300046462 | Ga0495651_0100174 | Ga0495651_0100174_164_655 | 150 |
| 294 | 3300046524 | Ga0495648_0052445 | Ga0495648_0052445_1179_1640 | 150 |
| 295 | 3300046559 | Ga0495667_0286141 | Ga0495667_0286141_476_967 | 150 |
| 296 | 3300046809 | Ga0495600_0387340 | Ga0495600_0387340_64_555 | 150 |
| 297 | 3300047320 | Ga0495672_0349822 | Ga0495672_0349822_20_511 | 150 |
| 298 | 3300047472 | Ga0495686_0025668 | Ga0495686_0025668_16_480 | 150 |
| 299 | 3300048921 | Ga0496118_0396055 | Ga0496118_0396055_121_645 | 150 |
| 300 | 3300048924 | Ga0496121_0004744 | Ga0496121_0004744_8835_9326 | 150 |
| 301 | 3300048924 | Ga0496121_0428612 | Ga0496121_0428612_154_678 | 150 |
| 302 | 3300048928 | Ga0496125_0000060 | Ga0496125_0000060_251729_252193 | 150 |
| 303 | 3300048928 | Ga0496125_0003316 | Ga0496125_0003316_4904_5368 | 150 |
| 304 | 3300048929 | Ga0496126_0065875 | Ga0496126_0065875_410_901 | 150 |
| 305 | 3300048929 | Ga0496126_0361197 | Ga0496126_0361197_286_750 | 150 |
| 306 | 3300049569 | Ga0501032_0085305 | Ga0501032_0085305_1181_1645 | 150 |
| 307 | 3300049570 | Ga0501033_0215952 | Ga0501033_0215952_368_832 | 150 |
| 308 | 3300049571 | Ga0501034_0000439 | Ga0501034_0000439_10506_10985 | 150 |
| 309 | 3300049571 | Ga0501034_0019423 | Ga0501034_0019423_2999_3463 | 150 |
| 310 | 3300049571 | Ga0501034_1486216 | Ga0501034_1486216_65_529 | 150 |
| 311 | 3300049573 | Ga0501037_0079593 | Ga0501037_0079593_1442_1906 | 150 |
| 312 | 3300049574 | Ga0501038_0094474 | Ga0501038_0094474_1093_1557 | 150 |
| 313 | 3300049574 | Ga0501038_0116966 | Ga0501038_0116966_158_622 | 150 |
| 314 | 3300049580 | Ga0501046_0188683 | Ga0501046_0188683_385_849 | 150 |
| 315 | 3300049581 | Ga0501047_0027621 | Ga0501047_0027621_2191_2643 | 150 |
| 316 | 3300049584 | Ga0501068_0255865 | Ga0501068_0255865_106_570 | 150 |
| 317 | 3300049588 | Ga0501072_0126150 | Ga0501072_0126150_100_564 | 150 |
| 318 | 3300049590 | Ga0501074_0181014 | Ga0501074_0181014_671_1123 | 150 |
| 319 | 3300049592 | Ga0501076_0097685 | Ga0501076_0097685_1463_1927 | 150 |
| 320 | 3300049741 | Ga0501079_0249051 | Ga0501079_0249051_64_528 | 150 |
| 321 | 3300049742 | Ga0501080_0025570 | Ga0501080_0025570_2769_3233 | 150 |
| 322 | 3300049744 | Ga0501083_0260753 | Ga0501083_0260753_587_1051 | 150 |
| 323 | 3300049822 | Ga0501035_1126965 | Ga0501035_1126965_138_590 | 150 |
| 324 | 3300053086 | Ga0500578_0255685 | Ga0500578_0255685_368_859 | 150 |
| 325 | 3300053092 | Ga0500583_0126400 | Ga0500583_0126400_434_925 | 150 |
| 326 | 3300053093 | Ga0500651_0015153 | Ga0500651_0015153_3309_3800 | 150 |
| 327 | 3300053096 | Ga0500641_0203678 | Ga0500641_0203678_131_622 | 150 |
| 328 | 3300053098 | Ga0500650_0233241 | Ga0500650_0233241_17_481 | 150 |
| 329 | 3300053119 | Ga0500595_001355 | Ga0500595_001355_7755_8219 | 150 |
| 330 | 3300053119 | Ga0500595_023565 | Ga0500595_023565_54_545 | 150 |
| 331 | 3300053139 | Ga0500568_0122205 | Ga0500568_0122205_135_626 | 150 |
| 332 | 3300053153 | Ga0500616_0023631 | Ga0500616_0023631_86_547 | 150 |
| 333 | 3300054114 | Ga0501084_0557179 | Ga0501084_0557179_333_797 | 150 |
| 334 | 3300003215 | JGI25153J46596_10003982 | JGI25153J46596_100039827 | 151 |
| 335 | 3300005329 | Ga0070683_100553405 | Ga0070683_1005534052 | 151 |
| 336 | 3300005336 | Ga0070680_100511712 | Ga0070680_1005117121 | 151 |
| 337 | 3300005338 | Ga0068868_100605743 | Ga0068868_1006057432 | 151 |
| 338 | 3300005339 | Ga0070660_100797671 | Ga0070660_1007976712 | 151 |
| 339 | 3300005340 | Ga0070689_101706795 | Ga0070689_1017067952 | 151 |
| 340 | 3300005366 | Ga0070659_100983227 | Ga0070659_1009832271 | 151 |
| 341 | 3300005458 | Ga0070681_10277579 | Ga0070681_102775792 | 151 |
| 342 | 3300005530 | Ga0070679_100153842 | Ga0070679_1001538424 | 151 |
| 343 | 3300005530 | Ga0070679_100339329 | Ga0070679_1003393292 | 151 |
| 344 | 3300005530 | Ga0070679_100612729 | Ga0070679_1006127292 | 151 |
| 345 | 3300005563 | Ga0068855_100279388 | Ga0068855_1002793882 | 151 |
| 346 | 3300005577 | Ga0068857_100224548 | Ga0068857_1002245481 | 151 |
| 347 | 3300005616 | Ga0068852_100003198 | Ga0068852_1000031984 | 151 |
| 348 | 3300006038 | Ga0075365_10171638 | Ga0075365_101716382 | 151 |
| 349 | 3300006042 | Ga0075368_10057624 | Ga0075368_100576242 | 151 |
| 350 | 3300006051 | Ga0075364_10269518 | Ga0075364_102695182 | 151 |
| 351 | 3300006178 | Ga0075367_10102936 | Ga0075367_101029363 | 151 |
| 352 | 3300006195 | Ga0075366_10042179 | Ga0075366_100421792 | 151 |
| 353 | 3300009551 | Ga0105238_10057443 | Ga0105238_100574434 | 151 |
| 354 | 3300013102 | Ga0157371_10100708 | Ga0157371_101007083 | 151 |
| 355 | 3300013105 | Ga0157369_10711585 | Ga0157369_107115852 | 151 |
| 356 | 3300014325 | Ga0163163_11255517 | Ga0163163_112555171 | 151 |
| 357 | 3300025261 | Ga0209233_1004370 | Ga0209233_10043705 | 151 |
| 358 | 3300025297 | Ga0209758_1000241 | Ga0209758_100024159 | 151 |
| 359 | 3300025297 | Ga0209758_1023449 | Ga0209758_10234492 | 151 |
| 360 | 3300025302 | Ga0207426_1073757 | Ga0207426_10737572 | 151 |
| 361 | 3300025912 | Ga0207707_10407929 | Ga0207707_104079292 | 151 |
| 362 | 3300025921 | Ga0207652_10242651 | Ga0207652_102426512 | 151 |
| 363 | 3300025924 | Ga0207694_10012607 | Ga0207694_100126072 | 151 |
| 364 | 3300025929 | Ga0207664_10226888 | Ga0207664_102268883 | 151 |
| 365 | 3300025935 | Ga0207709_11003067 | Ga0207709_110030672 | 151 |
| 366 | 3300025936 | Ga0207670_11471753 | Ga0207670_114717531 | 151 |
| 367 | 3300025937 | Ga0207669_10236375 | Ga0207669_102363753 | 151 |
| 368 | 3300025944 | Ga0207661_10105082 | Ga0207661_101050822 | 151 |
| 369 | 3300025949 | Ga0207667_10056364 | Ga0207667_100563644 | 151 |
| 370 | 3300026116 | Ga0207674_10084893 | Ga0207674_100848935 | 151 |
| 371 | 3300028800 | Ga0265338_10052834 | Ga0265338_100528344 | 151 |
| 372 | 3300031235 | Ga0265330_10068599 | Ga0265330_100685992 | 151 |
| 373 | 3300031241 | Ga0265325_10038950 | Ga0265325_100389504 | 151 |
| 374 | 3300031241 | Ga0265325_10176622 | Ga0265325_101766222 | 151 |
| 375 | 3300031247 | Ga0265340_10068129 | Ga0265340_100681293 | 151 |
| 376 | 3300031247 | Ga0265340_10071067 | Ga0265340_100710673 | 151 |
| 377 | 3300031665 | Ga0316575_10037815 | Ga0316575_100378152 | 151 |
| 378 | 3300031712 | Ga0265342_10019701 | Ga0265342_100197014 | 151 |
| 379 | 3300032005 | Ga0307411_10321237 | Ga0307411_103212371 | 151 |
| 380 | 3300032133 | Ga0316583_10061899 | Ga0316583_100618992 | 151 |
| 381 | 3300046517 | Ga0495630_0266749 | Ga0495630_0266749_298_765 | 151 |
| 382 | 3300046663 | Ga0495635_0214234 | Ga0495635_0214234_566_1033 | 151 |
| 383 | 3300046689 | Ga0495613_0152670 | Ga0495613_0152670_929_1396 | 151 |
| 384 | 3300048904 | Ga0496101_0161222 | Ga0496101_0161222_70_537 | 151 |
| 385 | 3300048907 | Ga0496104_0000466 | Ga0496104_0000466_31950_32417 | 151 |
| 386 | 3300048907 | Ga0496104_0037354 | Ga0496104_0037354_543_1010 | 151 |
| 387 | 3300048908 | Ga0496105_0065868 | Ga0496105_0065868_1315_1782 | 151 |
| 388 | 3300048908 | Ga0496105_0096886 | Ga0496105_0096886_303_770 | 151 |
| 389 | 3300048916 | Ga0496113_0161068 | Ga0496113_0161068_1090_1557 | 151 |
| 390 | 3300048917 | Ga0496114_1746096 | Ga0496114_1746096_30_497 | 151 |
| 391 | 3300048918 | Ga0496115_0102241 | Ga0496115_0102241_877_1344 | 151 |
| 392 | 3300048918 | Ga0496115_0175057 | Ga0496115_0175057_14_481 | 151 |
| 393 | 3300050493 | nmdc:mga0k408_46093_c1 | nmdc:mga0k408_46093_c1_672_1130 | 151 |
| 394 | 3300050494 | nmdc:mga06z11_67121_c1 | nmdc:mga06z11_67121_c1_476_934 | 151 |
| 395 | 3300050508 | nmdc:mga09592_53150_c1 | nmdc:mga09592_53150_c1_2843_3313 | 151 |
| 396 | 3300050509 | nmdc:mga0qj67_11915_c1 | nmdc:mga0qj67_11915_c1_277_747 | 151 |
| 397 | 3300053077 | Ga0495601_0727061 | Ga0495601_0727061_152_619 | 151 |
| 398 | 3300053085 | Ga0495619_0062365 | Ga0495619_0062365_1429_1896 | 151 |
| 399 | 3300053085 | Ga0495619_0648577 | Ga0495619_0648577_119_586 | 151 |
| 400 | 3300053096 | Ga0500641_0018182 | Ga0500641_0018182_1883_2341 | 151 |
| 401 | 3300053119 | Ga0500595_113317 | Ga0500595_113317_247_705 | 151 |
| 402 | 3300053139 | Ga0500568_0177653 | Ga0500568_0177653_76_534 | 151 |
| 403 | 3300005336 | Ga0070680_100058826 | Ga0070680_1000588263 | 152 |
| 404 | 3300005337 | Ga0070682_100341631 | Ga0070682_1003416312 | 152 |
| 405 | 3300005344 | Ga0070661_100809478 | Ga0070661_1008094781 | 152 |
| 406 | 3300005434 | Ga0070709_10040154 | Ga0070709_100401542 | 152 |
| 407 | 3300005435 | Ga0070714_100155738 | Ga0070714_1001557382 | 152 |
| 408 | 3300005435 | Ga0070714_100667074 | Ga0070714_1006670742 | 152 |
| 409 | 3300005437 | Ga0070710_10017052 | Ga0070710_100170523 | 152 |
| 410 | 3300005439 | Ga0070711_100043265 | Ga0070711_1000432653 | 152 |
| 411 | 3300005458 | Ga0070681_10120499 | Ga0070681_101204993 | 152 |
| 412 | 3300005530 | Ga0070679_100057917 | Ga0070679_1000579173 | 152 |
| 413 | 3300005535 | Ga0070684_100090107 | Ga0070684_1000901073 | 152 |
| 414 | 3300005539 | Ga0068853_101176117 | Ga0068853_1011761171 | 152 |
| 415 | 3300005563 | Ga0068855_100128657 | Ga0068855_1001286572 | 152 |
| 416 | 3300005577 | Ga0068857_100255515 | Ga0068857_1002555152 | 152 |
| 417 | 3300005614 | Ga0068856_101114309 | Ga0068856_1011143091 | 152 |
| 418 | 3300005616 | Ga0068852_100260531 | Ga0068852_1002605312 | 152 |
| 419 | 3300005937 | Ga0081455_10323975 | Ga0081455_103239752 | 152 |
| 420 | 3300006163 | Ga0070715_10167979 | Ga0070715_101679792 | 152 |
| 421 | 3300006173 | Ga0070716_100070371 | Ga0070716_1000703712 | 152 |
| 422 | 3300006175 | Ga0070712_100044771 | Ga0070712_1000447712 | 152 |
| 423 | 3300006175 | Ga0070712_100390343 | Ga0070712_1003903432 | 152 |
| 424 | 3300009093 | Ga0105240_10175571 | Ga0105240_101755712 | 152 |
| 425 | 3300009551 | Ga0105238_10094621 | Ga0105238_100946214 | 152 |
| 426 | 3300013104 | Ga0157370_10230672 | Ga0157370_102306722 | 152 |
| 427 | 3300013105 | Ga0157369_10051616 | Ga0157369_100516162 | 152 |
| 428 | 3300021377 | Ga0213874_10274349 | Ga0213874_102743491 | 152 |
| 429 | 3300021384 | Ga0213876_10182100 | Ga0213876_101821001 | 152 |
| 430 | 3300021388 | Ga0213875_10180071 | Ga0213875_101800711 | 152 |
| 431 | 3300025898 | Ga0207692_10010941 | Ga0207692_100109412 | 152 |
| 432 | 3300025905 | Ga0207685_10097188 | Ga0207685_100971882 | 152 |
| 433 | 3300025906 | Ga0207699_10053415 | Ga0207699_100534153 | 152 |
| 434 | 3300025912 | Ga0207707_10792262 | Ga0207707_107922622 | 152 |
| 435 | 3300025915 | Ga0207693_10003341 | Ga0207693_100033415 | 152 |
| 436 | 3300025915 | Ga0207693_10033429 | Ga0207693_100334293 | 152 |
| 437 | 3300025915 | Ga0207693_10815645 | Ga0207693_108156452 | 152 |
| 438 | 3300025916 | Ga0207663_10078055 | Ga0207663_100780553 | 152 |
| 439 | 3300025916 | Ga0207663_10148579 | Ga0207663_101485792 | 152 |
| 440 | 3300025917 | Ga0207660_10031348 | Ga0207660_100313483 | 152 |
| 441 | 3300025921 | Ga0207652_10274304 | Ga0207652_102743042 | 152 |
| 442 | 3300025924 | Ga0207694_10116921 | Ga0207694_101169213 | 152 |
| 443 | 3300025929 | Ga0207664_10075575 | Ga0207664_100755751 | 152 |
| 444 | 3300025929 | Ga0207664_10578297 | Ga0207664_105782972 | 152 |
| 445 | 3300025939 | Ga0207665_10620394 | Ga0207665_106203941 | 152 |
| 446 | 3300025944 | Ga0207661_10907086 | Ga0207661_109070862 | 152 |
| 447 | 3300026041 | Ga0207639_11028744 | Ga0207639_110287442 | 152 |
| 448 | 3300026078 | Ga0207702_10054857 | Ga0207702_100548573 | 152 |
| 449 | 3300026116 | Ga0207674_10418858 | Ga0207674_104188582 | 152 |
| 450 | 3300031241 | Ga0265325_10052164 | Ga0265325_100521642 | 152 |
| 451 | 3300031241 | Ga0265325_10068906 | Ga0265325_100689063 | 152 |
| 452 | 3300031242 | Ga0265329_10035980 | Ga0265329_100359802 | 152 |
| 453 | 3300031249 | Ga0265339_10041296 | Ga0265339_100412964 | 152 |
| 454 | 3300031344 | Ga0265316_10051052 | Ga0265316_100510522 | 152 |
| 455 | 3300031595 | Ga0265313_10156634 | Ga0265313_101566341 | 152 |
| 456 | 3300031595 | Ga0265313_10237970 | Ga0265313_102379702 | 152 |
| 457 | 3300031665 | Ga0316575_10032856 | Ga0316575_100328563 | 152 |
| 458 | 3300031901 | Ga0307406_10866612 | Ga0307406_108666121 | 152 |
| 459 | 3300031911 | Ga0307412_10903371 | Ga0307412_109033712 | 152 |
| 460 | 3300031995 | Ga0307409_100534704 | Ga0307409_1005347042 | 152 |
| 461 | 3300035117 | Ga0373953_0006532 | Ga0373953_0006532_794_1258 | 152 |
| 462 | 3300035119 | Ga0373956_0266313 | Ga0373956_0266313_340_804 | 152 |
| 463 | 3300035120 | Ga0373957_0156575 | Ga0373957_0156575_449_913 | 152 |
| 464 | 3300035724 | Ga0373933_0013093 | Ga0373933_0013093_3626_4090 | 152 |
| 465 | 3300035725 | Ga0373947_0037363 | Ga0373947_0037363_916_1380 | 152 |
| 466 | 3300036401 | Ga0373937_0032624 | Ga0373937_0032624_2478_2942 | 152 |
| 467 | 3300036401 | Ga0373937_0158761 | Ga0373937_0158761_245_709 | 152 |
| 468 | 3300039437 | Ga0436365_0097464 | Ga0436365_0097464_1758_2222 | 152 |
| 469 | 3300039437 | Ga0436365_0484144 | Ga0436365_0484144_2919_3383 | 152 |
| 470 | 3300039447 | Ga0436361_0575185 | Ga0436361_0575185_116_580 | 152 |
| 471 | 3300039447 | Ga0436361_0713927 | Ga0436361_0713927_1714_2178 | 152 |
| 472 | 3300039447 | Ga0436361_0912045 | Ga0436361_0912045_374_838 | 152 |
| 473 | 3300039450 | Ga0436363_0781422 | Ga0436363_0781422_664_1128 | 152 |
| 474 | 3300046454 | Ga0495592_0028916 | Ga0495592_0028916_3552_4016 | 152 |
| 475 | 3300046461 | Ga0495641_0338412 | Ga0495641_0338412_15_479 | 152 |
| 476 | 3300046462 | Ga0495651_0027032 | Ga0495651_0027032_3469_3933 | 152 |
| 477 | 3300046477 | Ga0495664_0065939 | Ga0495664_0065939_1545_2009 | 152 |
| 478 | 3300046492 | Ga0495585_0279205 | Ga0495585_0279205_43_507 | 152 |
| 479 | 3300046516 | Ga0495628_0013822 | Ga0495628_0013822_3526_3990 | 152 |
| 480 | 3300046529 | Ga0495652_0001261 | Ga0495652_0001261_17095_17559 | 152 |
| 481 | 3300046533 | Ga0495640_0612999 | Ga0495640_0612999_63_527 | 152 |
| 482 | 3300046536 | Ga0495587_0019419 | Ga0495587_0019419_2685_3149 | 152 |
| 483 | 3300046543 | Ga0495645_0005294 | Ga0495645_0005294_4608_5072 | 152 |
| 484 | 3300046559 | Ga0495667_0000827 | Ga0495667_0000827_931_1395 | 152 |
| 485 | 3300046663 | Ga0495635_0219767 | Ga0495635_0219767_550_1014 | 152 |
| 486 | 3300046675 | Ga0495657_0070049 | Ga0495657_0070049_499_963 | 152 |
| 487 | 3300046678 | Ga0495599_0021479 | Ga0495599_0021479_98_562 | 152 |
| 488 | 3300046679 | Ga0495623_0033261 | Ga0495623_0033261_593_1057 | 152 |
| 489 | 3300046692 | Ga0495671_0417454 | Ga0495671_0417454_128_592 | 152 |
| 490 | 3300046809 | Ga0495600_0003565 | Ga0495600_0003565_6157_6621 | 152 |
| 491 | 3300047317 | Ga0495604_0024966 | Ga0495604_0024966_3562_4026 | 152 |
| 492 | 3300047319 | Ga0495674_0031760 | Ga0495674_0031760_3464_3928 | 152 |
| 493 | 3300047322 | Ga0495680_0002516 | Ga0495680_0002516_15038_15502 | 152 |
| 494 | 3300048088 | Ga0495602_0319331 | Ga0495602_0319331_64_528 | 152 |
| 495 | 3300048904 | Ga0496101_0122929 | Ga0496101_0122929_140_604 | 152 |
| 496 | 3300048905 | Ga0496102_0242393 | Ga0496102_0242393_1138_1602 | 152 |
| 497 | 3300048907 | Ga0496104_0000061 | Ga0496104_0000061_116725_117189 | 152 |
| 498 | 3300048907 | Ga0496104_0370878 | Ga0496104_0370878_316_780 | 152 |
| 499 | 3300048908 | Ga0496105_0010551 | Ga0496105_0010551_3533_3997 | 152 |
| 500 | 3300048910 | Ga0496107_1196088 | Ga0496107_1196088_62_526 | 152 |
| 501 | 3300048911 | Ga0496108_0354337 | Ga0496108_0354337_635_1099 | 152 |
| 502 | 3300048914 | Ga0496111_0874556 | Ga0496111_0874556_119_583 | 152 |
| 503 | 3300048915 | Ga0496112_0350430 | Ga0496112_0350430_649_1113 | 152 |
| 504 | 3300048917 | Ga0496114_0182841 | Ga0496114_0182841_459_923 | 152 |
| 505 | 3300048918 | Ga0496115_0039483 | Ga0496115_0039483_2422_2886 | 152 |
| 506 | 3300049569 | Ga0501032_0790571 | Ga0501032_0790571_34_498 | 152 |
| 507 | 3300049581 | Ga0501047_0168171 | Ga0501047_0168171_1587_2051 | 152 |
| 508 | 3300049586 | Ga0501070_0349007 | Ga0501070_0349007_206_676 | 152 |
| 509 | 3300049590 | Ga0501074_0178982 | Ga0501074_0178982_941_1411 | 152 |
| 510 | 3300049744 | Ga0501083_0587899 | Ga0501083_0587899_21_485 | 152 |
| 511 | 3300049822 | Ga0501035_0141678 | Ga0501035_0141678_115_585 | 152 |
| 512 | 3300049822 | Ga0501035_1375755 | Ga0501035_1375755_26_526 | 152 |
| 513 | 3300053077 | Ga0495601_0000153 | Ga0495601_0000153_28458_28922 | 152 |
| 514 | 3300053077 | Ga0495601_0036305 | Ga0495601_0036305_2216_2680 | 152 |
| 515 | 3300053078 | Ga0495612_0001586 | Ga0495612_0001586_5257_5721 | 152 |
| 516 | 3300053084 | Ga0495595_0000328 | Ga0495595_0000328_12697_13161 | 152 |
| 517 | 3300053085 | Ga0495619_0001072 | Ga0495619_0001072_3584_4048 | 152 |
| 518 | 3300053085 | Ga0495619_0011608 | Ga0495619_0011608_3852_4316 | 152 |
| 519 | 3300053085 | Ga0495619_0073167 | Ga0495619_0073167_908_1372 | 152 |
| 520 | 3300053087 | Ga0500643_000795 | Ga0500643_000795_6052_6516 | 152 |
| 521 | 3300053088 | Ga0500644_0023522 | Ga0500644_0023522_1221_1685 | 152 |
| 522 | 3300053111 | Ga0500572_102966 | Ga0500572_102966_144_608 | 152 |
| 523 | 3300053119 | Ga0500595_000001 | Ga0500595_000001_329622_330086 | 152 |
| 524 | 3300053131 | Ga0500652_014253 | Ga0500652_014253_884_1348 | 152 |
| 525 | 3300053153 | Ga0500616_0000001 | Ga0500616_0000001_1647875_1648339 | 152 |
| 526 | 3300053730 | Ga0500645_000015 | Ga0500645_000015_140780_141244 | 152 |
| 527 | 3300003323 | rootH1_10113021 | rootH1_101130212 | 153 |
| 528 | 3300005334 | Ga0068869_100953368 | Ga0068869_1009533681 | 153 |
| 529 | 3300005343 | Ga0070687_100833700 | Ga0070687_1008337001 | 153 |
| 530 | 3300005439 | Ga0070711_100008900 | Ga0070711_1000089001 | 153 |
| 531 | 3300005548 | Ga0070665_100215246 | Ga0070665_1002152462 | 153 |
| 532 | 3300005840 | Ga0068870_10588744 | Ga0068870_105887442 | 153 |
| 533 | 3300006048 | Ga0075363_100025836 | Ga0075363_1000258362 | 153 |
| 534 | 3300006051 | Ga0075364_10012460 | Ga0075364_100124604 | 153 |
| 535 | 3300006177 | Ga0075362_10055834 | Ga0075362_100558342 | 153 |
| 536 | 3300006178 | Ga0075367_10107828 | Ga0075367_101078282 | 153 |
| 537 | 3300006195 | Ga0075366_10038723 | Ga0075366_100387232 | 153 |
| 538 | 3300006195 | Ga0075366_10501080 | Ga0075366_105010801 | 153 |
| 539 | 3300006353 | Ga0075370_10150533 | Ga0075370_101505333 | 153 |
| 540 | 3300009094 | Ga0111539_10048105 | Ga0111539_100481056 | 153 |
| 541 | 3300009147 | Ga0114129_11177876 | Ga0114129_111778762 | 153 |
| 542 | 3300011119 | Ga0105246_12582018 | Ga0105246_125820181 | 153 |
| 543 | 3300013306 | Ga0163162_10631073 | Ga0163162_106310732 | 153 |
| 544 | 3300021361 | Ga0213872_10036087 | Ga0213872_100360873 | 153 |
| 545 | 3300025916 | Ga0207663_10700974 | Ga0207663_107009741 | 153 |
| 546 | 3300028379 | Ga0268266_11311795 | Ga0268266_113117951 | 153 |
| 547 | 3300031249 | Ga0265339_10139913 | Ga0265339_101399131 | 153 |
| 548 | 3300031712 | Ga0265342_10307568 | Ga0265342_103075682 | 153 |
| 549 | 3300039447 | Ga0436361_0531564 | Ga0436361_0531564_1289_1756 | 153 |
| 550 | 3300041408 | Ga0439453_0118227 | Ga0439453_0118227_77_544 | 153 |
| 551 | 3300046531 | Ga0495665_0000743 | Ga0495665_0000743_16_480 | 153 |
| 552 | 3300049569 | Ga0501032_0041744 | Ga0501032_0041744_2137_2604 | 153 |
| 553 | 3300049570 | Ga0501033_0195466 | Ga0501033_0195466_523_990 | 153 |
| 554 | 3300049571 | Ga0501034_0051283 | Ga0501034_0051283_443_910 | 153 |
| 555 | 3300049571 | Ga0501034_0503955 | Ga0501034_0503955_315_782 | 153 |
| 556 | 3300049572 | Ga0501036_0048401 | Ga0501036_0048401_2288_2755 | 153 |
| 557 | 3300049572 | Ga0501036_0469076 | Ga0501036_0469076_528_995 | 153 |
| 558 | 3300049573 | Ga0501037_0047256 | Ga0501037_0047256_1302_1769 | 153 |
| 559 | 3300049575 | Ga0501039_0068228 | Ga0501039_0068228_463_930 | 153 |
| 560 | 3300049575 | Ga0501039_0389967 | Ga0501039_0389967_499_966 | 153 |
| 561 | 3300049579 | Ga0501043_0441500 | Ga0501043_0441500_402_869 | 153 |
| 562 | 3300049579 | Ga0501043_0535467 | Ga0501043_0535467_325_792 | 153 |
| 563 | 3300049581 | Ga0501047_0132797 | Ga0501047_0132797_1234_1701 | 153 |
| 564 | 3300049581 | Ga0501047_0168383 | Ga0501047_0168383_250_750 | 153 |
| 565 | 3300049581 | Ga0501047_0744340 | Ga0501047_0744340_128_595 | 153 |
| 566 | 3300049586 | Ga0501070_0193436 | Ga0501070_0193436_681_1148 | 153 |
| 567 | 3300049586 | Ga0501070_0322054 | Ga0501070_0322054_571_1038 | 153 |
| 568 | 3300049822 | Ga0501035_0064435 | Ga0501035_0064435_2215_2682 | 153 |
| 569 | 3300049823 | Ga0501044_1244775 | Ga0501044_1244775_29_496 | 153 |
| 570 | 3300050489 | nmdc:mga03683_48716_c1 | nmdc:mga03683_48716_c1_452_919 | 153 |
| 571 | 3300050491 | nmdc:mga00v17_32752_c1 | nmdc:mga00v17_32752_c1_655_1122 | 153 |
| 572 | 3300050493 | nmdc:mga0k408_25879_c1 | nmdc:mga0k408_25879_c1_2496_2963 | 153 |
| 573 | 3300050494 | nmdc:mga06z11_249790_c1 | nmdc:mga06z11_249790_c1_329_796 | 153 |
| 574 | 3300050495 | nmdc:mga04h51_54295_c1 | nmdc:mga04h51_54295_c1_10_477 | 153 |
| 575 | 3300050507 | nmdc:mga05p37_6363_c1 | nmdc:mga05p37_6363_c1_137_607 | 153 |
| 576 | 3300050507 | nmdc:mga05p37_728542_c1 | nmdc:mga05p37_728542_c1_446_916 | 153 |
| 577 | 3300050508 | nmdc:mga09592_2569_c1 | nmdc:mga09592_2569_c1_1628_2098 | 153 |
| 578 | 3300050509 | nmdc:mga0qj67_1654_c1 | nmdc:mga0qj67_1654_c1_9307_9777 | 153 |
| 579 | 3300050510 | nmdc:mga06r32_4586_c1 | nmdc:mga06r32_4586_c1_6877_7347 | 153 |
| 580 | 3300050511 | nmdc:mga08y16_113197_c1 | nmdc:mga08y16_113197_c1_1719_2189 | 153 |
| 581 | 3300050512 | nmdc:mga0n895_2123_c1 | nmdc:mga0n895_2123_c1_5524_5994 | 153 |
| 582 | 3300050513 | nmdc:mga0rr50_5265_c1 | nmdc:mga0rr50_5265_c1_1654_2124 | 153 |
| 583 | 3300050514 | nmdc:mga08x19_176190_c1 | nmdc:mga08x19_176190_c1_136_606 | 153 |
| 584 | 3300050515 | nmdc:mga0a205_54427_c1 | nmdc:mga0a205_54427_c1_1001_1471 | 153 |
| 585 | 3300061719 | Ga0466962_0174953 | Ga0466962_0174953_318_818 | 153 |
| 586 | 3300005331 | Ga0070670_101789424 | Ga0070670_1017894241 | 154 |
| 587 | 3300005340 | Ga0070689_100746381 | Ga0070689_1007463812 | 154 |
| 588 | 3300005354 | Ga0070675_100053131 | Ga0070675_1000531313 | 154 |
| 589 | 3300005365 | Ga0070688_100926366 | Ga0070688_1009263662 | 154 |
| 590 | 3300005436 | Ga0070713_100696588 | Ga0070713_1006965882 | 154 |
| 591 | 3300009177 | Ga0105248_11677516 | Ga0105248_116775162 | 154 |
| 592 | 3300012507 | Ga0157342_1013783 | Ga0157342_10137831 | 154 |
| 593 | 3300013296 | Ga0157374_10771956 | Ga0157374_107719562 | 154 |
| 594 | 3300014325 | Ga0163163_11243048 | Ga0163163_112430482 | 154 |
| 595 | 3300014969 | Ga0157376_11212177 | Ga0157376_112121772 | 154 |
| 596 | 3300025925 | Ga0207650_10712331 | Ga0207650_107123312 | 154 |
| 597 | 3300025928 | Ga0207700_10685985 | Ga0207700_106859852 | 154 |
| 598 | 3300025936 | Ga0207670_10118200 | Ga0207670_101182002 | 154 |
| 599 | 3300025961 | Ga0207712_10369772 | Ga0207712_103697722 | 154 |
| 600 | 3300034817 | Ga0373948_0021352 | Ga0373948_0021352_260_727 | 154 |
| 601 | 3300034818 | Ga0373950_0005708 | Ga0373950_0005708_785_1252 | 154 |
| 602 | 3300035091 | Ga0373951_0075387 | Ga0373951_0075387_250_717 | 154 |
| 603 | 3300035116 | Ga0373945_0068147 | Ga0373945_0068147_742_1209 | 154 |
| 604 | 3300035119 | Ga0373956_0056820 | Ga0373956_0056820_1122_1589 | 154 |
| 605 | 3300035170 | Ga0373943_0045452 | Ga0373943_0045452_604_1071 | 154 |
| 606 | 3300035695 | Ga0373927_0002017 | Ga0373927_0002017_8867_9334 | 154 |
| 607 | 3300035725 | Ga0373947_0028888 | Ga0373947_0028888_1552_2019 | 154 |
| 608 | 3300037068 | Ga0373925_0004980 | Ga0373925_0004980_640_1107 | 154 |
| 609 | 3300037853 | Ga0436364_0454045 | Ga0436364_0454045_212_748 | 154 |
| 610 | 3300039437 | Ga0436365_0932459 | Ga0436365_0932459_25455_25934 | 154 |
| 611 | 3300039453 | Ga0436362_0900768 | Ga0436362_0900768_1085_1564 | 154 |
| 612 | 3300046452 | Ga0495617_036246 | Ga0495617_036246_703_1170 | 154 |
| 613 | 3300046454 | Ga0495592_0011627 | Ga0495592_0011627_1473_1940 | 154 |
| 614 | 3300046459 | Ga0495629_0005121 | Ga0495629_0005121_2228_2695 | 154 |
| 615 | 3300046461 | Ga0495641_0006685 | Ga0495641_0006685_4918_5385 | 154 |
| 616 | 3300046462 | Ga0495651_0002175 | Ga0495651_0002175_3239_3706 | 154 |
| 617 | 3300046463 | Ga0495653_0002883 | Ga0495653_0002883_767_1234 | 154 |
| 618 | 3300046472 | Ga0495580_0012507 | Ga0495580_0012507_3374_3841 | 154 |
| 619 | 3300046474 | Ga0495605_0073936 | Ga0495605_0073936_479_946 | 154 |
| 620 | 3300046475 | Ga0495639_0000713 | Ga0495639_0000713_65_532 | 154 |
| 621 | 3300046476 | Ga0495662_0000084 | Ga0495662_0000084_8839_9306 | 154 |
| 622 | 3300046491 | Ga0495584_0063809 | Ga0495584_0063809_429_896 | 154 |
| 623 | 3300046492 | Ga0495585_0004511 | Ga0495585_0004511_341_808 | 154 |
| 624 | 3300046499 | Ga0495594_0013840 | Ga0495594_0013840_1234_1701 | 154 |
| 625 | 3300046501 | Ga0495607_0038927 | Ga0495607_0038927_292_759 | 154 |
| 626 | 3300046511 | Ga0495608_0023449 | Ga0495608_0023449_2530_2997 | 154 |
| 627 | 3300046514 | Ga0495618_0007354 | Ga0495618_0007354_1234_1701 | 154 |
| 628 | 3300046516 | Ga0495628_0007423 | Ga0495628_0007423_2243_2710 | 154 |
| 629 | 3300046516 | Ga0495628_0482464 | Ga0495628_0482464_162_632 | 154 |
| 630 | 3300046517 | Ga0495630_0004290 | Ga0495630_0004290_8429_8896 | 154 |
| 631 | 3300046526 | Ga0495666_0041063 | Ga0495666_0041063_1233_1700 | 154 |
| 632 | 3300046529 | Ga0495652_0007683 | Ga0495652_0007683_2228_2695 | 154 |
| 633 | 3300046531 | Ga0495665_0113550 | Ga0495665_0113550_872_1339 | 154 |
| 634 | 3300046533 | Ga0495640_0043559 | Ga0495640_0043559_1106_1573 | 154 |
| 635 | 3300046558 | Ga0495633_0005344 | Ga0495633_0005344_1859_2326 | 154 |
| 636 | 3300046559 | Ga0495667_0000202 | Ga0495667_0000202_13733_14200 | 154 |
| 637 | 3300046615 | Ga0495656_0030187 | Ga0495656_0030187_1136_1603 | 154 |
| 638 | 3300046642 | Ga0495634_0005317 | Ga0495634_0005317_2356_2823 | 154 |
| 639 | 3300046648 | Ga0495611_0046030 | Ga0495611_0046030_917_1384 | 154 |
| 640 | 3300046663 | Ga0495635_0000399 | Ga0495635_0000399_12154_12621 | 154 |
| 641 | 3300046665 | Ga0495661_0163713 | Ga0495661_0163713_424_891 | 154 |
| 642 | 3300046674 | Ga0495588_0004780 | Ga0495588_0004780_1927_2394 | 154 |
| 643 | 3300046674 | Ga0495588_0328104 | Ga0495588_0328104_230_697 | 154 |
| 644 | 3300046680 | Ga0495646_0006797 | Ga0495646_0006797_3573_4040 | 154 |
| 645 | 3300046681 | Ga0495647_0004774 | Ga0495647_0004774_52_519 | 154 |
| 646 | 3300046681 | Ga0495647_0089419 | Ga0495647_0089419_287_754 | 154 |
| 647 | 3300046683 | Ga0495658_0003756 | Ga0495658_0003756_2292_2759 | 154 |
| 648 | 3300046689 | Ga0495613_0001462 | Ga0495613_0001462_7097_7564 | 154 |
| 649 | 3300046690 | Ga0495624_0000222 | Ga0495624_0000222_30109_30576 | 154 |
| 650 | 3300046691 | Ga0495670_0117922 | Ga0495670_0117922_139_606 | 154 |
| 651 | 3300046809 | Ga0495600_0003235 | Ga0495600_0003235_1773_2240 | 154 |
| 652 | 3300047315 | Ga0495581_0000145 | Ga0495581_0000145_17508_17975 | 154 |
| 653 | 3300047317 | Ga0495604_0005816 | Ga0495604_0005816_1424_1891 | 154 |
| 654 | 3300047319 | Ga0495674_0007404 | Ga0495674_0007404_8839_9306 | 154 |
| 655 | 3300047321 | Ga0495676_0801921 | Ga0495676_0801921_80_547 | 154 |
| 656 | 3300047471 | Ga0495684_0000075 | Ga0495684_0000075_37952_38419 | 154 |
| 657 | 3300047673 | Ga0495593_0000228 | Ga0495593_0000228_20997_21464 | 154 |
| 658 | 3300048089 | Ga0495614_0013343 | Ga0495614_0013343_1576_2043 | 154 |
| 659 | 3300048928 | Ga0496125_0209377 | Ga0496125_0209377_696_1163 | 154 |
| 660 | 3300053077 | Ga0495601_0010084 | Ga0495601_0010084_4963_5430 | 154 |
| 661 | 3300053084 | Ga0495595_0000988 | Ga0495595_0000988_9070_9537 | 154 |
| 662 | 3300053085 | Ga0495619_0001117 | Ga0495619_0001117_13461_13928 | 154 |
| 663 | 2209111006 | 2214800760 | 2213830106 | 155 |
| 664 | 3300000041 | ARcpr5oldR_c000187 | ARcpr5oldR_0001878 | 155 |
| 665 | 3300000042 | ARSoilYngRDRAFT_c00132 | ARSoilYngRDRAFT_001323 | 155 |
| 666 | 3300000043 | ARcpr5yngRDRAFT_c000643 | ARcpr5yngRDRAFT_0006433 | 155 |
| 667 | 3300000044 | ARSoilOldRDRAFT_c000044 | ARSoilOldRDRAFT_00004423 | 155 |
| 668 | 3300000045 | ARCol0oldRDRAFT_c00484 | ARCol0oldRDRAFT_004844 | 155 |
| 669 | 3300000652 | ARCol0yngRDRAFT_1000153 | ARCol0yngRDRAFT_10001539 | 155 |
| 670 | 3300001430 | JGI24032J14994_101472 | JGI24032J14994_1014722 | 155 |
| 671 | 3300001915 | JGI24741J21665_1025315 | JGI24741J21665_10253152 | 155 |
| 672 | 3300001976 | JGI24752J21851_1016260 | JGI24752J21851_10162602 | 155 |
| 673 | 3300001977 | JGI24746J21847_1005317 | JGI24746J21847_10053173 | 155 |
| 674 | 3300001978 | JGI24747J21853_1014220 | JGI24747J21853_10142201 | 155 |
| 675 | 3300001989 | JGI24739J22299_10024622 | JGI24739J22299_100246223 | 155 |
| 676 | 3300001990 | JGI24737J22298_10006807 | JGI24737J22298_100068075 | 155 |
| 677 | 3300001990 | JGI24737J22298_10007788 | JGI24737J22298_100077884 | 155 |
| 678 | 3300001990 | JGI24737J22298_10024518 | JGI24737J22298_100245183 | 155 |
| 679 | 3300002073 | JGI24745J21846_1002155 | JGI24745J21846_10021552 | 155 |
| 680 | 3300002075 | JGI24738J21930_10016553 | JGI24738J21930_100165532 | 155 |
| 681 | 3300002076 | JGI24749J21850_1004742 | JGI24749J21850_10047422 | 155 |
| 682 | 3300002076 | JGI24749J21850_1005739 | JGI24749J21850_10057393 | 155 |
| 683 | 3300002126 | JGI24035J26624_1001878 | JGI24035J26624_10018782 | 155 |
| 684 | 3300002155 | JGI24033J26618_1016316 | JGI24033J26618_10163162 | 155 |
| 685 | 3300002239 | JGI24034J26672_10012906 | JGI24034J26672_100129062 | 155 |
| 686 | 3300002244 | JGI24742J22300_10002556 | JGI24742J22300_100025562 | 155 |
| 687 | 3300005290 | Ga0065712_10073820 | Ga0065712_100738204 | 155 |
| 688 | 3300005293 | Ga0065715_10096283 | Ga0065715_100962834 | 155 |
| 689 | 3300005328 | Ga0070676_10000985 | Ga0070676_100009857 | 155 |
| 690 | 3300005329 | Ga0070683_100001244 | Ga0070683_10000124418 | 155 |
| 691 | 3300005329 | Ga0070683_100645113 | Ga0070683_1006451132 | 155 |
| 692 | 3300005330 | Ga0070690_100012869 | Ga0070690_1000128694 | 155 |
| 693 | 3300005330 | Ga0070690_100026138 | Ga0070690_1000261384 | 155 |
| 694 | 3300005330 | Ga0070690_100506992 | Ga0070690_1005069922 | 155 |
| 695 | 3300005331 | Ga0070670_100012785 | Ga0070670_1000127856 | 155 |
| 696 | 3300005333 | Ga0070677_10006769 | Ga0070677_100067692 | 155 |
| 697 | 3300005334 | Ga0068869_100027806 | Ga0068869_1000278064 | 155 |
| 698 | 3300005334 | Ga0068869_100198362 | Ga0068869_1001983622 | 155 |
| 699 | 3300005335 | Ga0070666_10054336 | Ga0070666_100543363 | 155 |
| 700 | 3300005335 | Ga0070666_10178291 | Ga0070666_101782912 | 155 |
| 701 | 3300005335 | Ga0070666_10481090 | Ga0070666_104810901 | 155 |
| 702 | 3300005336 | Ga0070680_100044451 | Ga0070680_1000444512 | 155 |
| 703 | 3300005337 | Ga0070682_100029667 | Ga0070682_1000296674 | 155 |
| 704 | 3300005337 | Ga0070682_100115799 | Ga0070682_1001157992 | 155 |
| 705 | 3300005338 | Ga0068868_100004160 | Ga0068868_1000041605 | 155 |
| 706 | 3300005339 | Ga0070660_100000525 | Ga0070660_1000005257 | 155 |
| 707 | 3300005339 | Ga0070660_100059117 | Ga0070660_1000591172 | 155 |
| 708 | 3300005340 | Ga0070689_100135170 | Ga0070689_1001351702 | 155 |
| 709 | 3300005341 | Ga0070691_10002569 | Ga0070691_100025694 | 155 |
| 710 | 3300005341 | Ga0070691_10179444 | Ga0070691_101794442 | 155 |
| 711 | 3300005343 | Ga0070687_100082377 | Ga0070687_1000823772 | 155 |
| 712 | 3300005343 | Ga0070687_100171850 | Ga0070687_1001718501 | 155 |
| 713 | 3300005344 | Ga0070661_100004361 | Ga0070661_1000043617 | 155 |
| 714 | 3300005345 | Ga0070692_10009575 | Ga0070692_100095754 | 155 |
| 715 | 3300005345 | Ga0070692_10017346 | Ga0070692_100173462 | 155 |
| 716 | 3300005347 | Ga0070668_100015096 | Ga0070668_1000150967 | 155 |
| 717 | 3300005347 | Ga0070668_100112572 | Ga0070668_1001125723 | 155 |
| 718 | 3300005353 | Ga0070669_100002142 | Ga0070669_10000214211 | 155 |
| 719 | 3300005353 | Ga0070669_100012165 | Ga0070669_1000121652 | 155 |
| 720 | 3300005354 | Ga0070675_100696796 | Ga0070675_1006967962 | 155 |
| 721 | 3300005355 | Ga0070671_100005408 | Ga0070671_1000054086 | 155 |
| 722 | 3300005356 | Ga0070674_100001208 | Ga0070674_10000120811 | 155 |
| 723 | 3300005356 | Ga0070674_100602417 | Ga0070674_1006024172 | 155 |
| 724 | 3300005364 | Ga0070673_100006682 | Ga0070673_1000066823 | 155 |
| 725 | 3300005364 | Ga0070673_100331008 | Ga0070673_1003310082 | 155 |
| 726 | 3300005365 | Ga0070688_100001615 | Ga0070688_1000016154 | 155 |
| 727 | 3300005365 | Ga0070688_100002125 | Ga0070688_10000212511 | 155 |
| 728 | 3300005366 | Ga0070659_100452047 | Ga0070659_1004520472 | 155 |
| 729 | 3300005367 | Ga0070667_100018716 | Ga0070667_1000187166 | 155 |
| 730 | 3300005367 | Ga0070667_100027679 | Ga0070667_1000276795 | 155 |
| 731 | 3300005367 | Ga0070667_100041879 | Ga0070667_1000418794 | 155 |
| 732 | 3300005406 | Ga0070703_10018531 | Ga0070703_100185312 | 155 |
| 733 | 3300005406 | Ga0070703_10108693 | Ga0070703_101086931 | 155 |
| 734 | 3300005434 | Ga0070709_10137388 | Ga0070709_101373882 | 155 |
| 735 | 3300005436 | Ga0070713_100014447 | Ga0070713_1000144475 | 155 |
| 736 | 3300005436 | Ga0070713_100277870 | Ga0070713_1002778702 | 155 |
| 737 | 3300005436 | Ga0070713_100452867 | Ga0070713_1004528672 | 155 |
| 738 | 3300005437 | Ga0070710_10036006 | Ga0070710_100360064 | 155 |
| 739 | 3300005437 | Ga0070710_10139034 | Ga0070710_101390342 | 155 |
| 740 | 3300005438 | Ga0070701_10000532 | Ga0070701_100005325 | 155 |
| 741 | 3300005439 | Ga0070711_100104380 | Ga0070711_1001043802 | 155 |
| 742 | 3300005440 | Ga0070705_100006339 | Ga0070705_1000063396 | 155 |
| 743 | 3300005440 | Ga0070705_100150389 | Ga0070705_1001503892 | 155 |
| 744 | 3300005440 | Ga0070705_101508158 | Ga0070705_1015081581 | 155 |
| 745 | 3300005441 | Ga0070700_100031664 | Ga0070700_1000316643 | 155 |
| 746 | 3300005444 | Ga0070694_100001428 | Ga0070694_10000142812 | 155 |
| 747 | 3300005444 | Ga0070694_100002143 | Ga0070694_1000021438 | 155 |
| 748 | 3300005445 | Ga0070708_100046627 | Ga0070708_1000466273 | 155 |
| 749 | 3300005445 | Ga0070708_100328671 | Ga0070708_1003286712 | 155 |
| 750 | 3300005455 | Ga0070663_100046288 | Ga0070663_1000462884 | 155 |
| 751 | 3300005455 | Ga0070663_100085578 | Ga0070663_1000855782 | 155 |
| 752 | 3300005455 | Ga0070663_100173614 | Ga0070663_1001736142 | 155 |
| 753 | 3300005456 | Ga0070678_100026205 | Ga0070678_1000262053 | 155 |
| 754 | 3300005456 | Ga0070678_100056901 | Ga0070678_1000569012 | 155 |
| 755 | 3300005457 | Ga0070662_100034625 | Ga0070662_1000346255 | 155 |
| 756 | 3300005458 | Ga0070681_10017611 | Ga0070681_100176119 | 155 |
| 757 | 3300005458 | Ga0070681_10133801 | Ga0070681_101338012 | 155 |
| 758 | 3300005458 | Ga0070681_10295426 | Ga0070681_102954262 | 155 |
| 759 | 3300005458 | Ga0070681_11234113 | Ga0070681_112341131 | 155 |
| 760 | 3300005459 | Ga0068867_100007122 | Ga0068867_1000071227 | 155 |
| 761 | 3300005459 | Ga0068867_100090816 | Ga0068867_1000908163 | 155 |
| 762 | 3300005459 | Ga0068867_100384372 | Ga0068867_1003843721 | 155 |
| 763 | 3300005466 | Ga0070685_10006338 | Ga0070685_100063387 | 155 |
| 764 | 3300005466 | Ga0070685_10010065 | Ga0070685_100100654 | 155 |
| 765 | 3300005468 | Ga0070707_101332321 | Ga0070707_1013323211 | 155 |
| 766 | 3300005530 | Ga0070679_100008193 | Ga0070679_1000081937 | 155 |
| 767 | 3300005530 | Ga0070679_100058535 | Ga0070679_1000585354 | 155 |
| 768 | 3300005530 | Ga0070679_100186809 | Ga0070679_1001868092 | 155 |
| 769 | 3300005530 | Ga0070679_100602214 | Ga0070679_1006022142 | 155 |
| 770 | 3300005535 | Ga0070684_100135689 | Ga0070684_1001356893 | 155 |
| 771 | 3300005535 | Ga0070684_100227057 | Ga0070684_1002270572 | 155 |
| 772 | 3300005535 | Ga0070684_100666844 | Ga0070684_1006668442 | 155 |
| 773 | 3300005536 | Ga0070697_101145666 | Ga0070697_1011456661 | 155 |
| 774 | 3300005539 | Ga0068853_100032736 | Ga0068853_1000327365 | 155 |
| 775 | 3300005539 | Ga0068853_100833033 | Ga0068853_1008330331 | 155 |
| 776 | 3300005543 | Ga0070672_100000940 | Ga0070672_1000009404 | 155 |
| 777 | 3300005544 | Ga0070686_100003535 | Ga0070686_1000035352 | 155 |
| 778 | 3300005544 | Ga0070686_100004740 | Ga0070686_1000047406 | 155 |
| 779 | 3300005544 | Ga0070686_101165750 | Ga0070686_1011657501 | 155 |
| 780 | 3300005545 | Ga0070695_100007876 | Ga0070695_1000078764 | 155 |
| 781 | 3300005545 | Ga0070695_100014616 | Ga0070695_1000146163 | 155 |
| 782 | 3300005546 | Ga0070696_100783602 | Ga0070696_1007836021 | 155 |
| 783 | 3300005547 | Ga0070693_100027001 | Ga0070693_1000270011 | 155 |
| 784 | 3300005547 | Ga0070693_100209343 | Ga0070693_1002093432 | 155 |
| 785 | 3300005548 | Ga0070665_100281953 | Ga0070665_1002819532 | 155 |
| 786 | 3300005549 | Ga0070704_100001579 | Ga0070704_1000015794 | 155 |
| 787 | 3300005549 | Ga0070704_100579013 | Ga0070704_1005790132 | 155 |
| 788 | 3300005563 | Ga0068855_100630157 | Ga0068855_1006301572 | 155 |
| 789 | 3300005564 | Ga0070664_100687532 | Ga0070664_1006875322 | 155 |
| 790 | 3300005577 | Ga0068857_100009322 | Ga0068857_1000093229 | 155 |
| 791 | 3300005577 | Ga0068857_100467783 | Ga0068857_1004677832 | 155 |
| 792 | 3300005578 | Ga0068854_100229222 | Ga0068854_1002292222 | 155 |
| 793 | 3300005614 | Ga0068856_100022760 | Ga0068856_1000227602 | 155 |
| 794 | 3300005614 | Ga0068856_100055386 | Ga0068856_1000553865 | 155 |
| 795 | 3300005614 | Ga0068856_100503178 | Ga0068856_1005031782 | 155 |
| 796 | 3300005615 | Ga0070702_100031454 | Ga0070702_1000314544 | 155 |
| 797 | 3300005615 | Ga0070702_100629261 | Ga0070702_1006292611 | 155 |
| 798 | 3300005616 | Ga0068852_100058916 | Ga0068852_1000589164 | 155 |
| 799 | 3300005616 | Ga0068852_100381048 | Ga0068852_1003810482 | 155 |
| 800 | 3300005617 | Ga0068859_100096576 | Ga0068859_1000965762 | 155 |
| 801 | 3300005618 | Ga0068864_100003045 | Ga0068864_10000304512 | 155 |
| 802 | 3300005718 | Ga0068866_10000410 | Ga0068866_1000041016 | 155 |
| 803 | 3300005718 | Ga0068866_10091486 | Ga0068866_100914863 | 155 |
| 804 | 3300005719 | Ga0068861_100009022 | Ga0068861_1000090223 | 155 |
| 805 | 3300005719 | Ga0068861_100040082 | Ga0068861_1000400824 | 155 |
| 806 | 3300005834 | Ga0068851_10490689 | Ga0068851_104906892 | 155 |
| 807 | 3300005840 | Ga0068870_10000215 | Ga0068870_1000021514 | 155 |
| 808 | 3300005841 | Ga0068863_100484261 | Ga0068863_1004842612 | 155 |
| 809 | 3300005842 | Ga0068858_100005681 | Ga0068858_1000056819 | 155 |
| 810 | 3300005842 | Ga0068858_100049473 | Ga0068858_1000494734 | 155 |
| 811 | 3300005842 | Ga0068858_100087583 | Ga0068858_1000875833 | 155 |
| 812 | 3300005842 | Ga0068858_100216226 | Ga0068858_1002162262 | 155 |
| 813 | 3300005843 | Ga0068860_100009344 | Ga0068860_1000093443 | 155 |
| 814 | 3300005843 | Ga0068860_100084361 | Ga0068860_1000843614 | 155 |
| 815 | 3300005843 | Ga0068860_100147618 | Ga0068860_1001476182 | 155 |
| 816 | 3300005844 | Ga0068862_100015662 | Ga0068862_1000156625 | 155 |
| 817 | 3300005844 | Ga0068862_100044125 | Ga0068862_1000441254 | 155 |
| 818 | 3300005937 | Ga0081455_10000012 | Ga0081455_10000012107 | 155 |
| 819 | 3300006028 | Ga0070717_10131054 | Ga0070717_101310543 | 155 |
| 820 | 3300006058 | Ga0075432_10298429 | Ga0075432_102984292 | 155 |
| 821 | 3300006163 | Ga0070715_10088100 | Ga0070715_100881002 | 155 |
| 822 | 3300006175 | Ga0070712_100062276 | Ga0070712_1000622762 | 155 |
| 823 | 3300006175 | Ga0070712_100403531 | Ga0070712_1004035312 | 155 |
| 824 | 3300006175 | Ga0070712_100941022 | Ga0070712_1009410221 | 155 |
| 825 | 3300006178 | Ga0075367_10112312 | Ga0075367_101123122 | 155 |
| 826 | 3300006178 | Ga0075367_10249295 | Ga0075367_102492952 | 155 |
| 827 | 3300006237 | Ga0097621_100003185 | Ga0097621_1000031855 | 155 |
| 828 | 3300006237 | Ga0097621_100020982 | Ga0097621_1000209824 | 155 |
| 829 | 3300006358 | Ga0068871_100002188 | Ga0068871_1000021885 | 155 |
| 830 | 3300006358 | Ga0068871_100236587 | Ga0068871_1002365872 | 155 |
| 831 | 3300006852 | Ga0075433_10145737 | Ga0075433_101457372 | 155 |
| 832 | 3300006871 | Ga0075434_100072114 | Ga0075434_1000721142 | 155 |
| 833 | 3300006871 | Ga0075434_100655384 | Ga0075434_1006553842 | 155 |
| 834 | 3300006881 | Ga0068865_100002213 | Ga0068865_1000022139 | 155 |
| 835 | 3300006931 | Ga0097620_100096573 | Ga0097620_1000965732 | 155 |
| 836 | 3300007076 | Ga0075435_100890253 | Ga0075435_1008902532 | 155 |
| 837 | 3300009036 | Ga0105244_10076572 | Ga0105244_100765722 | 155 |
| 838 | 3300009092 | Ga0105250_10021032 | Ga0105250_100210323 | 155 |
| 839 | 3300009093 | Ga0105240_10205018 | Ga0105240_102050182 | 155 |
| 840 | 3300009093 | Ga0105240_12104437 | Ga0105240_121044371 | 155 |
| 841 | 3300009094 | Ga0111539_10000114 | Ga0111539_1000011417 | 155 |
| 842 | 3300009094 | Ga0111539_10046475 | Ga0111539_100464754 | 155 |
| 843 | 3300009098 | Ga0105245_10014117 | Ga0105245_100141172 | 155 |
| 844 | 3300009098 | Ga0105245_10064510 | Ga0105245_100645102 | 155 |
| 845 | 3300009098 | Ga0105245_11666629 | Ga0105245_116666291 | 155 |
| 846 | 3300009101 | Ga0105247_10004602 | Ga0105247_100046027 | 155 |
| 847 | 3300009101 | Ga0105247_10124830 | Ga0105247_101248302 | 155 |
| 848 | 3300009101 | Ga0105247_10766609 | Ga0105247_107666092 | 155 |
| 849 | 3300009147 | Ga0114129_10467764 | Ga0114129_104677642 | 155 |
| 850 | 3300009148 | Ga0105243_10017428 | Ga0105243_100174285 | 155 |
| 851 | 3300009148 | Ga0105243_10068746 | Ga0105243_100687464 | 155 |
| 852 | 3300009174 | Ga0105241_10007805 | Ga0105241_100078057 | 155 |
| 853 | 3300009174 | Ga0105241_10174331 | Ga0105241_101743312 | 155 |
| 854 | 3300009174 | Ga0105241_10967710 | Ga0105241_109677101 | 155 |
| 855 | 3300009176 | Ga0105242_10011497 | Ga0105242_100114977 | 155 |
| 856 | 3300009176 | Ga0105242_10045137 | Ga0105242_100451373 | 155 |
| 857 | 3300009176 | Ga0105242_10421769 | Ga0105242_104217692 | 155 |
| 858 | 3300009177 | Ga0105248_10015424 | Ga0105248_100154244 | 155 |
| 859 | 3300009177 | Ga0105248_10015952 | Ga0105248_100159527 | 155 |
| 860 | 3300009177 | Ga0105248_10033034 | Ga0105248_100330342 | 155 |
| 861 | 3300009177 | Ga0105248_11219054 | Ga0105248_112190541 | 155 |
| 862 | 3300009545 | Ga0105237_10020483 | Ga0105237_100204832 | 155 |
| 863 | 3300009553 | Ga0105249_10019102 | Ga0105249_100191027 | 155 |
| 864 | 3300009553 | Ga0105249_10317131 | Ga0105249_103171312 | 155 |
| 865 | 3300010375 | Ga0105239_10039524 | Ga0105239_100395244 | 155 |
| 866 | 3300010375 | Ga0105239_10172932 | Ga0105239_101729321 | 155 |
| 867 | 3300010375 | Ga0105239_10553397 | Ga0105239_105533972 | 155 |
| 868 | 3300011119 | Ga0105246_10006910 | Ga0105246_100069103 | 155 |
| 869 | 3300011119 | Ga0105246_10014551 | Ga0105246_100145512 | 155 |
| 870 | 3300012476 | Ga0157344_1003626 | Ga0157344_10036262 | 155 |
| 871 | 3300012492 | Ga0157335_1024583 | Ga0157335_10245832 | 155 |
| 872 | 3300012494 | Ga0157341_1010202 | Ga0157341_10102022 | 155 |
| 873 | 3300012497 | Ga0157319_1024004 | Ga0157319_10240042 | 155 |
| 874 | 3300012498 | Ga0157345_1008648 | Ga0157345_10086481 | 155 |
| 875 | 3300012502 | Ga0157347_1006947 | Ga0157347_10069472 | 155 |
| 876 | 3300012503 | Ga0157313_1001104 | Ga0157313_10011042 | 155 |
| 877 | 3300013100 | Ga0157373_10112032 | Ga0157373_101120323 | 155 |
| 878 | 3300013100 | Ga0157373_10264708 | Ga0157373_102647082 | 155 |
| 879 | 3300013100 | Ga0157373_10334246 | Ga0157373_103342461 | 155 |
| 880 | 3300013102 | Ga0157371_10116284 | Ga0157371_101162842 | 155 |
| 881 | 3300013104 | Ga0157370_10293164 | Ga0157370_102931642 | 155 |
| 882 | 3300013296 | Ga0157374_10039734 | Ga0157374_100397345 | 155 |
| 883 | 3300013296 | Ga0157374_10148788 | Ga0157374_101487882 | 155 |
| 884 | 3300013297 | Ga0157378_10085000 | Ga0157378_100850005 | 155 |
| 885 | 3300013306 | Ga0163162_10043605 | Ga0163162_100436053 | 155 |
| 886 | 3300013306 | Ga0163162_10315316 | Ga0163162_103153162 | 155 |
| 887 | 3300013307 | Ga0157372_10244952 | Ga0157372_102449523 | 155 |
| 888 | 3300013308 | Ga0157375_10155208 | Ga0157375_101552083 | 155 |
| 889 | 3300013308 | Ga0157375_10168269 | Ga0157375_101682692 | 155 |
| 890 | 3300014325 | Ga0163163_10042146 | Ga0163163_100421462 | 155 |
| 891 | 3300014325 | Ga0163163_10089185 | Ga0163163_100891852 | 155 |
| 892 | 3300014326 | Ga0157380_10887660 | Ga0157380_108876602 | 155 |
| 893 | 3300014745 | Ga0157377_10005046 | Ga0157377_100050462 | 155 |
| 894 | 3300014968 | Ga0157379_10001743 | Ga0157379_1000174316 | 155 |
| 895 | 3300014968 | Ga0157379_10184364 | Ga0157379_101843642 | 155 |
| 896 | 3300014968 | Ga0157379_10515085 | Ga0157379_105150852 | 155 |
| 897 | 3300014968 | Ga0157379_11852688 | Ga0157379_118526881 | 155 |
| 898 | 3300014969 | Ga0157376_10004369 | Ga0157376_100043697 | 155 |
| 899 | 3300015265 | Ga0182005_1097311 | Ga0182005_10973112 | 155 |
| 900 | 3300017792 | Ga0163161_10078100 | Ga0163161_100781003 | 155 |
| 901 | 3300025271 | Ga0207666_1000732 | Ga0207666_10007323 | 155 |
| 902 | 3300025271 | Ga0207666_1000791 | Ga0207666_10007914 | 155 |
| 903 | 3300025315 | Ga0207697_10005124 | Ga0207697_100051246 | 155 |
| 904 | 3300025885 | Ga0207653_10004024 | Ga0207653_100040244 | 155 |
| 905 | 3300025893 | Ga0207682_10000071 | Ga0207682_1000007144 | 155 |
| 906 | 3300025898 | Ga0207692_10199649 | Ga0207692_101996492 | 155 |
| 907 | 3300025898 | Ga0207692_10327005 | Ga0207692_103270052 | 155 |
| 908 | 3300025899 | Ga0207642_10002908 | Ga0207642_100029086 | 155 |
| 909 | 3300025900 | Ga0207710_10004664 | Ga0207710_100046644 | 155 |
| 910 | 3300025900 | Ga0207710_10030042 | Ga0207710_100300423 | 155 |
| 911 | 3300025901 | Ga0207688_10004331 | Ga0207688_100043312 | 155 |
| 912 | 3300025901 | Ga0207688_10050355 | Ga0207688_100503552 | 155 |
| 913 | 3300025903 | Ga0207680_10010064 | Ga0207680_100100646 | 155 |
| 914 | 3300025903 | Ga0207680_10334991 | Ga0207680_103349912 | 155 |
| 915 | 3300025904 | Ga0207647_10002565 | Ga0207647_1000256515 | 155 |
| 916 | 3300025904 | Ga0207647_10008867 | Ga0207647_100088672 | 155 |
| 917 | 3300025905 | Ga0207685_10004209 | Ga0207685_100042093 | 155 |
| 918 | 3300025906 | Ga0207699_10004429 | Ga0207699_100044294 | 155 |
| 919 | 3300025906 | Ga0207699_10092009 | Ga0207699_100920092 | 155 |
| 920 | 3300025908 | Ga0207643_10000276 | Ga0207643_1000027633 | 155 |
| 921 | 3300025911 | Ga0207654_10004277 | Ga0207654_100042777 | 155 |
| 922 | 3300025911 | Ga0207654_10061393 | Ga0207654_100613932 | 155 |
| 923 | 3300025912 | Ga0207707_10012946 | Ga0207707_100129466 | 155 |
| 924 | 3300025912 | Ga0207707_10248930 | Ga0207707_102489302 | 155 |
| 925 | 3300025912 | Ga0207707_10499064 | Ga0207707_104990642 | 155 |
| 926 | 3300025913 | Ga0207695_10083002 | Ga0207695_100830022 | 155 |
| 927 | 3300025914 | Ga0207671_10233919 | Ga0207671_102339192 | 155 |
| 928 | 3300025915 | Ga0207693_10229718 | Ga0207693_102297182 | 155 |
| 929 | 3300025915 | Ga0207693_10297135 | Ga0207693_102971352 | 155 |
| 930 | 3300025915 | Ga0207693_10524969 | Ga0207693_105249691 | 155 |
| 931 | 3300025916 | Ga0207663_10112407 | Ga0207663_101124073 | 155 |
| 932 | 3300025916 | Ga0207663_10504720 | Ga0207663_105047202 | 155 |
| 933 | 3300025917 | Ga0207660_10000087 | Ga0207660_1000008732 | 155 |
| 934 | 3300025917 | Ga0207660_10032118 | Ga0207660_100321181 | 155 |
| 935 | 3300025917 | Ga0207660_10168553 | Ga0207660_101685532 | 155 |
| 936 | 3300025918 | Ga0207662_10095222 | Ga0207662_100952222 | 155 |
| 937 | 3300025919 | Ga0207657_10009053 | Ga0207657_100090534 | 155 |
| 938 | 3300025919 | Ga0207657_10047331 | Ga0207657_100473312 | 155 |
| 939 | 3300025919 | Ga0207657_10048561 | Ga0207657_100485614 | 155 |
| 940 | 3300025920 | Ga0207649_10002302 | Ga0207649_100023027 | 155 |
| 941 | 3300025920 | Ga0207649_10499333 | Ga0207649_104993332 | 155 |
| 942 | 3300025921 | Ga0207652_10014976 | Ga0207652_100149765 | 155 |
| 943 | 3300025921 | Ga0207652_10034741 | Ga0207652_100347412 | 155 |
| 944 | 3300025921 | Ga0207652_10119706 | Ga0207652_101197062 | 155 |
| 945 | 3300025921 | Ga0207652_10163291 | Ga0207652_101632913 | 155 |
| 946 | 3300025923 | Ga0207681_10002160 | Ga0207681_100021602 | 155 |
| 947 | 3300025923 | Ga0207681_10072458 | Ga0207681_100724584 | 155 |
| 948 | 3300025925 | Ga0207650_10019228 | Ga0207650_100192282 | 155 |
| 949 | 3300025926 | Ga0207659_10001604 | Ga0207659_100016043 | 155 |
| 950 | 3300025927 | Ga0207687_10038314 | Ga0207687_100383144 | 155 |
| 951 | 3300025927 | Ga0207687_10552116 | Ga0207687_105521162 | 155 |
| 952 | 3300025928 | Ga0207700_10044269 | Ga0207700_100442694 | 155 |
| 953 | 3300025928 | Ga0207700_10245931 | Ga0207700_102459312 | 155 |
| 954 | 3300025929 | Ga0207664_10240895 | Ga0207664_102408952 | 155 |
| 955 | 3300025931 | Ga0207644_10009341 | Ga0207644_100093413 | 155 |
| 956 | 3300025931 | Ga0207644_10048605 | Ga0207644_100486053 | 155 |
| 957 | 3300025932 | Ga0207690_10007427 | Ga0207690_100074277 | 155 |
| 958 | 3300025932 | Ga0207690_10366720 | Ga0207690_103667201 | 155 |
| 959 | 3300025933 | Ga0207706_10006428 | Ga0207706_1000642811 | 155 |
| 960 | 3300025933 | Ga0207706_10065125 | Ga0207706_100651253 | 155 |
| 961 | 3300025934 | Ga0207686_10002664 | Ga0207686_100026645 | 155 |
| 962 | 3300025934 | Ga0207686_10033863 | Ga0207686_100338632 | 155 |
| 963 | 3300025935 | Ga0207709_10004315 | Ga0207709_100043154 | 155 |
| 964 | 3300025935 | Ga0207709_10209918 | Ga0207709_102099182 | 155 |
| 965 | 3300025936 | Ga0207670_10000886 | Ga0207670_1000088617 | 155 |
| 966 | 3300025936 | Ga0207670_10054370 | Ga0207670_100543704 | 155 |
| 967 | 3300025937 | Ga0207669_10018860 | Ga0207669_100188604 | 155 |
| 968 | 3300025937 | Ga0207669_10649893 | Ga0207669_106498932 | 155 |
| 969 | 3300025938 | Ga0207704_10025289 | Ga0207704_100252892 | 155 |
| 970 | 3300025938 | Ga0207704_10308701 | Ga0207704_103087012 | 155 |
| 971 | 3300025939 | Ga0207665_10124325 | Ga0207665_101243253 | 155 |
| 972 | 3300025939 | Ga0207665_10161578 | Ga0207665_101615782 | 155 |
| 973 | 3300025940 | Ga0207691_10007048 | Ga0207691_100070487 | 155 |
| 974 | 3300025941 | Ga0207711_10099289 | Ga0207711_100992892 | 155 |
| 975 | 3300025941 | Ga0207711_10121039 | Ga0207711_101210392 | 155 |
| 976 | 3300025942 | Ga0207689_10008107 | Ga0207689_100081079 | 155 |
| 977 | 3300025944 | Ga0207661_10008272 | Ga0207661_100082723 | 155 |
| 978 | 3300025945 | Ga0207679_10000131 | Ga0207679_1000013153 | 155 |
| 979 | 3300025945 | Ga0207679_10309521 | Ga0207679_103095212 | 155 |
| 980 | 3300025945 | Ga0207679_10658481 | Ga0207679_106584811 | 155 |
| 981 | 3300025949 | Ga0207667_10076624 | Ga0207667_100766242 | 155 |
| 982 | 3300025960 | Ga0207651_10001949 | Ga0207651_100019492 | 155 |
| 983 | 3300025960 | Ga0207651_10358402 | Ga0207651_103584022 | 155 |
| 984 | 3300025961 | Ga0207712_10023188 | Ga0207712_100231884 | 155 |
| 985 | 3300025972 | Ga0207668_10000655 | Ga0207668_100006559 | 155 |
| 986 | 3300025972 | Ga0207668_10137107 | Ga0207668_101371072 | 155 |
| 987 | 3300025981 | Ga0207640_10032911 | Ga0207640_100329114 | 155 |
| 988 | 3300025981 | Ga0207640_10370960 | Ga0207640_103709601 | 155 |
| 989 | 3300025986 | Ga0207658_10018697 | Ga0207658_100186976 | 155 |
| 990 | 3300025986 | Ga0207658_10336803 | Ga0207658_103368031 | 155 |
| 991 | 3300025986 | Ga0207658_10476519 | Ga0207658_104765192 | 155 |
| 992 | 3300026023 | Ga0207677_10003214 | Ga0207677_100032144 | 155 |
| 993 | 3300026035 | Ga0207703_10003628 | Ga0207703_100036284 | 155 |
| 994 | 3300026035 | Ga0207703_10045633 | Ga0207703_100456334 | 155 |
| 995 | 3300026035 | Ga0207703_10052993 | Ga0207703_100529932 | 155 |
| 996 | 3300026041 | Ga0207639_10006126 | Ga0207639_100061262 | 155 |
| 997 | 3300026041 | Ga0207639_10039853 | Ga0207639_100398532 | 155 |
| 998 | 3300026067 | Ga0207678_10058646 | Ga0207678_100586462 | 155 |
| 999 | 3300026067 | Ga0207678_10515794 | Ga0207678_105157942 | 155 |
| 1000 | 3300026075 | Ga0207708_10005844 | Ga0207708_100058444 | 155 |
| 1001 | 3300026075 | Ga0207708_10010299 | Ga0207708_100102995 | 155 |
| 1002 | 3300026075 | Ga0207708_10940798 | Ga0207708_109407981 | 155 |
| 1003 | 3300026078 | Ga0207702_10003322 | Ga0207702_100033227 | 155 |
| 1004 | 3300026078 | Ga0207702_10269679 | Ga0207702_102696792 | 155 |
| 1005 | 3300026088 | Ga0207641_10001577 | Ga0207641_1000157716 | 155 |
| 1006 | 3300026089 | Ga0207648_10774664 | Ga0207648_107746642 | 155 |
| 1007 | 3300026095 | Ga0207676_10001374 | Ga0207676_100013747 | 155 |
| 1008 | 3300026116 | Ga0207674_10036528 | Ga0207674_100365282 | 155 |
| 1009 | 3300026118 | Ga0207675_100004272 | Ga0207675_1000042724 | 155 |
| 1010 | 3300026118 | Ga0207675_100163461 | Ga0207675_1001634612 | 155 |
| 1011 | 3300026121 | Ga0207683_10091160 | Ga0207683_100911604 | 155 |
| 1012 | 3300026142 | Ga0207698_10082289 | Ga0207698_100822893 | 155 |
| 1013 | 3300026142 | Ga0207698_10262304 | Ga0207698_102623042 | 155 |
| 1014 | 3300027360 | Ga0209969_1018346 | Ga0209969_10183462 | 155 |
| 1015 | 3300027378 | Ga0209981_1017743 | Ga0209981_10177431 | 155 |
| 1016 | 3300027424 | Ga0209984_1009741 | Ga0209984_10097412 | 155 |
| 1017 | 3300027543 | Ga0209999_1003958 | Ga0209999_10039583 | 155 |
| 1018 | 3300027617 | Ga0210002_1034988 | Ga0210002_10349882 | 155 |
| 1019 | 3300027665 | Ga0209983_1002977 | Ga0209983_10029774 | 155 |
| 1020 | 3300027682 | Ga0209971_1020904 | Ga0209971_10209042 | 155 |
| 1021 | 3300027695 | Ga0209966_1001582 | Ga0209966_10015824 | 155 |
| 1022 | 3300027717 | Ga0209998_10001451 | Ga0209998_100014512 | 155 |
| 1023 | 3300027717 | Ga0209998_10002203 | Ga0209998_100022036 | 155 |
| 1024 | 3300027907 | Ga0207428_10000255 | Ga0207428_1000025554 | 155 |
| 1025 | 3300027907 | Ga0207428_10008215 | Ga0207428_1000821510 | 155 |
| 1026 | 3300027907 | Ga0207428_10066577 | Ga0207428_100665774 | 155 |
| 1027 | 3300028379 | Ga0268266_10441550 | Ga0268266_104415502 | 155 |
| 1028 | 3300028379 | Ga0268266_10617949 | Ga0268266_106179491 | 155 |
| 1029 | 3300028380 | Ga0268265_10001553 | Ga0268265_100015537 | 155 |
| 1030 | 3300028380 | Ga0268265_10599609 | Ga0268265_105996092 | 155 |
| 1031 | 3300028381 | Ga0268264_10182973 | Ga0268264_101829732 | 155 |
| 1032 | 3300028381 | Ga0268264_10552344 | Ga0268264_105523442 | 155 |
| 1033 | 3300028381 | Ga0268264_10560450 | Ga0268264_105604502 | 155 |
| 1034 | 3300034816 | Ga0373930_0000252 | Ga0373930_0000252_1790_2257 | 155 |
| 1035 | 3300034817 | Ga0373948_0000821 | Ga0373948_0000821_110_577 | 155 |
| 1036 | 3300034818 | Ga0373950_0000200 | Ga0373950_0000200_2219_2686 | 155 |
| 1037 | 3300034819 | Ga0373958_0000159 | Ga0373958_0000159_6152_6619 | 155 |
| 1038 | 3300034819 | Ga0373958_0002164 | Ga0373958_0002164_151_618 | 155 |
| 1039 | 3300034820 | Ga0373959_0004470 | Ga0373959_0004470_1640_2107 | 155 |
| 1040 | 3300034957 | Ga0373938_0000096 | Ga0373938_0000096_11307_11774 | 155 |
| 1041 | 3300035083 | Ga0373926_0032602 | Ga0373926_0032602_335_808 | 155 |
| 1042 | 3300035084 | Ga0373928_0000443 | Ga0373928_0000443_7393_7860 | 155 |
| 1043 | 3300035084 | Ga0373928_0122920 | Ga0373928_0122920_82_555 | 155 |
| 1044 | 3300035085 | Ga0373929_0000756 | Ga0373929_0000756_320_787 | 155 |
| 1045 | 3300035088 | Ga0373940_0000018 | Ga0373940_0000018_11408_11875 | 155 |
| 1046 | 3300035089 | Ga0373944_0048607 | Ga0373944_0048607_624_1097 | 155 |
| 1047 | 3300035090 | Ga0373949_0000862 | Ga0373949_0000862_8566_9033 | 155 |
| 1048 | 3300035090 | Ga0373949_0005361 | Ga0373949_0005361_50_517 | 155 |
| 1049 | 3300035091 | Ga0373951_0000154 | Ga0373951_0000154_20271_20738 | 155 |
| 1050 | 3300035092 | Ga0373952_0000790 | Ga0373952_0000790_281_748 | 155 |
| 1051 | 3300035092 | Ga0373952_0001040 | Ga0373952_0001040_2422_2916 | 155 |
| 1052 | 3300035092 | Ga0373952_0020743 | Ga0373952_0020743_595_1068 | 155 |
| 1053 | 3300035112 | Ga0373932_0000155 | Ga0373932_0000155_7193_7660 | 155 |
| 1054 | 3300035112 | Ga0373932_0017117 | Ga0373932_0017117_1376_1843 | 155 |
| 1055 | 3300035113 | Ga0373936_0014185 | Ga0373936_0014185_1969_2442 | 155 |
| 1056 | 3300035114 | Ga0373939_0003369 | Ga0373939_0003369_2930_3397 | 155 |
| 1057 | 3300035115 | Ga0373941_0086549 | Ga0373941_0086549_590_1057 | 155 |
| 1058 | 3300035117 | Ga0373953_0005812 | Ga0373953_0005812_3450_3923 | 155 |
| 1059 | 3300035118 | Ga0373954_0006933 | Ga0373954_0006933_4377_4850 | 155 |
| 1060 | 3300035119 | Ga0373956_0042945 | Ga0373956_0042945_182_655 | 155 |
| 1061 | 3300035120 | Ga0373957_0003837 | Ga0373957_0003837_2842_3315 | 155 |
| 1062 | 3300035121 | Ga0373960_0000061 | Ga0373960_0000061_5089_5556 | 155 |
| 1063 | 3300035121 | Ga0373960_0029818 | Ga0373960_0029818_792_1286 | 155 |
| 1064 | 3300035170 | Ga0373943_0266959 | Ga0373943_0266959_26_499 | 155 |
| 1065 | 3300035170 | Ga0373943_0273836 | Ga0373943_0273836_340_813 | 155 |
| 1066 | 3300035171 | Ga0373946_0015814 | Ga0373946_0015814_111_584 | 155 |
| 1067 | 3300035172 | Ga0373955_0000212 | Ga0373955_0000212_10151_10624 | 155 |
| 1068 | 3300035172 | Ga0373955_0222778 | Ga0373955_0222778_458_931 | 155 |
| 1069 | 3300035207 | Ga0373942_0000537 | Ga0373942_0000537_7836_8303 | 155 |
| 1070 | 3300035241 | Ga0373961_0000451 | Ga0373961_0000451_34_501 | 155 |
| 1071 | 3300035241 | Ga0373961_0004512 | Ga0373961_0004512_1303_1797 | 155 |
| 1072 | 3300035242 | Ga0373962_0001266 | Ga0373962_0001266_3369_3836 | 155 |
| 1073 | 3300035410 | Ga0373924_0018323 | Ga0373924_0018323_1377_1850 | 155 |
| 1074 | 3300035691 | Ga0373931_0000170 | Ga0373931_0000170_14449_14943 | 155 |
| 1075 | 3300035691 | Ga0373931_0035713 | Ga0373931_0035713_939_1412 | 155 |
| 1076 | 3300035691 | Ga0373931_0092975 | Ga0373931_0092975_448_915 | 155 |
| 1077 | 3300035692 | Ga0373935_0159986 | Ga0373935_0159986_859_1332 | 155 |
| 1078 | 3300035695 | Ga0373927_0156923 | Ga0373927_0156923_83_556 | 155 |
| 1079 | 3300035695 | Ga0373927_0354286 | Ga0373927_0354286_262_735 | 155 |
| 1080 | 3300035724 | Ga0373933_0005386 | Ga0373933_0005386_2340_2813 | 155 |
| 1081 | 3300035725 | Ga0373947_0037922 | Ga0373947_0037922_1795_2268 | 155 |
| 1082 | 3300036401 | Ga0373937_0008093 | Ga0373937_0008093_6071_6544 | 155 |
| 1083 | 3300037068 | Ga0373925_0149804 | Ga0373925_0149804_1058_1531 | 155 |
| 1084 | 3300038996 | Ga0242420_016608 | Ga0242420_016608_25_492 | 155 |
| 1085 | 3300042012 | Ga0439455_0012465 | Ga0439455_0012465_327_794 | 155 |
| 1086 | 3300042138 | Ga0450903_071042 | Ga0450903_071042_19_486 | 155 |
| 1087 | 3300042439 | Ga0439464_0010836 | Ga0439464_0010836_999_1466 | 155 |
| 1088 | 3300042876 | Ga0451577_0028715 | Ga0451577_0028715_1393_1860 | 155 |
| 1089 | 3300044673 | Ga0453683_0200606 | Ga0453683_0200606_115_582 | 155 |
| 1090 | 3300044712 | Ga0453684_0545859 | Ga0453684_0545859_222_689 | 155 |
| 1091 | 3300045051 | Ga0451576_0096377 | Ga0451576_0096377_1119_1586 | 155 |
| 1092 | 3300046454 | Ga0495592_0053248 | Ga0495592_0053248_27_500 | 155 |
| 1093 | 3300046455 | Ga0495603_0132259 | Ga0495603_0132259_668_1141 | 155 |
| 1094 | 3300046459 | Ga0495629_0088382 | Ga0495629_0088382_179_652 | 155 |
| 1095 | 3300046459 | Ga0495629_0172031 | Ga0495629_0172031_629_1102 | 155 |
| 1096 | 3300046461 | Ga0495641_0090630 | Ga0495641_0090630_760_1233 | 155 |
| 1097 | 3300046462 | Ga0495651_0084734 | Ga0495651_0084734_1254_1727 | 155 |
| 1098 | 3300046462 | Ga0495651_0202887 | Ga0495651_0202887_672_1145 | 155 |
| 1099 | 3300046463 | Ga0495653_0001102 | Ga0495653_0001102_16699_17172 | 155 |
| 1100 | 3300046463 | Ga0495653_0385293 | Ga0495653_0385293_303_776 | 155 |
| 1101 | 3300046472 | Ga0495580_0294642 | Ga0495580_0294642_456_929 | 155 |
| 1102 | 3300046473 | Ga0495582_0149102 | Ga0495582_0149102_392_865 | 155 |
| 1103 | 3300046475 | Ga0495639_0156531 | Ga0495639_0156531_229_702 | 155 |
| 1104 | 3300046476 | Ga0495662_0013240 | Ga0495662_0013240_880_1353 | 155 |
| 1105 | 3300046476 | Ga0495662_0148524 | Ga0495662_0148524_208_681 | 155 |
| 1106 | 3300046491 | Ga0495584_0195232 | Ga0495584_0195232_177_671 | 155 |
| 1107 | 3300046499 | Ga0495594_0090706 | Ga0495594_0090706_134_607 | 155 |
| 1108 | 3300046501 | Ga0495607_0351159 | Ga0495607_0351159_21_494 | 155 |
| 1109 | 3300046514 | Ga0495618_0001557 | Ga0495618_0001557_4358_4831 | 155 |
| 1110 | 3300046514 | Ga0495618_0157467 | Ga0495618_0157467_780_1253 | 155 |
| 1111 | 3300046516 | Ga0495628_0466872 | Ga0495628_0466872_232_705 | 155 |
| 1112 | 3300046517 | Ga0495630_0006498 | Ga0495630_0006498_2503_2976 | 155 |
| 1113 | 3300046517 | Ga0495630_0068369 | Ga0495630_0068369_1252_1725 | 155 |
| 1114 | 3300046526 | Ga0495666_0090252 | Ga0495666_0090252_201_674 | 155 |
| 1115 | 3300046529 | Ga0495652_0013229 | Ga0495652_0013229_2073_2546 | 155 |
| 1116 | 3300046529 | Ga0495652_0360747 | Ga0495652_0360747_14_487 | 155 |
| 1117 | 3300046531 | Ga0495665_0090895 | Ga0495665_0090895_1043_1516 | 155 |
| 1118 | 3300046533 | Ga0495640_0005554 | Ga0495640_0005554_5672_6145 | 155 |
| 1119 | 3300046533 | Ga0495640_0049550 | Ga0495640_0049550_1177_1650 | 155 |
| 1120 | 3300046535 | Ga0495586_0099064 | Ga0495586_0099064_189_662 | 155 |
| 1121 | 3300046536 | Ga0495587_0002605 | Ga0495587_0002605_6733_7206 | 155 |
| 1122 | 3300046543 | Ga0495645_0211428 | Ga0495645_0211428_243_716 | 155 |
| 1123 | 3300046543 | Ga0495645_0356329 | Ga0495645_0356329_242_715 | 155 |
| 1124 | 3300046559 | Ga0495667_0008926 | Ga0495667_0008926_6042_6515 | 155 |
| 1125 | 3300046642 | Ga0495634_0093995 | Ga0495634_0093995_1279_1752 | 155 |
| 1126 | 3300046642 | Ga0495634_0274851 | Ga0495634_0274851_97_570 | 155 |
| 1127 | 3300046663 | Ga0495635_0003939 | Ga0495635_0003939_6189_6662 | 155 |
| 1128 | 3300046663 | Ga0495635_0071566 | Ga0495635_0071566_1784_2257 | 155 |
| 1129 | 3300046674 | Ga0495588_0010531 | Ga0495588_0010531_276_749 | 155 |
| 1130 | 3300046675 | Ga0495657_0001814 | Ga0495657_0001814_5435_5908 | 155 |
| 1131 | 3300046675 | Ga0495657_0081722 | Ga0495657_0081722_265_738 | 155 |
| 1132 | 3300046678 | Ga0495599_0003284 | Ga0495599_0003284_5166_5639 | 155 |
| 1133 | 3300046679 | Ga0495623_0002800 | Ga0495623_0002800_4792_5265 | 155 |
| 1134 | 3300046680 | Ga0495646_0003379 | Ga0495646_0003379_4638_5111 | 155 |
| 1135 | 3300046680 | Ga0495646_0447978 | Ga0495646_0447978_37_510 | 155 |
| 1136 | 3300046681 | Ga0495647_0010507 | Ga0495647_0010507_1486_1959 | 155 |
| 1137 | 3300046681 | Ga0495647_0267295 | Ga0495647_0267295_154_627 | 155 |
| 1138 | 3300046689 | Ga0495613_0080826 | Ga0495613_0080826_725_1198 | 155 |
| 1139 | 3300046689 | Ga0495613_0166761 | Ga0495613_0166761_192_665 | 155 |
| 1140 | 3300046689 | Ga0495613_0179897 | Ga0495613_0179897_310_783 | 155 |
| 1141 | 3300046690 | Ga0495624_0039247 | Ga0495624_0039247_905_1378 | 155 |
| 1142 | 3300047315 | Ga0495581_0050717 | Ga0495581_0050717_974_1447 | 155 |
| 1143 | 3300047317 | Ga0495604_0012054 | Ga0495604_0012054_4215_4688 | 155 |
| 1144 | 3300047317 | Ga0495604_0014609 | Ga0495604_0014609_27_500 | 155 |
| 1145 | 3300047319 | Ga0495674_0007467 | Ga0495674_0007467_6508_6981 | 155 |
| 1146 | 3300047319 | Ga0495674_0048018 | Ga0495674_0048018_242_715 | 155 |
| 1147 | 3300047321 | Ga0495676_0213279 | Ga0495676_0213279_845_1318 | 155 |
| 1148 | 3300047322 | Ga0495680_0004443 | Ga0495680_0004443_10552_11025 | 155 |
| 1149 | 3300047322 | Ga0495680_0041923 | Ga0495680_0041923_946_1419 | 155 |
| 1150 | 3300047444 | Ga0495675_0174884 | Ga0495675_0174884_470_943 | 155 |
| 1151 | 3300047471 | Ga0495684_0038948 | Ga0495684_0038948_2934_3407 | 155 |
| 1152 | 3300048088 | Ga0495602_0008317 | Ga0495602_0008317_8965_9438 | 155 |
| 1153 | 3300048089 | Ga0495614_0190134 | Ga0495614_0190134_134_607 | 155 |
| 1154 | 3300048903 | Ga0496100_0012706 | Ga0496100_0012706_4233_4727 | 155 |
| 1155 | 3300048904 | Ga0496101_0000546 | Ga0496101_0000546_22262_22756 | 155 |
| 1156 | 3300048904 | Ga0496101_0000799 | Ga0496101_0000799_14000_14473 | 155 |
| 1157 | 3300048905 | Ga0496102_0011785 | Ga0496102_0011785_6938_7411 | 155 |
| 1158 | 3300048905 | Ga0496102_0035226 | Ga0496102_0035226_1990_2463 | 155 |
| 1159 | 3300048905 | Ga0496102_0337988 | Ga0496102_0337988_816_1283 | 155 |
| 1160 | 3300048906 | Ga0496103_0060970 | Ga0496103_0060970_237_710 | 155 |
| 1161 | 3300048906 | Ga0496103_0268031 | Ga0496103_0268031_189_683 | 155 |
| 1162 | 3300048907 | Ga0496104_0024737 | Ga0496104_0024737_787_1260 | 155 |
| 1163 | 3300048908 | Ga0496105_0367421 | Ga0496105_0367421_151_618 | 155 |
| 1164 | 3300048909 | Ga0496106_0000596 | Ga0496106_0000596_16907_17401 | 155 |
| 1165 | 3300048909 | Ga0496106_0006785 | Ga0496106_0006785_3889_4362 | 155 |
| 1166 | 3300048909 | Ga0496106_0015745 | Ga0496106_0015745_186_659 | 155 |
| 1167 | 3300048909 | Ga0496106_0077447 | Ga0496106_0077447_94_561 | 155 |
| 1168 | 3300048909 | Ga0496106_0156862 | Ga0496106_0156862_975_1442 | 155 |
| 1169 | 3300048910 | Ga0496107_0001473 | Ga0496107_0001473_7377_7871 | 155 |
| 1170 | 3300048910 | Ga0496107_0037537 | Ga0496107_0037537_293_766 | 155 |
| 1171 | 3300048910 | Ga0496107_0056492 | Ga0496107_0056492_640_1107 | 155 |
| 1172 | 3300048912 | Ga0496109_0001819 | Ga0496109_0001819_12441_12908 | 155 |
| 1173 | 3300048912 | Ga0496109_0049079 | Ga0496109_0049079_2081_2548 | 155 |
| 1174 | 3300048912 | Ga0496109_0229451 | Ga0496109_0229451_93_566 | 155 |
| 1175 | 3300048913 | Ga0496110_0038079 | Ga0496110_0038079_669_1136 | 155 |
| 1176 | 3300048913 | Ga0496110_0073928 | Ga0496110_0073928_1163_1636 | 155 |
| 1177 | 3300048914 | Ga0496111_0041524 | Ga0496111_0041524_544_1017 | 155 |
| 1178 | 3300048914 | Ga0496111_0314801 | Ga0496111_0314801_98_565 | 155 |
| 1179 | 3300048915 | Ga0496112_0008772 | Ga0496112_0008772_2386_2853 | 155 |
| 1180 | 3300048915 | Ga0496112_0152055 | Ga0496112_0152055_1538_2011 | 155 |
| 1181 | 3300048916 | Ga0496113_0015822 | Ga0496113_0015822_2732_3199 | 155 |
| 1182 | 3300048916 | Ga0496113_0174348 | Ga0496113_0174348_144_617 | 155 |
| 1183 | 3300048917 | Ga0496114_0016139 | Ga0496114_0016139_3971_4444 | 155 |
| 1184 | 3300048917 | Ga0496114_0478593 | Ga0496114_0478593_616_1083 | 155 |
| 1185 | 3300048918 | Ga0496115_0082098 | Ga0496115_0082098_751_1224 | 155 |
| 1186 | 3300048918 | Ga0496115_1079594 | Ga0496115_1079594_127_594 | 155 |
| 1187 | 3300049570 | Ga0501033_0523432 | Ga0501033_0523432_120_632 | 155 |
| 1188 | 3300049574 | Ga0501038_0134609 | Ga0501038_0134609_812_1324 | 155 |
| 1189 | 3300049585 | Ga0501069_0610966 | Ga0501069_0610966_132_644 | 155 |
| 1190 | 3300049589 | Ga0501073_0018173 | Ga0501073_0018173_1742_2254 | 155 |
| 1191 | 3300049593 | Ga0501077_0060206 | Ga0501077_0060206_673_1140 | 155 |
| 1192 | 3300049743 | Ga0501081_0236596 | Ga0501081_0236596_596_1063 | 155 |
| 1193 | 3300049744 | Ga0501083_0024300 | Ga0501083_0024300_70_564 | 155 |
| 1194 | 3300050494 | nmdc:mga06z11_29428_c2 | nmdc:mga06z11_29428_c2_195_662 | 155 |
| 1195 | 3300050507 | nmdc:mga05p37_741212_c1 | nmdc:mga05p37_741212_c1_413_883 | 155 |
| 1196 | 3300050511 | nmdc:mga08y16_11839_c1 | nmdc:mga08y16_11839_c1_1365_1832 | 155 |
| 1197 | 3300050511 | nmdc:mga08y16_520239_c1 | nmdc:mga08y16_520239_c1_368_844 | 155 |
| 1198 | 3300050511 | nmdc:mga08y16_8011_c1 | nmdc:mga08y16_8011_c1_10522_10989 | 155 |
| 1199 | 3300050512 | nmdc:mga0n895_338139_c1 | nmdc:mga0n895_338139_c1_360_827 | 155 |
| 1200 | 3300050512 | nmdc:mga0n895_671956_c1 | nmdc:mga0n895_671956_c1_332_805 | 155 |
| 1201 | 3300050513 | nmdc:mga0rr50_850967_c1 | nmdc:mga0rr50_850967_c1_207_674 | 155 |
| 1202 | 3300050514 | nmdc:mga08x19_1247946_c1 | nmdc:mga08x19_1247946_c1_27_494 | 155 |
| 1203 | 3300050514 | nmdc:mga08x19_335073_c1 | nmdc:mga08x19_335073_c1_560_1027 | 155 |
| 1204 | 3300050515 | nmdc:mga0a205_129229_c1 | nmdc:mga0a205_129229_c1_1749_2216 | 155 |
| 1205 | 3300050515 | nmdc:mga0a205_166376_c1 | nmdc:mga0a205_166376_c1_1380_1847 | 155 |
| 1206 | 3300053077 | Ga0495601_0002167 | Ga0495601_0002167_214_687 | 155 |
| 1207 | 3300053077 | Ga0495601_0046952 | Ga0495601_0046952_301_774 | 155 |
| 1208 | 3300053078 | Ga0495612_0003368 | Ga0495612_0003368_5641_6114 | 155 |
| 1209 | 3300053078 | Ga0495612_0010382 | Ga0495612_0010382_3125_3598 | 155 |
| 1210 | 3300053084 | Ga0495595_0000307 | Ga0495595_0000307_5672_6145 | 155 |
| 1211 | 3300053084 | Ga0495595_0009648 | Ga0495595_0009648_2594_3067 | 155 |
| 1212 | 3300053085 | Ga0495619_0000059 | Ga0495619_0000059_10653_11126 | 155 |
| 1213 | 3300053085 | Ga0495619_0001730 | Ga0495619_0001730_13765_14238 | 155 |
| 1214 | 3300053093 | Ga0500651_0046995 | Ga0500651_0046995_562_1053 | 155 |
| 1215 | 3300053125 | Ga0500618_021017 | Ga0500618_021017_48_521 | 155 |
| 1216 | 3300060353 | Ga0501082_0089740 | Ga0501082_0089740_1586_2098 | 155 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2nnn-assembly3.cif.gz_E | crystal structure of probable transcriptional regulator from pseudomonas aeruginosa | 0.9621 | 23 | 155 |
| 2nnn-assembly5.cif.gz_J | crystal structure of probable transcriptional regulator from pseudomonas aeruginosa | 0.9589 | 23 | 155 |
| 4ija-assembly1.cif.gz_B | structure of s. aureus methicillin resistance factor mecr2 | 0.9578 | 53 | 113 |
| 2nnn-assembly4.cif.gz_G | crystal structure of probable transcriptional regulator from pseudomonas aeruginosa | 0.9577 | 23 | 155 |
| 2nnn-assembly3.cif.gz_E | crystal structure of probable transcriptional regulator from pseudomonas aeruginosa | 0.9551 | 23 | 155 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4ijaB01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9591 | 53 | 114 | 1.10.10.10 |
| 2nnnF00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9489 | 23 | 155 | 1.10.10.10 |
| af_Q57824_147_206_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9488 | 51 | 112 | 1.10.10.10 |
| 4ijaB01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9425 | 53 | 114 | 1.10.10.10 |
| 2nnnF00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9421 | 23 | 155 | 1.10.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2W5QTT3-F1-model_v4 | MarR family transcriptional regulator | 0.9851 | 20 | 155 |
GO:0003700
GO:0006950 |
| AF-A0A2U0THW1-F1-model_v4 | deleted | 0.9789 | 32 | 154 |
|
| AF-A0A7W6RZR6-F1-model_v4 | DNA-binding MarR family transcriptional regulator | 0.9777 | 28 | 155 |
GO:0003677
GO:0003700 GO:0006950 |
| AF-A0A839ZF82-F1-model_v4 | DNA-binding MarR family transcriptional regulator | 0.9772 | 22 | 155 |
GO:0003677
GO:0003700 GO:0006950 |
| AF-A0A4V2EAP2-F1-model_v4 | MarR family transcriptional regulator | 0.9725 | 22 | 154 |
GO:0003700
GO:0006950 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar