F491797

General Info

Members Datasets Scaffolds Average Seq Length
1216 521 1212 155

Family's Representative Sequence

Representative Sequence 3300046516|Ga0495628_0482464|Ga0495628_0482464_162_632
Length 156
Sequence MKTLSREKLKVVAARADASEQGSYVLDEQAGFLMRVAMQRHTSIFTSRMLEGLTRTQFAALAKLYEVGPCSQNHLGRLIYLDAATIKGVVDRLHLRGFVTALSDPNDRRRPVALTERGRQVTEAAMLVAAEITAATLTPLTADEQRMIAKLLRKLG

Samples

Sample ID Description Type Environment
1 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
2 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
3 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
4 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
5 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
6 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
7 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
8 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
9 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
10 3300000045 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere Metagenome Rhizosphere
11 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
12 3300001430 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 Metagenome Rhizosphere
13 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
14 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
15 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
16 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
17 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
18 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
19 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
20 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
21 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
22 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
23 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
24 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
25 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
26 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
27 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
28 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
29 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
30 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
31 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
32 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
33 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
34 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
35 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
36 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
37 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
38 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
39 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
40 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
41 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
42 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
43 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
44 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
45 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
46 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
47 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
48 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
49 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
50 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
51 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
52 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
53 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
54 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
55 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
56 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
57 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
58 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
59 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
60 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
61 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
62 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
63 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
64 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
65 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
66 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
67 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
68 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
69 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
70 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
71 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
72 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
73 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
74 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
75 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
76 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
77 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
78 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
79 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
80 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
81 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
82 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
83 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
84 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
85 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
86 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
87 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
88 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
89 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
90 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
91 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
92 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
93 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
94 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
95 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
96 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
97 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
98 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
99 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
100 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
101 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
102 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
103 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
104 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
105 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
106 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
107 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
108 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
109 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
110 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
111 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
112 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
113 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
114 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
115 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
116 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
117 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
118 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
119 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
120 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
121 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
122 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
123 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
124 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
125 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
126 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
127 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
128 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
129 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
130 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
131 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
132 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
133 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
134 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
135 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
136 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
137 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
138 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
139 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
140 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
141 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
142 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
143 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
144 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
145 3300012476 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.yng.070610 Metagenome Rhizosphere
146 3300012492 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 Metagenome Rhizosphere
147 3300012494 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 Metagenome Rhizosphere
148 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
149 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
150 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
151 3300012503 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R Metagenome Rhizosphere
152 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
153 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
154 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
155 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
156 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
157 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
158 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
159 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
160 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
161 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
162 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
163 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
164 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
165 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
166 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
167 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
168 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
169 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
170 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
171 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
172 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
173 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
174 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
175 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
177 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
178 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
179 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
234 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
238 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
239 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
240 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
241 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
242 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
244 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
245 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
246 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
247 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
248 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
249 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
250 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
251 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
252 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
253 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
254 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
255 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
256 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
257 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
258 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
259 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
260 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
261 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
262 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
263 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
264 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
265 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
266 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
267 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
268 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
269 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
270 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
271 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
272 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
273 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
274 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
275 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
276 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
277 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
278 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
279 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
280 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
281 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
282 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
283 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
284 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
285 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
286 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
287 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
288 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
289 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
290 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
291 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
292 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
293 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
294 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
295 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
296 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
297 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
298 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
299 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
300 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
301 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
302 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
303 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
304 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
305 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
306 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
307 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
308 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
309 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
310 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
311 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
312 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
313 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
314 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
315 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
316 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
317 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
318 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
319 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
320 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
321 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
322 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
323 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
324 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
325 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
326 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
327 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
328 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
329 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
330 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
331 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
332 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
333 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
334 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
335 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
336 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
337 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
338 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
339 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
340 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
341 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
342 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
343 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
344 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
345 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
346 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
347 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
348 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
349 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
350 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
351 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
352 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
353 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
354 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
355 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
356 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
357 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
358 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
359 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
360 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
361 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
362 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
363 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
364 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
365 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
366 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
367 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
368 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
369 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
370 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
371 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
372 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
373 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
374 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
375 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
376 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
377 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
378 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
379 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
380 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
381 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
382 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
383 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
384 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
385 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
386 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
387 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
388 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
389 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
390 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
391 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
392 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
393 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
394 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
395 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
396 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
397 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
398 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
399 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
400 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
401 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
402 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
403 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
404 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
405 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
406 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
407 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
408 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
409 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
410 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
411 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
412 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
413 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
414 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
415 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
416 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
417 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
418 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
419 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
420 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
421 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
422 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
423 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
424 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
425 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
426 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
427 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
428 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
429 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
430 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
431 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
432 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
433 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
434 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
435 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
436 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
437 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
438 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
439 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
440 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
441 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
442 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
443 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
444 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
445 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
446 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
447 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
448 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
449 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
450 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
451 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
452 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
453 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
454 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
455 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
456 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
457 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
458 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
459 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
460 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
461 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
462 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
463 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
464 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
465 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
466 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
467 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
468 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
469 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
470 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
471 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
472 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
473 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
474 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
475 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
476 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
477 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
478 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
479 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
480 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
481 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
482 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
483 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
484 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
485 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
486 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
487 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
488 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
489 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
490 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
491 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
492 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
493 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
494 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
495 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
496 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
497 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
498 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
499 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
500 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
501 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
502 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
503 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
504 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
505 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
506 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
507 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
508 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
509 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
510 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
511 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
512 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
513 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
514 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
515 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
516 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
517 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
518 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
519 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
520 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
521 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.59
Metatranscriptomes 0.08
Isolates 0.33

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.47
Nodule 0
Rhizoplane 5.02
Rhizosphere 82.73
Stem 0
Stem Tuber 0
Unclassified 3.78

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 2214800760 2209111006 Bacteria 10890
2 ARcpr5oldR_c000187 3300000041 Bacteria 10789
3 ARSoilYngRDRAFT_c00132 3300000042 Bacteria 12557
4 ARcpr5yngRDRAFT_c000643 3300000043 Bacteria 4372
5 ARSoilOldRDRAFT_c000044 3300000044 Bacteria 26451
6 ARCol0oldRDRAFT_c00484 3300000045 Bacteria 3716
7 ARCol0yngRDRAFT_1000153 3300000652 Bacteria 12275
8 JGI24032J14994_101472 3300001430 Bacteria 974
9 JGI24741J21665_1025315 3300001915 Bacteria 907
10 JGI24752J21851_1016260 3300001976 Bacteria 968
11 JGI24746J21847_1005317 3300001977 Bacteria 2011
12 JGI24747J21853_1014220 3300001978 Bacteria 827
13 JGI24739J22299_10024622 3300001989 Bacteria 2122
14 JGI24737J22298_10006807 3300001990 Bacteria 3884
15 JGI24737J22298_10007788 3300001990 Bacteria 3611
16 JGI24737J22298_10024518 3300001990 Unclassified 1910
17 JGI24745J21846_1002155 3300002073 Bacteria 1981
18 JGI24738J21930_10016553 3300002075 Bacteria 1556
19 JGI24749J21850_1004742 3300002076 Bacteria 1905
20 JGI24749J21850_1005739 3300002076 Bacteria 1732
21 JGI24035J26624_1001878 3300002126 Bacteria 1959
22 JGI24033J26618_1016316 3300002155 Bacteria 922
23 JGI24034J26672_10012906 3300002239 Bacteria 1264
24 JGI24742J22300_10002556 3300002244 Bacteria 2906
25 JGI25153J46596_10003982 3300003215 Bacteria 8074
26 rootH1_10113021 3300003323 Bacteria 1620
27 Ga0065165_1059454 3300005262 Bacteria 1052
28 Ga0065165_1104001 3300005262 Bacteria 707
29 Ga0065712_10073820 3300005290 Bacteria 4269
30 Ga0065715_10096283 3300005293 Bacteria 3910
31 Ga0070658_10072899 3300005327 Bacteria 2815
32 Ga0070658_10080660 3300005327 Bacteria 2672
33 Ga0070676_10000985 3300005328 Bacteria 14158
34 Ga0070676_10039981 3300005328 Bacteria 2714
35 Ga0070683_100001244 3300005329 Bacteria 19370
36 Ga0070683_100553405 3300005329 Bacteria 1100
37 Ga0070683_100645113 3300005329 Bacteria 1014
38 Ga0070690_100012869 3300005330 Bacteria 4930
39 Ga0070690_100021460 3300005330 Bacteria 3944
40 Ga0070690_100026138 3300005330 Bacteria 3598
41 Ga0070690_100506992 3300005330 Bacteria 904
42 Ga0070670_100012785 3300005331 Bacteria 7182
43 Ga0070670_101789424 3300005331 Unclassified 565
44 Ga0070677_10006769 3300005333 Bacteria 3814
45 Ga0068869_100027806 3300005334 Bacteria 3946
46 Ga0068869_100198362 3300005334 Unclassified 1581
47 Ga0068869_100953368 3300005334 Bacteria 745
48 Ga0070666_10054336 3300005335 Bacteria 2702
49 Ga0070666_10178291 3300005335 Bacteria 1490
50 Ga0070666_10481090 3300005335 Bacteria 899
51 Ga0070680_100044451 3300005336 Bacteria 3609
52 Ga0070680_100058826 3300005336 Bacteria 3144
53 Ga0070680_100066695 3300005336 Bacteria 2951
54 Ga0070680_100113040 3300005336 Bacteria 2261
55 Ga0070680_100511712 3300005336 Bacteria 1028
56 Ga0070680_100892790 3300005336 Bacteria 767
57 Ga0070682_100029667 3300005337 Bacteria 3294
58 Ga0070682_100115799 3300005337 Bacteria 1793
59 Ga0070682_100341631 3300005337 Bacteria 1113
60 Ga0070682_100547156 3300005337 Bacteria 905
61 Ga0068868_100004160 3300005338 Bacteria 10113
62 Ga0068868_100390300 3300005338 Bacteria 1199
63 Ga0068868_100605743 3300005338 Bacteria 971
64 Ga0070660_100000525 3300005339 Bacteria 25536
65 Ga0070660_100030675 3300005339 Bacteria 4033
66 Ga0070660_100059117 3300005339 Bacteria 2972
67 Ga0070660_100797671 3300005339 Bacteria 794
68 Ga0070660_100989190 3300005339 Bacteria 711
69 Ga0070689_100002898 3300005340 Bacteria 11283
70 Ga0070689_100135170 3300005340 Bacteria 1980
71 Ga0070689_100746381 3300005340 Unclassified 858
72 Ga0070689_101706795 3300005340 Bacteria 573
73 Ga0070691_10002569 3300005341 Bacteria 8092
74 Ga0070691_10179444 3300005341 Bacteria 1102
75 Ga0070687_100082377 3300005343 Bacteria 1759
76 Ga0070687_100171850 3300005343 Bacteria 1291
77 Ga0070687_100833700 3300005343 Bacteria 656
78 Ga0070661_100004361 3300005344 Bacteria 9758
79 Ga0070661_100086436 3300005344 Bacteria 2318
80 Ga0070661_100809478 3300005344 Bacteria 769
81 Ga0070692_10009575 3300005345 Bacteria 4373
82 Ga0070692_10017346 3300005345 Bacteria 3440
83 Ga0070668_100015096 3300005347 Bacteria 5771
84 Ga0070668_100112572 3300005347 Bacteria 2167
85 Ga0070668_100250077 3300005347 Bacteria 1471
86 Ga0070669_100002142 3300005353 Bacteria 14279
87 Ga0070669_100012165 3300005353 Bacteria 6108
88 Ga0070669_100128259 3300005353 Bacteria 1943
89 Ga0070675_100053131 3300005354 Bacteria 3332
90 Ga0070675_100328970 3300005354 Bacteria 1351
91 Ga0070675_100696796 3300005354 Bacteria 925
92 Ga0070671_100005408 3300005355 Bacteria 10186
93 Ga0070671_101230595 3300005355 Bacteria 659
94 Ga0070674_100001208 3300005356 Bacteria 13557
95 Ga0070674_100602417 3300005356 Bacteria 928
96 Ga0070673_100006682 3300005364 Bacteria 7519
97 Ga0070673_100331008 3300005364 Bacteria 1348
98 Ga0070688_100000970 3300005365 Bacteria 14364
99 Ga0070688_100001615 3300005365 Bacteria 11287
100 Ga0070688_100002125 3300005365 Bacteria 9989
101 Ga0070688_100926366 3300005365 Unclassified 688
102 Ga0070659_100442858 3300005366 Bacteria 1101
103 Ga0070659_100452047 3300005366 Bacteria 1090
104 Ga0070659_100623816 3300005366 Unclassified 928
105 Ga0070659_100983227 3300005366 Unclassified 740
106 Ga0070667_100018716 3300005367 Bacteria 5744
107 Ga0070667_100027679 3300005367 Bacteria 4717
108 Ga0070667_100041879 3300005367 Bacteria 3841
109 Ga0070667_100902466 3300005367 Bacteria 823
110 Ga0070703_10018531 3300005406 Bacteria 2014
111 Ga0070703_10108693 3300005406 Bacteria 989
112 Ga0070709_10040154 3300005434 Bacteria 2875
113 Ga0070709_10137388 3300005434 Bacteria 1676
114 Ga0070709_10203545 3300005434 Bacteria 1403
115 Ga0070709_10465381 3300005434 Bacteria 955
116 Ga0070714_100006637 3300005435 Bacteria 8954
117 Ga0070714_100155738 3300005435 Bacteria 2062
118 Ga0070714_100667074 3300005435 Bacteria 1002
119 Ga0070714_100788788 3300005435 Bacteria 920
120 Ga0070714_101649337 3300005435 Bacteria 626
121 Ga0070713_100014447 3300005436 Bacteria 5866
122 Ga0070713_100277870 3300005436 Bacteria 1535
123 Ga0070713_100452867 3300005436 Bacteria 1205
124 Ga0070713_100696588 3300005436 Bacteria 970
125 Ga0070710_10017052 3300005437 Bacteria 3709
126 Ga0070710_10036006 3300005437 Bacteria 2703
127 Ga0070710_10139034 3300005437 Bacteria 1487
128 Ga0070701_10000532 3300005438 Bacteria 13106
129 Ga0070711_100008900 3300005439 Bacteria 6161
130 Ga0070711_100043265 3300005439 Bacteria 3049
131 Ga0070711_100104380 3300005439 Bacteria 2067
132 Ga0070705_100006339 3300005440 Bacteria 5795
133 Ga0070705_100150389 3300005440 Unclassified 1544
134 Ga0070705_101508158 3300005440 Bacteria 563
135 Ga0070700_100031664 3300005441 Bacteria 3171
136 Ga0070694_100001428 3300005444 Bacteria 13999
137 Ga0070694_100002143 3300005444 Bacteria 11698
138 Ga0070708_100046627 3300005445 Bacteria 3824
139 Ga0070708_100328671 3300005445 Bacteria 1440
140 Ga0070663_100046288 3300005455 Bacteria 3077
141 Ga0070663_100085578 3300005455 Bacteria 2327
142 Ga0070663_100173614 3300005455 Bacteria 1668
143 Ga0070663_100219923 3300005455 Bacteria 1491
144 Ga0070678_100026205 3300005456 Bacteria 3937
145 Ga0070678_100056901 3300005456 Bacteria 2862
146 Ga0070678_100138354 3300005456 Bacteria 1945
147 Ga0070662_100034625 3300005457 Bacteria 3562
148 Ga0070681_10017611 3300005458 Bacteria 7140
149 Ga0070681_10109594 3300005458 Bacteria 2701
150 Ga0070681_10120499 3300005458 Bacteria 2558
151 Ga0070681_10133801 3300005458 Bacteria 2410
152 Ga0070681_10277579 3300005458 Bacteria 1587
153 Ga0070681_10295426 3300005458 Bacteria 1530
154 Ga0070681_11234113 3300005458 Bacteria 670
155 Ga0068867_100007122 3300005459 Bacteria 7900
156 Ga0068867_100090816 3300005459 Bacteria 2318
157 Ga0068867_100384372 3300005459 Bacteria 1180
158 Ga0070685_10006338 3300005466 Bacteria 6029
159 Ga0070685_10010065 3300005466 Bacteria 4905
160 Ga0070707_101332321 3300005468 Bacteria 684
161 Ga0070679_100008193 3300005530 Bacteria 9826
162 Ga0070679_100057917 3300005530 Bacteria 3861
163 Ga0070679_100058535 3300005530 Bacteria 3839
164 Ga0070679_100153842 3300005530 Bacteria 2276
165 Ga0070679_100186809 3300005530 Bacteria 2043
166 Ga0070679_100339329 3300005530 Bacteria 1451
167 Ga0070679_100474175 3300005530 Bacteria 1196
168 Ga0070679_100505201 3300005530 Bacteria 1153
169 Ga0070679_100505526 3300005530 Bacteria 1152
170 Ga0070679_100594718 3300005530 Bacteria 1050
171 Ga0070679_100602214 3300005530 Bacteria 1042
172 Ga0070679_100612729 3300005530 Bacteria 1032
173 Ga0070679_100931253 3300005530 Unclassified 812
174 Ga0070684_100090107 3300005535 Bacteria 2727
175 Ga0070684_100135689 3300005535 Bacteria 2223
176 Ga0070684_100227057 3300005535 Bacteria 1704
177 Ga0070684_100666844 3300005535 Bacteria 969
178 Ga0070697_101145666 3300005536 Unclassified 693
179 Ga0068853_100032736 3300005539 Bacteria 4406
180 Ga0068853_100833033 3300005539 Bacteria 884
181 Ga0068853_101176117 3300005539 Bacteria 740
182 Ga0070672_100000940 3300005543 Bacteria 17505
183 Ga0070686_100003535 3300005544 Bacteria 8573
184 Ga0070686_100004740 3300005544 Bacteria 7501
185 Ga0070686_101165750 3300005544 Unclassified 639
186 Ga0070695_100007876 3300005545 Bacteria 6310
187 Ga0070695_100014616 3300005545 Bacteria 4733
188 Ga0070696_100783602 3300005546 Bacteria 784
189 Ga0070693_100027001 3300005547 Bacteria 3105
190 Ga0070693_100209343 3300005547 Bacteria 1271
191 Ga0070665_100215246 3300005548 Bacteria 1922
192 Ga0070665_100281953 3300005548 Unclassified 1664
193 Ga0070704_100001579 3300005549 Bacteria 12300
194 Ga0070704_100579013 3300005549 Bacteria 984
195 Ga0068855_100023093 3300005563 Bacteria 7453
196 Ga0068855_100128657 3300005563 Bacteria 2893
197 Ga0068855_100279388 3300005563 Bacteria 1855
198 Ga0068855_100630157 3300005563 Bacteria 1154
199 Ga0068855_100666786 3300005563 Bacteria 1116
200 Ga0070664_100687532 3300005564 Bacteria 952
201 Ga0068857_100009322 3300005577 Bacteria 8522
202 Ga0068857_100224548 3300005577 Bacteria 1716
203 Ga0068857_100255515 3300005577 Bacteria 1607
204 Ga0068857_100467783 3300005577 Bacteria 1180
205 Ga0068854_100090300 3300005578 Bacteria 2278
206 Ga0068854_100229222 3300005578 Unclassified 1474
207 Ga0068856_100022760 3300005614 Bacteria 6093
208 Ga0068856_100045729 3300005614 Bacteria 4311
209 Ga0068856_100055386 3300005614 Bacteria 3914
210 Ga0068856_100503178 3300005614 Bacteria 1233
211 Ga0068856_100503931 3300005614 Bacteria 1232
212 Ga0068856_101114309 3300005614 Bacteria 806
213 Ga0070702_100031454 3300005615 Bacteria 2904
214 Ga0070702_100629261 3300005615 Unclassified 809
215 Ga0068852_100003198 3300005616 Bacteria 11433
216 Ga0068852_100058916 3300005616 Bacteria 3328
217 Ga0068852_100134350 3300005616 Bacteria 2283
218 Ga0068852_100260531 3300005616 Bacteria 1665
219 Ga0068852_100381048 3300005616 Bacteria 1384
220 Ga0068859_100096576 3300005617 Unclassified 3007
221 Ga0068859_100525799 3300005617 Bacteria 1278
222 Ga0068864_100003045 3300005618 Bacteria 13839
223 Ga0068864_100016705 3300005618 Bacteria 6115
224 Ga0068866_10000410 3300005718 Bacteria 20000
225 Ga0068866_10091486 3300005718 Bacteria 1658
226 Ga0068866_10487672 3300005718 Bacteria 813
227 Ga0068861_100009022 3300005719 Bacteria 6875
228 Ga0068861_100040082 3300005719 Bacteria 3500
229 Ga0068851_10490689 3300005834 Unclassified 735
230 Ga0068870_10000215 3300005840 Bacteria 20886
231 Ga0068870_10588744 3300005840 Bacteria 754
232 Ga0068863_100484261 3300005841 Bacteria 1217
233 Ga0068858_100005681 3300005842 Bacteria 12193
234 Ga0068858_100049473 3300005842 Bacteria 3893
235 Ga0068858_100087583 3300005842 Bacteria 2896
236 Ga0068858_100216226 3300005842 Bacteria 1814
237 Ga0068858_100445845 3300005842 Bacteria 1247
238 Ga0068860_100009344 3300005843 Bacteria 9741
239 Ga0068860_100084361 3300005843 Bacteria 3022
240 Ga0068860_100147618 3300005843 Bacteria 2263
241 Ga0068862_100015662 3300005844 Bacteria 6299
242 Ga0068862_100044125 3300005844 Bacteria 3803
243 Ga0081455_10000012 3300005937 Bacteria 201668
244 Ga0081455_10323975 3300005937 Bacteria 1097
245 Ga0081539_10021800 3300005985 Bacteria 4264
246 Ga0070717_10066769 3300006028 Bacteria 2992
247 Ga0070717_10131054 3300006028 Bacteria 2156
248 Ga0075365_10054599 3300006038 Bacteria 2650
249 Ga0075365_10171638 3300006038 Bacteria 1514
250 Ga0075368_10057624 3300006042 Bacteria 1551
251 Ga0075363_100025836 3300006048 Bacteria 2999
252 Ga0075363_100103010 3300006048 Bacteria 1581
253 Ga0075364_10012460 3300006051 Bacteria 5202
254 Ga0075364_10113903 3300006051 Bacteria 1807
255 Ga0075364_10269518 3300006051 Unclassified 1158
256 Ga0075364_10362153 3300006051 Bacteria 989
257 Ga0075364_10403479 3300006051 Bacteria 933
258 Ga0075432_10298429 3300006058 Bacteria 668
259 Ga0070715_10088100 3300006163 Bacteria 1422
260 Ga0070715_10167979 3300006163 Bacteria 1090
261 Ga0070716_100070371 3300006173 Bacteria 2054
262 Ga0070716_101102772 3300006173 Unclassified 633
263 Ga0070712_100044771 3300006175 Bacteria 3053
264 Ga0070712_100062276 3300006175 Bacteria 2637
265 Ga0070712_100390343 3300006175 Bacteria 1147
266 Ga0070712_100403531 3300006175 Bacteria 1129
267 Ga0070712_100551581 3300006175 Bacteria 971
268 Ga0070712_100941022 3300006175 Bacteria 746
269 Ga0070712_101834221 3300006175 Bacteria 531
270 Ga0075362_10055834 3300006177 Bacteria 1776
271 Ga0075367_10102936 3300006178 Bacteria 1747
272 Ga0075367_10107828 3300006178 Bacteria 1707
273 Ga0075367_10112312 3300006178 Bacteria 1674
274 Ga0075367_10249295 3300006178 Bacteria 1114
275 Ga0075369_10124732 3300006186 Bacteria 1167
276 Ga0075366_10038723 3300006195 Bacteria 2816
277 Ga0075366_10042179 3300006195 Bacteria 2701
278 Ga0075366_10501080 3300006195 Bacteria 751
279 Ga0097621_100003185 3300006237 Bacteria 11280
280 Ga0097621_100020982 3300006237 Bacteria 5042
281 Ga0075370_10150533 3300006353 Bacteria 1364
282 Ga0075370_10305990 3300006353 Bacteria 946
283 Ga0075370_10625550 3300006353 Bacteria 653
284 Ga0068871_100002188 3300006358 Bacteria 13277
285 Ga0068871_100236587 3300006358 Bacteria 1587
286 Ga0075431_100854608 3300006847 Bacteria 881
287 Ga0075433_10145737 3300006852 Bacteria 2105
288 Ga0075434_100072114 3300006871 Bacteria 3445
289 Ga0075434_100655384 3300006871 Bacteria 1068
290 Ga0068865_100002213 3300006881 Bacteria 11451
291 Ga0075436_101151660 3300006914 Unclassified 585
292 Ga0097620_100096573 3300006931 Unclassified 3007
293 Ga0097620_100525784 3300006931 Bacteria 1278
294 Ga0075435_100890253 3300007076 Unclassified 776
295 Ga0075435_101178911 3300007076 Bacteria 670
296 Ga0099795_10255076 3300007788 Bacteria 758
297 Ga0105244_10076572 3300009036 Bacteria 1661
298 Ga0105250_10021032 3300009092 Bacteria 2634
299 Ga0105240_10175571 3300009093 Bacteria 2533
300 Ga0105240_10205018 3300009093 Bacteria 2309
301 Ga0105240_10222888 3300009093 Bacteria 2196
302 Ga0105240_12104437 3300009093 Bacteria 586
303 Ga0111539_10000114 3300009094 Bacteria 88757
304 Ga0111539_10046475 3300009094 Bacteria 5192
305 Ga0111539_10048105 3300009094 Bacteria 5094
306 Ga0105245_10014117 3300009098 Bacteria 6959
307 Ga0105245_10064510 3300009098 Bacteria 3310
308 Ga0105245_11666629 3300009098 Unclassified 690
309 Ga0105247_10004602 3300009101 Bacteria 8793
310 Ga0105247_10124830 3300009101 Unclassified 1672
311 Ga0105247_10766609 3300009101 Unclassified 733
312 Ga0114129_10196645 3300009147 Bacteria 2734
313 Ga0114129_10467764 3300009147 Bacteria 1652
314 Ga0114129_11177876 3300009147 Bacteria 956
315 Ga0105243_10017428 3300009148 Bacteria 5430
316 Ga0105243_10068746 3300009148 Bacteria 2855
317 Ga0105241_10007805 3300009174 Bacteria 7868
318 Ga0105241_10174331 3300009174 Bacteria 1778
319 Ga0105241_10967710 3300009174 Bacteria 794
320 Ga0105242_10011497 3300009176 Bacteria 6805
321 Ga0105242_10045137 3300009176 Bacteria 3570
322 Ga0105242_10421769 3300009176 Bacteria 1250
323 Ga0105248_10015424 3300009177 Bacteria 8423
324 Ga0105248_10015952 3300009177 Bacteria 8273
325 Ga0105248_10033034 3300009177 Bacteria 5779
326 Ga0105248_11219054 3300009177 Bacteria 851
327 Ga0105248_11677516 3300009177 Unclassified 720
328 Ga0105237_10020483 3300009545 Bacteria 6814
329 Ga0105238_10057443 3300009551 Bacteria 3901
330 Ga0105238_10094621 3300009551 Bacteria 2975
331 Ga0105249_10019102 3300009553 Bacteria 6113
332 Ga0105249_10317131 3300009553 Bacteria 1569
333 Ga0105249_10617774 3300009553 Bacteria 1139
334 Ga0105239_10039524 3300010375 Bacteria 5169
335 Ga0105239_10172932 3300010375 Bacteria 2416
336 Ga0105239_10553397 3300010375 Bacteria 1310
337 Ga0105246_10006910 3300011119 Bacteria 6943
338 Ga0105246_10014551 3300011119 Bacteria 4949
339 Ga0105246_12582018 3300011119 Bacteria 501
340 Ga0157344_1003626 3300012476 Unclassified 881
341 Ga0157335_1024583 3300012492 Unclassified 596
342 Ga0157341_1010202 3300012494 Unclassified 794
343 Ga0157319_1024004 3300012497 Unclassified 614
344 Ga0157345_1008648 3300012498 Unclassified 855
345 Ga0157347_1006947 3300012502 Bacteria 1119
346 Ga0157313_1001104 3300012503 Unclassified 1397
347 Ga0157342_1013783 3300012507 Unclassified 867
348 Ga0157373_10112032 3300013100 Bacteria 1918
349 Ga0157373_10264708 3300013100 Bacteria 1217
350 Ga0157373_10334246 3300013100 Bacteria 1079
351 Ga0157371_10100708 3300013102 Bacteria 2049
352 Ga0157371_10116284 3300013102 Bacteria 1900
353 Ga0157370_10230672 3300013104 Bacteria 1714
354 Ga0157370_10246969 3300013104 Bacteria 1651
355 Ga0157370_10293164 3300013104 Bacteria 1502
356 Ga0157370_10421031 3300013104 Bacteria 1229
357 Ga0157369_10051616 3300013105 Bacteria 4450
358 Ga0157369_10711585 3300013105 Bacteria 1034
359 Ga0157374_10039734 3300013296 Bacteria 4330
360 Ga0157374_10148788 3300013296 Bacteria 2276
361 Ga0157374_10771956 3300013296 Unclassified 976
362 Ga0157378_10085000 3300013297 Bacteria 2866
363 Ga0163162_10012152 3300013306 Bacteria 8405
364 Ga0163162_10043605 3300013306 Bacteria 4492
365 Ga0163162_10315316 3300013306 Bacteria 1696
366 Ga0163162_10631073 3300013306 Bacteria 1196
367 Ga0157372_10244952 3300013307 Unclassified 2080
368 Ga0157375_10034225 3300013308 Bacteria 4838
369 Ga0157375_10155208 3300013308 Bacteria 2427
370 Ga0157375_10168269 3300013308 Bacteria 2338
371 Ga0163163_10007836 3300014325 Bacteria 9443
372 Ga0163163_10042146 3300014325 Bacteria 4469
373 Ga0163163_10089185 3300014325 Bacteria 3096
374 Ga0163163_11243048 3300014325 Unclassified 807
375 Ga0163163_11255517 3300014325 Bacteria 803
376 Ga0157380_10520404 3300014326 Bacteria 1160
377 Ga0157380_10887660 3300014326 Bacteria 917
378 Ga0157377_10005046 3300014745 Bacteria 6163
379 Ga0157379_10001743 3300014968 Bacteria 17988
380 Ga0157379_10184364 3300014968 Bacteria 1886
381 Ga0157379_10515085 3300014968 Bacteria 1110
382 Ga0157379_10635299 3300014968 Bacteria 998
383 Ga0157379_11852688 3300014968 Bacteria 594
384 Ga0157376_10004369 3300014969 Bacteria 9832
385 Ga0157376_10805559 3300014969 Bacteria 952
386 Ga0157376_11212177 3300014969 Unclassified 783
387 Ga0182005_1097311 3300015265 Bacteria 822
388 Ga0163161_10078100 3300017792 Bacteria 2433
389 Ga0163161_10231698 3300017792 Bacteria 1433
390 Ga0206356_10418905 3300020070 Bacteria 2138
391 Ga0213872_10036087 3300021361 Bacteria 2260
392 Ga0213874_10105697 3300021377 Bacteria 941
393 Ga0213874_10274349 3300021377 Bacteria 628
394 Ga0213876_10010724 3300021384 Bacteria 4911
395 Ga0213876_10049608 3300021384 Bacteria 2218
396 Ga0213876_10182100 3300021384 Bacteria 1117
397 Ga0213875_10000074 3300021388 Bacteria 118349
398 Ga0213875_10180071 3300021388 Bacteria 993
399 Ga0209233_1004370 3300025261 Bacteria 4819
400 Ga0207666_1000732 3300025271 Bacteria 3929
401 Ga0207666_1000791 3300025271 Bacteria 3793
402 Ga0209564_1000544 3300025295 Bacteria 60955
403 Ga0209564_1016332 3300025295 Bacteria 2962
404 Ga0209758_1000241 3300025297 Bacteria 113998
405 Ga0209758_1002224 3300025297 Bacteria 20148
406 Ga0209758_1023449 3300025297 Bacteria 2790
407 Ga0207426_1073757 3300025302 Bacteria 943
408 Ga0207697_10005124 3300025315 Bacteria 6132
409 Ga0207697_10039255 3300025315 Bacteria 1942
410 Ga0207653_10004024 3300025885 Bacteria 4625
411 Ga0207682_10000071 3300025893 Bacteria 44843
412 Ga0207692_10010941 3300025898 Bacteria 3841
413 Ga0207692_10199649 3300025898 Bacteria 1175
414 Ga0207692_10327005 3300025898 Bacteria 940
415 Ga0207692_10895980 3300025898 Bacteria 583
416 Ga0207642_10002908 3300025899 Bacteria 5359
417 Ga0207710_10004664 3300025900 Bacteria 5948
418 Ga0207710_10030042 3300025900 Bacteria 2368
419 Ga0207688_10004331 3300025901 Bacteria 7735
420 Ga0207688_10050355 3300025901 Bacteria 2331
421 Ga0207680_10010064 3300025903 Bacteria 4717
422 Ga0207680_10334991 3300025903 Bacteria 1060
423 Ga0207647_10002565 3300025904 Bacteria 13740
424 Ga0207647_10008867 3300025904 Bacteria 7175
425 Ga0207685_10004209 3300025905 Bacteria 3623
426 Ga0207685_10097188 3300025905 Bacteria 1252
427 Ga0207699_10004429 3300025906 Bacteria 6713
428 Ga0207699_10053415 3300025906 Bacteria 2395
429 Ga0207699_10092009 3300025906 Bacteria 1906
430 Ga0207645_10037724 3300025907 Bacteria 3101
431 Ga0207643_10000276 3300025908 Bacteria 35671
432 Ga0207705_10102516 3300025909 Bacteria 2106
433 Ga0207705_10484475 3300025909 Bacteria 960
434 Ga0207654_10004277 3300025911 Bacteria 7204
435 Ga0207654_10061393 3300025911 Bacteria 2199
436 Ga0207654_10285765 3300025911 Bacteria 1117
437 Ga0207707_10012946 3300025912 Bacteria 7262
438 Ga0207707_10066546 3300025912 Bacteria 3139
439 Ga0207707_10099789 3300025912 Bacteria 2537
440 Ga0207707_10248930 3300025912 Bacteria 1544
441 Ga0207707_10288818 3300025912 Bacteria 1419
442 Ga0207707_10407929 3300025912 Bacteria 1166
443 Ga0207707_10499064 3300025912 Bacteria 1038
444 Ga0207707_10792262 3300025912 Bacteria 790
445 Ga0207695_10083002 3300025913 Bacteria 3238
446 Ga0207695_10419864 3300025913 Bacteria 1222
447 Ga0207671_10233919 3300025914 Bacteria 1442
448 Ga0207693_10003341 3300025915 Bacteria 13731
449 Ga0207693_10033429 3300025915 Bacteria 4059
450 Ga0207693_10229718 3300025915 Bacteria 1457
451 Ga0207693_10297135 3300025915 Bacteria 1265
452 Ga0207693_10411522 3300025915 Bacteria 1057
453 Ga0207693_10524969 3300025915 Bacteria 924
454 Ga0207693_10815645 3300025915 Bacteria 719
455 Ga0207663_10078055 3300025916 Bacteria 2157
456 Ga0207663_10112407 3300025916 Bacteria 1850
457 Ga0207663_10148579 3300025916 Bacteria 1641
458 Ga0207663_10504720 3300025916 Bacteria 940
459 Ga0207663_10700974 3300025916 Bacteria 802
460 Ga0207660_10000087 3300025917 Bacteria 49552
461 Ga0207660_10031348 3300025917 Bacteria 3660
462 Ga0207660_10032118 3300025917 Bacteria 3621
463 Ga0207660_10150054 3300025917 Bacteria 1790
464 Ga0207660_10168553 3300025917 Bacteria 1694
465 Ga0207660_10862448 3300025917 Bacteria 739
466 Ga0207662_10095222 3300025918 Bacteria 1837
467 Ga0207657_10009053 3300025919 Bacteria 10053
468 Ga0207657_10019619 3300025919 Bacteria 6412
469 Ga0207657_10042193 3300025919 Bacteria 4027
470 Ga0207657_10047331 3300025919 Bacteria 3761
471 Ga0207657_10048561 3300025919 Bacteria 3705
472 Ga0207649_10002302 3300025920 Bacteria 10744
473 Ga0207649_10360715 3300025920 Bacteria 1078
474 Ga0207649_10499333 3300025920 Bacteria 925
475 Ga0207652_10014976 3300025921 Bacteria 6291
476 Ga0207652_10034741 3300025921 Bacteria 4251
477 Ga0207652_10119706 3300025921 Bacteria 2342
478 Ga0207652_10142060 3300025921 Bacteria 2147
479 Ga0207652_10149856 3300025921 Bacteria 2088
480 Ga0207652_10163291 3300025921 Bacteria 1997
481 Ga0207652_10242651 3300025921 Bacteria 1624
482 Ga0207652_10274304 3300025921 Bacteria 1521
483 Ga0207681_10002160 3300025923 Bacteria 12529
484 Ga0207681_10039030 3300025923 Bacteria 3150
485 Ga0207681_10072458 3300025923 Bacteria 2406
486 Ga0207694_10012607 3300025924 Bacteria 6371
487 Ga0207694_10116921 3300025924 Bacteria 2125
488 Ga0207650_10019228 3300025925 Bacteria 4797
489 Ga0207650_10712331 3300025925 Unclassified 848
490 Ga0207659_10001604 3300025926 Bacteria 13419
491 Ga0207659_10215754 3300025926 Bacteria 1540
492 Ga0207687_10038314 3300025927 Bacteria 3276
493 Ga0207687_10552116 3300025927 Bacteria 967
494 Ga0207700_10044269 3300025928 Bacteria 3275
495 Ga0207700_10245931 3300025928 Bacteria 1526
496 Ga0207700_10685985 3300025928 Bacteria 914
497 Ga0207664_10029948 3300025929 Bacteria 4152
498 Ga0207664_10075575 3300025929 Bacteria 2724
499 Ga0207664_10226888 3300025929 Bacteria 1622
500 Ga0207664_10240895 3300025929 Bacteria 1575
501 Ga0207664_10578297 3300025929 Bacteria 1008
502 Ga0207644_10009341 3300025931 Bacteria 6440
503 Ga0207644_10048605 3300025931 Bacteria 3034
504 Ga0207644_10842020 3300025931 Bacteria 768
505 Ga0207690_10007427 3300025932 Bacteria 6506
506 Ga0207690_10223308 3300025932 Bacteria 1442
507 Ga0207690_10366720 3300025932 Bacteria 1142
508 Ga0207706_10006428 3300025933 Bacteria 10915
509 Ga0207706_10065125 3300025933 Bacteria 3209
510 Ga0207686_10002664 3300025934 Bacteria 9686
511 Ga0207686_10033863 3300025934 Bacteria 3052
512 Ga0207709_10004315 3300025935 Bacteria 8237
513 Ga0207709_10148526 3300025935 Bacteria 1620
514 Ga0207709_10209918 3300025935 Bacteria 1397
515 Ga0207709_11003067 3300025935 Bacteria 682
516 Ga0207670_10000486 3300025936 Bacteria 21952
517 Ga0207670_10000886 3300025936 Bacteria 15786
518 Ga0207670_10054370 3300025936 Bacteria 2701
519 Ga0207670_10118200 3300025936 Bacteria 1922
520 Ga0207670_11471753 3300025936 Bacteria 579
521 Ga0207669_10018860 3300025937 Bacteria 3578
522 Ga0207669_10236375 3300025937 Bacteria 1352
523 Ga0207669_10649893 3300025937 Unclassified 862
524 Ga0207704_10025289 3300025938 Bacteria 3236
525 Ga0207704_10308701 3300025938 Bacteria 1215
526 Ga0207665_10124325 3300025939 Bacteria 1825
527 Ga0207665_10161578 3300025939 Bacteria 1612
528 Ga0207665_10161603 3300025939 Bacteria 1611
529 Ga0207665_10620394 3300025939 Bacteria 846
530 Ga0207691_10007048 3300025940 Bacteria 10845
531 Ga0207691_10856808 3300025940 Bacteria 762
532 Ga0207711_10099289 3300025941 Bacteria 2573
533 Ga0207711_10121039 3300025941 Bacteria 2336
534 Ga0207689_10008107 3300025942 Bacteria 9162
535 Ga0207661_10008272 3300025944 Bacteria 7432
536 Ga0207661_10105082 3300025944 Bacteria 2379
537 Ga0207661_10907086 3300025944 Bacteria 811
538 Ga0207679_10000131 3300025945 Bacteria 61363
539 Ga0207679_10309521 3300025945 Bacteria 1364
540 Ga0207679_10658481 3300025945 Bacteria 948
541 Ga0207667_10056364 3300025949 Bacteria 4128
542 Ga0207667_10066210 3300025949 Bacteria 3766
543 Ga0207667_10076624 3300025949 Bacteria 3470
544 Ga0207667_11104269 3300025949 Bacteria 776
545 Ga0207651_10001949 3300025960 Bacteria 9701
546 Ga0207651_10358402 3300025960 Bacteria 1230
547 Ga0207712_10023188 3300025961 Bacteria 4094
548 Ga0207712_10369772 3300025961 Bacteria 1197
549 Ga0207668_10000655 3300025972 Bacteria 21225
550 Ga0207668_10137107 3300025972 Bacteria 1876
551 Ga0207668_10232112 3300025972 Bacteria 1488
552 Ga0207640_10032911 3300025981 Bacteria 3219
553 Ga0207640_10370960 3300025981 Bacteria 1156
554 Ga0207658_10018697 3300025986 Bacteria 4790
555 Ga0207658_10336803 3300025986 Bacteria 1310
556 Ga0207658_10476519 3300025986 Bacteria 1108
557 Ga0207677_10003214 3300026023 Bacteria 8618
558 Ga0207677_10059304 3300026023 Bacteria 2639
559 Ga0207703_10003628 3300026035 Bacteria 12867
560 Ga0207703_10045633 3300026035 Bacteria 3526
561 Ga0207703_10052993 3300026035 Bacteria 3297
562 Ga0207639_10006126 3300026041 Bacteria 8163
563 Ga0207639_10039853 3300026041 Bacteria 3503
564 Ga0207639_11028744 3300026041 Bacteria 772
565 Ga0207678_10004081 3300026067 Bacteria 13135
566 Ga0207678_10058646 3300026067 Bacteria 3312
567 Ga0207678_10515794 3300026067 Bacteria 1043
568 Ga0207708_10005844 3300026075 Bacteria 9104
569 Ga0207708_10010299 3300026075 Bacteria 6943
570 Ga0207708_10940798 3300026075 Unclassified 749
571 Ga0207702_10003322 3300026078 Bacteria 14778
572 Ga0207702_10054857 3300026078 Bacteria 3378
573 Ga0207702_10269679 3300026078 Bacteria 1605
574 Ga0207702_11348262 3300026078 Bacteria 707
575 Ga0207641_10001577 3300026088 Bacteria 22260
576 Ga0207648_10190350 3300026089 Bacteria 1818
577 Ga0207648_10774664 3300026089 Bacteria 892
578 Ga0207676_10001374 3300026095 Bacteria 18087
579 Ga0207676_10005788 3300026095 Bacteria 8741
580 Ga0207674_10036528 3300026116 Bacteria 5116
581 Ga0207674_10084893 3300026116 Bacteria 3163
582 Ga0207674_10418858 3300026116 Bacteria 1294
583 Ga0207675_100004272 3300026118 Bacteria 13806
584 Ga0207675_100163461 3300026118 Bacteria 2125
585 Ga0207683_10018680 3300026121 Bacteria 5915
586 Ga0207683_10091160 3300026121 Bacteria 2715
587 Ga0207698_10082289 3300026142 Bacteria 2602
588 Ga0207698_10123944 3300026142 Bacteria 2193
589 Ga0207698_10221202 3300026142 Bacteria 1711
590 Ga0207698_10262304 3300026142 Bacteria 1588
591 Ga0209969_1018346 3300027360 Bacteria 1034
592 Ga0209981_1017743 3300027378 Bacteria 1006
593 Ga0209984_1009741 3300027424 Bacteria 1225
594 Ga0209999_1003958 3300027543 Bacteria 2667
595 Ga0210002_1034988 3300027617 Bacteria 843
596 Ga0209983_1002977 3300027665 Bacteria 3657
597 Ga0209971_1020904 3300027682 Bacteria 1557
598 Ga0209966_1001582 3300027695 Bacteria 3915
599 Ga0209998_10001451 3300027717 Bacteria 5728
600 Ga0209998_10002203 3300027717 Bacteria 4517
601 Ga0207428_10000255 3300027907 Bacteria 72962
602 Ga0207428_10008215 3300027907 Bacteria 9439
603 Ga0207428_10066577 3300027907 Bacteria 2838
604 Ga0268266_10182841 3300028379 Bacteria 1910
605 Ga0268266_10441550 3300028379 Bacteria 1236
606 Ga0268266_10536683 3300028379 Bacteria 1120
607 Ga0268266_10617949 3300028379 Bacteria 1041
608 Ga0268266_11074836 3300028379 Bacteria 779
609 Ga0268266_11311795 3300028379 Bacteria 699
610 Ga0268265_10001553 3300028380 Bacteria 19032
611 Ga0268265_10599609 3300028380 Bacteria 1052
612 Ga0268264_10182973 3300028381 Bacteria 1905
613 Ga0268264_10552344 3300028381 Bacteria 1129
614 Ga0268264_10560450 3300028381 Bacteria 1122
615 Ga0265338_10052834 3300028800 Bacteria 3641
616 Ga0265338_10203324 3300028800 Bacteria 1492
617 Ga0265330_10068599 3300031235 Bacteria 1535
618 Ga0265320_10035321 3300031240 Bacteria 2535
619 Ga0265325_10038950 3300031241 Bacteria 2506
620 Ga0265325_10052164 3300031241 Bacteria 2101
621 Ga0265325_10068906 3300031241 Bacteria 1780
622 Ga0265325_10176622 3300031241 Bacteria 996
623 Ga0265329_10007181 3300031242 Bacteria 4334
624 Ga0265329_10035980 3300031242 Bacteria 1598
625 Ga0265340_10068129 3300031247 Bacteria 1690
626 Ga0265340_10071067 3300031247 Bacteria 1650
627 Ga0265340_10152576 3300031247 Bacteria 1052
628 Ga0265339_10041296 3300031249 Bacteria 2562
629 Ga0265339_10139913 3300031249 Bacteria 1232
630 Ga0265316_10051052 3300031344 Bacteria 3250
631 Ga0265316_10524679 3300031344 Bacteria 844
632 Ga0265313_10156634 3300031595 Bacteria 970
633 Ga0265313_10237970 3300031595 Bacteria 746
634 Ga0316575_10032856 3300031665 Bacteria 2034
635 Ga0316575_10037815 3300031665 Bacteria 1902
636 Ga0316579_10001599 3300031691 Bacteria 8284
637 Ga0265314_10000672 3300031711 Bacteria 41774
638 Ga0265342_10017835 3300031712 Bacteria 4609
639 Ga0265342_10019701 3300031712 Bacteria 4343
640 Ga0265342_10307568 3300031712 Unclassified 833
641 Ga0307406_10866612 3300031901 Bacteria 767
642 Ga0307412_10903371 3300031911 Unclassified 774
643 Ga0307409_100534704 3300031995 Bacteria 1148
644 Ga0307411_10321237 3300032005 Bacteria 1250
645 Ga0316583_10061899 3300032133 Bacteria 1311
646 Ga0373930_0000252 3300034816 Bacteria 6822
647 Ga0373948_0000821 3300034817 Bacteria 4102
648 Ga0373948_0021352 3300034817 Bacteria 1239
649 Ga0373950_0000200 3300034818 Bacteria 8183
650 Ga0373950_0005708 3300034818 Bacteria 1867
651 Ga0373958_0000159 3300034819 Bacteria 7683
652 Ga0373958_0002164 3300034819 Bacteria 2724
653 Ga0373959_0004470 3300034820 Unclassified 2256
654 Ga0373938_0000096 3300034957 Bacteria 11910
655 Ga0373926_0032602 3300035083 Bacteria 1838
656 Ga0373928_0000443 3300035084 Bacteria 8179
657 Ga0373928_0122920 3300035084 Unclassified 697
658 Ga0373929_0000756 3300035085 Bacteria 6285
659 Ga0373940_0000018 3300035088 Bacteria 19361
660 Ga0373944_0048607 3300035089 Unclassified 1331
661 Ga0373949_0000862 3300035090 Bacteria 9571
662 Ga0373949_0005361 3300035090 Bacteria 2861
663 Ga0373951_0000154 3300035091 Bacteria 25002
664 Ga0373951_0075387 3300035091 Unclassified 865
665 Ga0373952_0000790 3300035092 Bacteria 5689
666 Ga0373952_0001040 3300035092 Bacteria 5060
667 Ga0373952_0020743 3300035092 Bacteria 1380
668 Ga0373932_0000155 3300035112 Bacteria 19871
669 Ga0373932_0017117 3300035112 Bacteria 1857
670 Ga0373936_0014185 3300035113 Bacteria 3044
671 Ga0373939_0003369 3300035114 Bacteria 3751
672 Ga0373941_0086549 3300035115 Unclassified 1067
673 Ga0373945_0068147 3300035116 Bacteria 1341
674 Ga0373953_0005812 3300035117 Bacteria 4033
675 Ga0373953_0006532 3300035117 Bacteria 3849
676 Ga0373954_0006933 3300035118 Bacteria 4946
677 Ga0373956_0042945 3300035119 Bacteria 2011
678 Ga0373956_0056820 3300035119 Bacteria 1767
679 Ga0373956_0266313 3300035119 Bacteria 815
680 Ga0373957_0003837 3300035120 Bacteria 4509
681 Ga0373957_0156575 3300035120 Bacteria 937
682 Ga0373960_0000061 3300035121 Bacteria 14957
683 Ga0373960_0029818 3300035121 Bacteria 1515
684 Ga0373943_0045452 3300035170 Bacteria 2140
685 Ga0373943_0266959 3300035170 Bacteria 964
686 Ga0373943_0273836 3300035170 Bacteria 953
687 Ga0373946_0015814 3300035171 Bacteria 2867
688 Ga0373955_0000212 3300035172 Bacteria 24331
689 Ga0373955_0222778 3300035172 Bacteria 1127
690 Ga0373942_0000537 3300035207 Bacteria 10631
691 Ga0373961_0000451 3300035241 Bacteria 16466
692 Ga0373961_0004512 3300035241 Bacteria 3366
693 Ga0373962_0001266 3300035242 Bacteria 5937
694 Ga0373924_0018323 3300035410 Bacteria 2696
695 Ga0373931_0000170 3300035691 Bacteria 28307
696 Ga0373931_0005509 3300035691 Bacteria 5864
697 Ga0373931_0035713 3300035691 Bacteria 2586
698 Ga0373931_0092975 3300035691 Bacteria 1683
699 Ga0373935_0159986 3300035692 Bacteria 1534
700 Ga0373927_0002017 3300035695 Bacteria 14958
701 Ga0373927_0156923 3300035695 Bacteria 1490
702 Ga0373927_0354286 3300035695 Bacteria 967
703 Ga0373933_0005386 3300035724 Bacteria 6966
704 Ga0373933_0013093 3300035724 Bacteria 4593
705 Ga0373947_0028888 3300035725 Bacteria 3252
706 Ga0373947_0037363 3300035725 Bacteria 2882
707 Ga0373947_0037922 3300035725 Bacteria 2860
708 Ga0373937_0008093 3300036401 Bacteria 9127
709 Ga0373937_0032624 3300036401 Bacteria 4724
710 Ga0373937_0158761 3300036401 Bacteria 2120
711 Ga0373925_0004980 3300037068 Bacteria 9973
712 Ga0373925_0149804 3300037068 Bacteria 1831
713 Ga0395899_0004968 3300037312 Bacteria 10348
714 Ga0395899_0016270 3300037312 Bacteria 5670
715 Ga0395900_0007564 3300037418 Bacteria 11218
716 Ga0395900_0247416 3300037418 Unclassified 1785
717 Ga0395900_0306301 3300037418 Bacteria 1573
718 Ga0395900_0510748 3300037418 Bacteria 1151
719 Ga0395898_0007267 3300037466 Bacteria 11758
720 Ga0395898_0039336 3300037466 Bacteria 4681
721 Ga0395898_0058851 3300037466 Bacteria 3740
722 Ga0436364_0454045 3300037853 Bacteria 1304
723 Ga0436364_0708558 3300037853 Bacteria 7665
724 Ga0395901_0021099 3300038443 Bacteria 6674
725 Ga0395901_0028444 3300038443 Bacteria 5748
726 Ga0395901_0147318 3300038443 Bacteria 2474
727 Ga0242420_016608 3300038996 Unclassified 1283
728 Ga0436365_0097464 3300039437 Bacteria 3738
729 Ga0436365_0217897 3300039437 Bacteria 871
730 Ga0436365_0484144 3300039437 Bacteria 3695
731 Ga0436365_0932459 3300039437 Bacteria 27077
732 Ga0436365_1459828 3300039437 Bacteria 5750
733 Ga0436365_1674422 3300039437 Bacteria 918
734 Ga0436365_1717450 3300039437 Bacteria 1426
735 Ga0436365_1804874 3300039437 Bacteria 4035
736 Ga0436360_1161303 3300039438 Bacteria 1428
737 Ga0436361_0531564 3300039447 Bacteria 3274
738 Ga0436361_0575185 3300039447 Bacteria 1212
739 Ga0436361_0713927 3300039447 Bacteria 2271
740 Ga0436361_0912045 3300039447 Bacteria 877
741 Ga0436363_0552664 3300039450 Bacteria 1053
742 Ga0436363_0781422 3300039450 Bacteria 2462
743 Ga0436362_0529917 3300039453 Bacteria 639
744 Ga0436362_0640430 3300039453 Bacteria 643
745 Ga0436362_0900768 3300039453 Bacteria 1803
746 Ga0439453_0118227 3300041408 Bacteria 605
747 Ga0451795_0516035 3300041456 Bacteria 846
748 Ga0439455_0012465 3300042012 Bacteria 1910
749 Ga0450903_071042 3300042138 Bacteria 503
750 Ga0439464_0010836 3300042439 Bacteria 2410
751 Ga0451577_0028715 3300042876 Bacteria 5030
752 Ga0453683_0200606 3300044673 Unclassified 1267
753 Ga0466966_0087561 3300044684 Bacteria 1935
754 Ga0466963_0574791 3300044694 Bacteria 796
755 Ga0466963_0817932 3300044694 Bacteria 657
756 Ga0453684_0545859 3300044712 Bacteria 1277
757 Ga0466971_0177815 3300044719 Bacteria 1000
758 Ga0466971_0202491 3300044719 Bacteria 937
759 Ga0466957_0060008 3300044842 Bacteria 2332
760 Ga0466957_0110387 3300044842 Bacteria 1743
761 Ga0451576_0096377 3300045051 Bacteria 3077
762 Ga0466958_0074137 3300045836 Bacteria 2085
763 Ga0466958_0207992 3300045836 Bacteria 1246
764 Ga0466967_1157226 3300045976 Bacteria 771
765 Ga0495617_036246 3300046452 Bacteria 1654
766 Ga0495592_0011627 3300046454 Bacteria 6666
767 Ga0495592_0028916 3300046454 Bacteria 4195
768 Ga0495592_0053248 3300046454 Bacteria 3002
769 Ga0495603_0132259 3300046455 Bacteria 1452
770 Ga0495629_0005121 3300046459 Bacteria 9800
771 Ga0495629_0088382 3300046459 Bacteria 2161
772 Ga0495629_0172031 3300046459 Bacteria 1503
773 Ga0495638_0008737 3300046460 Bacteria 7158
774 Ga0495638_0420974 3300046460 Bacteria 688
775 Ga0495641_0006685 3300046461 Bacteria 7409
776 Ga0495641_0090630 3300046461 Unclassified 1366
777 Ga0495641_0338412 3300046461 Bacteria 680
778 Ga0495651_0002175 3300046462 Bacteria 15159
779 Ga0495651_0027032 3300046462 Bacteria 4468
780 Ga0495651_0084734 3300046462 Bacteria 2388
781 Ga0495651_0100174 3300046462 Bacteria 2159
782 Ga0495651_0202887 3300046462 Bacteria 1386
783 Ga0495653_0001102 3300046463 Bacteria 20835
784 Ga0495653_0002883 3300046463 Bacteria 13751
785 Ga0495653_0385293 3300046463 Bacteria 894
786 Ga0495580_0012507 3300046472 Bacteria 6507
787 Ga0495580_0294642 3300046472 Bacteria 1105
788 Ga0495582_0149102 3300046473 Bacteria 1327
789 Ga0495605_0073936 3300046474 Bacteria 1605
790 Ga0495639_0000713 3300046475 Bacteria 15217
791 Ga0495639_0156531 3300046475 Bacteria 1101
792 Ga0495662_0000084 3300046476 Bacteria 33781
793 Ga0495662_0013240 3300046476 Bacteria 4015
794 Ga0495662_0148524 3300046476 Bacteria 1154
795 Ga0495664_0065939 3300046477 Bacteria 2159
796 Ga0495584_0063809 3300046491 Bacteria 1852
797 Ga0495584_0188752 3300046491 Bacteria 1047
798 Ga0495584_0195232 3300046491 Bacteria 1029
799 Ga0495585_0004511 3300046492 Bacteria 9020
800 Ga0495585_0279205 3300046492 Bacteria 826
801 Ga0495594_0013840 3300046499 Bacteria 4218
802 Ga0495594_0090706 3300046499 Bacteria 1712
803 Ga0495607_0038927 3300046501 Bacteria 2844
804 Ga0495607_0074547 3300046501 Bacteria 1883
805 Ga0495607_0351159 3300046501 Unclassified 681
806 Ga0495606_0290416 3300046507 Bacteria 890
807 Ga0495608_0023449 3300046511 Bacteria 4229
808 Ga0495610_0132570 3300046512 Bacteria 1080
809 Ga0495618_0001557 3300046514 Bacteria 15382
810 Ga0495618_0007354 3300046514 Bacteria 6663
811 Ga0495618_0157467 3300046514 Unclassified 1449
812 Ga0495620_0055096 3300046515 Bacteria 1677
813 Ga0495628_0007423 3300046516 Bacteria 9490
814 Ga0495628_0013822 3300046516 Bacteria 6784
815 Ga0495628_0466872 3300046516 Bacteria 915
816 Ga0495628_0482464 3300046516 Bacteria 897
817 Ga0495630_0004290 3300046517 Bacteria 10001
818 Ga0495630_0006498 3300046517 Bacteria 8324
819 Ga0495630_0068369 3300046517 Bacteria 2671
820 Ga0495630_0266749 3300046517 Unclassified 1308
821 Ga0495631_0072338 3300046518 Bacteria 1489
822 Ga0495632_0102658 3300046519 Bacteria 1347
823 Ga0495637_0048540 3300046520 Bacteria 1787
824 Ga0495643_0038796 3300046522 Bacteria 2607
825 Ga0495648_0052445 3300046524 Bacteria 2477
826 Ga0495666_0041063 3300046526 Bacteria 2241
827 Ga0495666_0090252 3300046526 Bacteria 1446
828 Ga0495652_0001261 3300046529 Bacteria 28344
829 Ga0495652_0007683 3300046529 Bacteria 9928
830 Ga0495652_0013229 3300046529 Bacteria 7428
831 Ga0495652_0360747 3300046529 Bacteria 1038
832 Ga0495654_0121103 3300046530 Bacteria 1184
833 Ga0495665_0000743 3300046531 Bacteria 16866
834 Ga0495665_0090895 3300046531 Bacteria 1604
835 Ga0495665_0113550 3300046531 Unclassified 1420
836 Ga0495640_0005554 3300046533 Bacteria 10026
837 Ga0495640_0043559 3300046533 Bacteria 3124
838 Ga0495640_0049550 3300046533 Bacteria 2895
839 Ga0495640_0612999 3300046533 Bacteria 657
840 Ga0495586_0099064 3300046535 Bacteria 1616
841 Ga0495587_0002605 3300046536 Bacteria 12041
842 Ga0495587_0019419 3300046536 Bacteria 4206
843 Ga0495645_0005294 3300046543 Bacteria 8838
844 Ga0495645_0211428 3300046543 Bacteria 1309
845 Ga0495645_0356329 3300046543 Bacteria 941
846 Ga0495633_0005344 3300046558 Bacteria 7875
847 Ga0495633_0197438 3300046558 Bacteria 924
848 Ga0495667_0000202 3300046559 Bacteria 40046
849 Ga0495667_0000827 3300046559 Bacteria 19976
850 Ga0495667_0008926 3300046559 Bacteria 6815
851 Ga0495667_0286141 3300046559 Bacteria 1046
852 Ga0495656_0030187 3300046615 Bacteria 2189
853 Ga0495668_0107180 3300046616 Bacteria 1528
854 Ga0495634_0005317 3300046642 Bacteria 9928
855 Ga0495634_0093995 3300046642 Bacteria 1944
856 Ga0495634_0274851 3300046642 Bacteria 1024
857 Ga0495611_0046030 3300046648 Bacteria 1955
858 Ga0495635_0000399 3300046663 Bacteria 27531
859 Ga0495635_0003939 3300046663 Bacteria 10325
860 Ga0495635_0071566 3300046663 Bacteria 2377
861 Ga0495635_0214234 3300046663 Unclassified 1304
862 Ga0495635_0219767 3300046663 Unclassified 1285
863 Ga0495661_0077892 3300046665 Bacteria 1919
864 Ga0495661_0163713 3300046665 Bacteria 1192
865 Ga0495588_0004780 3300046674 Bacteria 5990
866 Ga0495588_0010531 3300046674 Bacteria 4303
867 Ga0495588_0328104 3300046674 Unclassified 805
868 Ga0495657_0001814 3300046675 Bacteria 18251
869 Ga0495657_0070049 3300046675 Bacteria 2292
870 Ga0495657_0081722 3300046675 Bacteria 2089
871 Ga0495599_0003284 3300046678 Bacteria 9430
872 Ga0495599_0021479 3300046678 Bacteria 4028
873 Ga0495623_0002800 3300046679 Bacteria 11506
874 Ga0495623_0033261 3300046679 Bacteria 3309
875 Ga0495646_0003379 3300046680 Bacteria 9918
876 Ga0495646_0006797 3300046680 Bacteria 7257
877 Ga0495646_0447978 3300046680 Bacteria 667
878 Ga0495647_0004774 3300046681 Bacteria 4423
879 Ga0495647_0010507 3300046681 Bacteria 3154
880 Ga0495647_0089419 3300046681 Bacteria 1260
881 Ga0495647_0267295 3300046681 Bacteria 764
882 Ga0495658_0003756 3300046683 Bacteria 7513
883 Ga0495613_0001462 3300046689 Bacteria 17997
884 Ga0495613_0080826 3300046689 Bacteria 2362
885 Ga0495613_0152670 3300046689 Unclassified 1646
886 Ga0495613_0166761 3300046689 Bacteria 1564
887 Ga0495613_0179897 3300046689 Bacteria 1498
888 Ga0495624_0000222 3300046690 Bacteria 44293
889 Ga0495624_0039247 3300046690 Bacteria 3036
890 Ga0495670_0014304 3300046691 Bacteria 3902
891 Ga0495670_0117922 3300046691 Bacteria 1377
892 Ga0495671_0081617 3300046692 Bacteria 1584
893 Ga0495671_0417454 3300046692 Bacteria 642
894 Ga0495600_0003235 3300046809 Bacteria 9529
895 Ga0495600_0003565 3300046809 Bacteria 9159
896 Ga0495600_0387340 3300046809 Bacteria 871
897 Ga0495581_0000145 3300047315 Bacteria 31255
898 Ga0495581_0050717 3300047315 Bacteria 2397
899 Ga0495604_0005816 3300047317 Bacteria 9782
900 Ga0495604_0012054 3300047317 Bacteria 6873
901 Ga0495604_0014609 3300047317 Bacteria 6258
902 Ga0495604_0024966 3300047317 Bacteria 4765
903 Ga0495674_0007404 3300047319 Bacteria 10489
904 Ga0495674_0007467 3300047319 Bacteria 10440
905 Ga0495674_0031760 3300047319 Bacteria 4794
906 Ga0495674_0048018 3300047319 Bacteria 3780
907 Ga0495672_0349822 3300047320 Bacteria 687
908 Ga0495676_0213279 3300047321 Bacteria 1334
909 Ga0495676_0801921 3300047321 Unclassified 606
910 Ga0495680_0002516 3300047322 Bacteria 18743
911 Ga0495680_0004443 3300047322 Bacteria 13399
912 Ga0495680_0041923 3300047322 Bacteria 3635
913 Ga0495675_0174884 3300047444 Bacteria 1317
914 Ga0495684_0000075 3300047471 Bacteria 67922
915 Ga0495684_0038948 3300047471 Bacteria 3643
916 Ga0495686_0025668 3300047472 Bacteria 3862
917 Ga0495593_0000228 3300047673 Bacteria 30037
918 Ga0495602_0008317 3300048088 Bacteria 10844
919 Ga0495602_0319331 3300048088 Unclassified 1130
920 Ga0495614_0013343 3300048089 Bacteria 3604
921 Ga0495614_0190134 3300048089 Bacteria 926
922 Ga0496100_0012706 3300048903 Bacteria 4837
923 Ga0496100_0443960 3300048903 Bacteria 994
924 Ga0496101_0000546 3300048904 Bacteria 23085
925 Ga0496101_0000799 3300048904 Bacteria 18620
926 Ga0496101_0122929 3300048904 Bacteria 1964
927 Ga0496101_0161222 3300048904 Unclassified 1720
928 Ga0496102_0011785 3300048905 Bacteria 7545
929 Ga0496102_0035226 3300048905 Bacteria 4504
930 Ga0496102_0242393 3300048905 Bacteria 1700
931 Ga0496102_0337988 3300048905 Bacteria 1418
932 Ga0496102_0506863 3300048905 Bacteria 1129
933 Ga0496103_0060970 3300048906 Bacteria 2345
934 Ga0496103_0268031 3300048906 Bacteria 1098
935 Ga0496104_0000061 3300048907 Bacteria 117394
936 Ga0496104_0000466 3300048907 Bacteria 34882
937 Ga0496104_0024737 3300048907 Bacteria 5528
938 Ga0496104_0037354 3300048907 Bacteria 4542
939 Ga0496104_0370878 3300048907 Unclassified 1344
940 Ga0496105_0010551 3300048908 Bacteria 7267
941 Ga0496105_0065868 3300048908 Bacteria 2990
942 Ga0496105_0096886 3300048908 Bacteria 2436
943 Ga0496105_0367421 3300048908 Bacteria 1147
944 Ga0496106_0000596 3300048909 Bacteria 25827
945 Ga0496106_0006785 3300048909 Bacteria 8475
946 Ga0496106_0015745 3300048909 Bacteria 5594
947 Ga0496106_0077447 3300048909 Plasmid 2550
948 Ga0496106_0156862 3300048909 Bacteria 1798
949 Ga0496106_0188371 3300048909 Bacteria 1639
950 Ga0496107_0001473 3300048910 Bacteria 14562
951 Ga0496107_0037537 3300048910 Bacteria 3476
952 Ga0496107_0056492 3300048910 Bacteria 2836
953 Ga0496107_1196088 3300048910 Bacteria 546
954 Ga0496108_0085616 3300048911 Bacteria 2676
955 Ga0496108_0354337 3300048911 Bacteria 1281
956 Ga0496109_0001819 3300048912 Bacteria 17742
957 Ga0496109_0049079 3300048912 Bacteria 3842
958 Ga0496109_0229451 3300048912 Bacteria 1746
959 Ga0496109_0260005 3300048912 Bacteria 1635
960 Ga0496110_0038079 3300048913 Bacteria 4183
961 Ga0496110_0073928 3300048913 Bacteria 3025
962 Ga0496111_0041524 3300048914 Bacteria 3301
963 Ga0496111_0314801 3300048914 Unclassified 1160
964 Ga0496111_0874556 3300048914 Bacteria 648
965 Ga0496112_0008772 3300048915 Bacteria 9071
966 Ga0496112_0152055 3300048915 Bacteria 2282
967 Ga0496112_0350430 3300048915 Bacteria 1419
968 Ga0496113_0015822 3300048916 Bacteria 5198
969 Ga0496113_0161068 3300048916 Bacteria 1774
970 Ga0496113_0174348 3300048916 Bacteria 1704
971 Ga0496113_0205665 3300048916 Bacteria 1566
972 Ga0496114_0016139 3300048917 Bacteria 6010
973 Ga0496114_0182841 3300048917 Bacteria 1831
974 Ga0496114_0478593 3300048917 Bacteria 1102
975 Ga0496114_1746096 3300048917 Bacteria 510
976 Ga0496115_0039483 3300048918 Bacteria 3749
977 Ga0496115_0082098 3300048918 Bacteria 2625
978 Ga0496115_0102241 3300048918 Bacteria 2350
979 Ga0496115_0175057 3300048918 Bacteria 1774
980 Ga0496115_1079594 3300048918 Bacteria 609
981 Ga0496116_0035974 3300048919 Bacteria 3472
982 Ga0496117_0247131 3300048920 Bacteria 975
983 Ga0496118_0040442 3300048921 Bacteria 3707
984 Ga0496118_0396055 3300048921 Bacteria 719
985 Ga0496119_0188263 3300048922 Bacteria 1077
986 Ga0496120_0031024 3300048923 Bacteria 3242
987 Ga0496121_0004744 3300048924 Bacteria 17941
988 Ga0496121_0022276 3300048924 Bacteria 6160
989 Ga0496121_0428612 3300048924 Bacteria 858
990 Ga0496122_0045182 3300048925 Bacteria 3426
991 Ga0496122_0045783 3300048925 Bacteria 3396
992 Ga0496123_0014609 3300048926 Bacteria 6493
993 Ga0496123_0056977 3300048926 Bacteria 2548
994 Ga0496124_0050017 3300048927 Bacteria 3563
995 Ga0496125_0000060 3300048928 Bacteria 264143
996 Ga0496125_0002052 3300048928 Bacteria 27206
997 Ga0496125_0003316 3300048928 Bacteria 19699
998 Ga0496125_0047469 3300048928 Bacteria 3590
999 Ga0496125_0198199 3300048928 Bacteria 1318
1000 Ga0496125_0209377 3300048928 Bacteria 1268
1001 Ga0496126_0065875 3300048929 Bacteria 3240
1002 Ga0496126_0273397 3300048929 Bacteria 1401
1003 Ga0496126_0361197 3300048929 Bacteria 1186
1004 Ga0501032_0012085 3300049569 Bacteria 6181
1005 Ga0501032_0041744 3300049569 Bacteria 3114
1006 Ga0501032_0085305 3300049569 Bacteria 2099
1007 Ga0501032_0790571 3300049569 Bacteria 599
1008 Ga0501033_0020592 3300049570 Bacteria 4984
1009 Ga0501033_0195466 3300049570 Bacteria 1446
1010 Ga0501033_0215952 3300049570 Bacteria 1366
1011 Ga0501033_0523432 3300049570 Bacteria 819
1012 Ga0501034_0000439 3300049571 Bacteria 68932
1013 Ga0501034_0019423 3300049571 Bacteria 6951
1014 Ga0501034_0051283 3300049571 Bacteria 4160
1015 Ga0501034_0061673 3300049571 Bacteria 3765
1016 Ga0501034_0143038 3300049571 Bacteria 2370
1017 Ga0501034_0503955 3300049571 Bacteria 1124
1018 Ga0501034_1486216 3300049571 Bacteria 551
1019 Ga0501036_0048401 3300049572 Bacteria 3599
1020 Ga0501036_0197608 3300049572 Bacteria 1692
1021 Ga0501036_0469076 3300049572 Bacteria 1048
1022 Ga0501037_0047256 3300049573 Bacteria 3155
1023 Ga0501037_0079593 3300049573 Bacteria 2378
1024 Ga0501037_0367273 3300049573 Bacteria 990
1025 Ga0501038_0094474 3300049574 Bacteria 2499
1026 Ga0501038_0099256 3300049574 Bacteria 2427
1027 Ga0501038_0116966 3300049574 Bacteria 2202
1028 Ga0501038_0134609 3300049574 Bacteria 2026
1029 Ga0501038_0884992 3300049574 Bacteria 660
1030 Ga0501039_0068228 3300049575 Bacteria 2761
1031 Ga0501039_0099565 3300049575 Bacteria 2268
1032 Ga0501039_0272709 3300049575 Bacteria 1330
1033 Ga0501039_0389967 3300049575 Bacteria 1094
1034 Ga0501043_0023823 3300049579 Bacteria 4801
1035 Ga0501043_0441500 3300049579 Bacteria 979
1036 Ga0501043_0535467 3300049579 Bacteria 872
1037 Ga0501046_0188683 3300049580 Bacteria 1538
1038 Ga0501046_0691082 3300049580 Bacteria 719
1039 Ga0501047_0011147 3300049581 Bacteria 8507
1040 Ga0501047_0027621 3300049581 Bacteria 5467
1041 Ga0501047_0060667 3300049581 Bacteria 3649
1042 Ga0501047_0132797 3300049581 Bacteria 2369
1043 Ga0501047_0168171 3300049581 Bacteria 2062
1044 Ga0501047_0168383 3300049581 Bacteria 2061
1045 Ga0501047_0515332 3300049581 Bacteria 1022
1046 Ga0501047_0744340 3300049581 Bacteria 796
1047 Ga0501048_0426161 3300049582 Bacteria 949
1048 Ga0501067_0105171 3300049583 Bacteria 1568
1049 Ga0501067_0133064 3300049583 Bacteria 1384
1050 Ga0501068_0005601 3300049584 Bacteria 6878
1051 Ga0501068_0099295 3300049584 Bacteria 1803
1052 Ga0501068_0255865 3300049584 Bacteria 1116
1053 Ga0501069_0321422 3300049585 Bacteria 909
1054 Ga0501069_0610966 3300049585 Bacteria 655
1055 Ga0501070_0026384 3300049586 Bacteria 4874
1056 Ga0501070_0031140 3300049586 Bacteria 4468
1057 Ga0501070_0166989 3300049586 Bacteria 1813
1058 Ga0501070_0193436 3300049586 Bacteria 1671
1059 Ga0501070_0322054 3300049586 Bacteria 1257
1060 Ga0501070_0349007 3300049586 Bacteria 1201
1061 Ga0501072_0126150 3300049588 Bacteria 2039
1062 Ga0501072_0405568 3300049588 Bacteria 1081
1063 Ga0501073_0018173 3300049589 Bacteria 5082
1064 Ga0501073_0021921 3300049589 Bacteria 4602
1065 Ga0501073_0066219 3300049589 Bacteria 2518
1066 Ga0501074_0030975 3300049590 Bacteria 3876
1067 Ga0501074_0106764 3300049590 Bacteria 2004
1068 Ga0501074_0178982 3300049590 Bacteria 1513
1069 Ga0501074_0181014 3300049590 Bacteria 1504
1070 Ga0501076_0097685 3300049592 Bacteria 2366
1071 Ga0501077_0060206 3300049593 Bacteria 2410
1072 Ga0501079_0249051 3300049741 Bacteria 1388
1073 Ga0501080_0025570 3300049742 Bacteria 5481
1074 Ga0501080_0048700 3300049742 Bacteria 3943
1075 Ga0501081_0236596 3300049743 Bacteria 1331
1076 Ga0501083_0024300 3300049744 Bacteria 4199
1077 Ga0501083_0260753 3300049744 Bacteria 1128
1078 Ga0501083_0323384 3300049744 Bacteria 1003
1079 Ga0501083_0409323 3300049744 Bacteria 882
1080 Ga0501083_0587899 3300049744 Bacteria 724
1081 Ga0501035_0001020 3300049822 Bacteria 29508
1082 Ga0501035_0040124 3300049822 Bacteria 4232
1083 Ga0501035_0064435 3300049822 Bacteria 3257
1084 Ga0501035_0141678 3300049822 Bacteria 2090
1085 Ga0501035_1126965 3300049822 Bacteria 612
1086 Ga0501035_1375755 3300049822 Bacteria 542
1087 Ga0501044_0051820 3300049823 Bacteria 4231
1088 Ga0501044_0190272 3300049823 Bacteria 2015
1089 Ga0501044_0986273 3300049823 Bacteria 715
1090 Ga0501044_1244775 3300049823 Bacteria 611
1091 nmdc:mga03683_48716_c1 3300050489 Bacteria 1762
1092 nmdc:mga03n38_467087_c1 3300050490 Bacteria 704
1093 nmdc:mga00v17_32752_c1 3300050491 Bacteria 3074
1094 nmdc:mga00v17_497679_c1 3300050491 Bacteria 790
1095 nmdc:mga0yw44_24622_c1 3300050492 Bacteria 3409
1096 nmdc:mga0yw44_261780_c1 3300050492 Bacteria 1153
1097 nmdc:mga0k408_25879_c1 3300050493 Bacteria 3325
1098 nmdc:mga0k408_46093_c1 3300050493 Bacteria 2517
1099 nmdc:mga06z11_249790_c1 3300050494 Bacteria 1044
1100 nmdc:mga06z11_29428_c2 3300050494 Bacteria 1735
1101 nmdc:mga06z11_481779_c1 3300050494 Bacteria 751
1102 nmdc:mga06z11_67121_c1 3300050494 Bacteria 1887
1103 nmdc:mga04h51_54295_c1 3300050495 Bacteria 1354
1104 nmdc:mga07m45_192380_c1 3300050496 Bacteria 1186
1105 nmdc:mga05p37_263038_c1 3300050507 Bacteria 2064
1106 nmdc:mga05p37_6363_c1 3300050507 Bacteria 13916
1107 nmdc:mga05p37_728542_c1 3300050507 Bacteria 1097
1108 nmdc:mga05p37_741212_c1 3300050507 Bacteria 1084
1109 nmdc:mga09592_2569_c1 3300050508 Bacteria 14701
1110 nmdc:mga09592_53150_c1 3300050508 Bacteria 3419
1111 nmdc:mga0qj67_11915_c1 3300050509 Bacteria 6532
1112 nmdc:mga0qj67_1654_c1 3300050509 Bacteria 15711
1113 nmdc:mga06r32_4586_c1 3300050510 Bacteria 12389
1114 nmdc:mga08y16_113197_c1 3300050511 Bacteria 2825
1115 nmdc:mga08y16_11839_c1 3300050511 Bacteria 9164
1116 nmdc:mga08y16_520239_c1 3300050511 Bacteria 1207
1117 nmdc:mga08y16_8011_c1 3300050511 Bacteria 11053
1118 nmdc:mga0n895_2123_c1 3300050512 Bacteria 15311
1119 nmdc:mga0n895_338139_c1 3300050512 Bacteria 1525
1120 nmdc:mga0n895_671956_c1 3300050512 Bacteria 1033
1121 nmdc:mga0rr50_5265_c1 3300050513 Bacteria 7696
1122 nmdc:mga0rr50_702348_c1 3300050513 Bacteria 863
1123 nmdc:mga0rr50_850967_c1 3300050513 Bacteria 778
1124 nmdc:mga08x19_1247946_c1 3300050514 Unclassified 527
1125 nmdc:mga08x19_176190_c1 3300050514 Bacteria 1458
1126 nmdc:mga08x19_335073_c1 3300050514 Bacteria 1055
1127 nmdc:mga0a205_129229_c1 3300050515 Bacteria 2427
1128 nmdc:mga0a205_166376_c1 3300050515 Bacteria 2101
1129 nmdc:mga0a205_54427_c1 3300050515 Bacteria 3864
1130 nmdc:mga0sz30_24362_c1 3300050516 Bacteria 2469
1131 nmdc:mga0sz30_25895_c1 3300050516 Bacteria 2401
1132 Ga0495601_0000153 3300053077 Bacteria 38651
1133 Ga0495601_0002167 3300053077 Bacteria 11051
1134 Ga0495601_0010084 3300053077 Bacteria 5609
1135 Ga0495601_0036305 3300053077 Bacteria 3077
1136 Ga0495601_0046952 3300053077 Bacteria 2718
1137 Ga0495601_0727061 3300053077 Unclassified 632
1138 Ga0495612_0001586 3300053078 Bacteria 9382
1139 Ga0495612_0003368 3300053078 Bacteria 6620
1140 Ga0495612_0010382 3300053078 Bacteria 3767
1141 Ga0495595_0000307 3300053084 Bacteria 19073
1142 Ga0495595_0000328 3300053084 Bacteria 18520
1143 Ga0495595_0000988 3300053084 Bacteria 10960
1144 Ga0495595_0009648 3300053084 Bacteria 3997
1145 Ga0495595_0087243 3300053084 Bacteria 1494
1146 Ga0495619_0000059 3300053085 Bacteria 92434
1147 Ga0495619_0001072 3300053085 Bacteria 17936
1148 Ga0495619_0001117 3300053085 Bacteria 17612
1149 Ga0495619_0001730 3300053085 Bacteria 14479
1150 Ga0495619_0011608 3300053085 Bacteria 5551
1151 Ga0495619_0062365 3300053085 Bacteria 2481
1152 Ga0495619_0073167 3300053085 Bacteria 2296
1153 Ga0495619_0648577 3300053085 Unclassified 720
1154 Ga0500578_0255685 3300053086 Bacteria 1054
1155 Ga0500643_000795 3300053087 Bacteria 20468
1156 Ga0500644_0023522 3300053088 Bacteria 1872
1157 Ga0500581_037329 3300053089 Bacteria 2489
1158 Ga0500646_0041866 3300053090 Bacteria 1292
1159 Ga0500583_0126400 3300053092 Bacteria 1267
1160 Ga0500651_0015153 3300053093 Bacteria 4726
1161 Ga0500651_0046995 3300053093 Bacteria 2714
1162 Ga0500651_0061784 3300053093 Bacteria 2339
1163 Ga0500651_0079963 3300053093 Bacteria 2025
1164 Ga0500651_0127512 3300053093 Bacteria 1541
1165 Ga0500651_0147238 3300053093 Bacteria 1416
1166 Ga0500566_0000471 3300053094 Bacteria 22436
1167 Ga0500641_0008300 3300053096 Bacteria 3704
1168 Ga0500641_0018182 3300053096 Bacteria 2640
1169 Ga0500641_0203678 3300053096 Bacteria 844
1170 Ga0500650_0000278 3300053098 Bacteria 12391
1171 Ga0500650_0233241 3300053098 Bacteria 830
1172 Ga0500556_0000002 3300053104 Bacteria 773626
1173 Ga0500562_051123 3300053108 Bacteria 1105
1174 Ga0500569_031183 3300053109 Bacteria 1497
1175 Ga0500572_102966 3300053111 Bacteria 914
1176 Ga0500593_151956 3300053117 Bacteria 897
1177 Ga0500595_000001 3300053119 Bacteria 1088438
1178 Ga0500595_001355 3300053119 Bacteria 13187
1179 Ga0500595_023565 3300053119 Bacteria 2161
1180 Ga0500595_113317 3300053119 Bacteria 770
1181 Ga0500608_001268 3300053122 Bacteria 9004
1182 Ga0500618_013813 3300053125 Bacteria 2078
1183 Ga0500618_021017 3300053125 Bacteria 1596
1184 Ga0500618_066140 3300053125 Bacteria 812
1185 Ga0500642_0000016 3300053130 Bacteria 176560
1186 Ga0500652_002258 3300053131 Bacteria 5787
1187 Ga0500652_014253 3300053131 Bacteria 2838
1188 Ga0500658_0058211 3300053134 Bacteria 1600
1189 Ga0500559_0000066 3300053136 Bacteria 84664
1190 Ga0500559_0279593 3300053136 Bacteria 785
1191 Ga0500568_0000594 3300053139 Bacteria 26294
1192 Ga0500568_0122205 3300053139 Bacteria 970
1193 Ga0500568_0177653 3300053139 Bacteria 783
1194 Ga0500577_0063126 3300053142 Bacteria 1431
1195 Ga0500588_0199489 3300053146 Bacteria 741
1196 Ga0500590_023132 3300053148 Bacteria 3229
1197 Ga0500604_0065752 3300053151 Bacteria 1147
1198 Ga0500616_0000001 3300053153 Bacteria 1986011
1199 Ga0500616_0000061 3300053153 Bacteria 249158
1200 Ga0500616_0023631 3300053153 Bacteria 3421
1201 Ga0500622_0002843 3300053156 Bacteria 12132
1202 Ga0500627_0164914 3300053158 Bacteria 999
1203 Ga0500633_0108580 3300053160 Bacteria 1026
1204 Ga0500634_0150276 3300053161 Bacteria 1090
1205 Ga0500636_0006653 3300053177 Bacteria 6646
1206 Ga0500637_0536520 3300053178 Bacteria 570
1207 Ga0500645_000015 3300053730 Bacteria 150140
1208 Ga0500645_025271 3300053730 Bacteria 1812
1209 Ga0501084_0557179 3300054114 Bacteria 968
1210 Ga0501082_0089740 3300060353 Bacteria 2654
1211 Ga0466962_0174953 3300061719 Bacteria 1046
1212 Ga0466962_0440700 3300061719 Bacteria 655

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050490 nmdc:mga03n38_467087_c1 nmdc:mga03n38_467087_c1_127_603 140
2 3300007788 Ga0099795_10255076 Ga0099795_102550762 142
3 3300005355 Ga0070671_101230595 Ga0070671_1012305951 144
4 3300039438 Ga0436360_1161303 Ga0436360_1161303_583_1047 144
5 3300021384 Ga0213876_10010724 Ga0213876_100107244 145
6 3300039437 Ga0436365_1674422 Ga0436365_1674422_205_642 145
7 3300039437 Ga0436365_1804874 Ga0436365_1804874_336_773 145
8 3300046491 Ga0495584_0188752 Ga0495584_0188752_558_1022 145
9 3300049581 Ga0501047_0515332 Ga0501047_0515332_162_602 145
10 3300005434 Ga0070709_10465381 Ga0070709_104653812 146
11 3300005435 Ga0070714_100006637 Ga0070714_10000663710 146
12 3300025929 Ga0207664_10029948 Ga0207664_100299483 146
13 3300049571 Ga0501034_0061673 Ga0501034_0061673_2890_3336 146
14 3300049572 Ga0501036_0197608 Ga0501036_0197608_130_576 146
15 3300049574 Ga0501038_0884992 Ga0501038_0884992_37_483 146
16 3300049575 Ga0501039_0272709 Ga0501039_0272709_722_1168 146
17 3300049581 Ga0501047_0060667 Ga0501047_0060667_1199_1645 146
18 3300049583 Ga0501067_0105171 Ga0501067_0105171_450_896 146
19 3300049584 Ga0501068_0099295 Ga0501068_0099295_495_941 146
20 3300049586 Ga0501070_0166989 Ga0501070_0166989_466_912 146
21 3300049588 Ga0501072_0405568 Ga0501072_0405568_440_886 146
22 3300049589 Ga0501073_0021921 Ga0501073_0021921_3601_4047 146
23 3300049590 Ga0501074_0106764 Ga0501074_0106764_681_1127 146
24 3300049744 Ga0501083_0323384 Ga0501083_0323384_477_923 146
25 3300049823 Ga0501044_0190272 Ga0501044_0190272_397_843 146
26 iso_pu_bacteria 2602042107 2603856853 146
27 iso_pu_bacteria 2857524615 2857528318 146
28 iso_pu_bacteria 2893066018 2893068753 146
29 iso_pu_bacteria 2919073203 2919075745 146
30 3300006038 Ga0075365_10054599 Ga0075365_100545992 147
31 3300006048 Ga0075363_100103010 Ga0075363_1001030102 147
32 3300006051 Ga0075364_10113903 Ga0075364_101139032 147
33 3300006051 Ga0075364_10403479 Ga0075364_104034792 147
34 3300006353 Ga0075370_10305990 Ga0075370_103059902 147
35 3300006847 Ga0075431_100854608 Ga0075431_1008546082 147
36 3300009147 Ga0114129_10196645 Ga0114129_101966452 147
37 3300021377 Ga0213874_10105697 Ga0213874_101056972 147
38 3300021384 Ga0213876_10049608 Ga0213876_100496082 147
39 3300039437 Ga0436365_0217897 Ga0436365_0217897_340_789 147
40 3300039437 Ga0436365_1459828 Ga0436365_1459828_4879_5328 147
41 3300039450 Ga0436363_0552664 Ga0436363_0552664_442_891 147
42 3300039453 Ga0436362_0640430 Ga0436362_0640430_137_586 147
43 3300050492 nmdc:mga0yw44_24622_c1 nmdc:mga0yw44_24622_c1_2836_3282 147
44 3300050496 nmdc:mga07m45_192380_c1 nmdc:mga07m45_192380_c1_273_719 147
45 3300050507 nmdc:mga05p37_263038_c1 nmdc:mga05p37_263038_c1_436_888 147
46 3300005328 Ga0070676_10039981 Ga0070676_100399813 148
47 3300005330 Ga0070690_100021460 Ga0070690_1000214602 148
48 3300005338 Ga0068868_100390300 Ga0068868_1003903002 148
49 3300005340 Ga0070689_100002898 Ga0070689_1000028983 148
50 3300005353 Ga0070669_100128259 Ga0070669_1001282592 148
51 3300005354 Ga0070675_100328970 Ga0070675_1003289702 148
52 3300005365 Ga0070688_100000970 Ga0070688_1000009709 148
53 3300005434 Ga0070709_10203545 Ga0070709_102035452 148
54 3300005435 Ga0070714_100788788 Ga0070714_1007887882 148
55 3300005456 Ga0070678_100138354 Ga0070678_1001383541 148
56 3300005530 Ga0070679_100474175 Ga0070679_1004741752 148
57 3300005563 Ga0068855_100023093 Ga0068855_1000230935 148
58 3300005614 Ga0068856_100503931 Ga0068856_1005039311 148
59 3300005617 Ga0068859_100525799 Ga0068859_1005257992 148
60 3300005618 Ga0068864_100016705 Ga0068864_1000167052 148
61 3300005718 Ga0068866_10487672 Ga0068866_104876721 148
62 3300005842 Ga0068858_100445845 Ga0068858_1004458451 148
63 3300006028 Ga0070717_10066769 Ga0070717_100667693 148
64 3300006173 Ga0070716_101102772 Ga0070716_1011027722 148
65 3300006914 Ga0075436_101151660 Ga0075436_1011516601 148
66 3300006931 Ga0097620_100525784 Ga0097620_1005257842 148
67 3300007076 Ga0075435_101178911 Ga0075435_1011789112 148
68 3300009553 Ga0105249_10617774 Ga0105249_106177741 148
69 3300013306 Ga0163162_10012152 Ga0163162_100121522 148
70 3300013308 Ga0157375_10034225 Ga0157375_100342254 148
71 3300014325 Ga0163163_10007836 Ga0163163_100078366 148
72 3300014968 Ga0157379_10635299 Ga0157379_106352991 148
73 3300014969 Ga0157376_10805559 Ga0157376_108055591 148
74 3300017792 Ga0163161_10231698 Ga0163161_102316981 148
75 3300021388 Ga0213875_10000074 Ga0213875_1000007419 148
76 3300025315 Ga0207697_10039255 Ga0207697_100392552 148
77 3300025898 Ga0207692_10895980 Ga0207692_108959801 148
78 3300025907 Ga0207645_10037724 Ga0207645_100377243 148
79 3300025911 Ga0207654_10285765 Ga0207654_102857651 148
80 3300025923 Ga0207681_10039030 Ga0207681_100390302 148
81 3300025926 Ga0207659_10215754 Ga0207659_102157541 148
82 3300025935 Ga0207709_10148526 Ga0207709_101485262 148
83 3300025936 Ga0207670_10000486 Ga0207670_100004868 148
84 3300025939 Ga0207665_10161603 Ga0207665_101616032 148
85 3300025940 Ga0207691_10856808 Ga0207691_108568082 148
86 3300025949 Ga0207667_10066210 Ga0207667_100662104 148
87 3300026023 Ga0207677_10059304 Ga0207677_100593043 148
88 3300026078 Ga0207702_11348262 Ga0207702_113482622 148
89 3300026089 Ga0207648_10190350 Ga0207648_101903502 148
90 3300026095 Ga0207676_10005788 Ga0207676_100057886 148
91 3300026121 Ga0207683_10018680 Ga0207683_100186806 148
92 3300026142 Ga0207698_10123944 Ga0207698_101239443 148
93 3300035691 Ga0373931_0005509 Ga0373931_0005509_4654_5112 148
94 3300037418 Ga0395900_0306301 Ga0395900_0306301_458_910 148
95 3300037853 Ga0436364_0708558 Ga0436364_0708558_2400_2849 148
96 3300039437 Ga0436365_1717450 Ga0436365_1717450_709_1155 148
97 3300039453 Ga0436362_0529917 Ga0436362_0529917_33_482 148
98 3300044694 Ga0466963_0817932 Ga0466963_0817932_33_485 148
99 3300044719 Ga0466971_0177815 Ga0466971_0177815_508_960 148
100 3300044842 Ga0466957_0060008 Ga0466957_0060008_1521_1973 148
101 3300045836 Ga0466958_0207992 Ga0466958_0207992_12_464 148
102 3300048905 Ga0496102_0506863 Ga0496102_0506863_18_476 148
103 3300048911 Ga0496108_0085616 Ga0496108_0085616_289_747 148
104 3300048912 Ga0496109_0260005 Ga0496109_0260005_232_690 148
105 3300048916 Ga0496113_0205665 Ga0496113_0205665_556_1014 148
106 3300049585 Ga0501069_0321422 Ga0501069_0321422_314_778 148
107 3300049586 Ga0501070_0026384 Ga0501070_0026384_4079_4543 148
108 3300049822 Ga0501035_0001020 Ga0501035_0001020_5104_5568 148
109 3300049823 Ga0501044_0986273 Ga0501044_0986273_198_662 148
110 3300050513 nmdc:mga0rr50_702348_c1 nmdc:mga0rr50_702348_c1_96_566 148
111 3300005262 Ga0065165_1059454 Ga0065165_10594542 149
112 3300005262 Ga0065165_1104001 Ga0065165_11040011 149
113 3300005336 Ga0070680_100892790 Ga0070680_1008927901 149
114 3300005366 Ga0070659_100623816 Ga0070659_1006238161 149
115 3300005367 Ga0070667_100902466 Ga0070667_1009024661 149
116 3300005435 Ga0070714_101649337 Ga0070714_1016493371 149
117 3300005455 Ga0070663_100219923 Ga0070663_1002199232 149
118 3300005530 Ga0070679_100505201 Ga0070679_1005052011 149
119 3300005530 Ga0070679_100594718 Ga0070679_1005947182 149
120 3300006175 Ga0070712_101834221 Ga0070712_1018342211 149
121 3300006186 Ga0075369_10124732 Ga0075369_101247322 149
122 3300006353 Ga0075370_10625550 Ga0075370_106255501 149
123 3300025295 Ga0209564_1000544 Ga0209564_100054441 149
124 3300025295 Ga0209564_1016332 Ga0209564_10163323 149
125 3300025917 Ga0207660_10862448 Ga0207660_108624482 149
126 3300026067 Ga0207678_10004081 Ga0207678_100040818 149
127 3300028379 Ga0268266_10182841 Ga0268266_101828412 149
128 3300031247 Ga0265340_10152576 Ga0265340_101525761 149
129 3300031691 Ga0316579_10001599 Ga0316579_100015995 149
130 3300037312 Ga0395899_0004968 Ga0395899_0004968_3642_4097 149
131 3300037312 Ga0395899_0016270 Ga0395899_0016270_3870_4325 149
132 3300037418 Ga0395900_0007564 Ga0395900_0007564_1705_2160 149
133 3300037418 Ga0395900_0247416 Ga0395900_0247416_401_856 149
134 3300037418 Ga0395900_0510748 Ga0395900_0510748_683_1138 149
135 3300037466 Ga0395898_0007267 Ga0395898_0007267_7798_8253 149
136 3300037466 Ga0395898_0039336 Ga0395898_0039336_1609_2064 149
137 3300037466 Ga0395898_0058851 Ga0395898_0058851_2696_3151 149
138 3300038443 Ga0395901_0021099 Ga0395901_0021099_90_545 149
139 3300038443 Ga0395901_0028444 Ga0395901_0028444_4223_4678 149
140 3300038443 Ga0395901_0147318 Ga0395901_0147318_198_653 149
141 3300041456 Ga0451795_0516035 Ga0451795_0516035_353_814 149
142 3300044684 Ga0466966_0087561 Ga0466966_0087561_106_561 149
143 3300044719 Ga0466971_0202491 Ga0466971_0202491_382_837 149
144 3300044842 Ga0466957_0110387 Ga0466957_0110387_610_1065 149
145 3300045836 Ga0466958_0074137 Ga0466958_0074137_70_525 149
146 3300045976 Ga0466967_1157226 Ga0466967_1157226_242_697 149
147 3300046460 Ga0495638_0008737 Ga0495638_0008737_1148_1609 149
148 3300046501 Ga0495607_0074547 Ga0495607_0074547_800_1261 149
149 3300046507 Ga0495606_0290416 Ga0495606_0290416_236_697 149
150 3300046512 Ga0495610_0132570 Ga0495610_0132570_284_745 149
151 3300046515 Ga0495620_0055096 Ga0495620_0055096_1086_1547 149
152 3300046518 Ga0495631_0072338 Ga0495631_0072338_785_1246 149
153 3300046519 Ga0495632_0102658 Ga0495632_0102658_419_880 149
154 3300046520 Ga0495637_0048540 Ga0495637_0048540_352_813 149
155 3300046522 Ga0495643_0038796 Ga0495643_0038796_107_568 149
156 3300046530 Ga0495654_0121103 Ga0495654_0121103_612_1073 149
157 3300046558 Ga0495633_0197438 Ga0495633_0197438_294_755 149
158 3300046616 Ga0495668_0107180 Ga0495668_0107180_475_936 149
159 3300046665 Ga0495661_0077892 Ga0495661_0077892_528_989 149
160 3300046691 Ga0495670_0014304 Ga0495670_0014304_249_710 149
161 3300046692 Ga0495671_0081617 Ga0495671_0081617_431_892 149
162 3300048903 Ga0496100_0443960 Ga0496100_0443960_398_859 149
163 3300048909 Ga0496106_0188371 Ga0496106_0188371_691_1152 149
164 3300048919 Ga0496116_0035974 Ga0496116_0035974_2375_2836 149
165 3300048920 Ga0496117_0247131 Ga0496117_0247131_274_735 149
166 3300048921 Ga0496118_0040442 Ga0496118_0040442_1710_2171 149
167 3300048922 Ga0496119_0188263 Ga0496119_0188263_330_791 149
168 3300048923 Ga0496120_0031024 Ga0496120_0031024_2435_2896 149
169 3300048924 Ga0496121_0022276 Ga0496121_0022276_874_1335 149
170 3300048925 Ga0496122_0045182 Ga0496122_0045182_1714_2175 149
171 3300048925 Ga0496122_0045783 Ga0496122_0045783_1316_1774 149
172 3300048926 Ga0496123_0014609 Ga0496123_0014609_5087_5548 149
173 3300048926 Ga0496123_0056977 Ga0496123_0056977_1265_1723 149
174 3300048927 Ga0496124_0050017 Ga0496124_0050017_53_514 149
175 3300048928 Ga0496125_0002052 Ga0496125_0002052_7682_8143 149
176 3300048928 Ga0496125_0047469 Ga0496125_0047469_1680_2141 149
177 3300048928 Ga0496125_0198199 Ga0496125_0198199_473_931 149
178 3300048929 Ga0496126_0273397 Ga0496126_0273397_858_1319 149
179 3300049569 Ga0501032_0012085 Ga0501032_0012085_3093_3554 149
180 3300049570 Ga0501033_0020592 Ga0501033_0020592_809_1270 149
181 3300049571 Ga0501034_0143038 Ga0501034_0143038_344_805 149
182 3300049573 Ga0501037_0367273 Ga0501037_0367273_333_794 149
183 3300049574 Ga0501038_0099256 Ga0501038_0099256_333_794 149
184 3300049575 Ga0501039_0099565 Ga0501039_0099565_895_1356 149
185 3300049579 Ga0501043_0023823 Ga0501043_0023823_3560_4021 149
186 3300049580 Ga0501046_0691082 Ga0501046_0691082_11_472 149
187 3300049581 Ga0501047_0011147 Ga0501047_0011147_5008_5469 149
188 3300049582 Ga0501048_0426161 Ga0501048_0426161_427_888 149
189 3300049583 Ga0501067_0133064 Ga0501067_0133064_271_732 149
190 3300049584 Ga0501068_0005601 Ga0501068_0005601_1272_1733 149
191 3300049586 Ga0501070_0031140 Ga0501070_0031140_3569_4030 149
192 3300049589 Ga0501073_0066219 Ga0501073_0066219_751_1212 149
193 3300049590 Ga0501074_0030975 Ga0501074_0030975_1932_2393 149
194 3300049742 Ga0501080_0048700 Ga0501080_0048700_1195_1656 149
195 3300049744 Ga0501083_0409323 Ga0501083_0409323_207_668 149
196 3300049822 Ga0501035_0040124 Ga0501035_0040124_2536_2997 149
197 3300049823 Ga0501044_0051820 Ga0501044_0051820_1909_2370 149
198 3300050491 nmdc:mga00v17_497679_c1 nmdc:mga00v17_497679_c1_283_744 149
199 3300050492 nmdc:mga0yw44_261780_c1 nmdc:mga0yw44_261780_c1_159_620 149
200 3300050494 nmdc:mga06z11_481779_c1 nmdc:mga06z11_481779_c1_200_661 149
201 3300050516 nmdc:mga0sz30_24362_c1 nmdc:mga0sz30_24362_c1_880_1341 149
202 3300050516 nmdc:mga0sz30_25895_c1 nmdc:mga0sz30_25895_c1_1642_2103 149
203 3300053084 Ga0495595_0087243 Ga0495595_0087243_870_1325 149
204 3300053089 Ga0500581_037329 Ga0500581_037329_1268_1729 149
205 3300053090 Ga0500646_0041866 Ga0500646_0041866_256_717 149
206 3300053093 Ga0500651_0061784 Ga0500651_0061784_1175_1636 149
207 3300053093 Ga0500651_0079963 Ga0500651_0079963_577_1044 149
208 3300053093 Ga0500651_0127512 Ga0500651_0127512_147_608 149
209 3300053093 Ga0500651_0147238 Ga0500651_0147238_651_1109 149
210 3300053094 Ga0500566_0000471 Ga0500566_0000471_21215_21676 149
211 3300053096 Ga0500641_0008300 Ga0500641_0008300_1502_1963 149
212 3300053098 Ga0500650_0000278 Ga0500650_0000278_7808_8269 149
213 3300053104 Ga0500556_0000002 Ga0500556_0000002_309949_310410 149
214 3300053108 Ga0500562_051123 Ga0500562_051123_353_814 149
215 3300053109 Ga0500569_031183 Ga0500569_031183_638_1099 149
216 3300053117 Ga0500593_151956 Ga0500593_151956_323_784 149
217 3300053122 Ga0500608_001268 Ga0500608_001268_1980_2441 149
218 3300053125 Ga0500618_013813 Ga0500618_013813_274_735 149
219 3300053125 Ga0500618_066140 Ga0500618_066140_36_494 149
220 3300053130 Ga0500642_0000016 Ga0500642_0000016_5762_6223 149
221 3300053131 Ga0500652_002258 Ga0500652_002258_2988_3449 149
222 3300053134 Ga0500658_0058211 Ga0500658_0058211_371_832 149
223 3300053136 Ga0500559_0000066 Ga0500559_0000066_14503_14964 149
224 3300053136 Ga0500559_0279593 Ga0500559_0279593_291_749 149
225 3300053139 Ga0500568_0000594 Ga0500568_0000594_20629_21090 149
226 3300053142 Ga0500577_0063126 Ga0500577_0063126_224_685 149
227 3300053146 Ga0500588_0199489 Ga0500588_0199489_25_486 149
228 3300053148 Ga0500590_023132 Ga0500590_023132_1063_1530 149
229 3300053151 Ga0500604_0065752 Ga0500604_0065752_366_827 149
230 3300053153 Ga0500616_0000061 Ga0500616_0000061_119641_120102 149
231 3300053156 Ga0500622_0002843 Ga0500622_0002843_8151_8612 149
232 3300053158 Ga0500627_0164914 Ga0500627_0164914_94_555 149
233 3300053160 Ga0500633_0108580 Ga0500633_0108580_358_819 149
234 3300053161 Ga0500634_0150276 Ga0500634_0150276_458_916 149
235 3300053177 Ga0500636_0006653 Ga0500636_0006653_5760_6227 149
236 3300053178 Ga0500637_0536520 Ga0500637_0536520_76_543 149
237 3300053730 Ga0500645_025271 Ga0500645_025271_284_745 149
238 3300061719 Ga0466962_0440700 Ga0466962_0440700_82_537 149
239 3300005327 Ga0070658_10072899 Ga0070658_100728993 150
240 3300005327 Ga0070658_10080660 Ga0070658_100806603 150
241 3300005336 Ga0070680_100066695 Ga0070680_1000666954 150
242 3300005336 Ga0070680_100113040 Ga0070680_1001130403 150
243 3300005337 Ga0070682_100547156 Ga0070682_1005471561 150
244 3300005339 Ga0070660_100030675 Ga0070660_1000306754 150
245 3300005339 Ga0070660_100989190 Ga0070660_1009891901 150
246 3300005344 Ga0070661_100086436 Ga0070661_1000864363 150
247 3300005347 Ga0070668_100250077 Ga0070668_1002500772 150
248 3300005366 Ga0070659_100442858 Ga0070659_1004428582 150
249 3300005458 Ga0070681_10109594 Ga0070681_101095942 150
250 3300005530 Ga0070679_100505526 Ga0070679_1005055262 150
251 3300005530 Ga0070679_100931253 Ga0070679_1009312532 150
252 3300005563 Ga0068855_100666786 Ga0068855_1006667862 150
253 3300005578 Ga0068854_100090300 Ga0068854_1000903003 150
254 3300005614 Ga0068856_100045729 Ga0068856_1000457294 150
255 3300005616 Ga0068852_100134350 Ga0068852_1001343502 150
256 3300005985 Ga0081539_10021800 Ga0081539_100218004 150
257 3300006051 Ga0075364_10362153 Ga0075364_103621532 150
258 3300006175 Ga0070712_100551581 Ga0070712_1005515812 150
259 3300009093 Ga0105240_10222888 Ga0105240_102228882 150
260 3300013104 Ga0157370_10246969 Ga0157370_102469691 150
261 3300013104 Ga0157370_10421031 Ga0157370_104210312 150
262 3300014326 Ga0157380_10520404 Ga0157380_105204042 150
263 3300020070 Ga0206356_10418905 Ga0206356_104189053 150
264 3300025297 Ga0209758_1002224 Ga0209758_100222413 150
265 3300025909 Ga0207705_10102516 Ga0207705_101025162 150
266 3300025909 Ga0207705_10484475 Ga0207705_104844752 150
267 3300025912 Ga0207707_10066546 Ga0207707_100665463 150
268 3300025912 Ga0207707_10099789 Ga0207707_100997892 150
269 3300025912 Ga0207707_10288818 Ga0207707_102888182 150
270 3300025913 Ga0207695_10419864 Ga0207695_104198642 150
271 3300025915 Ga0207693_10411522 Ga0207693_104115222 150
272 3300025917 Ga0207660_10150054 Ga0207660_101500542 150
273 3300025919 Ga0207657_10019619 Ga0207657_100196195 150
274 3300025919 Ga0207657_10042193 Ga0207657_100421932 150
275 3300025920 Ga0207649_10360715 Ga0207649_103607151 150
276 3300025921 Ga0207652_10142060 Ga0207652_101420602 150
277 3300025921 Ga0207652_10149856 Ga0207652_101498563 150
278 3300025931 Ga0207644_10842020 Ga0207644_108420201 150
279 3300025932 Ga0207690_10223308 Ga0207690_102233082 150
280 3300025949 Ga0207667_11104269 Ga0207667_111042691 150
281 3300025972 Ga0207668_10232112 Ga0207668_102321122 150
282 3300026142 Ga0207698_10221202 Ga0207698_102212022 150
283 3300028379 Ga0268266_10536683 Ga0268266_105366832 150
284 3300028379 Ga0268266_11074836 Ga0268266_110748362 150
285 3300028800 Ga0265338_10203324 Ga0265338_102033242 150
286 3300031240 Ga0265320_10035321 Ga0265320_100353213 150
287 3300031242 Ga0265329_10007181 Ga0265329_100071814 150
288 3300031344 Ga0265316_10524679 Ga0265316_105246791 150
289 3300031711 Ga0265314_10000672 Ga0265314_1000067229 150
290 3300031712 Ga0265342_10017835 Ga0265342_100178354 150
291 3300044694 Ga0466963_0574791 Ga0466963_0574791_279_731 150
292 3300046460 Ga0495638_0420974 Ga0495638_0420974_205_669 150
293 3300046462 Ga0495651_0100174 Ga0495651_0100174_164_655 150
294 3300046524 Ga0495648_0052445 Ga0495648_0052445_1179_1640 150
295 3300046559 Ga0495667_0286141 Ga0495667_0286141_476_967 150
296 3300046809 Ga0495600_0387340 Ga0495600_0387340_64_555 150
297 3300047320 Ga0495672_0349822 Ga0495672_0349822_20_511 150
298 3300047472 Ga0495686_0025668 Ga0495686_0025668_16_480 150
299 3300048921 Ga0496118_0396055 Ga0496118_0396055_121_645 150
300 3300048924 Ga0496121_0004744 Ga0496121_0004744_8835_9326 150
301 3300048924 Ga0496121_0428612 Ga0496121_0428612_154_678 150
302 3300048928 Ga0496125_0000060 Ga0496125_0000060_251729_252193 150
303 3300048928 Ga0496125_0003316 Ga0496125_0003316_4904_5368 150
304 3300048929 Ga0496126_0065875 Ga0496126_0065875_410_901 150
305 3300048929 Ga0496126_0361197 Ga0496126_0361197_286_750 150
306 3300049569 Ga0501032_0085305 Ga0501032_0085305_1181_1645 150
307 3300049570 Ga0501033_0215952 Ga0501033_0215952_368_832 150
308 3300049571 Ga0501034_0000439 Ga0501034_0000439_10506_10985 150
309 3300049571 Ga0501034_0019423 Ga0501034_0019423_2999_3463 150
310 3300049571 Ga0501034_1486216 Ga0501034_1486216_65_529 150
311 3300049573 Ga0501037_0079593 Ga0501037_0079593_1442_1906 150
312 3300049574 Ga0501038_0094474 Ga0501038_0094474_1093_1557 150
313 3300049574 Ga0501038_0116966 Ga0501038_0116966_158_622 150
314 3300049580 Ga0501046_0188683 Ga0501046_0188683_385_849 150
315 3300049581 Ga0501047_0027621 Ga0501047_0027621_2191_2643 150
316 3300049584 Ga0501068_0255865 Ga0501068_0255865_106_570 150
317 3300049588 Ga0501072_0126150 Ga0501072_0126150_100_564 150
318 3300049590 Ga0501074_0181014 Ga0501074_0181014_671_1123 150
319 3300049592 Ga0501076_0097685 Ga0501076_0097685_1463_1927 150
320 3300049741 Ga0501079_0249051 Ga0501079_0249051_64_528 150
321 3300049742 Ga0501080_0025570 Ga0501080_0025570_2769_3233 150
322 3300049744 Ga0501083_0260753 Ga0501083_0260753_587_1051 150
323 3300049822 Ga0501035_1126965 Ga0501035_1126965_138_590 150
324 3300053086 Ga0500578_0255685 Ga0500578_0255685_368_859 150
325 3300053092 Ga0500583_0126400 Ga0500583_0126400_434_925 150
326 3300053093 Ga0500651_0015153 Ga0500651_0015153_3309_3800 150
327 3300053096 Ga0500641_0203678 Ga0500641_0203678_131_622 150
328 3300053098 Ga0500650_0233241 Ga0500650_0233241_17_481 150
329 3300053119 Ga0500595_001355 Ga0500595_001355_7755_8219 150
330 3300053119 Ga0500595_023565 Ga0500595_023565_54_545 150
331 3300053139 Ga0500568_0122205 Ga0500568_0122205_135_626 150
332 3300053153 Ga0500616_0023631 Ga0500616_0023631_86_547 150
333 3300054114 Ga0501084_0557179 Ga0501084_0557179_333_797 150
334 3300003215 JGI25153J46596_10003982 JGI25153J46596_100039827 151
335 3300005329 Ga0070683_100553405 Ga0070683_1005534052 151
336 3300005336 Ga0070680_100511712 Ga0070680_1005117121 151
337 3300005338 Ga0068868_100605743 Ga0068868_1006057432 151
338 3300005339 Ga0070660_100797671 Ga0070660_1007976712 151
339 3300005340 Ga0070689_101706795 Ga0070689_1017067952 151
340 3300005366 Ga0070659_100983227 Ga0070659_1009832271 151
341 3300005458 Ga0070681_10277579 Ga0070681_102775792 151
342 3300005530 Ga0070679_100153842 Ga0070679_1001538424 151
343 3300005530 Ga0070679_100339329 Ga0070679_1003393292 151
344 3300005530 Ga0070679_100612729 Ga0070679_1006127292 151
345 3300005563 Ga0068855_100279388 Ga0068855_1002793882 151
346 3300005577 Ga0068857_100224548 Ga0068857_1002245481 151
347 3300005616 Ga0068852_100003198 Ga0068852_1000031984 151
348 3300006038 Ga0075365_10171638 Ga0075365_101716382 151
349 3300006042 Ga0075368_10057624 Ga0075368_100576242 151
350 3300006051 Ga0075364_10269518 Ga0075364_102695182 151
351 3300006178 Ga0075367_10102936 Ga0075367_101029363 151
352 3300006195 Ga0075366_10042179 Ga0075366_100421792 151
353 3300009551 Ga0105238_10057443 Ga0105238_100574434 151
354 3300013102 Ga0157371_10100708 Ga0157371_101007083 151
355 3300013105 Ga0157369_10711585 Ga0157369_107115852 151
356 3300014325 Ga0163163_11255517 Ga0163163_112555171 151
357 3300025261 Ga0209233_1004370 Ga0209233_10043705 151
358 3300025297 Ga0209758_1000241 Ga0209758_100024159 151
359 3300025297 Ga0209758_1023449 Ga0209758_10234492 151
360 3300025302 Ga0207426_1073757 Ga0207426_10737572 151
361 3300025912 Ga0207707_10407929 Ga0207707_104079292 151
362 3300025921 Ga0207652_10242651 Ga0207652_102426512 151
363 3300025924 Ga0207694_10012607 Ga0207694_100126072 151
364 3300025929 Ga0207664_10226888 Ga0207664_102268883 151
365 3300025935 Ga0207709_11003067 Ga0207709_110030672 151
366 3300025936 Ga0207670_11471753 Ga0207670_114717531 151
367 3300025937 Ga0207669_10236375 Ga0207669_102363753 151
368 3300025944 Ga0207661_10105082 Ga0207661_101050822 151
369 3300025949 Ga0207667_10056364 Ga0207667_100563644 151
370 3300026116 Ga0207674_10084893 Ga0207674_100848935 151
371 3300028800 Ga0265338_10052834 Ga0265338_100528344 151
372 3300031235 Ga0265330_10068599 Ga0265330_100685992 151
373 3300031241 Ga0265325_10038950 Ga0265325_100389504 151
374 3300031241 Ga0265325_10176622 Ga0265325_101766222 151
375 3300031247 Ga0265340_10068129 Ga0265340_100681293 151
376 3300031247 Ga0265340_10071067 Ga0265340_100710673 151
377 3300031665 Ga0316575_10037815 Ga0316575_100378152 151
378 3300031712 Ga0265342_10019701 Ga0265342_100197014 151
379 3300032005 Ga0307411_10321237 Ga0307411_103212371 151
380 3300032133 Ga0316583_10061899 Ga0316583_100618992 151
381 3300046517 Ga0495630_0266749 Ga0495630_0266749_298_765 151
382 3300046663 Ga0495635_0214234 Ga0495635_0214234_566_1033 151
383 3300046689 Ga0495613_0152670 Ga0495613_0152670_929_1396 151
384 3300048904 Ga0496101_0161222 Ga0496101_0161222_70_537 151
385 3300048907 Ga0496104_0000466 Ga0496104_0000466_31950_32417 151
386 3300048907 Ga0496104_0037354 Ga0496104_0037354_543_1010 151
387 3300048908 Ga0496105_0065868 Ga0496105_0065868_1315_1782 151
388 3300048908 Ga0496105_0096886 Ga0496105_0096886_303_770 151
389 3300048916 Ga0496113_0161068 Ga0496113_0161068_1090_1557 151
390 3300048917 Ga0496114_1746096 Ga0496114_1746096_30_497 151
391 3300048918 Ga0496115_0102241 Ga0496115_0102241_877_1344 151
392 3300048918 Ga0496115_0175057 Ga0496115_0175057_14_481 151
393 3300050493 nmdc:mga0k408_46093_c1 nmdc:mga0k408_46093_c1_672_1130 151
394 3300050494 nmdc:mga06z11_67121_c1 nmdc:mga06z11_67121_c1_476_934 151
395 3300050508 nmdc:mga09592_53150_c1 nmdc:mga09592_53150_c1_2843_3313 151
396 3300050509 nmdc:mga0qj67_11915_c1 nmdc:mga0qj67_11915_c1_277_747 151
397 3300053077 Ga0495601_0727061 Ga0495601_0727061_152_619 151
398 3300053085 Ga0495619_0062365 Ga0495619_0062365_1429_1896 151
399 3300053085 Ga0495619_0648577 Ga0495619_0648577_119_586 151
400 3300053096 Ga0500641_0018182 Ga0500641_0018182_1883_2341 151
401 3300053119 Ga0500595_113317 Ga0500595_113317_247_705 151
402 3300053139 Ga0500568_0177653 Ga0500568_0177653_76_534 151
403 3300005336 Ga0070680_100058826 Ga0070680_1000588263 152
404 3300005337 Ga0070682_100341631 Ga0070682_1003416312 152
405 3300005344 Ga0070661_100809478 Ga0070661_1008094781 152
406 3300005434 Ga0070709_10040154 Ga0070709_100401542 152
407 3300005435 Ga0070714_100155738 Ga0070714_1001557382 152
408 3300005435 Ga0070714_100667074 Ga0070714_1006670742 152
409 3300005437 Ga0070710_10017052 Ga0070710_100170523 152
410 3300005439 Ga0070711_100043265 Ga0070711_1000432653 152
411 3300005458 Ga0070681_10120499 Ga0070681_101204993 152
412 3300005530 Ga0070679_100057917 Ga0070679_1000579173 152
413 3300005535 Ga0070684_100090107 Ga0070684_1000901073 152
414 3300005539 Ga0068853_101176117 Ga0068853_1011761171 152
415 3300005563 Ga0068855_100128657 Ga0068855_1001286572 152
416 3300005577 Ga0068857_100255515 Ga0068857_1002555152 152
417 3300005614 Ga0068856_101114309 Ga0068856_1011143091 152
418 3300005616 Ga0068852_100260531 Ga0068852_1002605312 152
419 3300005937 Ga0081455_10323975 Ga0081455_103239752 152
420 3300006163 Ga0070715_10167979 Ga0070715_101679792 152
421 3300006173 Ga0070716_100070371 Ga0070716_1000703712 152
422 3300006175 Ga0070712_100044771 Ga0070712_1000447712 152
423 3300006175 Ga0070712_100390343 Ga0070712_1003903432 152
424 3300009093 Ga0105240_10175571 Ga0105240_101755712 152
425 3300009551 Ga0105238_10094621 Ga0105238_100946214 152
426 3300013104 Ga0157370_10230672 Ga0157370_102306722 152
427 3300013105 Ga0157369_10051616 Ga0157369_100516162 152
428 3300021377 Ga0213874_10274349 Ga0213874_102743491 152
429 3300021384 Ga0213876_10182100 Ga0213876_101821001 152
430 3300021388 Ga0213875_10180071 Ga0213875_101800711 152
431 3300025898 Ga0207692_10010941 Ga0207692_100109412 152
432 3300025905 Ga0207685_10097188 Ga0207685_100971882 152
433 3300025906 Ga0207699_10053415 Ga0207699_100534153 152
434 3300025912 Ga0207707_10792262 Ga0207707_107922622 152
435 3300025915 Ga0207693_10003341 Ga0207693_100033415 152
436 3300025915 Ga0207693_10033429 Ga0207693_100334293 152
437 3300025915 Ga0207693_10815645 Ga0207693_108156452 152
438 3300025916 Ga0207663_10078055 Ga0207663_100780553 152
439 3300025916 Ga0207663_10148579 Ga0207663_101485792 152
440 3300025917 Ga0207660_10031348 Ga0207660_100313483 152
441 3300025921 Ga0207652_10274304 Ga0207652_102743042 152
442 3300025924 Ga0207694_10116921 Ga0207694_101169213 152
443 3300025929 Ga0207664_10075575 Ga0207664_100755751 152
444 3300025929 Ga0207664_10578297 Ga0207664_105782972 152
445 3300025939 Ga0207665_10620394 Ga0207665_106203941 152
446 3300025944 Ga0207661_10907086 Ga0207661_109070862 152
447 3300026041 Ga0207639_11028744 Ga0207639_110287442 152
448 3300026078 Ga0207702_10054857 Ga0207702_100548573 152
449 3300026116 Ga0207674_10418858 Ga0207674_104188582 152
450 3300031241 Ga0265325_10052164 Ga0265325_100521642 152
451 3300031241 Ga0265325_10068906 Ga0265325_100689063 152
452 3300031242 Ga0265329_10035980 Ga0265329_100359802 152
453 3300031249 Ga0265339_10041296 Ga0265339_100412964 152
454 3300031344 Ga0265316_10051052 Ga0265316_100510522 152
455 3300031595 Ga0265313_10156634 Ga0265313_101566341 152
456 3300031595 Ga0265313_10237970 Ga0265313_102379702 152
457 3300031665 Ga0316575_10032856 Ga0316575_100328563 152
458 3300031901 Ga0307406_10866612 Ga0307406_108666121 152
459 3300031911 Ga0307412_10903371 Ga0307412_109033712 152
460 3300031995 Ga0307409_100534704 Ga0307409_1005347042 152
461 3300035117 Ga0373953_0006532 Ga0373953_0006532_794_1258 152
462 3300035119 Ga0373956_0266313 Ga0373956_0266313_340_804 152
463 3300035120 Ga0373957_0156575 Ga0373957_0156575_449_913 152
464 3300035724 Ga0373933_0013093 Ga0373933_0013093_3626_4090 152
465 3300035725 Ga0373947_0037363 Ga0373947_0037363_916_1380 152
466 3300036401 Ga0373937_0032624 Ga0373937_0032624_2478_2942 152
467 3300036401 Ga0373937_0158761 Ga0373937_0158761_245_709 152
468 3300039437 Ga0436365_0097464 Ga0436365_0097464_1758_2222 152
469 3300039437 Ga0436365_0484144 Ga0436365_0484144_2919_3383 152
470 3300039447 Ga0436361_0575185 Ga0436361_0575185_116_580 152
471 3300039447 Ga0436361_0713927 Ga0436361_0713927_1714_2178 152
472 3300039447 Ga0436361_0912045 Ga0436361_0912045_374_838 152
473 3300039450 Ga0436363_0781422 Ga0436363_0781422_664_1128 152
474 3300046454 Ga0495592_0028916 Ga0495592_0028916_3552_4016 152
475 3300046461 Ga0495641_0338412 Ga0495641_0338412_15_479 152
476 3300046462 Ga0495651_0027032 Ga0495651_0027032_3469_3933 152
477 3300046477 Ga0495664_0065939 Ga0495664_0065939_1545_2009 152
478 3300046492 Ga0495585_0279205 Ga0495585_0279205_43_507 152
479 3300046516 Ga0495628_0013822 Ga0495628_0013822_3526_3990 152
480 3300046529 Ga0495652_0001261 Ga0495652_0001261_17095_17559 152
481 3300046533 Ga0495640_0612999 Ga0495640_0612999_63_527 152
482 3300046536 Ga0495587_0019419 Ga0495587_0019419_2685_3149 152
483 3300046543 Ga0495645_0005294 Ga0495645_0005294_4608_5072 152
484 3300046559 Ga0495667_0000827 Ga0495667_0000827_931_1395 152
485 3300046663 Ga0495635_0219767 Ga0495635_0219767_550_1014 152
486 3300046675 Ga0495657_0070049 Ga0495657_0070049_499_963 152
487 3300046678 Ga0495599_0021479 Ga0495599_0021479_98_562 152
488 3300046679 Ga0495623_0033261 Ga0495623_0033261_593_1057 152
489 3300046692 Ga0495671_0417454 Ga0495671_0417454_128_592 152
490 3300046809 Ga0495600_0003565 Ga0495600_0003565_6157_6621 152
491 3300047317 Ga0495604_0024966 Ga0495604_0024966_3562_4026 152
492 3300047319 Ga0495674_0031760 Ga0495674_0031760_3464_3928 152
493 3300047322 Ga0495680_0002516 Ga0495680_0002516_15038_15502 152
494 3300048088 Ga0495602_0319331 Ga0495602_0319331_64_528 152
495 3300048904 Ga0496101_0122929 Ga0496101_0122929_140_604 152
496 3300048905 Ga0496102_0242393 Ga0496102_0242393_1138_1602 152
497 3300048907 Ga0496104_0000061 Ga0496104_0000061_116725_117189 152
498 3300048907 Ga0496104_0370878 Ga0496104_0370878_316_780 152
499 3300048908 Ga0496105_0010551 Ga0496105_0010551_3533_3997 152
500 3300048910 Ga0496107_1196088 Ga0496107_1196088_62_526 152
501 3300048911 Ga0496108_0354337 Ga0496108_0354337_635_1099 152
502 3300048914 Ga0496111_0874556 Ga0496111_0874556_119_583 152
503 3300048915 Ga0496112_0350430 Ga0496112_0350430_649_1113 152
504 3300048917 Ga0496114_0182841 Ga0496114_0182841_459_923 152
505 3300048918 Ga0496115_0039483 Ga0496115_0039483_2422_2886 152
506 3300049569 Ga0501032_0790571 Ga0501032_0790571_34_498 152
507 3300049581 Ga0501047_0168171 Ga0501047_0168171_1587_2051 152
508 3300049586 Ga0501070_0349007 Ga0501070_0349007_206_676 152
509 3300049590 Ga0501074_0178982 Ga0501074_0178982_941_1411 152
510 3300049744 Ga0501083_0587899 Ga0501083_0587899_21_485 152
511 3300049822 Ga0501035_0141678 Ga0501035_0141678_115_585 152
512 3300049822 Ga0501035_1375755 Ga0501035_1375755_26_526 152
513 3300053077 Ga0495601_0000153 Ga0495601_0000153_28458_28922 152
514 3300053077 Ga0495601_0036305 Ga0495601_0036305_2216_2680 152
515 3300053078 Ga0495612_0001586 Ga0495612_0001586_5257_5721 152
516 3300053084 Ga0495595_0000328 Ga0495595_0000328_12697_13161 152
517 3300053085 Ga0495619_0001072 Ga0495619_0001072_3584_4048 152
518 3300053085 Ga0495619_0011608 Ga0495619_0011608_3852_4316 152
519 3300053085 Ga0495619_0073167 Ga0495619_0073167_908_1372 152
520 3300053087 Ga0500643_000795 Ga0500643_000795_6052_6516 152
521 3300053088 Ga0500644_0023522 Ga0500644_0023522_1221_1685 152
522 3300053111 Ga0500572_102966 Ga0500572_102966_144_608 152
523 3300053119 Ga0500595_000001 Ga0500595_000001_329622_330086 152
524 3300053131 Ga0500652_014253 Ga0500652_014253_884_1348 152
525 3300053153 Ga0500616_0000001 Ga0500616_0000001_1647875_1648339 152
526 3300053730 Ga0500645_000015 Ga0500645_000015_140780_141244 152
527 3300003323 rootH1_10113021 rootH1_101130212 153
528 3300005334 Ga0068869_100953368 Ga0068869_1009533681 153
529 3300005343 Ga0070687_100833700 Ga0070687_1008337001 153
530 3300005439 Ga0070711_100008900 Ga0070711_1000089001 153
531 3300005548 Ga0070665_100215246 Ga0070665_1002152462 153
532 3300005840 Ga0068870_10588744 Ga0068870_105887442 153
533 3300006048 Ga0075363_100025836 Ga0075363_1000258362 153
534 3300006051 Ga0075364_10012460 Ga0075364_100124604 153
535 3300006177 Ga0075362_10055834 Ga0075362_100558342 153
536 3300006178 Ga0075367_10107828 Ga0075367_101078282 153
537 3300006195 Ga0075366_10038723 Ga0075366_100387232 153
538 3300006195 Ga0075366_10501080 Ga0075366_105010801 153
539 3300006353 Ga0075370_10150533 Ga0075370_101505333 153
540 3300009094 Ga0111539_10048105 Ga0111539_100481056 153
541 3300009147 Ga0114129_11177876 Ga0114129_111778762 153
542 3300011119 Ga0105246_12582018 Ga0105246_125820181 153
543 3300013306 Ga0163162_10631073 Ga0163162_106310732 153
544 3300021361 Ga0213872_10036087 Ga0213872_100360873 153
545 3300025916 Ga0207663_10700974 Ga0207663_107009741 153
546 3300028379 Ga0268266_11311795 Ga0268266_113117951 153
547 3300031249 Ga0265339_10139913 Ga0265339_101399131 153
548 3300031712 Ga0265342_10307568 Ga0265342_103075682 153
549 3300039447 Ga0436361_0531564 Ga0436361_0531564_1289_1756 153
550 3300041408 Ga0439453_0118227 Ga0439453_0118227_77_544 153
551 3300046531 Ga0495665_0000743 Ga0495665_0000743_16_480 153
552 3300049569 Ga0501032_0041744 Ga0501032_0041744_2137_2604 153
553 3300049570 Ga0501033_0195466 Ga0501033_0195466_523_990 153
554 3300049571 Ga0501034_0051283 Ga0501034_0051283_443_910 153
555 3300049571 Ga0501034_0503955 Ga0501034_0503955_315_782 153
556 3300049572 Ga0501036_0048401 Ga0501036_0048401_2288_2755 153
557 3300049572 Ga0501036_0469076 Ga0501036_0469076_528_995 153
558 3300049573 Ga0501037_0047256 Ga0501037_0047256_1302_1769 153
559 3300049575 Ga0501039_0068228 Ga0501039_0068228_463_930 153
560 3300049575 Ga0501039_0389967 Ga0501039_0389967_499_966 153
561 3300049579 Ga0501043_0441500 Ga0501043_0441500_402_869 153
562 3300049579 Ga0501043_0535467 Ga0501043_0535467_325_792 153
563 3300049581 Ga0501047_0132797 Ga0501047_0132797_1234_1701 153
564 3300049581 Ga0501047_0168383 Ga0501047_0168383_250_750 153
565 3300049581 Ga0501047_0744340 Ga0501047_0744340_128_595 153
566 3300049586 Ga0501070_0193436 Ga0501070_0193436_681_1148 153
567 3300049586 Ga0501070_0322054 Ga0501070_0322054_571_1038 153
568 3300049822 Ga0501035_0064435 Ga0501035_0064435_2215_2682 153
569 3300049823 Ga0501044_1244775 Ga0501044_1244775_29_496 153
570 3300050489 nmdc:mga03683_48716_c1 nmdc:mga03683_48716_c1_452_919 153
571 3300050491 nmdc:mga00v17_32752_c1 nmdc:mga00v17_32752_c1_655_1122 153
572 3300050493 nmdc:mga0k408_25879_c1 nmdc:mga0k408_25879_c1_2496_2963 153
573 3300050494 nmdc:mga06z11_249790_c1 nmdc:mga06z11_249790_c1_329_796 153
574 3300050495 nmdc:mga04h51_54295_c1 nmdc:mga04h51_54295_c1_10_477 153
575 3300050507 nmdc:mga05p37_6363_c1 nmdc:mga05p37_6363_c1_137_607 153
576 3300050507 nmdc:mga05p37_728542_c1 nmdc:mga05p37_728542_c1_446_916 153
577 3300050508 nmdc:mga09592_2569_c1 nmdc:mga09592_2569_c1_1628_2098 153
578 3300050509 nmdc:mga0qj67_1654_c1 nmdc:mga0qj67_1654_c1_9307_9777 153
579 3300050510 nmdc:mga06r32_4586_c1 nmdc:mga06r32_4586_c1_6877_7347 153
580 3300050511 nmdc:mga08y16_113197_c1 nmdc:mga08y16_113197_c1_1719_2189 153
581 3300050512 nmdc:mga0n895_2123_c1 nmdc:mga0n895_2123_c1_5524_5994 153
582 3300050513 nmdc:mga0rr50_5265_c1 nmdc:mga0rr50_5265_c1_1654_2124 153
583 3300050514 nmdc:mga08x19_176190_c1 nmdc:mga08x19_176190_c1_136_606 153
584 3300050515 nmdc:mga0a205_54427_c1 nmdc:mga0a205_54427_c1_1001_1471 153
585 3300061719 Ga0466962_0174953 Ga0466962_0174953_318_818 153
586 3300005331 Ga0070670_101789424 Ga0070670_1017894241 154
587 3300005340 Ga0070689_100746381 Ga0070689_1007463812 154
588 3300005354 Ga0070675_100053131 Ga0070675_1000531313 154
589 3300005365 Ga0070688_100926366 Ga0070688_1009263662 154
590 3300005436 Ga0070713_100696588 Ga0070713_1006965882 154
591 3300009177 Ga0105248_11677516 Ga0105248_116775162 154
592 3300012507 Ga0157342_1013783 Ga0157342_10137831 154
593 3300013296 Ga0157374_10771956 Ga0157374_107719562 154
594 3300014325 Ga0163163_11243048 Ga0163163_112430482 154
595 3300014969 Ga0157376_11212177 Ga0157376_112121772 154
596 3300025925 Ga0207650_10712331 Ga0207650_107123312 154
597 3300025928 Ga0207700_10685985 Ga0207700_106859852 154
598 3300025936 Ga0207670_10118200 Ga0207670_101182002 154
599 3300025961 Ga0207712_10369772 Ga0207712_103697722 154
600 3300034817 Ga0373948_0021352 Ga0373948_0021352_260_727 154
601 3300034818 Ga0373950_0005708 Ga0373950_0005708_785_1252 154
602 3300035091 Ga0373951_0075387 Ga0373951_0075387_250_717 154
603 3300035116 Ga0373945_0068147 Ga0373945_0068147_742_1209 154
604 3300035119 Ga0373956_0056820 Ga0373956_0056820_1122_1589 154
605 3300035170 Ga0373943_0045452 Ga0373943_0045452_604_1071 154
606 3300035695 Ga0373927_0002017 Ga0373927_0002017_8867_9334 154
607 3300035725 Ga0373947_0028888 Ga0373947_0028888_1552_2019 154
608 3300037068 Ga0373925_0004980 Ga0373925_0004980_640_1107 154
609 3300037853 Ga0436364_0454045 Ga0436364_0454045_212_748 154
610 3300039437 Ga0436365_0932459 Ga0436365_0932459_25455_25934 154
611 3300039453 Ga0436362_0900768 Ga0436362_0900768_1085_1564 154
612 3300046452 Ga0495617_036246 Ga0495617_036246_703_1170 154
613 3300046454 Ga0495592_0011627 Ga0495592_0011627_1473_1940 154
614 3300046459 Ga0495629_0005121 Ga0495629_0005121_2228_2695 154
615 3300046461 Ga0495641_0006685 Ga0495641_0006685_4918_5385 154
616 3300046462 Ga0495651_0002175 Ga0495651_0002175_3239_3706 154
617 3300046463 Ga0495653_0002883 Ga0495653_0002883_767_1234 154
618 3300046472 Ga0495580_0012507 Ga0495580_0012507_3374_3841 154
619 3300046474 Ga0495605_0073936 Ga0495605_0073936_479_946 154
620 3300046475 Ga0495639_0000713 Ga0495639_0000713_65_532 154
621 3300046476 Ga0495662_0000084 Ga0495662_0000084_8839_9306 154
622 3300046491 Ga0495584_0063809 Ga0495584_0063809_429_896 154
623 3300046492 Ga0495585_0004511 Ga0495585_0004511_341_808 154
624 3300046499 Ga0495594_0013840 Ga0495594_0013840_1234_1701 154
625 3300046501 Ga0495607_0038927 Ga0495607_0038927_292_759 154
626 3300046511 Ga0495608_0023449 Ga0495608_0023449_2530_2997 154
627 3300046514 Ga0495618_0007354 Ga0495618_0007354_1234_1701 154
628 3300046516 Ga0495628_0007423 Ga0495628_0007423_2243_2710 154
629 3300046516 Ga0495628_0482464 Ga0495628_0482464_162_632 154
630 3300046517 Ga0495630_0004290 Ga0495630_0004290_8429_8896 154
631 3300046526 Ga0495666_0041063 Ga0495666_0041063_1233_1700 154
632 3300046529 Ga0495652_0007683 Ga0495652_0007683_2228_2695 154
633 3300046531 Ga0495665_0113550 Ga0495665_0113550_872_1339 154
634 3300046533 Ga0495640_0043559 Ga0495640_0043559_1106_1573 154
635 3300046558 Ga0495633_0005344 Ga0495633_0005344_1859_2326 154
636 3300046559 Ga0495667_0000202 Ga0495667_0000202_13733_14200 154
637 3300046615 Ga0495656_0030187 Ga0495656_0030187_1136_1603 154
638 3300046642 Ga0495634_0005317 Ga0495634_0005317_2356_2823 154
639 3300046648 Ga0495611_0046030 Ga0495611_0046030_917_1384 154
640 3300046663 Ga0495635_0000399 Ga0495635_0000399_12154_12621 154
641 3300046665 Ga0495661_0163713 Ga0495661_0163713_424_891 154
642 3300046674 Ga0495588_0004780 Ga0495588_0004780_1927_2394 154
643 3300046674 Ga0495588_0328104 Ga0495588_0328104_230_697 154
644 3300046680 Ga0495646_0006797 Ga0495646_0006797_3573_4040 154
645 3300046681 Ga0495647_0004774 Ga0495647_0004774_52_519 154
646 3300046681 Ga0495647_0089419 Ga0495647_0089419_287_754 154
647 3300046683 Ga0495658_0003756 Ga0495658_0003756_2292_2759 154
648 3300046689 Ga0495613_0001462 Ga0495613_0001462_7097_7564 154
649 3300046690 Ga0495624_0000222 Ga0495624_0000222_30109_30576 154
650 3300046691 Ga0495670_0117922 Ga0495670_0117922_139_606 154
651 3300046809 Ga0495600_0003235 Ga0495600_0003235_1773_2240 154
652 3300047315 Ga0495581_0000145 Ga0495581_0000145_17508_17975 154
653 3300047317 Ga0495604_0005816 Ga0495604_0005816_1424_1891 154
654 3300047319 Ga0495674_0007404 Ga0495674_0007404_8839_9306 154
655 3300047321 Ga0495676_0801921 Ga0495676_0801921_80_547 154
656 3300047471 Ga0495684_0000075 Ga0495684_0000075_37952_38419 154
657 3300047673 Ga0495593_0000228 Ga0495593_0000228_20997_21464 154
658 3300048089 Ga0495614_0013343 Ga0495614_0013343_1576_2043 154
659 3300048928 Ga0496125_0209377 Ga0496125_0209377_696_1163 154
660 3300053077 Ga0495601_0010084 Ga0495601_0010084_4963_5430 154
661 3300053084 Ga0495595_0000988 Ga0495595_0000988_9070_9537 154
662 3300053085 Ga0495619_0001117 Ga0495619_0001117_13461_13928 154
663 2209111006 2214800760 2213830106 155
664 3300000041 ARcpr5oldR_c000187 ARcpr5oldR_0001878 155
665 3300000042 ARSoilYngRDRAFT_c00132 ARSoilYngRDRAFT_001323 155
666 3300000043 ARcpr5yngRDRAFT_c000643 ARcpr5yngRDRAFT_0006433 155
667 3300000044 ARSoilOldRDRAFT_c000044 ARSoilOldRDRAFT_00004423 155
668 3300000045 ARCol0oldRDRAFT_c00484 ARCol0oldRDRAFT_004844 155
669 3300000652 ARCol0yngRDRAFT_1000153 ARCol0yngRDRAFT_10001539 155
670 3300001430 JGI24032J14994_101472 JGI24032J14994_1014722 155
671 3300001915 JGI24741J21665_1025315 JGI24741J21665_10253152 155
672 3300001976 JGI24752J21851_1016260 JGI24752J21851_10162602 155
673 3300001977 JGI24746J21847_1005317 JGI24746J21847_10053173 155
674 3300001978 JGI24747J21853_1014220 JGI24747J21853_10142201 155
675 3300001989 JGI24739J22299_10024622 JGI24739J22299_100246223 155
676 3300001990 JGI24737J22298_10006807 JGI24737J22298_100068075 155
677 3300001990 JGI24737J22298_10007788 JGI24737J22298_100077884 155
678 3300001990 JGI24737J22298_10024518 JGI24737J22298_100245183 155
679 3300002073 JGI24745J21846_1002155 JGI24745J21846_10021552 155
680 3300002075 JGI24738J21930_10016553 JGI24738J21930_100165532 155
681 3300002076 JGI24749J21850_1004742 JGI24749J21850_10047422 155
682 3300002076 JGI24749J21850_1005739 JGI24749J21850_10057393 155
683 3300002126 JGI24035J26624_1001878 JGI24035J26624_10018782 155
684 3300002155 JGI24033J26618_1016316 JGI24033J26618_10163162 155
685 3300002239 JGI24034J26672_10012906 JGI24034J26672_100129062 155
686 3300002244 JGI24742J22300_10002556 JGI24742J22300_100025562 155
687 3300005290 Ga0065712_10073820 Ga0065712_100738204 155
688 3300005293 Ga0065715_10096283 Ga0065715_100962834 155
689 3300005328 Ga0070676_10000985 Ga0070676_100009857 155
690 3300005329 Ga0070683_100001244 Ga0070683_10000124418 155
691 3300005329 Ga0070683_100645113 Ga0070683_1006451132 155
692 3300005330 Ga0070690_100012869 Ga0070690_1000128694 155
693 3300005330 Ga0070690_100026138 Ga0070690_1000261384 155
694 3300005330 Ga0070690_100506992 Ga0070690_1005069922 155
695 3300005331 Ga0070670_100012785 Ga0070670_1000127856 155
696 3300005333 Ga0070677_10006769 Ga0070677_100067692 155
697 3300005334 Ga0068869_100027806 Ga0068869_1000278064 155
698 3300005334 Ga0068869_100198362 Ga0068869_1001983622 155
699 3300005335 Ga0070666_10054336 Ga0070666_100543363 155
700 3300005335 Ga0070666_10178291 Ga0070666_101782912 155
701 3300005335 Ga0070666_10481090 Ga0070666_104810901 155
702 3300005336 Ga0070680_100044451 Ga0070680_1000444512 155
703 3300005337 Ga0070682_100029667 Ga0070682_1000296674 155
704 3300005337 Ga0070682_100115799 Ga0070682_1001157992 155
705 3300005338 Ga0068868_100004160 Ga0068868_1000041605 155
706 3300005339 Ga0070660_100000525 Ga0070660_1000005257 155
707 3300005339 Ga0070660_100059117 Ga0070660_1000591172 155
708 3300005340 Ga0070689_100135170 Ga0070689_1001351702 155
709 3300005341 Ga0070691_10002569 Ga0070691_100025694 155
710 3300005341 Ga0070691_10179444 Ga0070691_101794442 155
711 3300005343 Ga0070687_100082377 Ga0070687_1000823772 155
712 3300005343 Ga0070687_100171850 Ga0070687_1001718501 155
713 3300005344 Ga0070661_100004361 Ga0070661_1000043617 155
714 3300005345 Ga0070692_10009575 Ga0070692_100095754 155
715 3300005345 Ga0070692_10017346 Ga0070692_100173462 155
716 3300005347 Ga0070668_100015096 Ga0070668_1000150967 155
717 3300005347 Ga0070668_100112572 Ga0070668_1001125723 155
718 3300005353 Ga0070669_100002142 Ga0070669_10000214211 155
719 3300005353 Ga0070669_100012165 Ga0070669_1000121652 155
720 3300005354 Ga0070675_100696796 Ga0070675_1006967962 155
721 3300005355 Ga0070671_100005408 Ga0070671_1000054086 155
722 3300005356 Ga0070674_100001208 Ga0070674_10000120811 155
723 3300005356 Ga0070674_100602417 Ga0070674_1006024172 155
724 3300005364 Ga0070673_100006682 Ga0070673_1000066823 155
725 3300005364 Ga0070673_100331008 Ga0070673_1003310082 155
726 3300005365 Ga0070688_100001615 Ga0070688_1000016154 155
727 3300005365 Ga0070688_100002125 Ga0070688_10000212511 155
728 3300005366 Ga0070659_100452047 Ga0070659_1004520472 155
729 3300005367 Ga0070667_100018716 Ga0070667_1000187166 155
730 3300005367 Ga0070667_100027679 Ga0070667_1000276795 155
731 3300005367 Ga0070667_100041879 Ga0070667_1000418794 155
732 3300005406 Ga0070703_10018531 Ga0070703_100185312 155
733 3300005406 Ga0070703_10108693 Ga0070703_101086931 155
734 3300005434 Ga0070709_10137388 Ga0070709_101373882 155
735 3300005436 Ga0070713_100014447 Ga0070713_1000144475 155
736 3300005436 Ga0070713_100277870 Ga0070713_1002778702 155
737 3300005436 Ga0070713_100452867 Ga0070713_1004528672 155
738 3300005437 Ga0070710_10036006 Ga0070710_100360064 155
739 3300005437 Ga0070710_10139034 Ga0070710_101390342 155
740 3300005438 Ga0070701_10000532 Ga0070701_100005325 155
741 3300005439 Ga0070711_100104380 Ga0070711_1001043802 155
742 3300005440 Ga0070705_100006339 Ga0070705_1000063396 155
743 3300005440 Ga0070705_100150389 Ga0070705_1001503892 155
744 3300005440 Ga0070705_101508158 Ga0070705_1015081581 155
745 3300005441 Ga0070700_100031664 Ga0070700_1000316643 155
746 3300005444 Ga0070694_100001428 Ga0070694_10000142812 155
747 3300005444 Ga0070694_100002143 Ga0070694_1000021438 155
748 3300005445 Ga0070708_100046627 Ga0070708_1000466273 155
749 3300005445 Ga0070708_100328671 Ga0070708_1003286712 155
750 3300005455 Ga0070663_100046288 Ga0070663_1000462884 155
751 3300005455 Ga0070663_100085578 Ga0070663_1000855782 155
752 3300005455 Ga0070663_100173614 Ga0070663_1001736142 155
753 3300005456 Ga0070678_100026205 Ga0070678_1000262053 155
754 3300005456 Ga0070678_100056901 Ga0070678_1000569012 155
755 3300005457 Ga0070662_100034625 Ga0070662_1000346255 155
756 3300005458 Ga0070681_10017611 Ga0070681_100176119 155
757 3300005458 Ga0070681_10133801 Ga0070681_101338012 155
758 3300005458 Ga0070681_10295426 Ga0070681_102954262 155
759 3300005458 Ga0070681_11234113 Ga0070681_112341131 155
760 3300005459 Ga0068867_100007122 Ga0068867_1000071227 155
761 3300005459 Ga0068867_100090816 Ga0068867_1000908163 155
762 3300005459 Ga0068867_100384372 Ga0068867_1003843721 155
763 3300005466 Ga0070685_10006338 Ga0070685_100063387 155
764 3300005466 Ga0070685_10010065 Ga0070685_100100654 155
765 3300005468 Ga0070707_101332321 Ga0070707_1013323211 155
766 3300005530 Ga0070679_100008193 Ga0070679_1000081937 155
767 3300005530 Ga0070679_100058535 Ga0070679_1000585354 155
768 3300005530 Ga0070679_100186809 Ga0070679_1001868092 155
769 3300005530 Ga0070679_100602214 Ga0070679_1006022142 155
770 3300005535 Ga0070684_100135689 Ga0070684_1001356893 155
771 3300005535 Ga0070684_100227057 Ga0070684_1002270572 155
772 3300005535 Ga0070684_100666844 Ga0070684_1006668442 155
773 3300005536 Ga0070697_101145666 Ga0070697_1011456661 155
774 3300005539 Ga0068853_100032736 Ga0068853_1000327365 155
775 3300005539 Ga0068853_100833033 Ga0068853_1008330331 155
776 3300005543 Ga0070672_100000940 Ga0070672_1000009404 155
777 3300005544 Ga0070686_100003535 Ga0070686_1000035352 155
778 3300005544 Ga0070686_100004740 Ga0070686_1000047406 155
779 3300005544 Ga0070686_101165750 Ga0070686_1011657501 155
780 3300005545 Ga0070695_100007876 Ga0070695_1000078764 155
781 3300005545 Ga0070695_100014616 Ga0070695_1000146163 155
782 3300005546 Ga0070696_100783602 Ga0070696_1007836021 155
783 3300005547 Ga0070693_100027001 Ga0070693_1000270011 155
784 3300005547 Ga0070693_100209343 Ga0070693_1002093432 155
785 3300005548 Ga0070665_100281953 Ga0070665_1002819532 155
786 3300005549 Ga0070704_100001579 Ga0070704_1000015794 155
787 3300005549 Ga0070704_100579013 Ga0070704_1005790132 155
788 3300005563 Ga0068855_100630157 Ga0068855_1006301572 155
789 3300005564 Ga0070664_100687532 Ga0070664_1006875322 155
790 3300005577 Ga0068857_100009322 Ga0068857_1000093229 155
791 3300005577 Ga0068857_100467783 Ga0068857_1004677832 155
792 3300005578 Ga0068854_100229222 Ga0068854_1002292222 155
793 3300005614 Ga0068856_100022760 Ga0068856_1000227602 155
794 3300005614 Ga0068856_100055386 Ga0068856_1000553865 155
795 3300005614 Ga0068856_100503178 Ga0068856_1005031782 155
796 3300005615 Ga0070702_100031454 Ga0070702_1000314544 155
797 3300005615 Ga0070702_100629261 Ga0070702_1006292611 155
798 3300005616 Ga0068852_100058916 Ga0068852_1000589164 155
799 3300005616 Ga0068852_100381048 Ga0068852_1003810482 155
800 3300005617 Ga0068859_100096576 Ga0068859_1000965762 155
801 3300005618 Ga0068864_100003045 Ga0068864_10000304512 155
802 3300005718 Ga0068866_10000410 Ga0068866_1000041016 155
803 3300005718 Ga0068866_10091486 Ga0068866_100914863 155
804 3300005719 Ga0068861_100009022 Ga0068861_1000090223 155
805 3300005719 Ga0068861_100040082 Ga0068861_1000400824 155
806 3300005834 Ga0068851_10490689 Ga0068851_104906892 155
807 3300005840 Ga0068870_10000215 Ga0068870_1000021514 155
808 3300005841 Ga0068863_100484261 Ga0068863_1004842612 155
809 3300005842 Ga0068858_100005681 Ga0068858_1000056819 155
810 3300005842 Ga0068858_100049473 Ga0068858_1000494734 155
811 3300005842 Ga0068858_100087583 Ga0068858_1000875833 155
812 3300005842 Ga0068858_100216226 Ga0068858_1002162262 155
813 3300005843 Ga0068860_100009344 Ga0068860_1000093443 155
814 3300005843 Ga0068860_100084361 Ga0068860_1000843614 155
815 3300005843 Ga0068860_100147618 Ga0068860_1001476182 155
816 3300005844 Ga0068862_100015662 Ga0068862_1000156625 155
817 3300005844 Ga0068862_100044125 Ga0068862_1000441254 155
818 3300005937 Ga0081455_10000012 Ga0081455_10000012107 155
819 3300006028 Ga0070717_10131054 Ga0070717_101310543 155
820 3300006058 Ga0075432_10298429 Ga0075432_102984292 155
821 3300006163 Ga0070715_10088100 Ga0070715_100881002 155
822 3300006175 Ga0070712_100062276 Ga0070712_1000622762 155
823 3300006175 Ga0070712_100403531 Ga0070712_1004035312 155
824 3300006175 Ga0070712_100941022 Ga0070712_1009410221 155
825 3300006178 Ga0075367_10112312 Ga0075367_101123122 155
826 3300006178 Ga0075367_10249295 Ga0075367_102492952 155
827 3300006237 Ga0097621_100003185 Ga0097621_1000031855 155
828 3300006237 Ga0097621_100020982 Ga0097621_1000209824 155
829 3300006358 Ga0068871_100002188 Ga0068871_1000021885 155
830 3300006358 Ga0068871_100236587 Ga0068871_1002365872 155
831 3300006852 Ga0075433_10145737 Ga0075433_101457372 155
832 3300006871 Ga0075434_100072114 Ga0075434_1000721142 155
833 3300006871 Ga0075434_100655384 Ga0075434_1006553842 155
834 3300006881 Ga0068865_100002213 Ga0068865_1000022139 155
835 3300006931 Ga0097620_100096573 Ga0097620_1000965732 155
836 3300007076 Ga0075435_100890253 Ga0075435_1008902532 155
837 3300009036 Ga0105244_10076572 Ga0105244_100765722 155
838 3300009092 Ga0105250_10021032 Ga0105250_100210323 155
839 3300009093 Ga0105240_10205018 Ga0105240_102050182 155
840 3300009093 Ga0105240_12104437 Ga0105240_121044371 155
841 3300009094 Ga0111539_10000114 Ga0111539_1000011417 155
842 3300009094 Ga0111539_10046475 Ga0111539_100464754 155
843 3300009098 Ga0105245_10014117 Ga0105245_100141172 155
844 3300009098 Ga0105245_10064510 Ga0105245_100645102 155
845 3300009098 Ga0105245_11666629 Ga0105245_116666291 155
846 3300009101 Ga0105247_10004602 Ga0105247_100046027 155
847 3300009101 Ga0105247_10124830 Ga0105247_101248302 155
848 3300009101 Ga0105247_10766609 Ga0105247_107666092 155
849 3300009147 Ga0114129_10467764 Ga0114129_104677642 155
850 3300009148 Ga0105243_10017428 Ga0105243_100174285 155
851 3300009148 Ga0105243_10068746 Ga0105243_100687464 155
852 3300009174 Ga0105241_10007805 Ga0105241_100078057 155
853 3300009174 Ga0105241_10174331 Ga0105241_101743312 155
854 3300009174 Ga0105241_10967710 Ga0105241_109677101 155
855 3300009176 Ga0105242_10011497 Ga0105242_100114977 155
856 3300009176 Ga0105242_10045137 Ga0105242_100451373 155
857 3300009176 Ga0105242_10421769 Ga0105242_104217692 155
858 3300009177 Ga0105248_10015424 Ga0105248_100154244 155
859 3300009177 Ga0105248_10015952 Ga0105248_100159527 155
860 3300009177 Ga0105248_10033034 Ga0105248_100330342 155
861 3300009177 Ga0105248_11219054 Ga0105248_112190541 155
862 3300009545 Ga0105237_10020483 Ga0105237_100204832 155
863 3300009553 Ga0105249_10019102 Ga0105249_100191027 155
864 3300009553 Ga0105249_10317131 Ga0105249_103171312 155
865 3300010375 Ga0105239_10039524 Ga0105239_100395244 155
866 3300010375 Ga0105239_10172932 Ga0105239_101729321 155
867 3300010375 Ga0105239_10553397 Ga0105239_105533972 155
868 3300011119 Ga0105246_10006910 Ga0105246_100069103 155
869 3300011119 Ga0105246_10014551 Ga0105246_100145512 155
870 3300012476 Ga0157344_1003626 Ga0157344_10036262 155
871 3300012492 Ga0157335_1024583 Ga0157335_10245832 155
872 3300012494 Ga0157341_1010202 Ga0157341_10102022 155
873 3300012497 Ga0157319_1024004 Ga0157319_10240042 155
874 3300012498 Ga0157345_1008648 Ga0157345_10086481 155
875 3300012502 Ga0157347_1006947 Ga0157347_10069472 155
876 3300012503 Ga0157313_1001104 Ga0157313_10011042 155
877 3300013100 Ga0157373_10112032 Ga0157373_101120323 155
878 3300013100 Ga0157373_10264708 Ga0157373_102647082 155
879 3300013100 Ga0157373_10334246 Ga0157373_103342461 155
880 3300013102 Ga0157371_10116284 Ga0157371_101162842 155
881 3300013104 Ga0157370_10293164 Ga0157370_102931642 155
882 3300013296 Ga0157374_10039734 Ga0157374_100397345 155
883 3300013296 Ga0157374_10148788 Ga0157374_101487882 155
884 3300013297 Ga0157378_10085000 Ga0157378_100850005 155
885 3300013306 Ga0163162_10043605 Ga0163162_100436053 155
886 3300013306 Ga0163162_10315316 Ga0163162_103153162 155
887 3300013307 Ga0157372_10244952 Ga0157372_102449523 155
888 3300013308 Ga0157375_10155208 Ga0157375_101552083 155
889 3300013308 Ga0157375_10168269 Ga0157375_101682692 155
890 3300014325 Ga0163163_10042146 Ga0163163_100421462 155
891 3300014325 Ga0163163_10089185 Ga0163163_100891852 155
892 3300014326 Ga0157380_10887660 Ga0157380_108876602 155
893 3300014745 Ga0157377_10005046 Ga0157377_100050462 155
894 3300014968 Ga0157379_10001743 Ga0157379_1000174316 155
895 3300014968 Ga0157379_10184364 Ga0157379_101843642 155
896 3300014968 Ga0157379_10515085 Ga0157379_105150852 155
897 3300014968 Ga0157379_11852688 Ga0157379_118526881 155
898 3300014969 Ga0157376_10004369 Ga0157376_100043697 155
899 3300015265 Ga0182005_1097311 Ga0182005_10973112 155
900 3300017792 Ga0163161_10078100 Ga0163161_100781003 155
901 3300025271 Ga0207666_1000732 Ga0207666_10007323 155
902 3300025271 Ga0207666_1000791 Ga0207666_10007914 155
903 3300025315 Ga0207697_10005124 Ga0207697_100051246 155
904 3300025885 Ga0207653_10004024 Ga0207653_100040244 155
905 3300025893 Ga0207682_10000071 Ga0207682_1000007144 155
906 3300025898 Ga0207692_10199649 Ga0207692_101996492 155
907 3300025898 Ga0207692_10327005 Ga0207692_103270052 155
908 3300025899 Ga0207642_10002908 Ga0207642_100029086 155
909 3300025900 Ga0207710_10004664 Ga0207710_100046644 155
910 3300025900 Ga0207710_10030042 Ga0207710_100300423 155
911 3300025901 Ga0207688_10004331 Ga0207688_100043312 155
912 3300025901 Ga0207688_10050355 Ga0207688_100503552 155
913 3300025903 Ga0207680_10010064 Ga0207680_100100646 155
914 3300025903 Ga0207680_10334991 Ga0207680_103349912 155
915 3300025904 Ga0207647_10002565 Ga0207647_1000256515 155
916 3300025904 Ga0207647_10008867 Ga0207647_100088672 155
917 3300025905 Ga0207685_10004209 Ga0207685_100042093 155
918 3300025906 Ga0207699_10004429 Ga0207699_100044294 155
919 3300025906 Ga0207699_10092009 Ga0207699_100920092 155
920 3300025908 Ga0207643_10000276 Ga0207643_1000027633 155
921 3300025911 Ga0207654_10004277 Ga0207654_100042777 155
922 3300025911 Ga0207654_10061393 Ga0207654_100613932 155
923 3300025912 Ga0207707_10012946 Ga0207707_100129466 155
924 3300025912 Ga0207707_10248930 Ga0207707_102489302 155
925 3300025912 Ga0207707_10499064 Ga0207707_104990642 155
926 3300025913 Ga0207695_10083002 Ga0207695_100830022 155
927 3300025914 Ga0207671_10233919 Ga0207671_102339192 155
928 3300025915 Ga0207693_10229718 Ga0207693_102297182 155
929 3300025915 Ga0207693_10297135 Ga0207693_102971352 155
930 3300025915 Ga0207693_10524969 Ga0207693_105249691 155
931 3300025916 Ga0207663_10112407 Ga0207663_101124073 155
932 3300025916 Ga0207663_10504720 Ga0207663_105047202 155
933 3300025917 Ga0207660_10000087 Ga0207660_1000008732 155
934 3300025917 Ga0207660_10032118 Ga0207660_100321181 155
935 3300025917 Ga0207660_10168553 Ga0207660_101685532 155
936 3300025918 Ga0207662_10095222 Ga0207662_100952222 155
937 3300025919 Ga0207657_10009053 Ga0207657_100090534 155
938 3300025919 Ga0207657_10047331 Ga0207657_100473312 155
939 3300025919 Ga0207657_10048561 Ga0207657_100485614 155
940 3300025920 Ga0207649_10002302 Ga0207649_100023027 155
941 3300025920 Ga0207649_10499333 Ga0207649_104993332 155
942 3300025921 Ga0207652_10014976 Ga0207652_100149765 155
943 3300025921 Ga0207652_10034741 Ga0207652_100347412 155
944 3300025921 Ga0207652_10119706 Ga0207652_101197062 155
945 3300025921 Ga0207652_10163291 Ga0207652_101632913 155
946 3300025923 Ga0207681_10002160 Ga0207681_100021602 155
947 3300025923 Ga0207681_10072458 Ga0207681_100724584 155
948 3300025925 Ga0207650_10019228 Ga0207650_100192282 155
949 3300025926 Ga0207659_10001604 Ga0207659_100016043 155
950 3300025927 Ga0207687_10038314 Ga0207687_100383144 155
951 3300025927 Ga0207687_10552116 Ga0207687_105521162 155
952 3300025928 Ga0207700_10044269 Ga0207700_100442694 155
953 3300025928 Ga0207700_10245931 Ga0207700_102459312 155
954 3300025929 Ga0207664_10240895 Ga0207664_102408952 155
955 3300025931 Ga0207644_10009341 Ga0207644_100093413 155
956 3300025931 Ga0207644_10048605 Ga0207644_100486053 155
957 3300025932 Ga0207690_10007427 Ga0207690_100074277 155
958 3300025932 Ga0207690_10366720 Ga0207690_103667201 155
959 3300025933 Ga0207706_10006428 Ga0207706_1000642811 155
960 3300025933 Ga0207706_10065125 Ga0207706_100651253 155
961 3300025934 Ga0207686_10002664 Ga0207686_100026645 155
962 3300025934 Ga0207686_10033863 Ga0207686_100338632 155
963 3300025935 Ga0207709_10004315 Ga0207709_100043154 155
964 3300025935 Ga0207709_10209918 Ga0207709_102099182 155
965 3300025936 Ga0207670_10000886 Ga0207670_1000088617 155
966 3300025936 Ga0207670_10054370 Ga0207670_100543704 155
967 3300025937 Ga0207669_10018860 Ga0207669_100188604 155
968 3300025937 Ga0207669_10649893 Ga0207669_106498932 155
969 3300025938 Ga0207704_10025289 Ga0207704_100252892 155
970 3300025938 Ga0207704_10308701 Ga0207704_103087012 155
971 3300025939 Ga0207665_10124325 Ga0207665_101243253 155
972 3300025939 Ga0207665_10161578 Ga0207665_101615782 155
973 3300025940 Ga0207691_10007048 Ga0207691_100070487 155
974 3300025941 Ga0207711_10099289 Ga0207711_100992892 155
975 3300025941 Ga0207711_10121039 Ga0207711_101210392 155
976 3300025942 Ga0207689_10008107 Ga0207689_100081079 155
977 3300025944 Ga0207661_10008272 Ga0207661_100082723 155
978 3300025945 Ga0207679_10000131 Ga0207679_1000013153 155
979 3300025945 Ga0207679_10309521 Ga0207679_103095212 155
980 3300025945 Ga0207679_10658481 Ga0207679_106584811 155
981 3300025949 Ga0207667_10076624 Ga0207667_100766242 155
982 3300025960 Ga0207651_10001949 Ga0207651_100019492 155
983 3300025960 Ga0207651_10358402 Ga0207651_103584022 155
984 3300025961 Ga0207712_10023188 Ga0207712_100231884 155
985 3300025972 Ga0207668_10000655 Ga0207668_100006559 155
986 3300025972 Ga0207668_10137107 Ga0207668_101371072 155
987 3300025981 Ga0207640_10032911 Ga0207640_100329114 155
988 3300025981 Ga0207640_10370960 Ga0207640_103709601 155
989 3300025986 Ga0207658_10018697 Ga0207658_100186976 155
990 3300025986 Ga0207658_10336803 Ga0207658_103368031 155
991 3300025986 Ga0207658_10476519 Ga0207658_104765192 155
992 3300026023 Ga0207677_10003214 Ga0207677_100032144 155
993 3300026035 Ga0207703_10003628 Ga0207703_100036284 155
994 3300026035 Ga0207703_10045633 Ga0207703_100456334 155
995 3300026035 Ga0207703_10052993 Ga0207703_100529932 155
996 3300026041 Ga0207639_10006126 Ga0207639_100061262 155
997 3300026041 Ga0207639_10039853 Ga0207639_100398532 155
998 3300026067 Ga0207678_10058646 Ga0207678_100586462 155
999 3300026067 Ga0207678_10515794 Ga0207678_105157942 155
1000 3300026075 Ga0207708_10005844 Ga0207708_100058444 155
1001 3300026075 Ga0207708_10010299 Ga0207708_100102995 155
1002 3300026075 Ga0207708_10940798 Ga0207708_109407981 155
1003 3300026078 Ga0207702_10003322 Ga0207702_100033227 155
1004 3300026078 Ga0207702_10269679 Ga0207702_102696792 155
1005 3300026088 Ga0207641_10001577 Ga0207641_1000157716 155
1006 3300026089 Ga0207648_10774664 Ga0207648_107746642 155
1007 3300026095 Ga0207676_10001374 Ga0207676_100013747 155
1008 3300026116 Ga0207674_10036528 Ga0207674_100365282 155
1009 3300026118 Ga0207675_100004272 Ga0207675_1000042724 155
1010 3300026118 Ga0207675_100163461 Ga0207675_1001634612 155
1011 3300026121 Ga0207683_10091160 Ga0207683_100911604 155
1012 3300026142 Ga0207698_10082289 Ga0207698_100822893 155
1013 3300026142 Ga0207698_10262304 Ga0207698_102623042 155
1014 3300027360 Ga0209969_1018346 Ga0209969_10183462 155
1015 3300027378 Ga0209981_1017743 Ga0209981_10177431 155
1016 3300027424 Ga0209984_1009741 Ga0209984_10097412 155
1017 3300027543 Ga0209999_1003958 Ga0209999_10039583 155
1018 3300027617 Ga0210002_1034988 Ga0210002_10349882 155
1019 3300027665 Ga0209983_1002977 Ga0209983_10029774 155
1020 3300027682 Ga0209971_1020904 Ga0209971_10209042 155
1021 3300027695 Ga0209966_1001582 Ga0209966_10015824 155
1022 3300027717 Ga0209998_10001451 Ga0209998_100014512 155
1023 3300027717 Ga0209998_10002203 Ga0209998_100022036 155
1024 3300027907 Ga0207428_10000255 Ga0207428_1000025554 155
1025 3300027907 Ga0207428_10008215 Ga0207428_1000821510 155
1026 3300027907 Ga0207428_10066577 Ga0207428_100665774 155
1027 3300028379 Ga0268266_10441550 Ga0268266_104415502 155
1028 3300028379 Ga0268266_10617949 Ga0268266_106179491 155
1029 3300028380 Ga0268265_10001553 Ga0268265_100015537 155
1030 3300028380 Ga0268265_10599609 Ga0268265_105996092 155
1031 3300028381 Ga0268264_10182973 Ga0268264_101829732 155
1032 3300028381 Ga0268264_10552344 Ga0268264_105523442 155
1033 3300028381 Ga0268264_10560450 Ga0268264_105604502 155
1034 3300034816 Ga0373930_0000252 Ga0373930_0000252_1790_2257 155
1035 3300034817 Ga0373948_0000821 Ga0373948_0000821_110_577 155
1036 3300034818 Ga0373950_0000200 Ga0373950_0000200_2219_2686 155
1037 3300034819 Ga0373958_0000159 Ga0373958_0000159_6152_6619 155
1038 3300034819 Ga0373958_0002164 Ga0373958_0002164_151_618 155
1039 3300034820 Ga0373959_0004470 Ga0373959_0004470_1640_2107 155
1040 3300034957 Ga0373938_0000096 Ga0373938_0000096_11307_11774 155
1041 3300035083 Ga0373926_0032602 Ga0373926_0032602_335_808 155
1042 3300035084 Ga0373928_0000443 Ga0373928_0000443_7393_7860 155
1043 3300035084 Ga0373928_0122920 Ga0373928_0122920_82_555 155
1044 3300035085 Ga0373929_0000756 Ga0373929_0000756_320_787 155
1045 3300035088 Ga0373940_0000018 Ga0373940_0000018_11408_11875 155
1046 3300035089 Ga0373944_0048607 Ga0373944_0048607_624_1097 155
1047 3300035090 Ga0373949_0000862 Ga0373949_0000862_8566_9033 155
1048 3300035090 Ga0373949_0005361 Ga0373949_0005361_50_517 155
1049 3300035091 Ga0373951_0000154 Ga0373951_0000154_20271_20738 155
1050 3300035092 Ga0373952_0000790 Ga0373952_0000790_281_748 155
1051 3300035092 Ga0373952_0001040 Ga0373952_0001040_2422_2916 155
1052 3300035092 Ga0373952_0020743 Ga0373952_0020743_595_1068 155
1053 3300035112 Ga0373932_0000155 Ga0373932_0000155_7193_7660 155
1054 3300035112 Ga0373932_0017117 Ga0373932_0017117_1376_1843 155
1055 3300035113 Ga0373936_0014185 Ga0373936_0014185_1969_2442 155
1056 3300035114 Ga0373939_0003369 Ga0373939_0003369_2930_3397 155
1057 3300035115 Ga0373941_0086549 Ga0373941_0086549_590_1057 155
1058 3300035117 Ga0373953_0005812 Ga0373953_0005812_3450_3923 155
1059 3300035118 Ga0373954_0006933 Ga0373954_0006933_4377_4850 155
1060 3300035119 Ga0373956_0042945 Ga0373956_0042945_182_655 155
1061 3300035120 Ga0373957_0003837 Ga0373957_0003837_2842_3315 155
1062 3300035121 Ga0373960_0000061 Ga0373960_0000061_5089_5556 155
1063 3300035121 Ga0373960_0029818 Ga0373960_0029818_792_1286 155
1064 3300035170 Ga0373943_0266959 Ga0373943_0266959_26_499 155
1065 3300035170 Ga0373943_0273836 Ga0373943_0273836_340_813 155
1066 3300035171 Ga0373946_0015814 Ga0373946_0015814_111_584 155
1067 3300035172 Ga0373955_0000212 Ga0373955_0000212_10151_10624 155
1068 3300035172 Ga0373955_0222778 Ga0373955_0222778_458_931 155
1069 3300035207 Ga0373942_0000537 Ga0373942_0000537_7836_8303 155
1070 3300035241 Ga0373961_0000451 Ga0373961_0000451_34_501 155
1071 3300035241 Ga0373961_0004512 Ga0373961_0004512_1303_1797 155
1072 3300035242 Ga0373962_0001266 Ga0373962_0001266_3369_3836 155
1073 3300035410 Ga0373924_0018323 Ga0373924_0018323_1377_1850 155
1074 3300035691 Ga0373931_0000170 Ga0373931_0000170_14449_14943 155
1075 3300035691 Ga0373931_0035713 Ga0373931_0035713_939_1412 155
1076 3300035691 Ga0373931_0092975 Ga0373931_0092975_448_915 155
1077 3300035692 Ga0373935_0159986 Ga0373935_0159986_859_1332 155
1078 3300035695 Ga0373927_0156923 Ga0373927_0156923_83_556 155
1079 3300035695 Ga0373927_0354286 Ga0373927_0354286_262_735 155
1080 3300035724 Ga0373933_0005386 Ga0373933_0005386_2340_2813 155
1081 3300035725 Ga0373947_0037922 Ga0373947_0037922_1795_2268 155
1082 3300036401 Ga0373937_0008093 Ga0373937_0008093_6071_6544 155
1083 3300037068 Ga0373925_0149804 Ga0373925_0149804_1058_1531 155
1084 3300038996 Ga0242420_016608 Ga0242420_016608_25_492 155
1085 3300042012 Ga0439455_0012465 Ga0439455_0012465_327_794 155
1086 3300042138 Ga0450903_071042 Ga0450903_071042_19_486 155
1087 3300042439 Ga0439464_0010836 Ga0439464_0010836_999_1466 155
1088 3300042876 Ga0451577_0028715 Ga0451577_0028715_1393_1860 155
1089 3300044673 Ga0453683_0200606 Ga0453683_0200606_115_582 155
1090 3300044712 Ga0453684_0545859 Ga0453684_0545859_222_689 155
1091 3300045051 Ga0451576_0096377 Ga0451576_0096377_1119_1586 155
1092 3300046454 Ga0495592_0053248 Ga0495592_0053248_27_500 155
1093 3300046455 Ga0495603_0132259 Ga0495603_0132259_668_1141 155
1094 3300046459 Ga0495629_0088382 Ga0495629_0088382_179_652 155
1095 3300046459 Ga0495629_0172031 Ga0495629_0172031_629_1102 155
1096 3300046461 Ga0495641_0090630 Ga0495641_0090630_760_1233 155
1097 3300046462 Ga0495651_0084734 Ga0495651_0084734_1254_1727 155
1098 3300046462 Ga0495651_0202887 Ga0495651_0202887_672_1145 155
1099 3300046463 Ga0495653_0001102 Ga0495653_0001102_16699_17172 155
1100 3300046463 Ga0495653_0385293 Ga0495653_0385293_303_776 155
1101 3300046472 Ga0495580_0294642 Ga0495580_0294642_456_929 155
1102 3300046473 Ga0495582_0149102 Ga0495582_0149102_392_865 155
1103 3300046475 Ga0495639_0156531 Ga0495639_0156531_229_702 155
1104 3300046476 Ga0495662_0013240 Ga0495662_0013240_880_1353 155
1105 3300046476 Ga0495662_0148524 Ga0495662_0148524_208_681 155
1106 3300046491 Ga0495584_0195232 Ga0495584_0195232_177_671 155
1107 3300046499 Ga0495594_0090706 Ga0495594_0090706_134_607 155
1108 3300046501 Ga0495607_0351159 Ga0495607_0351159_21_494 155
1109 3300046514 Ga0495618_0001557 Ga0495618_0001557_4358_4831 155
1110 3300046514 Ga0495618_0157467 Ga0495618_0157467_780_1253 155
1111 3300046516 Ga0495628_0466872 Ga0495628_0466872_232_705 155
1112 3300046517 Ga0495630_0006498 Ga0495630_0006498_2503_2976 155
1113 3300046517 Ga0495630_0068369 Ga0495630_0068369_1252_1725 155
1114 3300046526 Ga0495666_0090252 Ga0495666_0090252_201_674 155
1115 3300046529 Ga0495652_0013229 Ga0495652_0013229_2073_2546 155
1116 3300046529 Ga0495652_0360747 Ga0495652_0360747_14_487 155
1117 3300046531 Ga0495665_0090895 Ga0495665_0090895_1043_1516 155
1118 3300046533 Ga0495640_0005554 Ga0495640_0005554_5672_6145 155
1119 3300046533 Ga0495640_0049550 Ga0495640_0049550_1177_1650 155
1120 3300046535 Ga0495586_0099064 Ga0495586_0099064_189_662 155
1121 3300046536 Ga0495587_0002605 Ga0495587_0002605_6733_7206 155
1122 3300046543 Ga0495645_0211428 Ga0495645_0211428_243_716 155
1123 3300046543 Ga0495645_0356329 Ga0495645_0356329_242_715 155
1124 3300046559 Ga0495667_0008926 Ga0495667_0008926_6042_6515 155
1125 3300046642 Ga0495634_0093995 Ga0495634_0093995_1279_1752 155
1126 3300046642 Ga0495634_0274851 Ga0495634_0274851_97_570 155
1127 3300046663 Ga0495635_0003939 Ga0495635_0003939_6189_6662 155
1128 3300046663 Ga0495635_0071566 Ga0495635_0071566_1784_2257 155
1129 3300046674 Ga0495588_0010531 Ga0495588_0010531_276_749 155
1130 3300046675 Ga0495657_0001814 Ga0495657_0001814_5435_5908 155
1131 3300046675 Ga0495657_0081722 Ga0495657_0081722_265_738 155
1132 3300046678 Ga0495599_0003284 Ga0495599_0003284_5166_5639 155
1133 3300046679 Ga0495623_0002800 Ga0495623_0002800_4792_5265 155
1134 3300046680 Ga0495646_0003379 Ga0495646_0003379_4638_5111 155
1135 3300046680 Ga0495646_0447978 Ga0495646_0447978_37_510 155
1136 3300046681 Ga0495647_0010507 Ga0495647_0010507_1486_1959 155
1137 3300046681 Ga0495647_0267295 Ga0495647_0267295_154_627 155
1138 3300046689 Ga0495613_0080826 Ga0495613_0080826_725_1198 155
1139 3300046689 Ga0495613_0166761 Ga0495613_0166761_192_665 155
1140 3300046689 Ga0495613_0179897 Ga0495613_0179897_310_783 155
1141 3300046690 Ga0495624_0039247 Ga0495624_0039247_905_1378 155
1142 3300047315 Ga0495581_0050717 Ga0495581_0050717_974_1447 155
1143 3300047317 Ga0495604_0012054 Ga0495604_0012054_4215_4688 155
1144 3300047317 Ga0495604_0014609 Ga0495604_0014609_27_500 155
1145 3300047319 Ga0495674_0007467 Ga0495674_0007467_6508_6981 155
1146 3300047319 Ga0495674_0048018 Ga0495674_0048018_242_715 155
1147 3300047321 Ga0495676_0213279 Ga0495676_0213279_845_1318 155
1148 3300047322 Ga0495680_0004443 Ga0495680_0004443_10552_11025 155
1149 3300047322 Ga0495680_0041923 Ga0495680_0041923_946_1419 155
1150 3300047444 Ga0495675_0174884 Ga0495675_0174884_470_943 155
1151 3300047471 Ga0495684_0038948 Ga0495684_0038948_2934_3407 155
1152 3300048088 Ga0495602_0008317 Ga0495602_0008317_8965_9438 155
1153 3300048089 Ga0495614_0190134 Ga0495614_0190134_134_607 155
1154 3300048903 Ga0496100_0012706 Ga0496100_0012706_4233_4727 155
1155 3300048904 Ga0496101_0000546 Ga0496101_0000546_22262_22756 155
1156 3300048904 Ga0496101_0000799 Ga0496101_0000799_14000_14473 155
1157 3300048905 Ga0496102_0011785 Ga0496102_0011785_6938_7411 155
1158 3300048905 Ga0496102_0035226 Ga0496102_0035226_1990_2463 155
1159 3300048905 Ga0496102_0337988 Ga0496102_0337988_816_1283 155
1160 3300048906 Ga0496103_0060970 Ga0496103_0060970_237_710 155
1161 3300048906 Ga0496103_0268031 Ga0496103_0268031_189_683 155
1162 3300048907 Ga0496104_0024737 Ga0496104_0024737_787_1260 155
1163 3300048908 Ga0496105_0367421 Ga0496105_0367421_151_618 155
1164 3300048909 Ga0496106_0000596 Ga0496106_0000596_16907_17401 155
1165 3300048909 Ga0496106_0006785 Ga0496106_0006785_3889_4362 155
1166 3300048909 Ga0496106_0015745 Ga0496106_0015745_186_659 155
1167 3300048909 Ga0496106_0077447 Ga0496106_0077447_94_561 155
1168 3300048909 Ga0496106_0156862 Ga0496106_0156862_975_1442 155
1169 3300048910 Ga0496107_0001473 Ga0496107_0001473_7377_7871 155
1170 3300048910 Ga0496107_0037537 Ga0496107_0037537_293_766 155
1171 3300048910 Ga0496107_0056492 Ga0496107_0056492_640_1107 155
1172 3300048912 Ga0496109_0001819 Ga0496109_0001819_12441_12908 155
1173 3300048912 Ga0496109_0049079 Ga0496109_0049079_2081_2548 155
1174 3300048912 Ga0496109_0229451 Ga0496109_0229451_93_566 155
1175 3300048913 Ga0496110_0038079 Ga0496110_0038079_669_1136 155
1176 3300048913 Ga0496110_0073928 Ga0496110_0073928_1163_1636 155
1177 3300048914 Ga0496111_0041524 Ga0496111_0041524_544_1017 155
1178 3300048914 Ga0496111_0314801 Ga0496111_0314801_98_565 155
1179 3300048915 Ga0496112_0008772 Ga0496112_0008772_2386_2853 155
1180 3300048915 Ga0496112_0152055 Ga0496112_0152055_1538_2011 155
1181 3300048916 Ga0496113_0015822 Ga0496113_0015822_2732_3199 155
1182 3300048916 Ga0496113_0174348 Ga0496113_0174348_144_617 155
1183 3300048917 Ga0496114_0016139 Ga0496114_0016139_3971_4444 155
1184 3300048917 Ga0496114_0478593 Ga0496114_0478593_616_1083 155
1185 3300048918 Ga0496115_0082098 Ga0496115_0082098_751_1224 155
1186 3300048918 Ga0496115_1079594 Ga0496115_1079594_127_594 155
1187 3300049570 Ga0501033_0523432 Ga0501033_0523432_120_632 155
1188 3300049574 Ga0501038_0134609 Ga0501038_0134609_812_1324 155
1189 3300049585 Ga0501069_0610966 Ga0501069_0610966_132_644 155
1190 3300049589 Ga0501073_0018173 Ga0501073_0018173_1742_2254 155
1191 3300049593 Ga0501077_0060206 Ga0501077_0060206_673_1140 155
1192 3300049743 Ga0501081_0236596 Ga0501081_0236596_596_1063 155
1193 3300049744 Ga0501083_0024300 Ga0501083_0024300_70_564 155
1194 3300050494 nmdc:mga06z11_29428_c2 nmdc:mga06z11_29428_c2_195_662 155
1195 3300050507 nmdc:mga05p37_741212_c1 nmdc:mga05p37_741212_c1_413_883 155
1196 3300050511 nmdc:mga08y16_11839_c1 nmdc:mga08y16_11839_c1_1365_1832 155
1197 3300050511 nmdc:mga08y16_520239_c1 nmdc:mga08y16_520239_c1_368_844 155
1198 3300050511 nmdc:mga08y16_8011_c1 nmdc:mga08y16_8011_c1_10522_10989 155
1199 3300050512 nmdc:mga0n895_338139_c1 nmdc:mga0n895_338139_c1_360_827 155
1200 3300050512 nmdc:mga0n895_671956_c1 nmdc:mga0n895_671956_c1_332_805 155
1201 3300050513 nmdc:mga0rr50_850967_c1 nmdc:mga0rr50_850967_c1_207_674 155
1202 3300050514 nmdc:mga08x19_1247946_c1 nmdc:mga08x19_1247946_c1_27_494 155
1203 3300050514 nmdc:mga08x19_335073_c1 nmdc:mga08x19_335073_c1_560_1027 155
1204 3300050515 nmdc:mga0a205_129229_c1 nmdc:mga0a205_129229_c1_1749_2216 155
1205 3300050515 nmdc:mga0a205_166376_c1 nmdc:mga0a205_166376_c1_1380_1847 155
1206 3300053077 Ga0495601_0002167 Ga0495601_0002167_214_687 155
1207 3300053077 Ga0495601_0046952 Ga0495601_0046952_301_774 155
1208 3300053078 Ga0495612_0003368 Ga0495612_0003368_5641_6114 155
1209 3300053078 Ga0495612_0010382 Ga0495612_0010382_3125_3598 155
1210 3300053084 Ga0495595_0000307 Ga0495595_0000307_5672_6145 155
1211 3300053084 Ga0495595_0009648 Ga0495595_0009648_2594_3067 155
1212 3300053085 Ga0495619_0000059 Ga0495619_0000059_10653_11126 155
1213 3300053085 Ga0495619_0001730 Ga0495619_0001730_13765_14238 155
1214 3300053093 Ga0500651_0046995 Ga0500651_0046995_562_1053 155
1215 3300053125 Ga0500618_021017 Ga0500618_021017_48_521 155
1216 3300060353 Ga0501082_0089740 Ga0501082_0089740_1586_2098 155

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01047

MarR

MarR family

53

110

0.99

PF12802

MarR_2

MarR family

51

110

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
2nnn-assembly3.cif.gz_E crystal structure of probable transcriptional regulator from pseudomonas aeruginosa 0.9621 23 155
2nnn-assembly5.cif.gz_J crystal structure of probable transcriptional regulator from pseudomonas aeruginosa 0.9589 23 155
4ija-assembly1.cif.gz_B structure of s. aureus methicillin resistance factor mecr2 0.9578 53 113
2nnn-assembly4.cif.gz_G crystal structure of probable transcriptional regulator from pseudomonas aeruginosa 0.9577 23 155
2nnn-assembly3.cif.gz_E crystal structure of probable transcriptional regulator from pseudomonas aeruginosa 0.9551 23 155
ID Description Score Start End Superfamily
4ijaB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9591 53 114 1.10.10.10
2nnnF00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9489 23 155 1.10.10.10
af_Q57824_147_206_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9488 51 112 1.10.10.10
4ijaB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9425 53 114 1.10.10.10
2nnnF00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9421 23 155 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A2W5QTT3-F1-model_v4 MarR family transcriptional regulator 0.9851 20 155 GO:0003700
GO:0006950
AF-A0A2U0THW1-F1-model_v4 deleted 0.9789 32 154
AF-A0A7W6RZR6-F1-model_v4 DNA-binding MarR family transcriptional regulator 0.9777 28 155 GO:0003677
GO:0003700
GO:0006950
AF-A0A839ZF82-F1-model_v4 DNA-binding MarR family transcriptional regulator 0.9772 22 155 GO:0003677
GO:0003700
GO:0006950
AF-A0A4V2EAP2-F1-model_v4 MarR family transcriptional regulator 0.9725 22 154 GO:0003700
GO:0006950

Feature Viewer

pLDDT pTM Quality
88.1 0.78 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map