F491682

General Info

Members Datasets Scaffolds Average Seq Length
1208 514 1118 457

Family's Representative Sequence

Representative Sequence 3300009551|Ga0105238_10000924|Ga0105238_1000092418
Length 513
Sequence MAKAKTAYVCTDCGAEHNKWQGQCIECNGWNTLSEFVVQPAKAAVAGAGARRGYAGEAAGAPKVTALTEVALTAESRTKTGIGELDRVLGGGLVDGSVVLIGGDPGIGKSTLLLQMLGTLGAVLPSVYVTGEESLAQVAGRAQRLDLPLAPLRALAETCIERILEQALATRPRVLVIDSIQTIWTETLTAAPGSVSQVRESAARLTRFAKETGTSVFLVGHVTKEGGIAGPRVLEHMVDAVLYFEGESGSRFRVLRAFKNRFGAVNELGVFAMSEKGLREVPNPSAIFLSTHTGPTSGSAVMVTREGTRPLLVEVQALVDQSSLGNPRRVALGMEQNRLAMLLAVLHRHGGLAVYDQDVFVNVVGGIRVQETAADLPVLLAVLSSFRDRPLPEKTVAFGEVGLSGEIRPVPNGEERLKEAATHGFRSHRAQGQCAEENAYRRDGSDRRGSSWRRHRAGDGLIDVGAWAERGSRSGCGSASVRIPLQQGVAQLCFLTPLPRFPPPSQPWRCSKR

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2524614729 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
3 2537561836 Rhodanobacter spathiphylli B39 Isolate Unclassified
4 2547132130 Stenotrophomonas maltophilia RR-10 Isolate Unclassified
5 2571042365 Lysobacter oryzae DSM 21044 Isolate Rhizosphere
6 2576861471 Stenotrophomonas rhizophila DSM 14405 Isolate Rhizosphere
7 2593339238 Luteibacter sp. UNCMF366Tsu5.1 Isolate Unclassified
8 2593339239 Luteibacter sp. UNCMF331Sha3.1 Isolate Unclassified
9 2627854209 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
10 2643221559 Lysobacter sp. Root559 Isolate Unclassified
11 2643221562 Rhodanobacter sp. Root561 Isolate Unclassified
12 2643221573 Lysobacter sp. Root604 Isolate Unclassified
13 2643221577 Rhodanobacter sp. Root627 Isolate Unclassified
14 2643221579 Pseudoxanthomonas sp. Root630 Isolate Unclassified
15 2643221581 Pseudoxanthomonas sp. Root65 Isolate Unclassified
16 2643221586 Lysobacter sp. Root667 Isolate Unclassified
17 2643221593 Lysobacter sp. Root690 Isolate Unclassified
18 2643221612 Lysobacter sp. Root76 Isolate Unclassified
19 2643221685 Rhodanobacter sp. Root480 Isolate Unclassified
20 2643221695 Lysobacter sp. Root494 Isolate Unclassified
21 2643221720 Lysobacter sp. Root916 Isolate Unclassified
22 2643221727 Lysobacter sp. Root96 Isolate Unclassified
23 2643221728 Lysobacter sp. Root983 Isolate Unclassified
24 2687453130 Dyella thiooxydans ATSB10 Isolate Unclassified
25 2718218334 Luteibacter rhizovicinus LJ96 Isolate Rhizosphere
26 2734482264 Dyella sp. AD052 Isolate Unclassified
27 2738543009 Luteibacter sp. OK325 Isolate Unclassified
28 2739367700 Dyella sp. YR388 Isolate Unclassified
29 2747842428 Stenotrophomonas sp. WCS2014-113 Isolate Unclassified
30 2747842501 Xanthomonas sp. WCS2014-23 Isolate Unclassified
31 2765235840 Stenotrophomonas maltophilia AA1 Isolate Unclassified
32 2816332141 Stenotrophomonas muris 1190 (v2) (version 2) Isolate Unclassified
33 2818991440 Luteibacter yeojuensis 583 Isolate Unclassified
34 2818991457 Xanthomonas translucens 569 Isolate Unclassified
35 2842391507 Stenotrophomonas maltophilia SEMIA 4027 Isolate Nodule
36 2842757796 Stenotrophomonas sp. R-72406 Isolate Unclassified
37 2842780639 Pseudoxanthomonas sp. R-71986 Isolate Unclassified
38 2842914999 Luteibacter sp. R-72151 Isolate Unclassified
39 2842918807 Luteibacter sp. R-73110 Isolate Unclassified
40 2848694841 Nostoc sp. RF31YmG Isolate Unclassified
41 2852649853 Stenotrophomonas sp. JAI102 Isolate Rhizosphere
42 2852684882 Xanthomonas sp. JAI131 Isolate Rhizosphere
43 2855730933 Achromobacter sp. HZ28 Isolate Nodule
44 2855767633 Achromobacter sp. HZ34 Isolate Nodule
45 2857442823 Stenotrophomonas sp. R-74235 Isolate Unclassified
46 2874220319 Stenotrophomonas maltophilia PS5 Isolate Unclassified
47 2884338543 Luteibacter pinisoli MAH-14 Isolate Rhizosphere
48 2884411467 Dyella sp. AD56 Isolate Rhizosphere
49 2887375801 Parapusillimonas sp. SGNA-6 Isolate Rhizosphere
50 2888373701 Serratia rhizosphaerae KUDC3025 Isolate Rhizosphere
51 2894414249 Luteimonas sp. LNNU 24178 Isolate Rhizosphere
52 2895395659 Rhodanobacter sp. T12-5 Isolate Unclassified
53 2895498888 Pseudoxanthomonas sp. SGD-10 Isolate Rhizosphere
54 2895511927 Pseudoxanthomonas sp. SGD-5-1 Isolate Rhizosphere
55 2895522137 Pseudoxanthomonas sp. SGNA-20 Isolate Rhizosphere
56 2895525241 Pseudoxanthomonas sp. SGT-18 Isolate Rhizosphere
57 2904463128 Luteibacter yeojuensis 3191 Isolate Unclassified
58 2919085039 Luteibacter sp. 1214 Isolate Unclassified
59 2919089067 Stenotrophomonas sp. 1337 Isolate Rhizosphere
60 2919130084 Xanthomonas sp. 1678 Isolate Rhizosphere
61 2919134579 Stenotrophomonas geniculata 1733 Isolate Rhizosphere
62 2919404418 Luteibacter sp. 3190 Isolate Unclassified
63 2919513703 Luteimonas sp. 3794 Isolate Unclassified
64 2919675420 Luteimonas terrae 4099 Isolate Unclassified
65 2923516293 Pseudoxanthomonas mexicana SLBN-89 Isolate Rhizosphere
66 2928496128 Stenotrophomonas indicatrix 1163 Isolate Unclassified
67 2928963466 Dyella japonica 1073 Isolate Unclassified
68 2929195423 Xanthomonas sp. R-73098 Hybrid assembly Isolate Unclassified
69 2931380184 Stenotrophomonas sp. DR822 Isolate Rhizosphere
70 2937610967 Stenotrophomonas maltophilia EP20 Isolate Unclassified
71 2939589442 Stenotrophomonas rhizophila 716 Isolate Rhizosphere
72 2939611941 Rhodanobacter soli 1757 Isolate Rhizosphere
73 2939622612 Stenotrophomonas sp. 2619 Isolate Rhizosphere
74 2939626828 Stenotrophomonas sp. 2694 Isolate Rhizosphere
75 2941471342 Luteibacter sp. 621 Isolate Unclassified
76 2941475908 Stenotrophomonas rhizophila 2680 Isolate Rhizosphere
77 2941489479 Lysobacter enzymogenes 2943 Isolate Rhizosphere
78 2953994433 Luteibacter sp. W1I16 Isolate Rhizosphere
79 2961047084 Stenotrophomonas maltophilia EP5 Isolate Unclassified
80 2961064222 Stenotrophomonas maltophilia EP13 Isolate Unclassified
81 2974307012 Stenotrophomonas sp. SORGH_AS_0282 Isolate Unclassified
82 2977247770 Stenotrophomonas rhizophila SORGH_AS 457 Isolate Unclassified
83 2984514374 Stenotrophomonas sp. SORGH_AS282 Isolate Aerial Root
84 2987605356 Stenotrophomonas sp. ATCM1_4 Isolate Unclassified
85 2995948881 Lysobacter enzymogenes B25 Isolate Unclassified
86 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
87 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
88 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
89 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
90 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
91 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
92 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
93 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
94 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
95 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
96 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
97 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
98 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
99 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
100 3300003503 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM Metagenome Rhizosphere
101 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
102 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
103 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
104 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
105 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
106 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
107 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
108 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
109 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
110 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
111 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
112 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
113 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
114 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
115 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
116 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
117 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
118 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
119 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
120 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
121 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
122 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
123 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
124 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
125 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
126 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
127 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
128 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
129 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
130 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
131 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
132 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
133 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
134 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
135 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
136 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
137 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
138 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
139 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
140 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
141 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
142 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
143 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
144 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
145 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
146 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
147 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
148 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
149 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
150 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
151 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
152 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
153 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
154 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
155 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
156 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
157 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
158 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
159 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
160 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
161 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
162 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
163 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
164 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
165 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
166 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
167 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
168 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
169 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
170 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
171 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
172 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
173 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
174 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
175 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
176 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
177 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
178 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
179 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
180 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
181 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
182 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
183 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
184 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
185 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
186 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
187 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
188 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
189 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
190 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
191 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
192 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
193 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
194 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
195 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
196 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
197 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
198 3300009979 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG Metagenome Rhizosphere
199 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
200 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
201 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
202 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
203 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
204 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
205 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
206 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
207 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
208 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
209 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
210 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
211 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
212 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
213 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
214 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
215 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
216 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
217 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
218 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
219 3300015689 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 Metagenome Rhizosphere
220 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
221 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
222 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
223 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
224 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
225 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
226 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
227 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
228 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
229 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
230 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
231 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
232 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
233 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
234 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
235 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
236 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
237 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
238 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
239 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
240 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
241 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
242 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
243 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
244 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
245 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
246 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
247 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
248 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
249 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
250 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
251 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
252 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
253 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
254 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
255 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
256 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
257 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
258 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
259 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
260 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
261 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
262 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
263 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
264 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
265 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
266 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
267 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
268 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
269 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
270 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
271 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
272 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
273 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
274 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
275 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
276 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
277 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
278 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
279 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
280 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
281 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
282 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
283 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
284 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
285 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
286 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
287 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
288 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
289 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
290 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
291 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
292 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
293 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
294 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
295 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
296 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
297 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
298 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
299 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
300 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
301 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
302 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
303 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
304 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
305 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
306 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
307 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
308 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
309 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
310 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
311 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
312 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
313 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
314 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
315 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
316 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
317 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
318 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
319 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
320 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
321 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
322 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
323 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
324 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
325 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
326 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
327 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
328 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
329 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
330 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
331 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
332 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
333 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
334 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
335 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
336 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
337 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
338 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
339 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
340 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
341 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
342 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
343 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
344 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
345 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
346 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
347 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
348 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
349 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
350 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
351 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
352 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
353 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
354 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
355 3300039145 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 Metagenome Unclassified
356 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
357 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
358 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
359 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
360 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
361 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
362 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
363 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
364 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
365 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
366 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
367 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
368 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
369 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
370 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
371 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
372 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
373 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
374 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
375 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
376 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
377 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
378 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
379 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
380 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
381 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
382 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
383 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
384 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
385 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
386 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
387 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
388 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
389 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
390 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
391 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
392 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
393 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
394 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
395 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
396 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
397 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
398 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
399 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
400 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
401 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
402 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
403 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
404 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
405 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
406 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
407 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
408 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
409 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
410 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
411 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
412 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
413 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
414 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
415 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
416 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
417 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
418 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
419 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
420 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
421 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
422 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
423 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
424 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
425 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
426 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
427 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
428 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
429 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
430 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
431 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
432 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
433 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
434 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
435 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
436 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
437 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
438 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
439 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
440 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
441 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
442 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
443 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
444 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
445 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
446 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
447 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
448 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
449 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
450 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
451 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
452 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
453 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
454 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
455 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
456 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
457 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
458 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
459 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
460 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
461 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
462 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
463 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
464 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
465 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
466 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
467 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
468 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
469 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
470 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
471 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
472 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
473 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
474 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
475 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
476 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
477 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
478 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
479 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
480 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
481 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
482 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
483 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
484 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
485 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
486 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
487 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
488 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
489 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
490 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
491 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
492 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
493 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
494 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
495 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
496 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
497 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
498 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
499 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
500 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
501 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
502 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
503 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
504 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
505 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
506 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
507 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
508 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
509 8002392321 Alcaligenes faecalis Mc250 Isolate Rhizosphere
510 8002869464 Pseudoxanthomonas helianthi 110414 Isolate Unclassified
511 8003014200 Lysobacter changpingensis Cm-3-T8 Isolate Rhizosphere
512 8021622325 Xanthomonas sp. LMG12462 Isolate Rhizosphere
513 8021626552 Xanthomonas sp. LMG12460 Isolate Rhizosphere
514 8021648035 Xanthomonas sp. LMG 12461 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.56
Metatranscriptomes 0.99
Isolates 7.45

Biome Distribution

Category Percentage (%)
Aerial Root 0.08
Bulb 0
Endosphere 15.89
Nodule 0.25
Rhizoplane 2.24
Rhizosphere 66.89
Stem 0
Stem Tuber 0
Unclassified 14.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_3055844 2162886007 Bacteria 22848
2 JGI24741J21665_1002156 3300001915 Bacteria 5235
3 JGI24741J21665_1009817 3300001915 Bacteria 1740
4 JGI24740J21852_10002197 3300001979 Bacteria 8920
5 JGI24740J21852_10005668 3300001979 Bacteria 5257
6 JGI24739J22299_10002332 3300001989 Bacteria 7312
7 JGI24739J22299_10013417 3300001989 Bacteria 2993
8 JGI24737J22298_10000899 3300001990 Bacteria 10568
9 JGI24737J22298_10016466 3300001990 Bacteria 2386
10 JGI25156J39149_1007693 3300002705 Bacteria 2796
11 JGI25162J39368_1000226 3300002737 Bacteria 57732
12 JGI25162J39368_1000686 3300002737 Bacteria 23602
13 JGI25162J39368_1003175 3300002737 Bacteria 5127
14 JGI25162J39368_1003182 3300002737 Bacteria 5116
15 JGI25162J39368_1005076 3300002737 Bacteria 2744
16 JGI25157J39369_1001011 3300002741 Bacteria 13050
17 JGI25157J39369_1001369 3300002741 Bacteria 9520
18 JGI25157J39369_1001673 3300002741 Bacteria 7535
19 JGI25163J39215_1001647 3300002771 Bacteria 3305
20 JGI25164J39214_1000045 3300002772 Bacteria 125909
21 JGI25164J39214_1000435 3300002772 Bacteria 22777
22 JGI25164J39214_1001511 3300002772 Bacteria 5227
23 JGI25164J39214_1001528 3300002772 Bacteria 5131
24 JGI25152J39213_1000231 3300002773 Bacteria 37495
25 JGI25150J39212_1000095 3300002774 Bacteria 50881
26 JGI25151J46595_10000183 3300003187 Bacteria 78518
27 JGI25151J46595_10000195 3300003187 Bacteria 74795
28 JGI25151J46595_10000477 3300003187 Bacteria 37879
29 JGI25165J46597_1000072 3300003214 Bacteria 192184
30 JGI25165J46597_1000260 3300003214 Bacteria 70453
31 JGI25165J46597_1002761 3300003214 Bacteria 5131
32 JGI25153J46596_10000291 3300003215 Bacteria 37879
33 JGI26141J51220_1001122 3300003503 Bacteria 1601
34 Ga0006562J51391_1014504 3300003578 Bacteria 8150
35 Ga0006562J51391_1014508 3300003578 Bacteria 4580
36 Ga0006562J51391_1103326 3300003578 Bacteria 3630
37 Ga0055533_1000545 3300003756 Bacteria 13392
38 Ga0055525_1000027 3300003759 Bacteria 340506
39 Ga0055527_1000293 3300003760 Bacteria 28864
40 Ga0055527_1000294 3300003760 Bacteria 28742
41 Ga0055527_1000694 3300003760 Bacteria 9781
42 Ga0055535_1000623 3300003761 Bacteria 28693
43 Ga0055535_1001746 3300003761 Bacteria 9711
44 Ga0055535_1001841 3300003761 Bacteria 9085
45 Ga0055535_1002043 3300003761 Bacteria 8164
46 Ga0055535_1002731 3300003761 Bacteria 5687
47 Ga0055542_1000275 3300003762 Bacteria 57732
48 Ga0055542_1000329 3300003762 Bacteria 50369
49 Ga0055542_1000649 3300003762 Bacteria 28693
50 Ga0055542_1000744 3300003762 Bacteria 25103
51 Ga0055542_1001536 3300003762 Bacteria 11068
52 Ga0055542_1001924 3300003762 Bacteria 8164
53 Ga0055529_1000233 3300003763 Bacteria 70453
54 Ga0055529_1000684 3300003763 Bacteria 23266
55 Ga0055529_1001153 3300003763 Bacteria 11068
56 Ga0055529_1001341 3300003763 Bacteria 8164
57 Ga0055526_1000157 3300003771 Bacteria 60697
58 Ga0055537_1000169 3300003773 Bacteria 48599
59 Ga0055524_1000288 3300003775 Bacteria 48798
60 Ga0055536_1005549 3300003781 Bacteria 6135
61 Ga0055534_1000110 3300003784 Bacteria 60793
62 Ga0055534_1000393 3300003784 Bacteria 27221
63 Ga0055528_1000131 3300003790 Bacteria 60697
64 Ga0055528_1000946 3300003790 Bacteria 19321
65 Ga0055530_10002947 3300003791 Bacteria 10283
66 Ga0055530_10005690 3300003791 Bacteria 5821
67 Ga0055540_1016278 3300003792 Bacteria 2123
68 Ga0055531_10001282 3300003794 Bacteria 18939
69 Ga0055531_10011812 3300003794 Bacteria 4169
70 Ga0055531_10017163 3300003794 Bacteria 3071
71 Ga0058692_1000002 3300003856 Bacteria 508401
72 Ga0058692_1000017 3300003856 Bacteria 274459
73 Ga0065165_1000587 3300005262 Bacteria 53507
74 Ga0065165_1005214 3300005262 Bacteria 7473
75 Ga0065714_10014766 3300005288 Bacteria 2918
76 Ga0065704_10000275 3300005289 Bacteria 50973
77 Ga0065704_10002244 3300005289 Bacteria 9786
78 Ga0065715_10008318 3300005293 Bacteria 3495
79 Ga0070658_10004423 3300005327 Bacteria 11448
80 Ga0070683_100009388 3300005329 Bacteria 8365
81 Ga0070683_100030128 3300005329 Bacteria 4921
82 Ga0070670_100005186 3300005331 Bacteria 10969
83 Ga0070670_100015079 3300005331 Bacteria 6633
84 Ga0070670_100057852 3300005331 Bacteria 3327
85 Ga0068869_100011621 3300005334 Bacteria 5782
86 Ga0068869_100056293 3300005334 Bacteria 2868
87 Ga0070666_10000005 3300005335 Bacteria 343092
88 Ga0070666_10000109 3300005335 Bacteria 56796
89 Ga0070666_10091149 3300005335 Bacteria 2094
90 Ga0070680_100000582 3300005336 Bacteria 25199
91 Ga0070680_100011170 3300005336 Bacteria 6946
92 Ga0070680_100019943 3300005336 Bacteria 5315
93 Ga0070682_100007842 3300005337 Bacteria 6009
94 Ga0068868_100096767 3300005338 Bacteria 2385
95 Ga0070660_100022544 3300005339 Bacteria 4658
96 Ga0070660_100092497 3300005339 Bacteria 2387
97 Ga0070660_100093919 3300005339 Bacteria 2369
98 Ga0070691_10004017 3300005341 Bacteria 6661
99 Ga0070661_100025439 3300005344 Bacteria 4254
100 Ga0070661_100066014 3300005344 Bacteria 2659
101 Ga0070661_100224930 3300005344 Bacteria 1440
102 Ga0070692_10013541 3300005345 Bacteria 3806
103 Ga0070668_100015112 3300005347 Bacteria 5768
104 Ga0070668_100055546 3300005347 Bacteria 3057
105 Ga0070671_100022064 3300005355 Bacteria 5201
106 Ga0070673_100035809 3300005364 Bacteria 3767
107 Ga0070659_100004293 3300005366 Bacteria 10174
108 Ga0070659_100015194 3300005366 Bacteria 5761
109 Ga0070659_100040216 3300005366 Bacteria 3653
110 Ga0070659_100121716 3300005366 Bacteria 2114
111 Ga0070667_100000005 3300005367 Bacteria 347268
112 Ga0070667_100011088 3300005367 Bacteria 7456
113 Ga0070714_100000030 3300005435 Bacteria 136610
114 Ga0070714_100022547 3300005435 Bacteria 5164
115 Ga0070663_100001614 3300005455 Bacteria 12448
116 Ga0070663_100021593 3300005455 Bacteria 4285
117 Ga0070663_100030288 3300005455 Bacteria 3706
118 Ga0070663_100063269 3300005455 Bacteria 2671
119 Ga0070678_100022542 3300005456 Bacteria 4176
120 Ga0070662_100029847 3300005457 Bacteria 3809
121 Ga0070662_100176421 3300005457 Bacteria 1682
122 Ga0070681_10000012 3300005458 Bacteria 137191
123 Ga0070681_10000151 3300005458 Bacteria 52829
124 Ga0070681_10015872 3300005458 Bacteria 7509
125 Ga0070681_10021334 3300005458 Bacteria 6494
126 Ga0070681_10049132 3300005458 Bacteria 4214
127 Ga0070681_10215218 3300005458 Bacteria 1838
128 Ga0068867_100047162 3300005459 Bacteria 3167
129 Ga0070685_10020643 3300005466 Bacteria 3566
130 Ga0070706_100137400 3300005467 Bacteria 2281
131 Ga0070707_100044426 3300005468 Bacteria 4254
132 Ga0070698_100003276 3300005471 Bacteria 17787
133 Ga0070698_100007458 3300005471 Bacteria 11830
134 Ga0070699_100006355 3300005518 Bacteria 10302
135 Ga0070699_100007511 3300005518 Bacteria 9480
136 Ga0070679_100000250 3300005530 Bacteria 45069
137 Ga0070679_100002170 3300005530 Bacteria 17707
138 Ga0070679_100017294 3300005530 Bacteria 6978
139 Ga0070679_100018115 3300005530 Bacteria 6827
140 Ga0070679_100020190 3300005530 Bacteria 6494
141 Ga0070679_100084666 3300005530 Bacteria 3159
142 Ga0070679_100091324 3300005530 Bacteria 3033
143 Ga0070679_100190477 3300005530 Bacteria 2020
144 Ga0070684_100043290 3300005535 Bacteria 3887
145 Ga0068853_100007278 3300005539 Bacteria 8861
146 Ga0068853_100037423 3300005539 Bacteria 4128
147 Ga0068853_100042692 3300005539 Bacteria 3878
148 Ga0068853_100211371 3300005539 Bacteria 1768
149 Ga0070672_100020456 3300005543 Bacteria 4827
150 Ga0070672_100028699 3300005543 Bacteria 4164
151 Ga0070672_100133477 3300005543 Bacteria 2043
152 Ga0070696_100016563 3300005546 Bacteria 4968
153 Ga0070696_100087642 3300005546 Bacteria 2211
154 Ga0070693_100004804 3300005547 Bacteria 6436
155 Ga0070693_100011978 3300005547 Bacteria 4379
156 Ga0070693_100022508 3300005547 Bacteria 3353
157 Ga0070665_100000057 3300005548 Bacteria 237271
158 Ga0070665_100002080 3300005548 Bacteria 22457
159 Ga0070665_100007314 3300005548 Bacteria 11232
160 Ga0070665_100055961 3300005548 Bacteria 3955
161 Ga0070665_100081154 3300005548 Bacteria 3249
162 Ga0070665_100094147 3300005548 Bacteria 3001
163 Ga0068855_100006636 3300005563 Bacteria 14054
164 Ga0068855_100009999 3300005563 Bacteria 11430
165 Ga0068855_100011362 3300005563 Bacteria 10749
166 Ga0068855_100048818 3300005563 Bacteria 4994
167 Ga0068855_100051540 3300005563 Bacteria 4848
168 Ga0068855_100175469 3300005563 Bacteria 2425
169 Ga0070664_100142482 3300005564 Bacteria 2111
170 Ga0068857_100018935 3300005577 Bacteria 6040
171 Ga0068857_100027344 3300005577 Bacteria 5032
172 Ga0068854_100007062 3300005578 Bacteria 7168
173 Ga0068854_100018464 3300005578 Bacteria 4682
174 Ga0068856_100000562 3300005614 Bacteria 40765
175 Ga0068856_100014061 3300005614 Bacteria 7740
176 Ga0068856_100017954 3300005614 Bacteria 6859
177 Ga0068856_100047688 3300005614 Bacteria 4221
178 Ga0068856_100054557 3300005614 Bacteria 3942
179 Ga0068856_100061782 3300005614 Bacteria 3701
180 Ga0068852_100070903 3300005616 Bacteria 3058
181 Ga0068852_100082345 3300005616 Bacteria 2859
182 Ga0068852_100145566 3300005616 Bacteria 2197
183 Ga0068859_100001188 3300005617 Bacteria 26597
184 Ga0068859_100032636 3300005617 Bacteria 5230
185 Ga0068859_100149907 3300005617 Bacteria 2408
186 Ga0068864_100027618 3300005618 Bacteria 4795
187 Ga0068864_100248184 3300005618 Bacteria 1651
188 Ga0068861_100057351 3300005719 Bacteria 2975
189 Ga0068851_10034009 3300005834 Bacteria 2543
190 Ga0068863_100014237 3300005841 Bacteria 7664
191 Ga0068858_100000756 3300005842 Bacteria 33914
192 Ga0068860_100022592 3300005843 Bacteria 6081
193 Ga0068860_100070622 3300005843 Bacteria 3320
194 Ga0075365_10003207 3300006038 Bacteria 8363
195 Ga0075363_100000300 3300006048 Bacteria 14500
196 Ga0075364_10000282 3300006051 Bacteria 24892
197 Ga0075364_10000611 3300006051 Bacteria 18426
198 Ga0075364_10019278 3300006051 Bacteria 4280
199 Ga0075364_10064642 3300006051 Bacteria 2401
200 Ga0075364_10084553 3300006051 Bacteria 2101
201 Ga0075367_10001307 3300006178 Bacteria 10548
202 Ga0075369_10000096 3300006186 Bacteria 23766
203 Ga0075427_10000040 3300006194 Bacteria 9268
204 Ga0097621_100051852 3300006237 Bacteria 3340
205 Ga0075370_10000080 3300006353 Bacteria 29469
206 Ga0068871_100039443 3300006358 Bacteria 3779
207 Ga0068871_100148287 3300006358 Bacteria 1999
208 Ga0075428_100248666 3300006844 Bacteria 1917
209 Ga0075428_100259391 3300006844 Bacteria 1872
210 Ga0075430_100065380 3300006846 Bacteria 3055
211 Ga0075431_100000523 3300006847 Bacteria 32218
212 Ga0075433_10115062 3300006852 Bacteria 2386
213 Ga0075434_100030354 3300006871 Bacteria 5322
214 Ga0075434_100148119 3300006871 Bacteria 2367
215 Ga0075429_100006840 3300006880 Bacteria 9897
216 Ga0097620_100001188 3300006931 Bacteria 26597
217 Ga0097620_100032636 3300006931 Bacteria 5230
218 Ga0097620_100149909 3300006931 Bacteria 2408
219 Ga0099794_10000547 3300007265 Bacteria 12624
220 Ga0105251_10000219 3300009011 Bacteria 58096
221 Ga0105240_10000898 3300009093 Bacteria 53055
222 Ga0105240_10010308 3300009093 Bacteria 13156
223 Ga0105240_10016744 3300009093 Bacteria 9914
224 Ga0105240_10023437 3300009093 Bacteria 8161
225 Ga0105240_10024511 3300009093 Bacteria 7950
226 Ga0105240_10074438 3300009093 Bacteria 4192
227 Ga0105240_10211204 3300009093 Bacteria 2268
228 Ga0105240_10448027 3300009093 Bacteria 1445
229 Ga0111539_10049286 3300009094 Bacteria 5024
230 Ga0114129_10011620 3300009147 Bacteria 12534
231 Ga0114129_10039875 3300009147 Bacteria 6625
232 Ga0114129_10284607 3300009147 Bacteria 2208
233 Ga0105243_10003262 3300009148 Bacteria 13207
234 Ga0105241_10003742 3300009174 Bacteria 11283
235 Ga0105241_10024704 3300009174 Bacteria 4463
236 Ga0105241_10055513 3300009174 Bacteria 3035
237 Ga0105242_10000940 3300009176 Bacteria 22701
238 Ga0105248_10001462 3300009177 Bacteria 26311
239 Ga0105248_10044939 3300009177 Bacteria 4953
240 Ga0105237_10000064 3300009545 Bacteria 139463
241 Ga0105237_10000183 3300009545 Bacteria 88412
242 Ga0105237_10004545 3300009545 Bacteria 16029
243 Ga0105237_10018769 3300009545 Bacteria 7151
244 Ga0105237_10288567 3300009545 Bacteria 1643
245 Ga0105237_10291157 3300009545 Bacteria 1636
246 Ga0105238_10000924 3300009551 Bacteria 30076
247 Ga0105238_10001307 3300009551 Bacteria 25025
248 Ga0105238_10006865 3300009551 Bacteria 11367
249 Ga0105238_10052297 3300009551 Bacteria 4106
250 Ga0105249_10000763 3300009553 Bacteria 28922
251 Ga0105249_10005381 3300009553 Bacteria 11047
252 Ga0105032_100667 3300009979 Bacteria 3358
253 Ga0105239_10000030 3300010375 Bacteria 233669
254 Ga0105239_10008425 3300010375 Bacteria 11739
255 Ga0105239_10009795 3300010375 Bacteria 10767
256 Ga0105239_10011192 3300010375 Bacteria 10013
257 Ga0105239_10016070 3300010375 Bacteria 8281
258 Ga0105239_10039052 3300010375 Bacteria 5201
259 Ga0105239_10066978 3300010375 Bacteria 3944
260 Ga0105239_10098477 3300010375 Bacteria 3232
261 Ga0105239_10113787 3300010375 Bacteria 3001
262 Ga0157373_10028299 3300013100 Bacteria 4043
263 Ga0157371_10012688 3300013102 Bacteria 6428
264 Ga0157371_10025362 3300013102 Bacteria 4321
265 Ga0157371_10063818 3300013102 Bacteria 2611
266 Ga0157371_10103052 3300013102 Bacteria 2025
267 Ga0157370_10000407 3300013104 Bacteria 54357
268 Ga0157370_10002303 3300013104 Bacteria 23111
269 Ga0157370_10007052 3300013104 Bacteria 12267
270 Ga0157370_10012852 3300013104 Bacteria 8655
271 Ga0157370_10018203 3300013104 Bacteria 7069
272 Ga0157370_10030975 3300013104 Bacteria 5238
273 Ga0157370_10085469 3300013104 Bacteria 2964
274 Ga0157370_10214567 3300013104 Bacteria 1783
275 Ga0157369_10000195 3300013105 Bacteria 84688
276 Ga0157369_10000509 3300013105 Bacteria 51146
277 Ga0157369_10003447 3300013105 Bacteria 18744
278 Ga0157369_10004837 3300013105 Bacteria 15811
279 Ga0157369_10028624 3300013105 Bacteria 6165
280 Ga0157369_10045167 3300013105 Bacteria 4793
281 Ga0157369_10046724 3300013105 Bacteria 4704
282 Ga0157374_10011393 3300013296 Bacteria 7695
283 Ga0157374_10042600 3300013296 Bacteria 4188
284 Ga0157374_10054149 3300013296 Bacteria 3742
285 Ga0157374_10144118 3300013296 Bacteria 2313
286 Ga0157378_10000043 3300013297 Bacteria 107750
287 Ga0163162_10000015 3300013306 Bacteria 261996
288 Ga0163162_10008148 3300013306 Bacteria 10224
289 Ga0163162_10009175 3300013306 Bacteria 9626
290 Ga0163162_10045124 3300013306 Bacteria 4415
291 Ga0157372_10001376 3300013307 Bacteria 26252
292 Ga0157372_10005235 3300013307 Bacteria 13783
293 Ga0157372_10005613 3300013307 Bacteria 13341
294 Ga0157372_10037943 3300013307 Bacteria 5316
295 Ga0157372_10039541 3300013307 Bacteria 5206
296 Ga0157372_10047036 3300013307 Bacteria 4792
297 Ga0157372_10125511 3300013307 Bacteria 2951
298 Ga0157375_10000940 3300013308 Bacteria 25256
299 Ga0157375_10001135 3300013308 Bacteria 23067
300 Ga0157375_10019516 3300013308 Bacteria 6168
301 Ga0157375_10062201 3300013308 Bacteria 3709
302 Ga0157375_10073185 3300013308 Bacteria 3446
303 Ga0163163_10000196 3300014325 Bacteria 62407
304 Ga0163163_10039519 3300014325 Bacteria 4605
305 Ga0157380_10001358 3300014326 Bacteria 15941
306 Ga0182008_10002952 3300014497 Bacteria 10466
307 Ga0182008_10005759 3300014497 Bacteria 7012
308 Ga0182008_10009735 3300014497 Bacteria 5174
309 Ga0182008_10013586 3300014497 Bacteria 4280
310 Ga0157379_10040669 3300014968 Bacteria 4150
311 Ga0157379_10067062 3300014968 Bacteria 3209
312 Ga0157376_10002600 3300014969 Bacteria 12261
313 Ga0157376_10117229 3300014969 Bacteria 2354
314 Ga0157376_10152496 3300014969 Bacteria 2085
315 Ga0182006_1000085 3300015261 Bacteria 117595
316 Ga0182006_1001966 3300015261 Bacteria 11638
317 Ga0182006_1007417 3300015261 Bacteria 5020
318 Ga0182006_1029139 3300015261 Bacteria 2238
319 Ga0182006_1033402 3300015261 Bacteria 2063
320 Ga0182007_10001735 3300015262 Bacteria 11472
321 Ga0182007_10003021 3300015262 Bacteria 8128
322 Ga0182007_10003786 3300015262 Bacteria 7048
323 Ga0182007_10006163 3300015262 Bacteria 5175
324 Ga0182005_1000028 3300015265 Bacteria 221889
325 Ga0182005_1001033 3300015265 Bacteria 11788
326 Ga0183369_1007 3300015685 Bacteria 414878
327 Ga0183368_1003 3300015687 Bacteria 1276390
328 Ga0183360_10001 3300015689 Bacteria 3943671
329 Ga0163161_10003975 3300017792 Bacteria 10353
330 Ga0163161_10009726 3300017792 Bacteria 6661
331 Ga0163161_10019639 3300017792 Bacteria 4740
332 Ga0206356_10829538 3300020070 Bacteria 2824
333 Ga0206356_11137636 3300020070 Bacteria 3095
334 Ga0206354_11451415 3300020081 Bacteria 7136
335 Ga0206353_10693000 3300020082 Bacteria 3463
336 Ga0154015_1092133 3300020610 Bacteria 3070
337 Ga0209435_103996 3300025206 Bacteria 1678
338 Ga0209760_100625 3300025207 Bacteria 6019
339 Ga0209784_100709 3300025224 Bacteria 8923
340 Ga0209674_100012 3300025226 Bacteria 950162
341 Ga0209674_100119 3300025226 Bacteria 135468
342 Ga0209674_100603 3300025226 Bacteria 13673
343 Ga0209674_102640 3300025226 Bacteria 3722
344 Ga0209672_100005 3300025228 Bacteria 1069303
345 Ga0209672_100016 3300025228 Bacteria 522604
346 Ga0209672_100312 3300025228 Bacteria 32535
347 Ga0209672_101666 3300025228 Bacteria 7228
348 Ga0209147_102563 3300025229 Bacteria 4370
349 Ga0209563_100023 3300025230 Bacteria 636844
350 Ga0207427_100055 3300025231 Bacteria 209093
351 Ga0207427_100156 3300025231 Bacteria 77311
352 Ga0207427_101364 3300025231 Bacteria 9003
353 Ga0207427_101551 3300025231 Bacteria 7984
354 Ga0207427_101571 3300025231 Bacteria 7888
355 Ga0209437_100020 3300025233 Bacteria 656374
356 Ga0209437_100147 3300025233 Bacteria 161997
357 Ga0209437_100161 3300025233 Bacteria 148264
358 Ga0209437_100224 3300025233 Bacteria 101515
359 Ga0209437_100231 3300025233 Bacteria 94387
360 Ga0209437_100476 3300025233 Bacteria 30448
361 Ga0209437_104309 3300025233 Bacteria 2519
362 Ga0209258_100006 3300025242 Bacteria 1069303
363 Ga0209258_100012 3300025242 Bacteria 825544
364 Ga0209258_100049 3300025242 Bacteria 358328
365 Ga0209258_100064 3300025242 Bacteria 293837
366 Ga0209258_100186 3300025242 Bacteria 132381
367 Ga0209258_101060 3300025242 Bacteria 11992
368 Ga0207425_1000028 3300025245 Bacteria 286333
369 Ga0207425_1001541 3300025245 Bacteria 9450
370 Ga0209646_1001220 3300025246 Bacteria 7345
371 Ga0209646_1001618 3300025246 Bacteria 5805
372 Ga0209026_1000037 3300025250 Bacteria 282562
373 Ga0209026_1000099 3300025250 Bacteria 161750
374 Ga0209026_1000122 3300025250 Bacteria 126140
375 Ga0209026_1000541 3300025250 Bacteria 26051
376 Ga0209677_101301 3300025253 Bacteria 11108
377 Ga0209148_1000005 3300025254 Bacteria 1806504
378 Ga0209148_1000010 3300025254 Bacteria 1265567
379 Ga0209148_1000012 3300025254 Bacteria 1069303
380 Ga0209148_1000014 3300025254 Bacteria 925277
381 Ga0209148_1000073 3300025254 Bacteria 320851
382 Ga0209148_1000142 3300025254 Bacteria 163404
383 Ga0209148_1001552 3300025254 Bacteria 11114
384 Ga0209759_1000103 3300025256 Bacteria 153195
385 Ga0209759_1000792 3300025256 Bacteria 25985
386 Ga0209759_1001568 3300025256 Bacteria 12465
387 Ga0209759_1005814 3300025256 Bacteria 4235
388 Ga0209129_1000065 3300025258 Bacteria 232568
389 Ga0209129_1000752 3300025258 Bacteria 20589
390 Ga0209129_1006069 3300025258 Bacteria 4039
391 Ga0209233_1000009 3300025261 Bacteria 1265567
392 Ga0209233_1000020 3300025261 Bacteria 798224
393 Ga0209233_1000063 3300025261 Bacteria 395810
394 Ga0209233_1000147 3300025261 Bacteria 186517
395 Ga0209233_1000736 3300025261 Bacteria 14954
396 Ga0209233_1014052 3300025261 Bacteria 2268
397 Ga0209565_1000001 3300025263 Bacteria 2950419
398 Ga0209565_1000014 3300025263 Bacteria 530302
399 Ga0209565_1000081 3300025263 Bacteria 155639
400 Ga0209565_1003582 3300025263 Bacteria 4970
401 Ga0209455_1000008 3300025272 Bacteria 1069303
402 Ga0209455_1000014 3300025272 Bacteria 806601
403 Ga0209455_1000086 3300025272 Bacteria 244650
404 Ga0209455_1000177 3300025272 Bacteria 106026
405 Ga0209455_1000308 3300025272 Bacteria 49953
406 Ga0209673_1000001 3300025273 Bacteria 3176258
407 Ga0209673_1001077 3300025273 Bacteria 30774
408 Ga0209673_1004025 3300025273 Bacteria 8140
409 Ga0209675_1000001 3300025291 Bacteria 2950293
410 Ga0209675_1000021 3300025291 Bacteria 334833
411 Ga0209676_1000024 3300025292 Bacteria 578839
412 Ga0209676_1000225 3300025292 Bacteria 124018
413 Ga0209676_1001462 3300025292 Bacteria 22110
414 Ga0209676_1003048 3300025292 Bacteria 10819
415 Ga0209676_1003938 3300025292 Bacteria 8600
416 Ga0209676_1004689 3300025292 Bacteria 7499
417 Ga0209676_1008220 3300025292 Bacteria 4701
418 Ga0209025_1000002 3300025294 Bacteria 1393142
419 Ga0209025_1000015 3300025294 Bacteria 808120
420 Ga0209025_1000040 3300025294 Bacteria 376228
421 Ga0209025_1003033 3300025294 Bacteria 16562
422 Ga0209025_1006289 3300025294 Bacteria 9284
423 Ga0209564_1000001 3300025295 Bacteria 3176258
424 Ga0209564_1000547 3300025295 Bacteria 60759
425 Ga0209564_1013465 3300025295 Bacteria 3471
426 Ga0209564_1023516 3300025295 Bacteria 2137
427 Ga0209758_1000003 3300025297 Bacteria 1398533
428 Ga0209758_1001371 3300025297 Bacteria 29065
429 Ga0209758_1004728 3300025297 Bacteria 11097
430 Ga0209758_1010415 3300025297 Bacteria 5567
431 Ga0209758_1012329 3300025297 Bacteria 4796
432 Ga0209050_1000541 3300025298 Bacteria 62672
433 Ga0209050_1002752 3300025298 Bacteria 14152
434 Ga0209050_1003486 3300025298 Bacteria 11529
435 Ga0209256_1000002 3300025299 Bacteria 1906740
436 Ga0209256_1004202 3300025299 Bacteria 9257
437 Ga0209256_1007889 3300025299 Bacteria 5100
438 Ga0209256_1009510 3300025299 Bacteria 4250
439 Ga0209256_1010651 3300025299 Bacteria 3814
440 Ga0209256_1011461 3300025299 Bacteria 3541
441 Ga0209256_1021245 3300025299 Bacteria 2000
442 Ga0209051_1003094 3300025303 Bacteria 11224
443 Ga0209257_1000148 3300025304 Bacteria 193131
444 Ga0209257_1000180 3300025304 Bacteria 158090
445 Ga0209257_1000204 3300025304 Bacteria 143800
446 Ga0209257_1001906 3300025304 Bacteria 22534
447 Ga0209257_1002013 3300025304 Bacteria 21724
448 Ga0209257_1002127 3300025304 Bacteria 20664
449 Ga0209257_1004808 3300025304 Bacteria 10040
450 Ga0209257_1009717 3300025304 Bacteria 5061
451 Ga0209257_1010648 3300025304 Bacteria 4603
452 Ga0209257_1029601 3300025304 Bacteria 1781
453 Ga0207656_10001704 3300025321 Bacteria 7303
454 Ga0207656_10004357 3300025321 Bacteria 4935
455 Ga0207655_1000162 3300025728 Bacteria 122768
456 Ga0207713_1000393 3300025735 Bacteria 47322
457 Ga0207713_1039274 3300025735 Bacteria 1998
458 Ga0207680_10000005 3300025903 Bacteria 660983
459 Ga0207680_10000255 3300025903 Bacteria 25597
460 Ga0207680_10000514 3300025903 Bacteria 18482
461 Ga0207647_10000343 3300025904 Bacteria 37699
462 Ga0207647_10000512 3300025904 Bacteria 30880
463 Ga0207647_10000759 3300025904 Bacteria 25244
464 Ga0207647_10001940 3300025904 Bacteria 15811
465 Ga0207647_10007235 3300025904 Bacteria 8037
466 Ga0207647_10011712 3300025904 Bacteria 6138
467 Ga0207647_10011995 3300025904 Bacteria 6050
468 Ga0207647_10038298 3300025904 Bacteria 3032
469 Ga0207699_10133879 3300025906 Bacteria 1621
470 Ga0207645_10050498 3300025907 Bacteria 2656
471 Ga0207705_10000206 3300025909 Bacteria 59643
472 Ga0207705_10002274 3300025909 Bacteria 14859
473 Ga0207705_10002283 3300025909 Bacteria 14834
474 Ga0207705_10005224 3300025909 Bacteria 9733
475 Ga0207705_10028909 3300025909 Bacteria 3952
476 Ga0207684_10129946 3300025910 Bacteria 2162
477 Ga0207654_10029838 3300025911 Bacteria 2990
478 Ga0207707_10000064 3300025912 Bacteria 107490
479 Ga0207707_10000146 3300025912 Bacteria 73614
480 Ga0207707_10000244 3300025912 Bacteria 59403
481 Ga0207707_10000948 3300025912 Bacteria 27952
482 Ga0207707_10003238 3300025912 Bacteria 14458
483 Ga0207707_10005253 3300025912 Bacteria 11344
484 Ga0207707_10008914 3300025912 Bacteria 8712
485 Ga0207707_10014797 3300025912 Bacteria 6797
486 Ga0207707_10016433 3300025912 Bacteria 6456
487 Ga0207707_10018697 3300025912 Bacteria 6043
488 Ga0207707_10036183 3300025912 Bacteria 4317
489 Ga0207707_10192832 3300025912 Bacteria 1777
490 Ga0207695_10000007 3300025913 Bacteria 1092551
491 Ga0207695_10000780 3300025913 Bacteria 60243
492 Ga0207695_10001436 3300025913 Bacteria 40059
493 Ga0207695_10001823 3300025913 Bacteria 33507
494 Ga0207695_10008312 3300025913 Bacteria 13004
495 Ga0207695_10008391 3300025913 Bacteria 12942
496 Ga0207695_10011400 3300025913 Bacteria 10775
497 Ga0207695_10016742 3300025913 Bacteria 8562
498 Ga0207695_10026197 3300025913 Bacteria 6510
499 Ga0207671_10000061 3300025914 Bacteria 175061
500 Ga0207671_10000329 3300025914 Bacteria 69610
501 Ga0207671_10001147 3300025914 Bacteria 31646
502 Ga0207671_10003503 3300025914 Bacteria 15596
503 Ga0207671_10003678 3300025914 Bacteria 15116
504 Ga0207671_10023978 3300025914 Bacteria 4592
505 Ga0207660_10000399 3300025917 Bacteria 28577
506 Ga0207660_10000676 3300025917 Bacteria 22769
507 Ga0207660_10002480 3300025917 Bacteria 12131
508 Ga0207660_10004546 3300025917 Bacteria 9048
509 Ga0207660_10008645 3300025917 Bacteria 6583
510 Ga0207657_10014382 3300025919 Bacteria 7727
511 Ga0207657_10018424 3300025919 Bacteria 6664
512 Ga0207657_10021615 3300025919 Bacteria 6049
513 Ga0207657_10023056 3300025919 Bacteria 5805
514 Ga0207657_10035226 3300025919 Bacteria 4490
515 Ga0207657_10059762 3300025919 Bacteria 3273
516 Ga0207649_10000847 3300025920 Bacteria 19667
517 Ga0207649_10010415 3300025920 Bacteria 5109
518 Ga0207649_10027962 3300025920 Bacteria 3316
519 Ga0207652_10000019 3300025921 Bacteria 164416
520 Ga0207652_10000084 3300025921 Bacteria 101874
521 Ga0207652_10000644 3300025921 Bacteria 34523
522 Ga0207652_10002333 3300025921 Bacteria 16078
523 Ga0207652_10070526 3300025921 Bacteria 3035
524 Ga0207694_10000162 3300025924 Bacteria 68375
525 Ga0207694_10002417 3300025924 Bacteria 15274
526 Ga0207694_10003467 3300025924 Bacteria 12533
527 Ga0207650_10021393 3300025925 Bacteria 4571
528 Ga0207650_10115210 3300025925 Bacteria 2086
529 Ga0207664_10000026 3300025929 Bacteria 194571
530 Ga0207664_10001222 3300025929 Bacteria 17024
531 Ga0207644_10032119 3300025931 Bacteria 3660
532 Ga0207690_10000864 3300025932 Bacteria 19385
533 Ga0207690_10000975 3300025932 Bacteria 18344
534 Ga0207690_10004131 3300025932 Bacteria 8578
535 Ga0207690_10032621 3300025932 Bacteria 3343
536 Ga0207690_10069172 3300025932 Bacteria 2428
537 Ga0207690_10075459 3300025932 Bacteria 2338
538 Ga0207706_10011833 3300025933 Bacteria 7945
539 Ga0207706_10022696 3300025933 Bacteria 5633
540 Ga0207686_10046784 3300025934 Bacteria 2671
541 Ga0207709_10008328 3300025935 Bacteria 5743
542 Ga0207669_10045469 3300025937 Bacteria 2587
543 Ga0207704_10005852 3300025938 Bacteria 5690
544 Ga0207691_10043022 3300025940 Bacteria 4164
545 Ga0207691_10057527 3300025940 Bacteria 3538
546 Ga0207691_10100639 3300025940 Bacteria 2580
547 Ga0207691_10152273 3300025940 Bacteria 2033
548 Ga0207711_10001229 3300025941 Bacteria 24284
549 Ga0207689_10019419 3300025942 Bacteria 5729
550 Ga0207661_10006751 3300025944 Bacteria 8125
551 Ga0207661_10010584 3300025944 Bacteria 6643
552 Ga0207679_10041737 3300025945 Bacteria 3292
553 Ga0207667_10000386 3300025949 Bacteria 59640
554 Ga0207667_10001306 3300025949 Bacteria 31238
555 Ga0207667_10005108 3300025949 Bacteria 16029
556 Ga0207667_10005523 3300025949 Bacteria 15428
557 Ga0207667_10007230 3300025949 Bacteria 13398
558 Ga0207667_10011673 3300025949 Bacteria 10193
559 Ga0207667_10014077 3300025949 Bacteria 9132
560 Ga0207667_10015916 3300025949 Bacteria 8517
561 Ga0207667_10033066 3300025949 Bacteria 5564
562 Ga0207667_10064166 3300025949 Bacteria 3835
563 Ga0207667_10160495 3300025949 Bacteria 2312
564 Ga0207712_10001183 3300025961 Bacteria 18055
565 Ga0207712_10001310 3300025961 Bacteria 17057
566 Ga0207668_10124978 3300025972 Bacteria 1954
567 Ga0207640_10000378 3300025981 Bacteria 28715
568 Ga0207640_10002161 3300025981 Bacteria 10568
569 Ga0207640_10004984 3300025981 Bacteria 7217
570 Ga0207640_10006665 3300025981 Bacteria 6345
571 Ga0207640_10007842 3300025981 Bacteria 5892
572 Ga0207640_10009690 3300025981 Bacteria 5402
573 Ga0207640_10046461 3300025981 Bacteria 2794
574 Ga0207640_10183856 3300025981 Bacteria 1569
575 Ga0207658_10000006 3300025986 Bacteria 392309
576 Ga0207658_10054137 3300025986 Bacteria 2967
577 Ga0207677_10170338 3300026023 Bacteria 1702
578 Ga0207703_10000809 3300026035 Bacteria 30827
579 Ga0207703_10190879 3300026035 Bacteria 1814
580 Ga0207639_10000230 3300026041 Bacteria 41807
581 Ga0207639_10000955 3300026041 Bacteria 19606
582 Ga0207639_10002731 3300026041 Bacteria 11843
583 Ga0207639_10003037 3300026041 Bacteria 11300
584 Ga0207639_10009277 3300026041 Bacteria 6786
585 Ga0207639_10009814 3300026041 Bacteria 6616
586 Ga0207639_10174747 3300026041 Bacteria 1822
587 Ga0207678_10003502 3300026067 Bacteria 14112
588 Ga0207678_10004583 3300026067 Bacteria 12431
589 Ga0207678_10010017 3300026067 Bacteria 8317
590 Ga0207678_10019059 3300026067 Bacteria 6025
591 Ga0207678_10023472 3300026067 Bacteria 5394
592 Ga0207678_10034687 3300026067 Bacteria 4394
593 Ga0207678_10068449 3300026067 Bacteria 3046
594 Ga0207678_10185639 3300026067 Bacteria 1776
595 Ga0207702_10000580 3300026078 Bacteria 40765
596 Ga0207702_10001534 3300026078 Bacteria 22836
597 Ga0207702_10002243 3300026078 Bacteria 18541
598 Ga0207702_10011344 3300026078 Bacteria 7430
599 Ga0207702_10013254 3300026078 Bacteria 6856
600 Ga0207702_10013968 3300026078 Bacteria 6671
601 Ga0207702_10037249 3300026078 Bacteria 4070
602 Ga0207702_10083608 3300026078 Bacteria 2777
603 Ga0207641_10015985 3300026088 Bacteria 6143
604 Ga0207641_10035578 3300026088 Bacteria 4150
605 Ga0207641_10057206 3300026088 Bacteria 3316
606 Ga0207641_10147204 3300026088 Bacteria 2131
607 Ga0207648_10035235 3300026089 Bacteria 4409
608 Ga0207648_10139731 3300026089 Bacteria 2134
609 Ga0207676_10031909 3300026095 Bacteria 3964
610 Ga0207674_10000226 3300026116 Bacteria 70605
611 Ga0207674_10003517 3300026116 Bacteria 19121
612 Ga0207674_10011343 3300026116 Bacteria 10015
613 Ga0207674_10019482 3300026116 Bacteria 7347
614 Ga0207674_10021905 3300026116 Bacteria 6875
615 Ga0207674_10077428 3300026116 Bacteria 3331
616 Ga0207675_100171622 3300026118 Bacteria 2073
617 Ga0207675_100198094 3300026118 Bacteria 1928
618 Ga0207683_10030140 3300026121 Bacteria 4700
619 Ga0207683_10181461 3300026121 Bacteria 1909
620 Ga0207698_10002393 3300026142 Bacteria 11105
621 Ga0207698_10039764 3300026142 Bacteria 3487
622 Ga0209371_1000004 3300027312 Bacteria 1098197
623 Ga0209371_1000044 3300027312 Bacteria 327086
624 Ga0209999_1003238 3300027543 Bacteria 2906
625 Ga0209970_1003587 3300027614 Bacteria 2602
626 Ga0209983_1002823 3300027665 Bacteria 3755
627 Ga0209971_1004054 3300027682 Bacteria 3469
628 Ga0209966_1003940 3300027695 Bacteria 2506
629 Ga0209813_10001903 3300027866 Bacteria 4708
630 Ga0207428_10051338 3300027907 Bacteria 3297
631 Ga0268266_10000001 3300028379 Bacteria 4040580
632 Ga0268266_10000004 3300028379 Bacteria 1495817
633 Ga0268266_10000006 3300028379 Bacteria 1410021
634 Ga0268266_10036448 3300028379 Bacteria 4186
635 Ga0268266_10096882 3300028379 Bacteria 2594
636 Ga0268265_10002756 3300028380 Bacteria 12975
637 Ga0268264_10016468 3300028381 Bacteria 6053
638 Ga0268264_10032018 3300028381 Bacteria 4314
639 Ga0268256_1000005 3300030500 Bacteria 1082342
640 Ga0268256_1000046 3300030500 Bacteria 327003
641 Ga0316183_1029247 3300030742 Bacteria 7749
642 Ga0307513_10004159 3300031456 Bacteria 19385
643 Ga0307509_10000229 3300031507 Bacteria 90514
644 Ga0316575_10027325 3300031665 Bacteria 2220
645 Ga0316579_10002489 3300031691 Bacteria 6965
646 Ga0316579_10004798 3300031691 Bacteria 5400
647 Ga0316579_10012808 3300031691 Bacteria 3598
648 Ga0316576_10012035 3300031727 Bacteria 5700
649 Ga0316578_10003942 3300031728 Bacteria 6910
650 Ga0316578_10022778 3300031728 Bacteria 3498
651 Ga0307516_10016729 3300031730 Bacteria 7657
652 Ga0316577_10022907 3300031733 Bacteria 3468
653 Ga0307413_10000993 3300031824 Bacteria 10213
654 Ga0307413_10091134 3300031824 Bacteria 1985
655 Ga0307410_10027010 3300031852 Bacteria 3623
656 Ga0307406_10000399 3300031901 Bacteria 25114
657 Ga0307412_10002544 3300031911 Bacteria 10135
658 Ga0307412_10003373 3300031911 Bacteria 8872
659 Ga0307412_10080530 3300031911 Bacteria 2250
660 Ga0307416_100212079 3300032002 Bacteria 1848
661 Ga0307414_10001495 3300032004 Bacteria 12147
662 Ga0307414_10040419 3300032004 Bacteria 3150
663 Ga0307414_10044756 3300032004 Bacteria 3026
664 Ga0307414_10062609 3300032004 Bacteria 2641
665 Ga0307415_100180522 3300032126 Bacteria 1656
666 Ga0316585_10000379 3300032137 Bacteria 10294
667 Ga0316580_10000704 3300032139 Bacteria 8038
668 Ga0316580_10025695 3300032139 Bacteria 1821
669 Ga0316593_10000834 3300032168 Bacteria 6223
670 Ga0316593_10006078 3300032168 Bacteria 3237
671 Ga0316593_10013215 3300032168 Bacteria 2439
672 Ga0307510_10002044 3300033180 Bacteria 22812
673 Ga0307510_10025630 3300033180 Bacteria 6795
674 Ga0316596_1000778 3300033541 Bacteria 5868
675 Ga0373944_0003332 3300035089 Bacteria 4139
676 Ga0316574_0003460 3300035398 Bacteria 8140
677 Ga0316574_0006784 3300035398 Bacteria 6223
678 Ga0316574_0008025 3300035398 Bacteria 5833
679 Ga0373933_0064646 3300035724 Bacteria 2214
680 Ga0316582_0000279 3300036647 Bacteria 17480
681 Ga0316582_0003359 3300036647 Bacteria 7831
682 Ga0316584_0011104 3300036712 Bacteria 6317
683 Ga0316584_0014954 3300036712 Bacteria 5543
684 Ga0316584_0203168 3300036712 Bacteria 1461
685 Ga0373925_0021331 3300037068 Bacteria 4719
686 Ga0395899_0000108 3300037312 Bacteria 142347
687 Ga0395899_0020403 3300037312 Bacteria 5024
688 Ga0395899_0065751 3300037312 Bacteria 2664
689 Ga0395899_0082286 3300037312 Bacteria 2341
690 Ga0395899_0112338 3300037312 Bacteria 1957
691 Ga0395900_0000059 3300037418 Bacteria 205996
692 Ga0395900_0000144 3300037418 Bacteria 119971
693 Ga0395900_0001328 3300037418 Bacteria 29941
694 Ga0395900_0011739 3300037418 Bacteria 8957
695 Ga0395900_0047496 3300037418 Bacteria 4420
696 Ga0395900_0050272 3300037418 Bacteria 4294
697 Ga0395900_0068940 3300037418 Bacteria 3634
698 Ga0395900_0096985 3300037418 Bacteria 3029
699 Ga0395898_0000018 3300037466 Bacteria 418600
700 Ga0395898_0000049 3300037466 Bacteria 284792
701 Ga0395898_0286813 3300037466 Bacteria 1570
702 Ga0395905_0000855 3300037471 Bacteria 39769
703 Ga0395905_0044804 3300037471 Bacteria 4150
704 Ga0316581_0013450 3300037588 Bacteria 2321
705 Ga0395901_0000356 3300038443 Bacteria 55523
706 Ga0395901_0043265 3300038443 Bacteria 4672
707 Ga0395901_0146500 3300038443 Bacteria 2481
708 Ga0237819_00006 3300038705 Bacteria 78253
709 Ga0400490_03793 3300038726 Bacteria 3303
710 Ga0400490_30897 3300038726 Bacteria 40161
711 Ga0400490_38104 3300038726 Bacteria 20323
712 Ga0400488_33615 3300038741 Bacteria 6652
713 Ga0400486_17520 3300038742 Bacteria 2366
714 Ga0400483_133713 3300039062 Bacteria 14771
715 Ga0400483_226110 3300039062 Bacteria 3464
716 Ga0400487_61177 3300039110 Bacteria 6666
717 Ga0237816_00140 3300039145 Bacteria 5646
718 Ga0439436_0000030 3300041404 Bacteria 48429
719 Ga0439447_000680 3300041407 Bacteria 12629
720 Ga0439465_0000405 3300041413 Bacteria 12512
721 Ga0439465_0000621 3300041413 Bacteria 10781
722 Ga0439465_0013770 3300041413 Bacteria 2517
723 Ga0451797_1127267 3300041453 Bacteria 1562
724 Ga0451800_0416601 3300041459 Bacteria 5257
725 Ga0451806_541229 3300041462 Bacteria 7600
726 Ga0451804_0746312 3300041463 Bacteria 2456
727 Ga0451807_1917614 3300041486 Bacteria 3893
728 Ga0451837_0375995 3300041494 Bacteria 6077
729 Ga0451837_1201779 3300041494 Bacteria 3141
730 Ga0439445_0005445 3300042004 Bacteria 2901
731 Ga0439432_029987 3300042006 Bacteria 1765
732 Ga0439449_0000048 3300042007 Bacteria 36681
733 Ga0439449_0003482 3300042007 Bacteria 6115
734 Ga0450911_000912 3300042115 Bacteria 7852
735 Ga0450908_001001 3300042184 Bacteria 5468
736 Ga0451577_0017292 3300042876 Bacteria 6664
737 Ga0466969_0015288 3300044656 Bacteria 4023
738 Ga0466982_0000003 3300044672 Bacteria 417243
739 Ga0466966_0001324 3300044684 Bacteria 15870
740 Ga0466966_0031675 3300044684 Bacteria 3428
741 Ga0466961_0004875 3300044693 Bacteria 8442
742 Ga0466961_0005216 3300044693 Bacteria 8177
743 Ga0466961_0013157 3300044693 Bacteria 5293
744 Ga0466961_0020100 3300044693 Bacteria 4297
745 Ga0466963_0184095 3300044694 Bacteria 1459
746 Ga0453684_0000298 3300044712 Bacteria 209777
747 Ga0453684_0008337 3300044712 Bacteria 18633
748 Ga0466971_0003757 3300044719 Bacteria 6500
749 Ga0466971_0021286 3300044719 Bacteria 2886
750 Ga0466968_0024535 3300044735 Bacteria 2464
751 Ga0466968_0048671 3300044735 Bacteria 1804
752 Ga0466970_0000202 3300044765 Bacteria 28937
753 Ga0466970_0003852 3300044765 Bacteria 7344
754 Ga0466957_0002054 3300044842 Bacteria 10762
755 Ga0466957_0037073 3300044842 Bacteria 2934
756 Ga0466959_0000194 3300045049 Bacteria 39999
757 Ga0466959_0002267 3300045049 Bacteria 12261
758 Ga0466959_0015572 3300045049 Bacteria 5543
759 Ga0466959_0020295 3300045049 Bacteria 4894
760 Ga0466959_0114102 3300045049 Bacteria 1926
761 Ga0451576_0000033 3300045051 Bacteria 393131
762 Ga0466958_0044743 3300045836 Bacteria 2668
763 Ga0495617_000586 3300046452 Bacteria 18560
764 Ga0495617_000939 3300046452 Bacteria 13544
765 Ga0495627_005291 3300046453 Bacteria 5229
766 Ga0495638_0000038 3300046460 Bacteria 249534
767 Ga0495638_0000153 3300046460 Bacteria 109155
768 Ga0495638_0002596 3300046460 Bacteria 14582
769 Ga0495638_0003487 3300046460 Bacteria 12359
770 Ga0495638_0012299 3300046460 Bacteria 5869
771 Ga0495638_0072264 3300046460 Bacteria 2109
772 Ga0495653_0002459 3300046463 Bacteria 14723
773 Ga0495650_0000450 3300046471 Bacteria 65387
774 Ga0495650_0001325 3300046471 Bacteria 24874
775 Ga0495650_0005338 3300046471 Bacteria 8386
776 Ga0495650_0030228 3300046471 Bacteria 2456
777 Ga0495580_0134349 3300046472 Bacteria 1715
778 Ga0495582_0026408 3300046473 Bacteria 3183
779 Ga0495584_0002465 3300046491 Bacteria 10482
780 Ga0495585_0000104 3300046492 Bacteria 90097
781 Ga0495585_0008229 3300046492 Bacteria 6331
782 Ga0495607_0000211 3300046501 Bacteria 62291
783 Ga0495607_0002313 3300046501 Bacteria 15633
784 Ga0495607_0010293 3300046501 Bacteria 6290
785 Ga0495606_0000401 3300046507 Bacteria 73149
786 Ga0495606_0004520 3300046507 Bacteria 13843
787 Ga0495606_0006836 3300046507 Bacteria 10411
788 Ga0495606_0009207 3300046507 Bacteria 8393
789 Ga0495610_0000482 3300046512 Bacteria 41191
790 Ga0495616_0000086 3300046513 Bacteria 78187
791 Ga0495620_0001564 3300046515 Bacteria 13597
792 Ga0495620_0006441 3300046515 Bacteria 6450
793 Ga0495631_0001785 3300046518 Bacteria 12758
794 Ga0495631_0001835 3300046518 Bacteria 12523
795 Ga0495632_0000004 3300046519 Bacteria 381372
796 Ga0495632_0011223 3300046519 Bacteria 5242
797 Ga0495632_0022825 3300046519 Bacteria 3349
798 Ga0495632_0085193 3300046519 Bacteria 1503
799 Ga0495637_0010551 3300046520 Bacteria 4463
800 Ga0495643_0003848 3300046522 Bacteria 10809
801 Ga0495643_0007696 3300046522 Bacteria 6903
802 Ga0495648_0002502 3300046524 Bacteria 16862
803 Ga0495648_0004770 3300046524 Bacteria 11475
804 Ga0495648_0006343 3300046524 Bacteria 9673
805 Ga0495663_0000662 3300046525 Bacteria 11934
806 Ga0495663_0006399 3300046525 Bacteria 3251
807 Ga0495665_0036208 3300046531 Bacteria 2635
808 Ga0495621_0004807 3300046539 Bacteria 3830
809 Ga0495645_0080864 3300046543 Bacteria 2332
810 Ga0495622_0013271 3300046557 Bacteria 3823
811 Ga0495633_0008488 3300046558 Bacteria 5778
812 Ga0495633_0013496 3300046558 Bacteria 4303
813 Ga0495656_0005789 3300046615 Bacteria 4293
814 Ga0495656_0007758 3300046615 Bacteria 3807
815 Ga0495668_0003978 3300046616 Bacteria 10764
816 Ga0495611_0000001 3300046648 Bacteria 2628469
817 Ga0495611_0000105 3300046648 Bacteria 58236
818 Ga0495625_0000022 3300046660 Bacteria 278823
819 Ga0495625_0010863 3300046660 Bacteria 7483
820 Ga0495625_0017336 3300046660 Bacteria 5640
821 Ga0495661_0000199 3300046665 Bacteria 69536
822 Ga0495661_0000291 3300046665 Archaea 56833
823 Ga0495658_0025436 3300046683 Bacteria 3163
824 Ga0495613_0007234 3300046689 Bacteria 8264
825 Ga0495613_0057452 3300046689 Bacteria 2857
826 Ga0495670_0003523 3300046691 Bacteria 7684
827 Ga0495670_0006841 3300046691 Bacteria 5613
828 Ga0495670_0014938 3300046691 Bacteria 3822
829 Ga0495671_0000372 3300046692 Bacteria 36874
830 Ga0495649_0001571 3300046694 Bacteria 17089
831 Ga0495589_0000059 3300046794 Bacteria 107171
832 Ga0495589_0047146 3300046794 Bacteria 2136
833 Ga0495660_0000745 3300046810 Bacteria 24604
834 Ga0495660_0000747 3300046810 Bacteria 24561
835 Ga0495660_0001860 3300046810 Bacteria 13852
836 Ga0495636_0000912 3300047318 Bacteria 10978
837 Ga0495636_0012167 3300047318 Bacteria 3408
838 Ga0495636_0019322 3300047318 Bacteria 2738
839 Ga0495672_0008952 3300047320 Bacteria 7309
840 Ga0495683_0000001 3300047323 Unclassified 2230803
841 Ga0495683_0007577 3300047323 Bacteria 5853
842 Ga0495679_000004 3300047446 Bacteria 748056
843 Ga0495673_0000004 3300047469 Bacteria 1354526
844 Ga0495673_0000048 3300047469 Bacteria 265950
845 Ga0495673_0002942 3300047469 Bacteria 11496
846 Ga0495684_0070247 3300047471 Bacteria 2662
847 Ga0495686_0000017 3300047472 Bacteria 435554
848 Ga0495686_0001206 3300047472 Bacteria 29747
849 Ga0495686_0005468 3300047472 Bacteria 10011
850 Ga0495686_0006769 3300047472 Bacteria 8704
851 Ga0495686_0008204 3300047472 Bacteria 7701
852 Ga0495686_0047619 3300047472 Bacteria 2706
853 Ga0495593_0034417 3300047673 Bacteria 2755
854 Ga0496100_0006438 3300048903 Bacteria 6401
855 Ga0496101_0011176 3300048904 Bacteria 5949
856 Ga0496101_0038972 3300048904 Bacteria 3377
857 Ga0496102_0127663 3300048905 Bacteria 2378
858 Ga0496103_0030329 3300048906 Bacteria 3291
859 Ga0496104_0000011 3300048907 Bacteria 459358
860 Ga0496104_0034139 3300048907 Bacteria 4741
861 Ga0496104_0078965 3300048907 Bacteria 3136
862 Ga0496105_0000071 3300048908 Bacteria 79908
863 Ga0496105_0001886 3300048908 Bacteria 15030
864 Ga0496106_0001299 3300048909 Bacteria 18754
865 Ga0496106_0091174 3300048909 Bacteria 2353
866 Ga0496107_0153510 3300048910 Bacteria 1704
867 Ga0496108_0027988 3300048911 Bacteria 4662
868 Ga0496110_0046966 3300048913 Bacteria 3779
869 Ga0496111_0059706 3300048914 Bacteria 2763
870 Ga0496113_0002731 3300048916 Bacteria 10367
871 Ga0496114_0050953 3300048917 Bacteria 3446
872 Ga0496115_0000062 3300048918 Bacteria 100189
873 Ga0496115_0000182 3300048918 Bacteria 58480
874 Ga0496115_0000503 3300048918 Bacteria 30610
875 Ga0496115_0016934 3300048918 Bacteria 5560
876 Ga0496116_0006696 3300048919 Bacteria 10386
877 Ga0496116_0009340 3300048919 Bacteria 8376
878 Ga0496117_0001420 3300048920 Bacteria 34726
879 Ga0496117_0002445 3300048920 Bacteria 23395
880 Ga0496117_0004800 3300048920 Bacteria 14649
881 Ga0496117_0018341 3300048920 Bacteria 5800
882 Ga0496117_0019263 3300048920 Bacteria 5612
883 Ga0496117_0022804 3300048920 Bacteria 5014
884 Ga0496117_0037026 3300048920 Bacteria 3640
885 Ga0496118_0001724 3300048921 Bacteria 31870
886 Ga0496118_0002288 3300048921 Bacteria 26119
887 Ga0496118_0003187 3300048921 Bacteria 20960
888 Ga0496118_0007325 3300048921 Bacteria 11737
889 Ga0496118_0008410 3300048921 Bacteria 10671
890 Ga0496118_0008793 3300048921 Bacteria 10351
891 Ga0496118_0009162 3300048921 Bacteria 10057
892 Ga0496118_0009833 3300048921 Bacteria 9572
893 Ga0496118_0011915 3300048921 Bacteria 8416
894 Ga0496118_0018953 3300048921 Bacteria 6169
895 Ga0496118_0019029 3300048921 Bacteria 6155
896 Ga0496118_0073498 3300048921 Bacteria 2449
897 Ga0496119_0000430 3300048922 Bacteria 57802
898 Ga0496119_0001587 3300048922 Bacteria 27028
899 Ga0496119_0002453 3300048922 Bacteria 20369
900 Ga0496119_0004649 3300048922 Bacteria 13542
901 Ga0496119_0041560 3300048922 Bacteria 2925
902 Ga0496119_0078847 3300048922 Bacteria 1904
903 Ga0496120_0000313 3300048923 Bacteria 80663
904 Ga0496120_0001482 3300048923 Bacteria 27908
905 Ga0496120_0002147 3300048923 Bacteria 21033
906 Ga0496120_0007359 3300048923 Bacteria 8208
907 Ga0496121_0000878 3300048924 Bacteria 54427
908 Ga0496121_0005536 3300048924 Bacteria 16138
909 Ga0496121_0006097 3300048924 Bacteria 15167
910 Ga0496121_0007810 3300048924 Bacteria 12810
911 Ga0496121_0008433 3300048924 Bacteria 12122
912 Ga0496121_0012110 3300048924 Bacteria 9473
913 Ga0496121_0019136 3300048924 Bacteria 6864
914 Ga0496121_0022688 3300048924 Bacteria 6076
915 Ga0496121_0089774 3300048924 Bacteria 2404
916 Ga0496121_0091594 3300048924 Bacteria 2373
917 Ga0496121_0105816 3300048924 Bacteria 2158
918 Ga0496122_0001419 3300048925 Bacteria 38784
919 Ga0496122_0001926 3300048925 Bacteria 31324
920 Ga0496122_0002854 3300048925 Bacteria 23661
921 Ga0496122_0003345 3300048925 Bacteria 21155
922 Ga0496122_0006843 3300048925 Bacteria 12928
923 Ga0496122_0009589 3300048925 Bacteria 10146
924 Ga0496122_0022373 3300048925 Bacteria 5620
925 Ga0496122_0024178 3300048925 Bacteria 5324
926 Ga0496122_0026766 3300048925 Bacteria 4957
927 Ga0496122_0042883 3300048925 Bacteria 3553
928 Ga0496122_0044085 3300048925 Bacteria 3486
929 Ga0496123_0001882 3300048926 Bacteria 27416
930 Ga0496123_0002675 3300048926 Bacteria 21457
931 Ga0496123_0002721 3300048926 Bacteria 21201
932 Ga0496123_0007606 3300048926 Bacteria 10146
933 Ga0496123_0018133 3300048926 Bacteria 5620
934 Ga0496123_0027392 3300048926 Bacteria 4246
935 Ga0496123_0030854 3300048926 Bacteria 3915
936 Ga0496123_0055256 3300048926 Bacteria 2606
937 Ga0496124_0000032 3300048927 Bacteria 332524
938 Ga0496124_0003791 3300048927 Bacteria 18160
939 Ga0496124_0012352 3300048927 Bacteria 8434
940 Ga0496124_0020781 3300048927 Bacteria 6058
941 Ga0496124_0021085 3300048927 Bacteria 6009
942 Ga0496124_0021111 3300048927 Bacteria 6005
943 Ga0496124_0023684 3300048927 Bacteria 5600
944 Ga0496124_0034314 3300048927 Bacteria 4454
945 Ga0496124_0051630 3300048927 Bacteria 3497
946 Ga0496124_0064969 3300048927 Bacteria 3044
947 Ga0496125_0000330 3300048928 Bacteria 91043
948 Ga0496125_0007864 3300048928 Bacteria 11266
949 Ga0496125_0015861 3300048928 Bacteria 7258
950 Ga0496125_0018703 3300048928 Bacteria 6569
951 Ga0496125_0028197 3300048928 Bacteria 5076
952 Ga0496125_0041081 3300048928 Bacteria 3958
953 Ga0496125_0042192 3300048928 Bacteria 3889
954 Ga0496125_0103335 3300048928 Bacteria 2091
955 Ga0496126_0000057 3300048929 Bacteria 276781
956 Ga0496126_0007008 3300048929 Bacteria 12445
957 Ga0496126_0011781 3300048929 Bacteria 9002
958 Ga0496126_0011872 3300048929 Bacteria 8958
959 Ga0496126_0016809 3300048929 Bacteria 7303
960 Ga0496126_0058144 3300048929 Bacteria 3486
961 Ga0496126_0067712 3300048929 Bacteria 3190
962 Ga0496126_0109745 3300048929 Bacteria 2404
963 Ga0495678_000237 3300049459 Bacteria 62286
964 Ga0495682_0002463 3300049460 Bacteria 8743
965 Ga0495682_0012905 3300049460 Bacteria 3189
966 Ga0501031_0008301 3300049568 Bacteria 6754
967 Ga0501031_0028021 3300049568 Bacteria 3671
968 Ga0501032_0005884 3300049569 Bacteria 9068
969 Ga0501032_0008355 3300049569 Bacteria 7544
970 Ga0501032_0014147 3300049569 Bacteria 5656
971 Ga0501033_0000329 3300049570 Bacteria 45324
972 Ga0501033_0002339 3300049570 Bacteria 16164
973 Ga0501033_0006466 3300049570 Bacteria 9168
974 Ga0501033_0007203 3300049570 Bacteria 8681
975 Ga0501034_0000122 3300049571 Bacteria 144085
976 Ga0501034_0001357 3300049571 Bacteria 33066
977 Ga0501034_0001661 3300049571 Bacteria 28667
978 Ga0501034_0002041 3300049571 Bacteria 25359
979 Ga0501034_0003703 3300049571 Bacteria 17262
980 Ga0501034_0012439 3300049571 Bacteria 8790
981 Ga0501034_0025578 3300049571 Bacteria 6010
982 Ga0501034_0131845 3300049571 Bacteria 2482
983 Ga0501034_0137324 3300049571 Bacteria 2425
984 Ga0501034_0310492 3300049571 Bacteria 1511
985 Ga0501036_0020553 3300049572 Bacteria 5545
986 Ga0501036_0022920 3300049572 Bacteria 5257
987 Ga0501036_0031284 3300049572 Bacteria 4497
988 Ga0501036_0052114 3300049572 Bacteria 3465
989 Ga0501037_0004358 3300049573 Bacteria 10275
990 Ga0501037_0012058 3300049573 Bacteria 6364
991 Ga0501037_0015531 3300049573 Bacteria 5603
992 Ga0501037_0054749 3300049573 Bacteria 2917
993 Ga0501037_0082153 3300049573 Bacteria 2335
994 Ga0501037_0083968 3300049573 Bacteria 2307
995 Ga0501038_0001377 3300049574 Bacteria 22209
996 Ga0501038_0002332 3300049574 Bacteria 17683
997 Ga0501038_0015142 3300049574 Bacteria 7016
998 Ga0501038_0063967 3300049574 Bacteria 3138
999 Ga0501039_0026295 3300049575 Bacteria 4472
1000 Ga0501039_0046362 3300049575 Bacteria 3358
1001 Ga0501039_0060274 3300049575 Bacteria 2939
1002 Ga0501039_0072915 3300049575 Bacteria 2668
1003 Ga0501040_0001361 3300049576 Bacteria 15433
1004 Ga0501040_0040908 3300049576 Bacteria 3156
1005 Ga0501042_0000268 3300049578 Bacteria 25376
1006 Ga0501043_0004587 3300049579 Bacteria 11206
1007 Ga0501043_0008045 3300049579 Bacteria 8325
1008 Ga0501043_0022235 3300049579 Bacteria 4974
1009 Ga0501043_0040904 3300049579 Bacteria 3643
1010 Ga0501043_0086831 3300049579 Bacteria 2458
1011 Ga0501046_0002951 3300049580 Bacteria 15738
1012 Ga0501046_0053265 3300049580 Bacteria 3187
1013 Ga0501046_0058487 3300049580 Bacteria 3021
1014 Ga0501046_0109773 3300049580 Bacteria 2108
1015 Ga0501047_0000477 3300049581 Bacteria 43621
1016 Ga0501047_0000748 3300049581 Bacteria 33896
1017 Ga0501047_0001953 3300049581 Bacteria 19818
1018 Ga0501047_0002209 3300049581 Bacteria 18637
1019 Ga0501047_0007329 3300049581 Bacteria 10376
1020 Ga0501047_0037545 3300049581 Bacteria 4683
1021 Ga0501047_0066774 3300049581 Bacteria 3467
1022 Ga0501047_0076713 3300049581 Bacteria 3216
1023 Ga0501047_0111666 3300049581 Bacteria 2616
1024 Ga0501048_0142948 3300049582 Bacteria 1692
1025 Ga0501067_0000969 3300049583 Bacteria 15401
1026 Ga0501068_0005485 3300049584 Bacteria 6949
1027 Ga0501069_0000532 3300049585 Bacteria 17429
1028 Ga0501069_0007893 3300049585 Bacteria 5588
1029 Ga0501069_0009522 3300049585 Bacteria 5127
1030 Ga0501069_0090389 3300049585 Bacteria 1731
1031 Ga0501070_0000511 3300049586 Bacteria 35493
1032 Ga0501070_0002026 3300049586 Bacteria 17808
1033 Ga0501070_0012868 3300049586 Bacteria 7050
1034 Ga0501070_0016349 3300049586 Bacteria 6232
1035 Ga0501070_0021521 3300049586 Bacteria 5410
1036 Ga0501070_0024738 3300049586 Bacteria 5036
1037 Ga0501070_0040547 3300049586 Bacteria 3882
1038 Ga0501070_0043234 3300049586 Bacteria 3750
1039 Ga0501071_0073858 3300049587 Bacteria 2488
1040 Ga0501072_0002332 3300049588 Bacteria 14238
1041 Ga0501073_0002861 3300049589 Bacteria 12925
1042 Ga0501073_0003322 3300049589 Bacteria 12092
1043 Ga0501073_0023664 3300049589 Bacteria 4408
1044 Ga0501073_0031131 3300049589 Bacteria 3807
1045 Ga0501073_0079942 3300049589 Bacteria 2275
1046 Ga0501073_0098852 3300049589 Bacteria 2026
1047 Ga0501074_0001728 3300049590 Bacteria 14921
1048 Ga0501074_0004828 3300049590 Bacteria 9660
1049 Ga0501074_0005047 3300049590 Bacteria 9468
1050 Ga0501074_0013979 3300049590 Bacteria 5834
1051 Ga0501074_0027291 3300049590 Bacteria 4140
1052 Ga0501074_0027950 3300049590 Bacteria 4088
1053 Ga0501074_0053095 3300049590 Bacteria 2925
1054 Ga0501079_0046112 3300049741 Bacteria 3363
1055 Ga0501079_0060209 3300049741 Bacteria 2929
1056 Ga0501080_0001987 3300049742 Bacteria 17631
1057 Ga0501080_0004316 3300049742 Bacteria 12625
1058 Ga0501080_0031269 3300049742 Bacteria 4960
1059 Ga0501080_0035546 3300049742 Bacteria 4649
1060 Ga0501080_0035641 3300049742 Bacteria 4643
1061 Ga0501080_0068947 3300049742 Bacteria 3289
1062 Ga0501080_0074831 3300049742 Bacteria 3150
1063 Ga0501081_0058272 3300049743 Bacteria 2672
1064 Ga0501035_0003159 3300049822 Bacteria 15825
1065 Ga0501035_0003545 3300049822 Bacteria 14903
1066 Ga0501035_0004047 3300049822 Bacteria 13963
1067 Ga0501035_0007349 3300049822 Bacteria 10297
1068 Ga0501035_0021417 3300049822 Bacteria 5942
1069 Ga0501035_0029276 3300049822 Bacteria 5022
1070 Ga0501035_0035399 3300049822 Bacteria 4531
1071 Ga0501035_0100174 3300049822 Bacteria 2543
1072 Ga0501035_0167572 3300049822 Bacteria 1899
1073 Ga0501035_0176765 3300049822 Bacteria 1841
1074 Ga0501044_0000987 3300049823 Bacteria 34197
1075 Ga0501044_0004695 3300049823 Bacteria 15274
1076 Ga0501044_0014274 3300049823 Bacteria 8576
1077 Ga0501044_0021149 3300049823 Bacteria 6946
1078 Ga0501044_0040777 3300049823 Bacteria 4837
1079 Ga0501044_0056198 3300049823 Bacteria 4040
1080 Ga0501044_0096875 3300049823 Bacteria 2971
1081 Ga0501044_0148263 3300049823 Bacteria 2329
1082 Ga0501044_0157883 3300049823 Bacteria 2246
1083 Ga0501045_0007173 3300049824 Bacteria 7732
1084 nmdc:mga03n38_275_c1 3300050490 Bacteria 12239
1085 nmdc:mga00v17_112_c1 3300050491 Bacteria 48527
1086 nmdc:mga00v17_1548_c1 3300050491 Bacteria 12001
1087 nmdc:mga00v17_458_c1 3300050491 Bacteria 22819
1088 nmdc:mga00v17_9702_c1 3300050491 Bacteria 5223
1089 nmdc:mga0yw44_153_c1 3300050492 Bacteria 23825
1090 nmdc:mga06z11_1243_c1 3300050494 Bacteria 9404
1091 nmdc:mga06z11_950_c1 3300050494 Bacteria 10551
1092 nmdc:mga04h51_1512_c1 3300050495 Bacteria 5389
1093 nmdc:mga07m45_132_c1 3300050496 Bacteria 29506
1094 nmdc:mga05p37_48674_c1 3300050507 Bacteria 5213
1095 nmdc:mga05p37_58838_c1 3300050507 Bacteria 4733
1096 nmdc:mga09592_3405_c1 3300050508 Bacteria 12857
1097 nmdc:mga0qj67_19462_c1 3300050509 Bacteria 5186
1098 nmdc:mga06r32_1946_c1 3300050510 Bacteria 18400
1099 nmdc:mga08y16_43276_c1 3300050511 Bacteria 4719
1100 nmdc:mga0n895_144402_c1 3300050512 Bacteria 2409
1101 nmdc:mga0n895_28377_c1 3300050512 Bacteria 5322
1102 nmdc:mga0a205_61957_c1 3300050515 Bacteria 3614
1103 nmdc:mga0sz30_24_c2 3300050516 Bacteria 23796
1104 Ga0500610_0002481 3300053079 Bacteria 6818
1105 Ga0500643_000020 3300053087 Bacteria 290328
1106 Ga0500643_007001 3300053087 Bacteria 4625
1107 Ga0500651_0000592 3300053093 Bacteria 18193
1108 Ga0500651_0009373 3300053093 Bacteria 5811
1109 Ga0500566_0052977 3300053094 Bacteria 2317
1110 Ga0500555_000336 3300053103 Bacteria 20134
1111 Ga0500568_0000145 3300053139 Bacteria 62300
1112 Ga0500638_050268 3300053162 Bacteria 2016
1113 Ga0500645_008678 3300053730 Bacteria 3449
1114 Ga0501084_0112104 3300054114 Bacteria 2292
1115 Ga0501082_0000082 3300060353 Bacteria 71065
1116 Ga0466962_0001777 3300061719 Bacteria 10145
1117 Ga0466962_0014644 3300061719 Bacteria 3779
1118 Ga0466962_0074995 3300061719 Bacteria 1616

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013308 Ga0157375_10073185 Ga0157375_100731853 361
2 3300046524 Ga0495648_0006343 Ga0495648_0006343_4203_5441 406
3 3300031665 Ga0316575_10027325 Ga0316575_100273252 411
4 3300046689 Ga0495613_0057452 Ga0495613_0057452_1597_2844 411
5 3300046794 Ga0495589_0047146 Ga0495589_0047146_875_2122 411
6 3300037466 Ga0395898_0286813 Ga0395898_0286813_300_1550 412
7 3300045049 Ga0466959_0020295 Ga0466959_0020295_2473_3852 413
8 3300035398 Ga0316574_0003460 Ga0316574_0003460_1114_2412 416
9 3300049571 Ga0501034_0310492 Ga0501034_0310492_208_1470 416
10 3300006844 Ga0075428_100248666 Ga0075428_1002486661 417
11 3300006846 Ga0075430_100065380 Ga0075430_1000653803 417
12 3300006847 Ga0075431_100000523 Ga0075431_10000052329 417
13 3300050509 nmdc:mga0qj67_19462_c1 nmdc:mga0qj67_19462_c1_238_1593 417
14 3300050510 nmdc:mga06r32_1946_c1 nmdc:mga06r32_1946_c1_15946_17301 417
15 3300048922 Ga0496119_0041560 Ga0496119_0041560_1203_2462 418
16 3300048926 Ga0496123_0055256 Ga0496123_0055256_59_1318 418
17 3300005364 Ga0070673_100035809 Ga0070673_1000358093 420
18 3300025940 Ga0207691_10152273 Ga0207691_101522732 420
19 3300038726 Ga0400490_03793 Ga0400490_03793_339_1610 421
20 3300038742 Ga0400486_17520 Ga0400486_17520_1003_2274 421
21 3300039062 Ga0400483_226110 Ga0400483_226110_1540_2811 421
22 3300046615 Ga0495656_0005789 Ga0495656_0005789_2467_3741 421
23 3300049586 Ga0501070_0016349 Ga0501070_0016349_2712_4088 421
24 3300007265 Ga0099794_10000547 Ga0099794_100005478 422
25 3300025912 Ga0207707_10016433 Ga0207707_100164335 422
26 3300036647 Ga0316582_0000279 Ga0316582_0000279_14647_15921 423
27 3300036712 Ga0316584_0011104 Ga0316584_0011104_4451_5725 423
28 3300049586 Ga0501070_0002026 Ga0501070_0002026_82_1362 423
29 3300049586 Ga0501070_0024738 Ga0501070_0024738_46_1326 423
30 3300009093 Ga0105240_10448027 Ga0105240_104480272 425
31 3300041453 Ga0451797_1127267 Ga0451797_1127267_239_1516 425
32 3300044765 Ga0466970_0000202 Ga0466970_0000202_8736_10139 425
33 3300046471 Ga0495650_0005338 Ga0495650_0005338_744_2096 426
34 3300005367 Ga0070667_100000005 Ga0070667_10000000520 427
35 3300005455 Ga0070663_100001614 Ga0070663_1000016145 427
36 3300005539 Ga0068853_100037423 Ga0068853_1000374231 427
37 3300009177 Ga0105248_10001462 Ga0105248_1000146217 427
38 3300009545 Ga0105237_10004545 Ga0105237_100045455 427
39 3300009553 Ga0105249_10000763 Ga0105249_1000076327 427
40 3300025914 Ga0207671_10003678 Ga0207671_1000367813 427
41 3300025941 Ga0207711_10001229 Ga0207711_100012298 427
42 3300025961 Ga0207712_10001183 Ga0207712_100011832 427
43 3300025986 Ga0207658_10000006 Ga0207658_10000006351 427
44 3300026041 Ga0207639_10000955 Ga0207639_1000095518 427
45 3300026067 Ga0207678_10004583 Ga0207678_100045839 427
46 3300048925 Ga0496122_0001419 Ga0496122_0001419_4954_6333 427
47 3300048929 Ga0496126_0067712 Ga0496126_0067712_1066_2445 427
48 3300053087 Ga0500643_007001 Ga0500643_007001_791_2170 427
49 3300047471 Ga0495684_0070247 Ga0495684_0070247_62_1357 429
50 3300027695 Ga0209966_1003940 Ga0209966_10039402 430
51 3300005843 Ga0068860_100070622 Ga0068860_1000706223 431
52 3300028381 Ga0268264_10016468 Ga0268264_100164685 431
53 3300025935 Ga0207709_10008328 Ga0207709_100083282 432
54 3300049569 Ga0501032_0005884 Ga0501032_0005884_2221_3600 432
55 3300049589 Ga0501073_0003322 Ga0501073_0003322_9930_11309 432
56 3300003856 Ga0058692_1000002 Ga0058692_1000002471 433
57 3300005435 Ga0070714_100022547 Ga0070714_1000225473 433
58 3300005530 Ga0070679_100017294 Ga0070679_1000172943 433
59 3300013296 Ga0157374_10042600 Ga0157374_100426005 433
60 3300014497 Ga0182008_10013586 Ga0182008_100135863 433
61 3300015262 Ga0182007_10006163 Ga0182007_100061633 433
62 3300025929 Ga0207664_10001222 Ga0207664_1000122217 433
63 3300027312 Ga0209371_1000004 Ga0209371_1000004677 433
64 3300030500 Ga0268256_1000005 Ga0268256_1000005369 433
65 3300048917 Ga0496114_0050953 Ga0496114_0050953_787_2175 433
66 3300031507 Ga0307509_10000229 Ga0307509_1000022954 436
67 3300047472 Ga0495686_0006769 Ga0495686_0006769_1267_2646 436
68 3300005467 Ga0070706_100137400 Ga0070706_1001374002 437
69 3300005468 Ga0070707_100044426 Ga0070707_1000444263 437
70 3300005471 Ga0070698_100003276 Ga0070698_1000032763 437
71 3300005518 Ga0070699_100006355 Ga0070699_10000635511 437
72 3300025910 Ga0207684_10129946 Ga0207684_101299461 437
73 3300049568 Ga0501031_0008301 Ga0501031_0008301_357_1736 438
74 3300049570 Ga0501033_0006466 Ga0501033_0006466_229_1608 438
75 3300049571 Ga0501034_0001661 Ga0501034_0001661_25163_26542 438
76 3300049572 Ga0501036_0031284 Ga0501036_0031284_2220_3599 438
77 3300049574 Ga0501038_0001377 Ga0501038_0001377_20295_21674 438
78 3300049575 Ga0501039_0046362 Ga0501039_0046362_536_1915 438
79 3300049579 Ga0501043_0022235 Ga0501043_0022235_1707_3086 438
80 3300049580 Ga0501046_0002951 Ga0501046_0002951_4397_5776 438
81 3300049581 Ga0501047_0007329 Ga0501047_0007329_5341_6720 438
82 3300049822 Ga0501035_0004047 Ga0501035_0004047_8800_10179 438
83 3300049823 Ga0501044_0056198 Ga0501044_0056198_536_1915 438
84 3300041494 Ga0451837_1201779 Ga0451837_1201779_1100_2479 440
85 3300061719 Ga0466962_0001777 Ga0466962_0001777_3231_4610 440
86 3300005458 Ga0070681_10000012 Ga0070681_10000012111 441
87 3300025912 Ga0207707_10000948 Ga0207707_1000094827 441
88 3300046665 Ga0495661_0000291 Ga0495661_0000291_1246_2703 441
89 3300006852 Ga0075433_10115062 Ga0075433_101150623 442
90 3300006871 Ga0075434_100148119 Ga0075434_1001481192 442
91 3300009147 Ga0114129_10011620 Ga0114129_100116202 442
92 3300009147 Ga0114129_10284607 Ga0114129_102846072 442
93 3300031691 Ga0316579_10002489 Ga0316579_100024892 442
94 3300031728 Ga0316578_10022778 Ga0316578_100227782 442
95 3300031733 Ga0316577_10022907 Ga0316577_100229072 442
96 3300032137 Ga0316585_10000379 Ga0316585_100003799 442
97 3300032139 Ga0316580_10000704 Ga0316580_100007044 442
98 3300035398 Ga0316574_0006784 Ga0316574_0006784_4189_5553 442
99 3300036647 Ga0316582_0003359 Ga0316582_0003359_1193_2557 442
100 3300036712 Ga0316584_0014954 Ga0316584_0014954_482_1846 442
101 3300050507 nmdc:mga05p37_58838_c1 nmdc:mga05p37_58838_c1_1380_2732 442
102 3300050512 nmdc:mga0n895_144402_c1 nmdc:mga0n895_144402_c1_500_1852 442
103 3300050515 nmdc:mga0a205_61957_c1 nmdc:mga0a205_61957_c1_2187_3539 442
104 3300013102 Ga0157371_10025362 Ga0157371_100253622 443
105 3300013102 Ga0157371_10063818 Ga0157371_100638182 443
106 3300013104 Ga0157370_10085469 Ga0157370_100854692 443
107 3300013105 Ga0157369_10045167 Ga0157369_100451673 443
108 3300015261 Ga0182006_1029139 Ga0182006_10291392 443
109 3300017792 Ga0163161_10009726 Ga0163161_100097263 443
110 3300025981 Ga0207640_10046461 Ga0207640_100464612 443
111 3300031911 Ga0307412_10002544 Ga0307412_100025443 443
112 3300042115 Ga0450911_000912 Ga0450911_000912_6096_7472 443
113 3300044712 Ga0453684_0000298 Ga0453684_0000298_10714_12093 443
114 3300045051 Ga0451576_0000033 Ga0451576_0000033_381039_382418 443
115 3300048919 Ga0496116_0006696 Ga0496116_0006696_6200_7576 443
116 3300048920 Ga0496117_0037026 Ga0496117_0037026_1504_2880 443
117 3300048921 Ga0496118_0018953 Ga0496118_0018953_2666_4042 443
118 3300048924 Ga0496121_0012110 Ga0496121_0012110_5561_6937 443
119 3300048926 Ga0496123_0030854 Ga0496123_0030854_124_1500 443
120 3300048927 Ga0496124_0064969 Ga0496124_0064969_1287_2663 443
121 3300048928 Ga0496125_0041081 Ga0496125_0041081_1609_2985 443
122 3300032004 Ga0307414_10001495 Ga0307414_100014953 444
123 3300054114 Ga0501084_0112104 Ga0501084_0112104_611_1969 444
124 3300032168 Ga0316593_10006078 Ga0316593_100060782 445
125 iso_pu_bacteria 2887375801 2887380371 445
126 3300005471 Ga0070698_100007458 Ga0070698_1000074582 446
127 3300005518 Ga0070699_100007511 Ga0070699_1000075118 446
128 3300006844 Ga0075428_100259391 Ga0075428_1002593912 446
129 3300009147 Ga0114129_10039875 Ga0114129_100398752 446
130 3300046453 Ga0495627_005291 Ga0495627_005291_3115_4458 446
131 3300048921 Ga0496118_0002288 Ga0496118_0002288_15858_17237 446
132 3300050507 nmdc:mga05p37_48674_c1 nmdc:mga05p37_48674_c1_164_1534 446
133 3300006048 Ga0075363_100000300 Ga0075363_1000003004 447
134 3300006178 Ga0075367_10001307 Ga0075367_100013073 447
135 3300006186 Ga0075369_10000096 Ga0075369_1000009624 447
136 3300006194 Ga0075427_10000040 Ga0075427_100000408 447
137 3300006353 Ga0075370_10000080 Ga0075370_1000008010 447
138 3300006871 Ga0075434_100030354 Ga0075434_1000303544 447
139 3300006880 Ga0075429_100006840 Ga0075429_1000068404 447
140 3300009093 Ga0105240_10074438 Ga0105240_100744383 447
141 3300013307 Ga0157372_10047036 Ga0157372_100470362 447
142 3300027866 Ga0209813_10001903 Ga0209813_100019032 447
143 3300031691 Ga0316579_10004798 Ga0316579_100047984 447
144 3300036712 Ga0316584_0203168 Ga0316584_0203168_26_1393 447
145 3300037588 Ga0316581_0013450 Ga0316581_0013450_879_2246 447
146 3300046460 Ga0495638_0003487 Ga0495638_0003487_4351_5811 447
147 3300046525 Ga0495663_0006399 Ga0495663_0006399_404_1864 447
148 3300049571 Ga0501034_0001357 Ga0501034_0001357_29969_31339 447
149 3300049581 Ga0501047_0000748 Ga0501047_0000748_30692_32062 447
150 3300049583 Ga0501067_0000969 Ga0501067_0000969_12428_13798 447
151 3300049585 Ga0501069_0007893 Ga0501069_0007893_2202_3572 447
152 3300049586 Ga0501070_0000511 Ga0501070_0000511_33006_34376 447
153 3300049588 Ga0501072_0002332 Ga0501072_0002332_8272_9642 447
154 3300049589 Ga0501073_0031131 Ga0501073_0031131_2342_3712 447
155 3300049590 Ga0501074_0027291 Ga0501074_0027291_1373_2743 447
156 3300049742 Ga0501080_0068947 Ga0501080_0068947_583_1953 447
157 3300049823 Ga0501044_0096875 Ga0501044_0096875_191_1561 447
158 3300050490 nmdc:mga03n38_275_c1 nmdc:mga03n38_275_c1_6499_7881 447
159 3300050491 nmdc:mga00v17_458_c1 nmdc:mga00v17_458_c1_9777_11159 447
160 3300050494 nmdc:mga06z11_950_c1 nmdc:mga06z11_950_c1_7344_8726 447
161 3300050495 nmdc:mga04h51_1512_c1 nmdc:mga04h51_1512_c1_258_1640 447
162 3300050496 nmdc:mga07m45_132_c1 nmdc:mga07m45_132_c1_16435_17817 447
163 3300050508 nmdc:mga09592_3405_c1 nmdc:mga09592_3405_c1_8991_10373 447
164 3300050512 nmdc:mga0n895_28377_c1 nmdc:mga0n895_28377_c1_2972_4354 447
165 3300050516 nmdc:mga0sz30_24_c2 nmdc:mga0sz30_24_c2_20450_21832 447
166 3300025906 Ga0207699_10133879 Ga0207699_101338792 448
167 3300041413 Ga0439465_0000621 Ga0439465_0000621_8422_9801 448
168 3300042007 Ga0439449_0000048 Ga0439449_0000048_18634_20013 448
169 3300046810 Ga0495660_0001860 Ga0495660_0001860_9570_11006 448
170 3300049742 Ga0501080_0031269 Ga0501080_0031269_2075_3454 448
171 iso_pu_bacteria 2855730933 2855736366 448
172 iso_pu_bacteria 2855767633 2855773303 448
173 3300009093 Ga0105240_10000898 Ga0105240_1000089815 449
174 3300009094 Ga0111539_10049286 Ga0111539_100492864 449
175 3300009551 Ga0105238_10000924 Ga0105238_1000092418 449
176 3300009979 Ga0105032_100667 Ga0105032_1006674 449
177 3300013308 Ga0157375_10019516 Ga0157375_100195162 449
178 3300014326 Ga0157380_10001358 Ga0157380_100013588 449
179 3300025913 Ga0207695_10001436 Ga0207695_1000143615 449
180 3300027907 Ga0207428_10051338 Ga0207428_100513382 449
181 3300041486 Ga0451807_1917614 Ga0451807_1917614_1418_2800 449
182 3300044693 Ga0466961_0013157 Ga0466961_0013157_320_1699 449
183 3300044765 Ga0466970_0003852 Ga0466970_0003852_2613_3992 449
184 3300044842 Ga0466957_0002054 Ga0466957_0002054_2681_4060 449
185 3300049576 Ga0501040_0001361 Ga0501040_0001361_4746_6137 449
186 3300049576 Ga0501040_0040908 Ga0501040_0040908_986_2365 449
187 3300049578 Ga0501042_0000268 Ga0501042_0000268_5970_7361 449
188 3300050511 nmdc:mga08y16_43276_c1 nmdc:mga08y16_43276_c1_1492_2847 449
189 3300005339 Ga0070660_100022544 Ga0070660_1000225442 450
190 3300005530 Ga0070679_100018115 Ga0070679_1000181154 450
191 3300005617 Ga0068859_100032636 Ga0068859_1000326362 450
192 3300005618 Ga0068864_100027618 Ga0068864_1000276185 450
193 3300005719 Ga0068861_100057351 Ga0068861_1000573512 450
194 3300005843 Ga0068860_100022592 Ga0068860_1000225923 450
195 3300006038 Ga0075365_10003207 Ga0075365_100032073 450
196 3300006051 Ga0075364_10000282 Ga0075364_1000028220 450
197 3300006931 Ga0097620_100032636 Ga0097620_1000326362 450
198 3300013105 Ga0157369_10046724 Ga0157369_100467243 450
199 3300013306 Ga0163162_10008148 Ga0163162_1000814812 450
200 3300014325 Ga0163163_10039519 Ga0163163_100395193 450
201 3300014968 Ga0157379_10040669 Ga0157379_100406692 450
202 3300025909 Ga0207705_10028909 Ga0207705_100289092 450
203 3300025919 Ga0207657_10014382 Ga0207657_100143822 450
204 3300025972 Ga0207668_10124978 Ga0207668_101249782 450
205 3300026035 Ga0207703_10190879 Ga0207703_101908791 450
206 3300026095 Ga0207676_10031909 Ga0207676_100319095 450
207 3300026118 Ga0207675_100171622 Ga0207675_1001716222 450
208 3300028379 Ga0268266_10096882 Ga0268266_100968823 450
209 3300028381 Ga0268264_10032018 Ga0268264_100320182 450
210 3300031901 Ga0307406_10000399 Ga0307406_100003995 450
211 3300037068 Ga0373925_0021331 Ga0373925_0021331_1289_2647 450
212 3300048925 Ga0496122_0002854 Ga0496122_0002854_19592_21010 450
213 3300049581 Ga0501047_0111666 Ga0501047_0111666_1109_2482 450
214 3300049589 Ga0501073_0079942 Ga0501073_0079942_729_2102 450
215 3300050491 nmdc:mga00v17_112_c1 nmdc:mga00v17_112_c1_22614_24005 450
216 3300050492 nmdc:mga0yw44_153_c1 nmdc:mga0yw44_153_c1_20758_22149 450
217 3300050494 nmdc:mga06z11_1243_c1 nmdc:mga06z11_1243_c1_7537_8928 450
218 iso_pu_bacteria 2888373701 2888375110 450
219 iso_pu_bacteria 8002392321 8002393463 450
220 3300002737 JGI25162J39368_1000226 JGI25162J39368_10002262 451
221 3300002741 JGI25157J39369_1001011 JGI25157J39369_100101115 451
222 3300002771 JGI25163J39215_1001647 JGI25163J39215_10016473 451
223 3300002772 JGI25164J39214_1000435 JGI25164J39214_100043527 451
224 3300003214 JGI25165J46597_1000260 JGI25165J46597_100026073 451
225 3300003759 Ga0055525_1000027 Ga0055525_1000027167 451
226 3300003760 Ga0055527_1000293 Ga0055527_100029322 451
227 3300003760 Ga0055527_1000294 Ga0055527_100029412 451
228 3300003761 Ga0055535_1000623 Ga0055535_100062311 451
229 3300003761 Ga0055535_1002731 Ga0055535_10027315 451
230 3300003762 Ga0055542_1000275 Ga0055542_10002752 451
231 3300003762 Ga0055542_1000649 Ga0055542_100064923 451
232 3300003763 Ga0055529_1000233 Ga0055529_100023373 451
233 3300003763 Ga0055529_1000684 Ga0055529_100068423 451
234 3300005617 Ga0068859_100149907 Ga0068859_1001499071 451
235 3300006931 Ga0097620_100149909 Ga0097620_1001499093 451
236 3300013296 Ga0157374_10011393 Ga0157374_100113934 451
237 3300013306 Ga0163162_10000015 Ga0163162_10000015157 451
238 3300025206 Ga0209435_103996 Ga0209435_1039962 451
239 3300025207 Ga0209760_100625 Ga0209760_1006251 451
240 3300025224 Ga0209784_100709 Ga0209784_10070910 451
241 3300025228 Ga0209672_100005 Ga0209672_100005669 451
242 3300025230 Ga0209563_100023 Ga0209563_100023328 451
243 3300025231 Ga0207427_100156 Ga0207427_10015610 451
244 3300025233 Ga0209437_100147 Ga0209437_10014710 451
245 3300025242 Ga0209258_100006 Ga0209258_100006669 451
246 3300025242 Ga0209258_100049 Ga0209258_10004998 451
247 3300025246 Ga0209646_1001618 Ga0209646_10016183 451
248 3300025250 Ga0209026_1000099 Ga0209026_1000099161 451
249 3300025254 Ga0209148_1000010 Ga0209148_1000010922 451
250 3300025254 Ga0209148_1000012 Ga0209148_1000012669 451
251 3300025256 Ga0209759_1001568 Ga0209759_100156810 451
252 3300025261 Ga0209233_1000009 Ga0209233_1000009248 451
253 3300025272 Ga0209455_1000008 Ga0209455_1000008669 451
254 3300025272 Ga0209455_1000086 Ga0209455_1000086249 451
255 3300031691 Ga0316579_10012808 Ga0316579_100128083 451
256 3300031727 Ga0316576_10012035 Ga0316576_100120354 451
257 3300031728 Ga0316578_10003942 Ga0316578_100039424 451
258 3300031824 Ga0307413_10000993 Ga0307413_100009936 451
259 3300035398 Ga0316574_0008025 Ga0316574_0008025_2910_4271 451
260 3300044693 Ga0466961_0005216 Ga0466961_0005216_5967_7388 451
261 3300044719 Ga0466971_0003757 Ga0466971_0003757_554_1975 451
262 3300044842 Ga0466957_0037073 Ga0466957_0037073_677_2098 451
263 3300045049 Ga0466959_0015572 Ga0466959_0015572_1143_2564 451
264 3300045836 Ga0466958_0044743 Ga0466958_0044743_125_1546 451
265 3300046558 Ga0495633_0013496 Ga0495633_0013496_624_2039 451
266 3300047323 Ga0495683_0000001 Ga0495683_0000001_1449698_1451077 451
267 3300048906 Ga0496103_0030329 Ga0496103_0030329_319_1692 451
268 3300048918 Ga0496115_0000062 Ga0496115_0000062_50604_51971 451
269 3300048929 Ga0496126_0000057 Ga0496126_0000057_25637_27004 451
270 3300049571 Ga0501034_0131845 Ga0501034_0131845_853_2298 451
271 3300053093 Ga0500651_0000592 Ga0500651_0000592_7228_8610 451
272 3300061719 Ga0466962_0074995 Ga0466962_0074995_127_1548 451
273 3300002737 JGI25162J39368_1005076 JGI25162J39368_10050762 452
274 3300003187 JGI25151J46595_10000195 JGI25151J46595_1000019528 452
275 3300003762 Ga0055542_1000744 Ga0055542_10007445 452
276 3300003781 Ga0055536_1005549 Ga0055536_10055494 452
277 3300003794 Ga0055531_10001282 Ga0055531_1000128216 452
278 3300005466 Ga0070685_10020643 Ga0070685_100206435 452
279 3300005548 Ga0070665_100055961 Ga0070665_1000559613 452
280 3300006051 Ga0075364_10019278 Ga0075364_100192782 452
281 3300010375 Ga0105239_10008425 Ga0105239_100084252 452
282 3300013307 Ga0157372_10037943 Ga0157372_100379432 452
283 3300014969 Ga0157376_10152496 Ga0157376_101524963 452
284 3300015689 Ga0183360_10001 Ga0183360_100012252 452
285 3300025228 Ga0209672_101666 Ga0209672_1016665 452
286 3300025231 Ga0207427_101364 Ga0207427_10136410 452
287 3300025233 Ga0209437_100224 Ga0209437_10022451 452
288 3300025254 Ga0209148_1000005 Ga0209148_1000005997 452
289 3300025261 Ga0209233_1014052 Ga0209233_10140522 452
290 3300025263 Ga0209565_1003582 Ga0209565_10035826 452
291 3300025292 Ga0209676_1000024 Ga0209676_1000024407 452
292 3300025292 Ga0209676_1001462 Ga0209676_100146212 452
293 3300025294 Ga0209025_1000040 Ga0209025_1000040278 452
294 3300025299 Ga0209256_1004202 Ga0209256_10042025 452
295 3300025304 Ga0209257_1000148 Ga0209257_1000148137 452
296 3300025304 Ga0209257_1000180 Ga0209257_100018070 452
297 3300025304 Ga0209257_1001906 Ga0209257_100190615 452
298 3300025932 Ga0207690_10069172 Ga0207690_100691722 452
299 3300026067 Ga0207678_10010017 Ga0207678_100100179 452
300 3300031456 Ga0307513_10004159 Ga0307513_1000415916 452
301 3300032139 Ga0316580_10025695 Ga0316580_100256951 452
302 3300032168 Ga0316593_10000834 Ga0316593_100008347 452
303 3300033541 Ga0316596_1000778 Ga0316596_10007783 452
304 3300039145 Ga0237816_00140 Ga0237816_00140_1454_2833 452
305 3300041413 Ga0439465_0013770 Ga0439465_0013770_236_1615 452
306 3300042004 Ga0439445_0005445 Ga0439445_0005445_439_1830 452
307 3300042876 Ga0451577_0017292 Ga0451577_0017292_3486_4904 452
308 3300046460 Ga0495638_0002596 Ga0495638_0002596_4250_5632 452
309 3300046460 Ga0495638_0012299 Ga0495638_0012299_4427_5809 452
310 3300046471 Ga0495650_0000450 Ga0495650_0000450_96_1478 452
311 3300046507 Ga0495606_0000401 Ga0495606_0000401_29030_30412 452
312 3300046522 Ga0495643_0007696 Ga0495643_0007696_4190_5566 452
313 3300046525 Ga0495663_0000662 Ga0495663_0000662_6908_8287 452
314 3300046557 Ga0495622_0013271 Ga0495622_0013271_2382_3764 452
315 3300046660 Ga0495625_0017336 Ga0495625_0017336_4200_5582 452
316 3300046694 Ga0495649_0001571 Ga0495649_0001571_9076_10458 452
317 3300047318 Ga0495636_0000912 Ga0495636_0000912_9286_10677 452
318 3300047318 Ga0495636_0019322 Ga0495636_0019322_1101_2492 452
319 3300047320 Ga0495672_0008952 Ga0495672_0008952_1716_3092 452
320 3300047472 Ga0495686_0005468 Ga0495686_0005468_5484_6863 452
321 3300048907 Ga0496104_0078965 Ga0496104_0078965_1473_2855 452
322 3300048918 Ga0496115_0000182 Ga0496115_0000182_4408_5790 452
323 3300048918 Ga0496115_0016934 Ga0496115_0016934_84_1466 452
324 3300048920 Ga0496117_0002445 Ga0496117_0002445_18091_19467 452
325 3300048920 Ga0496117_0004800 Ga0496117_0004800_7170_8552 452
326 3300048921 Ga0496118_0007325 Ga0496118_0007325_6240_7616 452
327 3300048921 Ga0496118_0011915 Ga0496118_0011915_2839_4221 452
328 3300048924 Ga0496121_0006097 Ga0496121_0006097_179_1591 452
329 3300048924 Ga0496121_0105816 Ga0496121_0105816_184_1554 452
330 3300048925 Ga0496122_0042883 Ga0496122_0042883_1416_2795 452
331 3300048926 Ga0496123_0018133 Ga0496123_0018133_1526_2908 452
332 3300048929 Ga0496126_0058144 Ga0496126_0058144_95_1477 452
333 3300048929 Ga0496126_0109745 Ga0496126_0109745_24_1406 452
334 3300049570 Ga0501033_0002339 Ga0501033_0002339_3144_4514 452
335 3300049571 Ga0501034_0000122 Ga0501034_0000122_4421_5809 452
336 3300049575 Ga0501039_0060274 Ga0501039_0060274_1011_2381 452
337 3300049581 Ga0501047_0000477 Ga0501047_0000477_30910_32280 452
338 3300049822 Ga0501035_0029276 Ga0501035_0029276_863_2233 452
339 3300049823 Ga0501044_0000987 Ga0501044_0000987_22000_23370 452
340 3300053079 Ga0500610_0002481 Ga0500610_0002481_1036_2421 452
341 3300003187 JGI25151J46595_10000183 JGI25151J46595_1000018372 453
342 3300003771 Ga0055526_1000157 Ga0055526_100015731 453
343 3300003773 Ga0055537_1000169 Ga0055537_100016938 453
344 3300003775 Ga0055524_1000288 Ga0055524_100028819 453
345 3300003784 Ga0055534_1000110 Ga0055534_100011028 453
346 3300003784 Ga0055534_1000393 Ga0055534_10003935 453
347 3300003790 Ga0055528_1000131 Ga0055528_100013131 453
348 3300003790 Ga0055528_1000946 Ga0055528_100094610 453
349 3300003791 Ga0055530_10005690 Ga0055530_100056904 453
350 3300003792 Ga0055540_1016278 Ga0055540_10162781 453
351 3300003794 Ga0055531_10017163 Ga0055531_100171632 453
352 3300005339 Ga0070660_100092497 Ga0070660_1000924972 453
353 3300005366 Ga0070659_100121716 Ga0070659_1001217162 453
354 3300005458 Ga0070681_10049132 Ga0070681_100491324 453
355 3300005530 Ga0070679_100091324 Ga0070679_1000913242 453
356 3300005577 Ga0068857_100018935 Ga0068857_1000189355 453
357 3300006051 Ga0075364_10064642 Ga0075364_100646422 453
358 3300013102 Ga0157371_10103052 Ga0157371_101030521 453
359 3300014497 Ga0182008_10005759 Ga0182008_100057592 453
360 3300015261 Ga0182006_1033402 Ga0182006_10334021 453
361 3300025245 Ga0207425_1001541 Ga0207425_10015417 453
362 3300025263 Ga0209565_1000001 Ga0209565_10000011605 453
363 3300025263 Ga0209565_1000014 Ga0209565_1000014481 453
364 3300025263 Ga0209565_1000081 Ga0209565_100008110 453
365 3300025273 Ga0209673_1000001 Ga0209673_10000011605 453
366 3300025273 Ga0209673_1001077 Ga0209673_10010778 453
367 3300025291 Ga0209675_1000001 Ga0209675_1000001929 453
368 3300025291 Ga0209675_1000021 Ga0209675_10000218 453
369 3300025292 Ga0209676_1003048 Ga0209676_10030482 453
370 3300025292 Ga0209676_1008220 Ga0209676_10082202 453
371 3300025294 Ga0209025_1000015 Ga0209025_1000015222 453
372 3300025295 Ga0209564_1000001 Ga0209564_10000011091 453
373 3300025295 Ga0209564_1000547 Ga0209564_100054711 453
374 3300025297 Ga0209758_1012329 Ga0209758_10123294 453
375 3300025298 Ga0209050_1000541 Ga0209050_10005412 453
376 3300025298 Ga0209050_1003486 Ga0209050_10034863 453
377 3300025299 Ga0209256_1000002 Ga0209256_1000002463 453
378 3300025299 Ga0209256_1007889 Ga0209256_10078894 453
379 3300025299 Ga0209256_1021245 Ga0209256_10212452 453
380 3300025304 Ga0209257_1000204 Ga0209257_10002042 453
381 3300025304 Ga0209257_1004808 Ga0209257_10048088 453
382 3300025304 Ga0209257_1009717 Ga0209257_10097172 453
383 3300025304 Ga0209257_1010648 Ga0209257_10106484 453
384 3300025912 Ga0207707_10036183 Ga0207707_100361833 453
385 3300025932 Ga0207690_10032621 Ga0207690_100326213 453
386 3300025932 Ga0207690_10075459 Ga0207690_100754592 453
387 3300030742 Ga0316183_1029247 Ga0316183_10292472 453
388 3300031824 Ga0307413_10091134 Ga0307413_100911342 453
389 3300032004 Ga0307414_10040419 Ga0307414_100404191 453
390 3300032004 Ga0307414_10062609 Ga0307414_100626093 453
391 3300038726 Ga0400490_30897 Ga0400490_30897_297_1664 453
392 3300038726 Ga0400490_38104 Ga0400490_38104_16716_18083 453
393 3300038741 Ga0400488_33615 Ga0400488_33615_297_1664 453
394 3300039062 Ga0400483_133713 Ga0400483_133713_3993_5360 453
395 3300041407 Ga0439447_000680 Ga0439447_000680_8868_10301 453
396 3300048909 Ga0496106_0001299 Ga0496106_0001299_1012_2403 453
397 3300048921 Ga0496118_0009833 Ga0496118_0009833_2884_4260 453
398 3300048921 Ga0496118_0073498 Ga0496118_0073498_200_1735 453
399 3300048927 Ga0496124_0000032 Ga0496124_0000032_228427_229821 453
400 3300048927 Ga0496124_0020781 Ga0496124_0020781_2981_4357 453
401 3300048927 Ga0496124_0051630 Ga0496124_0051630_1354_2730 453
402 3300048928 Ga0496125_0028197 Ga0496125_0028197_706_2082 453
403 3300049742 Ga0501080_0004316 Ga0501080_0004316_6073_7443 453
404 iso_pu_bacteria 2687453130 2687583778 453
405 iso_pu_bacteria 2739367700 2739730249 453
406 iso_pu_bacteria 2884411467 2884412156 453
407 iso_pu_bacteria 2928963466 2928967685 453
408 3300026118 Ga0207675_100198094 Ga0207675_1001980942 454
409 3300031852 Ga0307410_10027010 Ga0307410_100270103 454
410 3300039110 Ga0400487_61177 Ga0400487_61177_4992_6374 454
411 3300044712 Ga0453684_0008337 Ga0453684_0008337_7227_8603 454
412 3300046463 Ga0495653_0002459 Ga0495653_0002459_10473_11957 454
413 3300046558 Ga0495633_0008488 Ga0495633_0008488_62_1462 454
414 3300046689 Ga0495613_0007234 Ga0495613_0007234_6047_7531 454
415 3300047673 Ga0495593_0034417 Ga0495593_0034417_1250_2734 454
416 3300048925 Ga0496122_0001926 Ga0496122_0001926_5285_6670 454
417 3300048926 Ga0496123_0001882 Ga0496123_0001882_24664_26049 454
418 iso_pu_bacteria 2537561836 2538832264 454
419 iso_pu_bacteria 2547132130 2547500237 454
420 iso_pu_bacteria 2576861471 2578459143 454
421 iso_pu_bacteria 2593339238 2595446813 454
422 iso_pu_bacteria 2593339239 2595449569 454
423 iso_pu_bacteria 2643221562 2643830274 454
424 iso_pu_bacteria 2643221577 2643896791 454
425 iso_pu_bacteria 2643221685 2644478996 454
426 iso_pu_bacteria 2816332141 2816516242 454
427 iso_pu_bacteria 2818991440 2819563963 454
428 iso_pu_bacteria 2842391507 2842393573 454
429 iso_pu_bacteria 2842918807 2842919881 454
430 iso_pu_bacteria 2852649853 2852651500 454
431 iso_pu_bacteria 2857442823 2857443025 454
432 iso_pu_bacteria 2874220319 2874220834 454
433 iso_pu_bacteria 2895395659 2895397661 454
434 iso_pu_bacteria 2904463128 2904464599 454
435 iso_pu_bacteria 2919089067 2919092651 454
436 iso_pu_bacteria 2919134579 2919136950 454
437 iso_pu_bacteria 2919404418 2919406098 454
438 iso_pu_bacteria 2928496128 2928496848 454
439 iso_pu_bacteria 2931380184 2931381542 454
440 iso_pu_bacteria 2937610967 2937611665 454
441 iso_pu_bacteria 2939589442 2939592243 454
442 iso_pu_bacteria 2939611941 2939612524 454
443 iso_pu_bacteria 2939626828 2939627599 454
444 iso_pu_bacteria 2941475908 2941476932 454
445 iso_pu_bacteria 2953994433 2953995180 454
446 iso_pu_bacteria 2961047084 2961047599 454
447 iso_pu_bacteria 2961064222 2961068430 454
448 iso_pu_bacteria 2974307012 2974309578 454
449 iso_pu_bacteria 2977247770 2977250316 454
450 iso_pu_bacteria 2984514374 2984515209 454
451 3300001915 JGI24741J21665_1002156 JGI24741J21665_10021565 455
452 3300001979 JGI24740J21852_10002197 JGI24740J21852_100021975 455
453 3300001979 JGI24740J21852_10005668 JGI24740J21852_100056684 455
454 3300005327 Ga0070658_10004423 Ga0070658_100044233 455
455 3300005329 Ga0070683_100009388 Ga0070683_1000093888 455
456 3300005329 Ga0070683_100030128 Ga0070683_1000301284 455
457 3300005335 Ga0070666_10000005 Ga0070666_10000005131 455
458 3300005335 Ga0070666_10000109 Ga0070666_1000010925 455
459 3300005336 Ga0070680_100019943 Ga0070680_1000199433 455
460 3300005339 Ga0070660_100093919 Ga0070660_1000939192 455
461 3300005344 Ga0070661_100025439 Ga0070661_1000254391 455
462 3300005344 Ga0070661_100224930 Ga0070661_1002249301 455
463 3300005345 Ga0070692_10013541 Ga0070692_100135414 455
464 3300005458 Ga0070681_10021334 Ga0070681_100213344 455
465 3300005530 Ga0070679_100020190 Ga0070679_1000201903 455
466 3300005530 Ga0070679_100190477 Ga0070679_1001904771 455
467 3300005535 Ga0070684_100043290 Ga0070684_1000432904 455
468 3300005546 Ga0070696_100087642 Ga0070696_1000876423 455
469 3300005548 Ga0070665_100007314 Ga0070665_1000073148 455
470 3300005563 Ga0068855_100175469 Ga0068855_1001754692 455
471 3300005564 Ga0070664_100142482 Ga0070664_1001424822 455
472 3300005577 Ga0068857_100027344 Ga0068857_1000273443 455
473 3300005614 Ga0068856_100047688 Ga0068856_1000476883 455
474 3300005614 Ga0068856_100061782 Ga0068856_1000617823 455
475 3300005616 Ga0068852_100070903 Ga0068852_1000709032 455
476 3300005616 Ga0068852_100145566 Ga0068852_1001455661 455
477 3300005834 Ga0068851_10034009 Ga0068851_100340092 455
478 3300009174 Ga0105241_10055513 Ga0105241_100555132 455
479 3300009545 Ga0105237_10291157 Ga0105237_102911571 455
480 3300013100 Ga0157373_10028299 Ga0157373_100282993 455
481 3300013104 Ga0157370_10007052 Ga0157370_100070525 455
482 3300013296 Ga0157374_10144118 Ga0157374_101441182 455
483 3300014325 Ga0163163_10000196 Ga0163163_100001962 455
484 3300020070 Ga0206356_10829538 Ga0206356_108295382 455
485 3300020070 Ga0206356_11137636 Ga0206356_111376361 455
486 3300020081 Ga0206354_11451415 Ga0206354_114514156 455
487 3300020082 Ga0206353_10693000 Ga0206353_106930001 455
488 3300020610 Ga0154015_1092133 Ga0154015_10921333 455
489 3300025321 Ga0207656_10004357 Ga0207656_100043575 455
490 3300025728 Ga0207655_1000162 Ga0207655_100016290 455
491 3300025735 Ga0207713_1039274 Ga0207713_10392742 455
492 3300025903 Ga0207680_10000005 Ga0207680_10000005489 455
493 3300025903 Ga0207680_10000255 Ga0207680_1000025515 455
494 3300025904 Ga0207647_10000759 Ga0207647_100007595 455
495 3300025904 Ga0207647_10011995 Ga0207647_100119954 455
496 3300025909 Ga0207705_10000206 Ga0207705_1000020632 455
497 3300025909 Ga0207705_10002274 Ga0207705_100022746 455
498 3300025909 Ga0207705_10002283 Ga0207705_100022833 455
499 3300025909 Ga0207705_10005224 Ga0207705_100052242 455
500 3300025912 Ga0207707_10000244 Ga0207707_1000024412 455
501 3300025912 Ga0207707_10003238 Ga0207707_100032388 455
502 3300025912 Ga0207707_10005253 Ga0207707_100052533 455
503 3300025912 Ga0207707_10008914 Ga0207707_100089143 455
504 3300025912 Ga0207707_10014797 Ga0207707_100147974 455
505 3300025913 Ga0207695_10001823 Ga0207695_100018233 455
506 3300025913 Ga0207695_10008391 Ga0207695_1000839115 455
507 3300025913 Ga0207695_10026197 Ga0207695_100261973 455
508 3300025917 Ga0207660_10002480 Ga0207660_100024807 455
509 3300025917 Ga0207660_10004546 Ga0207660_100045464 455
510 3300025917 Ga0207660_10008645 Ga0207660_100086453 455
511 3300025919 Ga0207657_10018424 Ga0207657_100184243 455
512 3300025919 Ga0207657_10021615 Ga0207657_100216154 455
513 3300025919 Ga0207657_10035226 Ga0207657_100352263 455
514 3300025920 Ga0207649_10010415 Ga0207649_100104153 455
515 3300025921 Ga0207652_10000644 Ga0207652_100006445 455
516 3300025921 Ga0207652_10002333 Ga0207652_100023339 455
517 3300025932 Ga0207690_10000864 Ga0207690_100008644 455
518 3300025932 Ga0207690_10000975 Ga0207690_1000097511 455
519 3300025933 Ga0207706_10022696 Ga0207706_100226963 455
520 3300025944 Ga0207661_10006751 Ga0207661_100067518 455
521 3300025944 Ga0207661_10010584 Ga0207661_100105843 455
522 3300025945 Ga0207679_10041737 Ga0207679_100417373 455
523 3300025949 Ga0207667_10000386 Ga0207667_1000038632 455
524 3300025949 Ga0207667_10005108 Ga0207667_1000510812 455
525 3300025949 Ga0207667_10005523 Ga0207667_100055234 455
526 3300025949 Ga0207667_10064166 Ga0207667_100641663 455
527 3300025981 Ga0207640_10002161 Ga0207640_100021615 455
528 3300025981 Ga0207640_10004984 Ga0207640_100049847 455
529 3300026041 Ga0207639_10002731 Ga0207639_100027313 455
530 3300026041 Ga0207639_10009277 Ga0207639_100092772 455
531 3300026067 Ga0207678_10023472 Ga0207678_100234723 455
532 3300026067 Ga0207678_10034687 Ga0207678_100346873 455
533 3300026067 Ga0207678_10068449 Ga0207678_100684492 455
534 3300026078 Ga0207702_10001534 Ga0207702_100015347 455
535 3300026078 Ga0207702_10037249 Ga0207702_100372492 455
536 3300026078 Ga0207702_10083608 Ga0207702_100836082 455
537 3300026116 Ga0207674_10011343 Ga0207674_100113435 455
538 3300026116 Ga0207674_10021905 Ga0207674_100219053 455
539 3300026116 Ga0207674_10077428 Ga0207674_100774281 455
540 3300026142 Ga0207698_10039764 Ga0207698_100397643 455
541 3300028379 Ga0268266_10000004 Ga0268266_100000041042 455
542 3300032168 Ga0316593_10013215 Ga0316593_100132152 455
543 3300033180 Ga0307510_10002044 Ga0307510_1000204421 455
544 3300033180 Ga0307510_10025630 Ga0307510_100256304 455
545 3300037418 Ga0395900_0047496 Ga0395900_0047496_852_2228 455
546 3300046471 Ga0495650_0001325 Ga0495650_0001325_399_1784 455
547 3300046522 Ga0495643_0003848 Ga0495643_0003848_94_1464 455
548 3300048905 Ga0496102_0127663 Ga0496102_0127663_110_1510 455
549 3300048913 Ga0496110_0046966 Ga0496110_0046966_1071_2441 455
550 3300048921 Ga0496118_0003187 Ga0496118_0003187_3027_4397 455
551 3300048921 Ga0496118_0009162 Ga0496118_0009162_6428_7828 455
552 3300048925 Ga0496122_0044085 Ga0496122_0044085_175_1611 455
553 3300048926 Ga0496123_0002675 Ga0496123_0002675_17256_18692 455
554 3300048928 Ga0496125_0103335 Ga0496125_0103335_537_1922 455
555 3300048929 Ga0496126_0011872 Ga0496126_0011872_7354_8739 455
556 3300049571 Ga0501034_0002041 Ga0501034_0002041_10758_12134 455
557 3300049585 Ga0501069_0000532 Ga0501069_0000532_7726_9216 455
558 3300049585 Ga0501069_0090389 Ga0501069_0090389_184_1560 455
559 3300049589 Ga0501073_0002861 Ga0501073_0002861_9438_10814 455
560 3300049590 Ga0501074_0013979 Ga0501074_0013979_96_1472 455
561 3300049823 Ga0501044_0021149 Ga0501044_0021149_4565_5941 455
562 iso_pu_bacteria 2718218334 2721026520 455
563 iso_pu_bacteria 2734482264 2735833485 455
564 iso_pu_bacteria 2738543009 2739229486 455
565 iso_pu_bacteria 2765235840 2765578198 455
566 iso_pu_bacteria 2842914999 2842918497 455
567 iso_pu_bacteria 2848694841 2848700147 455
568 iso_pu_bacteria 2884338543 2884341479 455
569 iso_pu_bacteria 2895498888 2895499169 455
570 iso_pu_bacteria 2895511927 2895512191 455
571 iso_pu_bacteria 2895522137 2895522202 455
572 iso_pu_bacteria 2895525241 2895527355 455
573 iso_pu_bacteria 2919085039 2919088319 455
574 iso_pu_bacteria 2919513703 2919516508 455
575 iso_pu_bacteria 2919675420 2919678608 455
576 iso_pu_bacteria 2941471342 2941472929 455
577 3300001915 JGI24741J21665_1009817 JGI24741J21665_10098172 456
578 3300005331 Ga0070670_100015079 Ga0070670_1000150793 456
579 3300005336 Ga0070680_100000582 Ga0070680_1000005828 456
580 3300005336 Ga0070680_100011170 Ga0070680_1000111705 456
581 3300005341 Ga0070691_10004017 Ga0070691_100040173 456
582 3300005344 Ga0070661_100066014 Ga0070661_1000660142 456
583 3300005347 Ga0070668_100055546 Ga0070668_1000555462 456
584 3300005366 Ga0070659_100040216 Ga0070659_1000402163 456
585 3300005455 Ga0070663_100030288 Ga0070663_1000302883 456
586 3300005455 Ga0070663_100063269 Ga0070663_1000632693 456
587 3300005457 Ga0070662_100029847 Ga0070662_1000298473 456
588 3300005458 Ga0070681_10000151 Ga0070681_1000015114 456
589 3300005458 Ga0070681_10015872 Ga0070681_100158723 456
590 3300005530 Ga0070679_100000250 Ga0070679_1000002505 456
591 3300005530 Ga0070679_100002170 Ga0070679_10000217015 456
592 3300005547 Ga0070693_100011978 Ga0070693_1000119782 456
593 3300005548 Ga0070665_100002080 Ga0070665_1000020803 456
594 3300005548 Ga0070665_100081154 Ga0070665_1000811544 456
595 3300005578 Ga0068854_100018464 Ga0068854_1000184644 456
596 3300005842 Ga0068858_100000756 Ga0068858_10000075631 456
597 3300009553 Ga0105249_10005381 Ga0105249_100053813 456
598 3300010375 Ga0105239_10039052 Ga0105239_100390526 456
599 3300013104 Ga0157370_10002303 Ga0157370_100023036 456
600 3300013297 Ga0157378_10000043 Ga0157378_1000004326 456
601 3300013307 Ga0157372_10005235 Ga0157372_100052353 456
602 3300025321 Ga0207656_10001704 Ga0207656_100017043 456
603 3300025903 Ga0207680_10000514 Ga0207680_1000051413 456
604 3300025904 Ga0207647_10000343 Ga0207647_100003434 456
605 3300025912 Ga0207707_10000064 Ga0207707_1000006451 456
606 3300025912 Ga0207707_10000146 Ga0207707_1000014664 456
607 3300025917 Ga0207660_10000399 Ga0207660_100003993 456
608 3300025917 Ga0207660_10000676 Ga0207660_1000067625 456
609 3300025921 Ga0207652_10000019 Ga0207652_10000019102 456
610 3300025921 Ga0207652_10000084 Ga0207652_1000008428 456
611 3300025924 Ga0207694_10002417 Ga0207694_100024173 456
612 3300025933 Ga0207706_10011833 Ga0207706_100118335 456
613 3300025949 Ga0207667_10033066 Ga0207667_100330662 456
614 3300025961 Ga0207712_10001310 Ga0207712_1000131010 456
615 3300025981 Ga0207640_10006665 Ga0207640_100066655 456
616 3300026035 Ga0207703_10000809 Ga0207703_100008093 456
617 3300026041 Ga0207639_10003037 Ga0207639_100030377 456
618 3300026041 Ga0207639_10174747 Ga0207639_101747472 456
619 3300026067 Ga0207678_10003502 Ga0207678_100035023 456
620 3300026067 Ga0207678_10185639 Ga0207678_101856392 456
621 3300026078 Ga0207702_10011344 Ga0207702_100113445 456
622 3300026089 Ga0207648_10139731 Ga0207648_101397312 456
623 3300028379 Ga0268266_10000006 Ga0268266_100000061091 456
624 3300028379 Ga0268266_10036448 Ga0268266_100364482 456
625 3300031730 Ga0307516_10016729 Ga0307516_100167296 456
626 3300037418 Ga0395900_0068940 Ga0395900_0068940_1133_2512 456
627 3300049568 Ga0501031_0028021 Ga0501031_0028021_1153_2526 456
628 3300049569 Ga0501032_0014147 Ga0501032_0014147_2879_4252 456
629 3300049570 Ga0501033_0000329 Ga0501033_0000329_13446_14819 456
630 3300049570 Ga0501033_0007203 Ga0501033_0007203_2092_3471 456
631 3300049571 Ga0501034_0003703 Ga0501034_0003703_9953_11326 456
632 3300049571 Ga0501034_0137324 Ga0501034_0137324_1031_2401 456
633 3300049572 Ga0501036_0020553 Ga0501036_0020553_4110_5489 456
634 3300049572 Ga0501036_0022920 Ga0501036_0022920_167_1540 456
635 3300049572 Ga0501036_0052114 Ga0501036_0052114_997_2370 456
636 3300049573 Ga0501037_0004358 Ga0501037_0004358_4776_6149 456
637 3300049573 Ga0501037_0012058 Ga0501037_0012058_3902_5275 456
638 3300049573 Ga0501037_0082153 Ga0501037_0082153_942_2312 456
639 3300049573 Ga0501037_0083968 Ga0501037_0083968_22_1401 456
640 3300049574 Ga0501038_0002332 Ga0501038_0002332_3471_4844 456
641 3300049574 Ga0501038_0063967 Ga0501038_0063967_703_2076 456
642 3300049575 Ga0501039_0026295 Ga0501039_0026295_1488_2861 456
643 3300049579 Ga0501043_0004587 Ga0501043_0004587_2134_3507 456
644 3300049579 Ga0501043_0008045 Ga0501043_0008045_4241_5611 456
645 3300049579 Ga0501043_0040904 Ga0501043_0040904_1299_2669 456
646 3300049580 Ga0501046_0053265 Ga0501046_0053265_1803_3173 456
647 3300049580 Ga0501046_0058487 Ga0501046_0058487_626_1999 456
648 3300049580 Ga0501046_0109773 Ga0501046_0109773_695_2068 456
649 3300049581 Ga0501047_0001953 Ga0501047_0001953_2868_4238 456
650 3300049581 Ga0501047_0002209 Ga0501047_0002209_12089_13459 456
651 3300049581 Ga0501047_0037545 Ga0501047_0037545_380_1753 456
652 3300049581 Ga0501047_0076713 Ga0501047_0076713_239_1618 456
653 3300049582 Ga0501048_0142948 Ga0501048_0142948_62_1432 456
654 3300049584 Ga0501068_0005485 Ga0501068_0005485_1834_3207 456
655 3300049585 Ga0501069_0009522 Ga0501069_0009522_365_1744 456
656 3300049586 Ga0501070_0012868 Ga0501070_0012868_4518_5897 456
657 3300049586 Ga0501070_0021521 Ga0501070_0021521_1417_2796 456
658 3300049586 Ga0501070_0040547 Ga0501070_0040547_1043_2422 456
659 3300049586 Ga0501070_0043234 Ga0501070_0043234_1884_3254 456
660 3300049587 Ga0501071_0073858 Ga0501071_0073858_356_1729 456
661 3300049589 Ga0501073_0023664 Ga0501073_0023664_2899_4272 456
662 3300049589 Ga0501073_0098852 Ga0501073_0098852_103_1473 456
663 3300049590 Ga0501074_0001728 Ga0501074_0001728_5083_6462 456
664 3300049590 Ga0501074_0004828 Ga0501074_0004828_1396_2775 456
665 3300049590 Ga0501074_0005047 Ga0501074_0005047_641_2011 456
666 3300049590 Ga0501074_0027950 Ga0501074_0027950_2508_3881 456
667 3300049590 Ga0501074_0053095 Ga0501074_0053095_347_1717 456
668 3300049741 Ga0501079_0046112 Ga0501079_0046112_824_2197 456
669 3300049741 Ga0501079_0060209 Ga0501079_0060209_1406_2776 456
670 3300049742 Ga0501080_0001987 Ga0501080_0001987_12894_14264 456
671 3300049742 Ga0501080_0035546 Ga0501080_0035546_3170_4543 456
672 3300049742 Ga0501080_0035641 Ga0501080_0035641_2509_3882 456
673 3300049742 Ga0501080_0074831 Ga0501080_0074831_494_1864 456
674 3300049743 Ga0501081_0058272 Ga0501081_0058272_1124_2497 456
675 3300049822 Ga0501035_0003159 Ga0501035_0003159_8544_9917 456
676 3300049822 Ga0501035_0003545 Ga0501035_0003545_3499_4878 456
677 3300049822 Ga0501035_0021417 Ga0501035_0021417_4212_5585 456
678 3300049822 Ga0501035_0035399 Ga0501035_0035399_665_2044 456
679 3300049822 Ga0501035_0100174 Ga0501035_0100174_1041_2420 456
680 3300049822 Ga0501035_0176765 Ga0501035_0176765_60_1433 456
681 3300049823 Ga0501044_0148263 Ga0501044_0148263_722_2095 456
682 3300049823 Ga0501044_0157883 Ga0501044_0157883_609_1982 456
683 3300049824 Ga0501045_0007173 Ga0501045_0007173_1822_3195 456
684 3300053139 Ga0500568_0000145 Ga0500568_0000145_16144_17517 456
685 3300060353 Ga0501082_0000082 Ga0501082_0000082_42559_43932 456
686 iso_pu_bacteria 2643221695 2644528817 456
687 iso_pu_bacteria 2842757796 2842759398 456
688 iso_pu_bacteria 2941489479 2941489558 456
689 iso_pu_bacteria 2995948881 2995950906 456
690 iso_pu_bacteria 8003014200 8003014691 456
691 3300001989 JGI24739J22299_10002332 JGI24739J22299_100023324 457
692 3300001989 JGI24739J22299_10013417 JGI24739J22299_100134172 457
693 3300001990 JGI24737J22298_10000899 JGI24737J22298_1000089911 457
694 3300001990 JGI24737J22298_10016466 JGI24737J22298_100164662 457
695 3300002705 JGI25156J39149_1007693 JGI25156J39149_10076932 457
696 3300002737 JGI25162J39368_1000686 JGI25162J39368_100068618 457
697 3300002741 JGI25157J39369_1001369 JGI25157J39369_10013694 457
698 3300002772 JGI25164J39214_1000045 JGI25164J39214_100004599 457
699 3300003214 JGI25165J46597_1000072 JGI25165J46597_100007299 457
700 3300003578 Ga0006562J51391_1014504 Ga0006562J51391_10145042 457
701 3300003578 Ga0006562J51391_1014508 Ga0006562J51391_10145084 457
702 3300003756 Ga0055533_1000545 Ga0055533_10005453 457
703 3300003760 Ga0055527_1000694 Ga0055527_10006946 457
704 3300003761 Ga0055535_1001746 Ga0055535_10017466 457
705 3300003761 Ga0055535_1001841 Ga0055535_10018418 457
706 3300003761 Ga0055535_1002043 Ga0055535_10020436 457
707 3300003762 Ga0055542_1000329 Ga0055542_100032950 457
708 3300003762 Ga0055542_1001536 Ga0055542_10015368 457
709 3300003762 Ga0055542_1001924 Ga0055542_10019246 457
710 3300003763 Ga0055529_1001153 Ga0055529_10011538 457
711 3300003763 Ga0055529_1001341 Ga0055529_10013416 457
712 3300005262 Ga0065165_1005214 Ga0065165_10052145 457
713 3300005288 Ga0065714_10014766 Ga0065714_100147662 457
714 3300005293 Ga0065715_10008318 Ga0065715_100083182 457
715 3300005334 Ga0068869_100056293 Ga0068869_1000562933 457
716 3300005335 Ga0070666_10091149 Ga0070666_100911491 457
717 3300005347 Ga0070668_100015112 Ga0070668_1000151122 457
718 3300005367 Ga0070667_100011088 Ga0070667_1000110887 457
719 3300005455 Ga0070663_100021593 Ga0070663_1000215934 457
720 3300005456 Ga0070678_100022542 Ga0070678_1000225422 457
721 3300005457 Ga0070662_100176421 Ga0070662_1001764211 457
722 3300005539 Ga0068853_100211371 Ga0068853_1002113711 457
723 3300005543 Ga0070672_100020456 Ga0070672_1000204564 457
724 3300005543 Ga0070672_100133477 Ga0070672_1001334772 457
725 3300005546 Ga0070696_100016563 Ga0070696_1000165632 457
726 3300005547 Ga0070693_100004804 Ga0070693_1000048043 457
727 3300005547 Ga0070693_100022508 Ga0070693_1000225082 457
728 3300005548 Ga0070665_100000057 Ga0070665_100000057222 457
729 3300005548 Ga0070665_100094147 Ga0070665_1000941473 457
730 3300005563 Ga0068855_100011362 Ga0068855_1000113627 457
731 3300005563 Ga0068855_100048818 Ga0068855_1000488182 457
732 3300005563 Ga0068855_100051540 Ga0068855_1000515402 457
733 3300005578 Ga0068854_100007062 Ga0068854_1000070627 457
734 3300005614 Ga0068856_100000562 Ga0068856_1000005623 457
735 3300005614 Ga0068856_100014061 Ga0068856_1000140614 457
736 3300005614 Ga0068856_100017954 Ga0068856_1000179542 457
737 3300005616 Ga0068852_100082345 Ga0068852_1000823452 457
738 3300005617 Ga0068859_100001188 Ga0068859_10000118816 457
739 3300005618 Ga0068864_100248184 Ga0068864_1002481842 457
740 3300006358 Ga0068871_100148287 Ga0068871_1001482871 457
741 3300006931 Ga0097620_100001188 Ga0097620_10000118816 457
742 3300009093 Ga0105240_10010308 Ga0105240_100103089 457
743 3300009093 Ga0105240_10016744 Ga0105240_1001674411 457
744 3300009174 Ga0105241_10003742 Ga0105241_100037424 457
745 3300009174 Ga0105241_10024704 Ga0105241_100247044 457
746 3300009545 Ga0105237_10000064 Ga0105237_1000006454 457
747 3300009545 Ga0105237_10000183 Ga0105237_1000018340 457
748 3300009551 Ga0105238_10006865 Ga0105238_100068657 457
749 3300010375 Ga0105239_10009795 Ga0105239_100097952 457
750 3300010375 Ga0105239_10066978 Ga0105239_100669784 457
751 3300013105 Ga0157369_10003447 Ga0157369_100034475 457
752 3300013105 Ga0157369_10004837 Ga0157369_100048374 457
753 3300013105 Ga0157369_10028624 Ga0157369_100286244 457
754 3300013306 Ga0163162_10009175 Ga0163162_100091753 457
755 3300013306 Ga0163162_10045124 Ga0163162_100451242 457
756 3300013307 Ga0157372_10005613 Ga0157372_1000561310 457
757 3300013307 Ga0157372_10039541 Ga0157372_100395414 457
758 3300013307 Ga0157372_10125511 Ga0157372_101255113 457
759 3300013308 Ga0157375_10062201 Ga0157375_100622012 457
760 3300014968 Ga0157379_10067062 Ga0157379_100670622 457
761 3300014969 Ga0157376_10002600 Ga0157376_100026005 457
762 3300015685 Ga0183369_1007 Ga0183369_1007368 457
763 3300015687 Ga0183368_1003 Ga0183368_1003715 457
764 3300025226 Ga0209674_100012 Ga0209674_100012466 457
765 3300025226 Ga0209674_100119 Ga0209674_100119113 457
766 3300025226 Ga0209674_100603 Ga0209674_10060315 457
767 3300025228 Ga0209672_100016 Ga0209672_100016317 457
768 3300025228 Ga0209672_100312 Ga0209672_10031212 457
769 3300025231 Ga0207427_100055 Ga0207427_100055112 457
770 3300025233 Ga0209437_100161 Ga0209437_100161117 457
771 3300025233 Ga0209437_104309 Ga0209437_1043093 457
772 3300025242 Ga0209258_100012 Ga0209258_100012458 457
773 3300025242 Ga0209258_100064 Ga0209258_100064199 457
774 3300025242 Ga0209258_100186 Ga0209258_10018627 457
775 3300025242 Ga0209258_101060 Ga0209258_1010603 457
776 3300025246 Ga0209646_1001220 Ga0209646_10012204 457
777 3300025250 Ga0209026_1000122 Ga0209026_100012216 457
778 3300025250 Ga0209026_1000541 Ga0209026_10005414 457
779 3300025253 Ga0209677_101301 Ga0209677_1013017 457
780 3300025254 Ga0209148_1000014 Ga0209148_1000014198 457
781 3300025254 Ga0209148_1000073 Ga0209148_1000073115 457
782 3300025254 Ga0209148_1000142 Ga0209148_100014288 457
783 3300025256 Ga0209759_1000103 Ga0209759_1000103118 457
784 3300025256 Ga0209759_1000792 Ga0209759_10007924 457
785 3300025256 Ga0209759_1005814 Ga0209759_10058142 457
786 3300025258 Ga0209129_1000752 Ga0209129_100075219 457
787 3300025261 Ga0209233_1000063 Ga0209233_1000063262 457
788 3300025261 Ga0209233_1000736 Ga0209233_10007364 457
789 3300025272 Ga0209455_1000014 Ga0209455_100001486 457
790 3300025272 Ga0209455_1000177 Ga0209455_100017727 457
791 3300025272 Ga0209455_1000308 Ga0209455_100030826 457
792 3300025297 Ga0209758_1001371 Ga0209758_100137126 457
793 3300025904 Ga0207647_10007235 Ga0207647_100072354 457
794 3300025904 Ga0207647_10011712 Ga0207647_100117125 457
795 3300025904 Ga0207647_10038298 Ga0207647_100382983 457
796 3300025907 Ga0207645_10050498 Ga0207645_100504982 457
797 3300025911 Ga0207654_10029838 Ga0207654_100298384 457
798 3300025912 Ga0207707_10192832 Ga0207707_101928322 457
799 3300025913 Ga0207695_10000007 Ga0207695_10000007779 457
800 3300025913 Ga0207695_10011400 Ga0207695_1001140011 457
801 3300025913 Ga0207695_10016742 Ga0207695_100167424 457
802 3300025914 Ga0207671_10000061 Ga0207671_1000006182 457
803 3300025914 Ga0207671_10000329 Ga0207671_1000032968 457
804 3300025914 Ga0207671_10003503 Ga0207671_1000350311 457
805 3300025914 Ga0207671_10023978 Ga0207671_100239784 457
806 3300025919 Ga0207657_10023056 Ga0207657_100230562 457
807 3300025920 Ga0207649_10000847 Ga0207649_1000084715 457
808 3300025924 Ga0207694_10003467 Ga0207694_100034674 457
809 3300025934 Ga0207686_10046784 Ga0207686_100467842 457
810 3300025937 Ga0207669_10045469 Ga0207669_100454693 457
811 3300025940 Ga0207691_10057527 Ga0207691_100575272 457
812 3300025940 Ga0207691_10100639 Ga0207691_101006392 457
813 3300025942 Ga0207689_10019419 Ga0207689_100194196 457
814 3300025949 Ga0207667_10007230 Ga0207667_100072308 457
815 3300025949 Ga0207667_10011673 Ga0207667_100116733 457
816 3300025949 Ga0207667_10014077 Ga0207667_100140777 457
817 3300025981 Ga0207640_10000378 Ga0207640_1000037831 457
818 3300025981 Ga0207640_10007842 Ga0207640_100078423 457
819 3300025981 Ga0207640_10183856 Ga0207640_101838562 457
820 3300025986 Ga0207658_10054137 Ga0207658_100541372 457
821 3300026041 Ga0207639_10009814 Ga0207639_100098144 457
822 3300026067 Ga0207678_10019059 Ga0207678_100190596 457
823 3300026078 Ga0207702_10000580 Ga0207702_100005803 457
824 3300026078 Ga0207702_10002243 Ga0207702_1000224312 457
825 3300026078 Ga0207702_10013254 Ga0207702_100132549 457
826 3300026078 Ga0207702_10013968 Ga0207702_100139685 457
827 3300026088 Ga0207641_10057206 Ga0207641_100572063 457
828 3300026116 Ga0207674_10000226 Ga0207674_1000022665 457
829 3300026116 Ga0207674_10003517 Ga0207674_1000351714 457
830 3300026121 Ga0207683_10030140 Ga0207683_100301405 457
831 3300026121 Ga0207683_10181461 Ga0207683_101814612 457
832 3300026142 Ga0207698_10002393 Ga0207698_100023937 457
833 3300028379 Ga0268266_10000001 Ga0268266_100000012815 457
834 3300028380 Ga0268265_10002756 Ga0268265_100027567 457
835 3300032002 Ga0307416_100212079 Ga0307416_1002120791 457
836 3300035089 Ga0373944_0003332 Ga0373944_0003332_1480_2859 457
837 3300035724 Ga0373933_0064646 Ga0373933_0064646_405_1784 457
838 3300037312 Ga0395899_0000108 Ga0395899_0000108_90959_92338 457
839 3300037312 Ga0395899_0020403 Ga0395899_0020403_3168_4547 457
840 3300037418 Ga0395900_0000144 Ga0395900_0000144_37991_39370 457
841 3300037418 Ga0395900_0001328 Ga0395900_0001328_13493_14881 457
842 3300037466 Ga0395898_0000018 Ga0395898_0000018_322272_323651 457
843 3300037466 Ga0395898_0000049 Ga0395898_0000049_188318_189697 457
844 3300037471 Ga0395905_0044804 Ga0395905_0044804_2237_3622 457
845 3300038443 Ga0395901_0146500 Ga0395901_0146500_454_1833 457
846 3300041494 Ga0451837_0375995 Ga0451837_0375995_4490_5866 457
847 3300044656 Ga0466969_0015288 Ga0466969_0015288_426_1805 457
848 3300044672 Ga0466982_0000003 Ga0466982_0000003_318446_319825 457
849 3300044684 Ga0466966_0001324 Ga0466966_0001324_4500_5879 457
850 3300044684 Ga0466966_0031675 Ga0466966_0031675_1213_2592 457
851 3300044693 Ga0466961_0004875 Ga0466961_0004875_5071_6450 457
852 3300044693 Ga0466961_0020100 Ga0466961_0020100_1809_3188 457
853 3300044694 Ga0466963_0184095 Ga0466963_0184095_53_1432 457
854 3300044719 Ga0466971_0021286 Ga0466971_0021286_1210_2589 457
855 3300044735 Ga0466968_0048671 Ga0466968_0048671_152_1531 457
856 3300045049 Ga0466959_0000194 Ga0466959_0000194_27881_29260 457
857 3300045049 Ga0466959_0002267 Ga0466959_0002267_9041_10420 457
858 3300045049 Ga0466959_0114102 Ga0466959_0114102_189_1568 457
859 3300046472 Ga0495580_0134349 Ga0495580_0134349_147_1526 457
860 3300046473 Ga0495582_0026408 Ga0495582_0026408_1161_2540 457
861 3300046531 Ga0495665_0036208 Ga0495665_0036208_879_2258 457
862 3300046543 Ga0495645_0080864 Ga0495645_0080864_300_1679 457
863 3300046683 Ga0495658_0025436 Ga0495658_0025436_1481_2860 457
864 3300047318 Ga0495636_0012167 Ga0495636_0012167_489_1871 457
865 3300048909 Ga0496106_0091174 Ga0496106_0091174_424_1806 457
866 3300048914 Ga0496111_0059706 Ga0496111_0059706_590_1972 457
867 3300048916 Ga0496113_0002731 Ga0496113_0002731_1498_2877 457
868 3300048918 Ga0496115_0000503 Ga0496115_0000503_17198_18577 457
869 3300048928 Ga0496125_0000330 Ga0496125_0000330_55068_56447 457
870 3300049569 Ga0501032_0008355 Ga0501032_0008355_5072_6472 457
871 3300049571 Ga0501034_0025578 Ga0501034_0025578_4443_5843 457
872 3300049573 Ga0501037_0015531 Ga0501037_0015531_640_2040 457
873 3300049574 Ga0501038_0015142 Ga0501038_0015142_5039_6439 457
874 3300049575 Ga0501039_0072915 Ga0501039_0072915_599_1999 457
875 3300049579 Ga0501043_0086831 Ga0501043_0086831_606_2006 457
876 3300049822 Ga0501035_0007349 Ga0501035_0007349_6750_8150 457
877 3300049823 Ga0501044_0004695 Ga0501044_0004695_12801_14201 457
878 3300049823 Ga0501044_0014274 Ga0501044_0014274_3209_4585 457
879 3300053094 Ga0500566_0052977 Ga0500566_0052977_468_1847 457
880 3300053162 Ga0500638_050268 Ga0500638_050268_193_1569 457
881 3300061719 Ga0466962_0014644 Ga0466962_0014644_284_1663 457
882 iso_pu_bacteria 2524614729 2525555967 457
883 iso_pu_bacteria 2571042365 2572253472 457
884 iso_pu_bacteria 2627854209 2630650981 457
885 iso_pu_bacteria 2643221559 2643815402 457
886 iso_pu_bacteria 2643221573 2643879453 457
887 iso_pu_bacteria 2643221586 2643940078 457
888 iso_pu_bacteria 2643221612 2644077134 457
889 iso_pu_bacteria 2643221720 2644662936 457
890 iso_pu_bacteria 2643221727 2644695448 457
891 iso_pu_bacteria 2643221728 2644698110 457
892 iso_pu_bacteria 2747842501 2748017182 457
893 iso_pu_bacteria 2818991457 2819660321 457
894 iso_pu_bacteria 2852684882 2852689143 457
895 iso_pu_bacteria 2919130084 2919130407 457
896 iso_pu_bacteria 2929195423 2929198585 457
897 iso_pu_bacteria 2987605356 2987608349 457
898 iso_pu_bacteria 8021622325 8021624868 457
899 iso_pu_bacteria 8021626552 8021627849 457
900 iso_pu_bacteria 8021648035 8021651918 457
901 3300002737 JGI25162J39368_1003175 JGI25162J39368_10031752 458
902 3300002737 JGI25162J39368_1003182 JGI25162J39368_10031822 458
903 3300002741 JGI25157J39369_1001673 JGI25157J39369_10016738 458
904 3300002772 JGI25164J39214_1001511 JGI25164J39214_10015113 458
905 3300002772 JGI25164J39214_1001528 JGI25164J39214_10015282 458
906 3300003214 JGI25165J46597_1002761 JGI25165J46597_10027613 458
907 3300003578 Ga0006562J51391_1103326 Ga0006562J51391_11033262 458
908 3300003791 Ga0055530_10002947 Ga0055530_100029478 458
909 3300003794 Ga0055531_10011812 Ga0055531_100118121 458
910 3300005262 Ga0065165_1000587 Ga0065165_100058734 458
911 3300005334 Ga0068869_100011621 Ga0068869_1000116211 458
912 3300005337 Ga0070682_100007842 Ga0070682_1000078422 458
913 3300005338 Ga0068868_100096767 Ga0068868_1000967671 458
914 3300005355 Ga0070671_100022064 Ga0070671_1000220643 458
915 3300005366 Ga0070659_100004293 Ga0070659_1000042936 458
916 3300005366 Ga0070659_100015194 Ga0070659_1000151945 458
917 3300005435 Ga0070714_100000030 Ga0070714_100000030134 458
918 3300005458 Ga0070681_10215218 Ga0070681_102152181 458
919 3300005530 Ga0070679_100084666 Ga0070679_1000846662 458
920 3300005539 Ga0068853_100007278 Ga0068853_1000072785 458
921 3300005539 Ga0068853_100042692 Ga0068853_1000426923 458
922 3300005543 Ga0070672_100028699 Ga0070672_1000286995 458
923 3300005563 Ga0068855_100006636 Ga0068855_1000066366 458
924 3300005563 Ga0068855_100009999 Ga0068855_1000099992 458
925 3300005614 Ga0068856_100054557 Ga0068856_1000545572 458
926 3300005841 Ga0068863_100014237 Ga0068863_1000142373 458
927 3300006051 Ga0075364_10084553 Ga0075364_100845531 458
928 3300006237 Ga0097621_100051852 Ga0097621_1000518525 458
929 3300006358 Ga0068871_100039443 Ga0068871_1000394435 458
930 3300009093 Ga0105240_10023437 Ga0105240_100234376 458
931 3300009093 Ga0105240_10024511 Ga0105240_100245115 458
932 3300009093 Ga0105240_10211204 Ga0105240_102112043 458
933 3300009177 Ga0105248_10044939 Ga0105248_100449394 458
934 3300009545 Ga0105237_10018769 Ga0105237_100187695 458
935 3300009545 Ga0105237_10288567 Ga0105237_102885671 458
936 3300009551 Ga0105238_10001307 Ga0105238_1000130710 458
937 3300009551 Ga0105238_10052297 Ga0105238_100522972 458
938 3300010375 Ga0105239_10000030 Ga0105239_10000030178 458
939 3300010375 Ga0105239_10011192 Ga0105239_100111926 458
940 3300010375 Ga0105239_10098477 Ga0105239_100984773 458
941 3300010375 Ga0105239_10113787 Ga0105239_101137871 458
942 3300013102 Ga0157371_10012688 Ga0157371_100126885 458
943 3300013104 Ga0157370_10012852 Ga0157370_100128522 458
944 3300013104 Ga0157370_10018203 Ga0157370_100182035 458
945 3300013104 Ga0157370_10030975 Ga0157370_100309753 458
946 3300013105 Ga0157369_10000195 Ga0157369_1000019561 458
947 3300013296 Ga0157374_10054149 Ga0157374_100541493 458
948 3300013307 Ga0157372_10001376 Ga0157372_100013768 458
949 3300013308 Ga0157375_10001135 Ga0157375_1000113518 458
950 3300014497 Ga0182008_10002952 Ga0182008_100029526 458
951 3300014497 Ga0182008_10009735 Ga0182008_100097352 458
952 3300015261 Ga0182006_1000085 Ga0182006_100008577 458
953 3300015261 Ga0182006_1001966 Ga0182006_10019667 458
954 3300015261 Ga0182006_1007417 Ga0182006_10074172 458
955 3300015262 Ga0182007_10001735 Ga0182007_100017355 458
956 3300015262 Ga0182007_10003021 Ga0182007_100030213 458
957 3300015262 Ga0182007_10003786 Ga0182007_100037863 458
958 3300015265 Ga0182005_1001033 Ga0182005_10010335 458
959 3300017792 Ga0163161_10003975 Ga0163161_100039754 458
960 3300025226 Ga0209674_102640 Ga0209674_1026404 458
961 3300025231 Ga0207427_101551 Ga0207427_1015513 458
962 3300025231 Ga0207427_101571 Ga0207427_1015716 458
963 3300025233 Ga0209437_100020 Ga0209437_100020410 458
964 3300025233 Ga0209437_100231 Ga0209437_10023193 458
965 3300025233 Ga0209437_100476 Ga0209437_10047615 458
966 3300025250 Ga0209026_1000037 Ga0209026_1000037134 458
967 3300025254 Ga0209148_1001552 Ga0209148_100155210 458
968 3300025258 Ga0209129_1006069 Ga0209129_10060691 458
969 3300025261 Ga0209233_1000020 Ga0209233_1000020216 458
970 3300025261 Ga0209233_1000147 Ga0209233_100014749 458
971 3300025273 Ga0209673_1004025 Ga0209673_10040255 458
972 3300025292 Ga0209676_1000225 Ga0209676_1000225110 458
973 3300025292 Ga0209676_1003938 Ga0209676_10039385 458
974 3300025294 Ga0209025_1003033 Ga0209025_100303310 458
975 3300025295 Ga0209564_1013465 Ga0209564_10134654 458
976 3300025295 Ga0209564_1023516 Ga0209564_10235161 458
977 3300025297 Ga0209758_1004728 Ga0209758_10047282 458
978 3300025297 Ga0209758_1010415 Ga0209758_10104156 458
979 3300025298 Ga0209050_1002752 Ga0209050_100275213 458
980 3300025299 Ga0209256_1009510 Ga0209256_10095105 458
981 3300025299 Ga0209256_1010651 Ga0209256_10106512 458
982 3300025299 Ga0209256_1011461 Ga0209256_10114614 458
983 3300025303 Ga0209051_1003094 Ga0209051_10030945 458
984 3300025304 Ga0209257_1002013 Ga0209257_100201314 458
985 3300025304 Ga0209257_1002127 Ga0209257_100212712 458
986 3300025304 Ga0209257_1029601 Ga0209257_10296011 458
987 3300025904 Ga0207647_10001940 Ga0207647_100019404 458
988 3300025912 Ga0207707_10018697 Ga0207707_100186976 458
989 3300025913 Ga0207695_10000780 Ga0207695_1000078060 458
990 3300025913 Ga0207695_10008312 Ga0207695_100083125 458
991 3300025914 Ga0207671_10001147 Ga0207671_1000114730 458
992 3300025919 Ga0207657_10059762 Ga0207657_100597622 458
993 3300025921 Ga0207652_10070526 Ga0207652_100705262 458
994 3300025924 Ga0207694_10000162 Ga0207694_1000016225 458
995 3300025929 Ga0207664_10000026 Ga0207664_1000002621 458
996 3300025931 Ga0207644_10032119 Ga0207644_100321193 458
997 3300025932 Ga0207690_10004131 Ga0207690_100041316 458
998 3300025940 Ga0207691_10043022 Ga0207691_100430225 458
999 3300025949 Ga0207667_10001306 Ga0207667_1000130615 458
1000 3300025949 Ga0207667_10015916 Ga0207667_100159165 458
1001 3300025949 Ga0207667_10160495 Ga0207667_101604952 458
1002 3300025981 Ga0207640_10009690 Ga0207640_100096903 458
1003 3300026023 Ga0207677_10170338 Ga0207677_101703381 458
1004 3300026041 Ga0207639_10000230 Ga0207639_1000023030 458
1005 3300026088 Ga0207641_10015985 Ga0207641_100159854 458
1006 3300026088 Ga0207641_10035578 Ga0207641_100355783 458
1007 3300026088 Ga0207641_10147204 Ga0207641_101472042 458
1008 3300026116 Ga0207674_10019482 Ga0207674_100194824 458
1009 3300031911 Ga0307412_10003373 Ga0307412_1000337310 458
1010 3300037312 Ga0395899_0065751 Ga0395899_0065751_208_1608 458
1011 3300037312 Ga0395899_0082286 Ga0395899_0082286_225_1616 458
1012 3300037312 Ga0395899_0112338 Ga0395899_0112338_36_1427 458
1013 3300037418 Ga0395900_0000059 Ga0395900_0000059_96743_98134 458
1014 3300037418 Ga0395900_0011739 Ga0395900_0011739_129_1529 458
1015 3300037418 Ga0395900_0050272 Ga0395900_0050272_1571_2962 458
1016 3300037418 Ga0395900_0096985 Ga0395900_0096985_1116_2507 458
1017 3300037471 Ga0395905_0000855 Ga0395905_0000855_7227_8627 458
1018 3300038443 Ga0395901_0000356 Ga0395901_0000356_50019_51404 458
1019 3300038443 Ga0395901_0043265 Ga0395901_0043265_823_2214 458
1020 3300041404 Ga0439436_0000030 Ga0439436_0000030_26903_28291 458
1021 3300041413 Ga0439465_0000405 Ga0439465_0000405_8668_10056 458
1022 3300042184 Ga0450908_001001 Ga0450908_001001_3798_5186 458
1023 3300044735 Ga0466968_0024535 Ga0466968_0024535_978_2366 458
1024 3300046460 Ga0495638_0000038 Ga0495638_0000038_180737_182122 458
1025 3300046507 Ga0495606_0009207 Ga0495606_0009207_2621_4009 458
1026 3300046512 Ga0495610_0000482 Ga0495610_0000482_19561_20949 458
1027 3300046539 Ga0495621_0004807 Ga0495621_0004807_1458_2858 458
1028 3300046616 Ga0495668_0003978 Ga0495668_0003978_2530_3918 458
1029 3300046691 Ga0495670_0003523 Ga0495670_0003523_3629_5017 458
1030 3300046810 Ga0495660_0000747 Ga0495660_0000747_2427_3815 458
1031 3300047469 Ga0495673_0000004 Ga0495673_0000004_117179_118567 458
1032 3300048903 Ga0496100_0006438 Ga0496100_0006438_2986_4374 458
1033 3300048904 Ga0496101_0011176 Ga0496101_0011176_12_1394 458
1034 3300048904 Ga0496101_0038972 Ga0496101_0038972_1183_2583 458
1035 3300048907 Ga0496104_0034139 Ga0496104_0034139_2168_3550 458
1036 3300048908 Ga0496105_0001886 Ga0496105_0001886_3686_5068 458
1037 3300048910 Ga0496107_0153510 Ga0496107_0153510_223_1605 458
1038 3300048911 Ga0496108_0027988 Ga0496108_0027988_546_1946 458
1039 3300048919 Ga0496116_0009340 Ga0496116_0009340_4463_5842 458
1040 3300048920 Ga0496117_0018341 Ga0496117_0018341_1539_2918 458
1041 3300048921 Ga0496118_0008410 Ga0496118_0008410_4885_6345 458
1042 3300048921 Ga0496118_0019029 Ga0496118_0019029_3023_4405 458
1043 3300048922 Ga0496119_0000430 Ga0496119_0000430_32844_34226 458
1044 3300048922 Ga0496119_0001587 Ga0496119_0001587_4065_5444 458
1045 3300048922 Ga0496119_0004649 Ga0496119_0004649_12039_13421 458
1046 3300048922 Ga0496119_0078847 Ga0496119_0078847_329_1708 458
1047 3300048923 Ga0496120_0000313 Ga0496120_0000313_4074_5453 458
1048 3300048923 Ga0496120_0001482 Ga0496120_0001482_22946_24328 458
1049 3300048923 Ga0496120_0007359 Ga0496120_0007359_3460_4842 458
1050 3300048924 Ga0496121_0007810 Ga0496121_0007810_7433_8821 458
1051 3300048924 Ga0496121_0008433 Ga0496121_0008433_4196_5578 458
1052 3300048924 Ga0496121_0022688 Ga0496121_0022688_1603_2985 458
1053 3300048924 Ga0496121_0089774 Ga0496121_0089774_936_2315 458
1054 3300048924 Ga0496121_0091594 Ga0496121_0091594_538_1917 458
1055 3300048925 Ga0496122_0009589 Ga0496122_0009589_6059_7441 458
1056 3300048925 Ga0496122_0022373 Ga0496122_0022373_2713_4095 458
1057 3300048925 Ga0496122_0024178 Ga0496122_0024178_1457_2845 458
1058 3300048925 Ga0496122_0026766 Ga0496122_0026766_532_1911 458
1059 3300048926 Ga0496123_0007606 Ga0496123_0007606_2706_4088 458
1060 3300048926 Ga0496123_0027392 Ga0496123_0027392_391_1779 458
1061 3300048927 Ga0496124_0012352 Ga0496124_0012352_3490_4872 458
1062 3300048927 Ga0496124_0021111 Ga0496124_0021111_2725_4104 458
1063 3300048927 Ga0496124_0023684 Ga0496124_0023684_2363_3739 458
1064 3300048927 Ga0496124_0034314 Ga0496124_0034314_1216_2595 458
1065 3300048928 Ga0496125_0015861 Ga0496125_0015861_4153_5532 458
1066 3300048928 Ga0496125_0018703 Ga0496125_0018703_1567_2949 458
1067 3300048928 Ga0496125_0042192 Ga0496125_0042192_2320_3699 458
1068 3300048929 Ga0496126_0007008 Ga0496126_0007008_10781_12160 458
1069 3300048929 Ga0496126_0016809 Ga0496126_0016809_2865_4247 458
1070 3300049571 Ga0501034_0012439 Ga0501034_0012439_2866_4254 458
1071 3300049573 Ga0501037_0054749 Ga0501037_0054749_1332_2717 458
1072 3300049581 Ga0501047_0066774 Ga0501047_0066774_1836_3227 458
1073 3300049822 Ga0501035_0167572 Ga0501035_0167572_478_1863 458
1074 3300049823 Ga0501044_0040777 Ga0501044_0040777_1639_3030 458
1075 3300050491 nmdc:mga00v17_9702_c1 nmdc:mga00v17_9702_c1_625_2049 458
1076 3300053093 Ga0500651_0009373 Ga0500651_0009373_4256_5638 458
1077 iso_pu_bacteria 2643221581 2643913132 458
1078 iso_pu_bacteria 2643221593 2643974355 458
1079 iso_pu_bacteria 2747842428 2747949905 458
1080 iso_pu_bacteria 2923516293 2923517833 458
1081 iso_pu_bacteria 2939622612 2939626400 458
1082 3300002773 JGI25152J39213_1000231 JGI25152J39213_100023115 459
1083 3300002774 JGI25150J39212_1000095 JGI25150J39212_100009522 459
1084 3300003187 JGI25151J46595_10000477 JGI25151J46595_1000047728 459
1085 3300003215 JGI25153J46596_10000291 JGI25153J46596_1000029128 459
1086 3300003503 JGI26141J51220_1001122 JGI26141J51220_10011221 459
1087 3300005289 Ga0065704_10002244 Ga0065704_100022449 459
1088 3300005331 Ga0070670_100057852 Ga0070670_1000578522 459
1089 3300005459 Ga0068867_100047162 Ga0068867_1000471622 459
1090 3300006051 Ga0075364_10000611 Ga0075364_100006114 459
1091 3300009176 Ga0105242_10000940 Ga0105242_100009407 459
1092 3300010375 Ga0105239_10016070 Ga0105239_100160703 459
1093 3300013104 Ga0157370_10000407 Ga0157370_100004074 459
1094 3300013104 Ga0157370_10214567 Ga0157370_102145672 459
1095 3300013105 Ga0157369_10000509 Ga0157369_1000050923 459
1096 3300013308 Ga0157375_10000940 Ga0157375_100009402 459
1097 3300014969 Ga0157376_10117229 Ga0157376_101172292 459
1098 3300015265 Ga0182005_1000028 Ga0182005_1000028136 459
1099 3300017792 Ga0163161_10019639 Ga0163161_100196394 459
1100 3300025229 Ga0209147_102563 Ga0209147_1025632 459
1101 3300025245 Ga0207425_1000028 Ga0207425_1000028136 459
1102 3300025258 Ga0209129_1000065 Ga0209129_100006584 459
1103 3300025292 Ga0209676_1004689 Ga0209676_10046894 459
1104 3300025294 Ga0209025_1000002 Ga0209025_1000002136 459
1105 3300025294 Ga0209025_1006289 Ga0209025_10062898 459
1106 3300025297 Ga0209758_1000003 Ga0209758_1000003143 459
1107 3300025904 Ga0207647_10000512 Ga0207647_1000051223 459
1108 3300025920 Ga0207649_10027962 Ga0207649_100279622 459
1109 3300025925 Ga0207650_10115210 Ga0207650_101152102 459
1110 3300025938 Ga0207704_10005852 Ga0207704_100058522 459
1111 3300026089 Ga0207648_10035235 Ga0207648_100352354 459
1112 3300027543 Ga0209999_1003238 Ga0209999_10032384 459
1113 3300027614 Ga0209970_1003587 Ga0209970_10035873 459
1114 3300027665 Ga0209983_1002823 Ga0209983_10028234 459
1115 3300027682 Ga0209971_1004054 Ga0209971_10040542 459
1116 3300038705 Ga0237819_00006 Ga0237819_00006_68853_70232 459
1117 3300042006 Ga0439432_029987 Ga0439432_029987_128_1516 459
1118 3300042007 Ga0439449_0003482 Ga0439449_0003482_1273_2661 459
1119 3300046452 Ga0495617_000586 Ga0495617_000586_7993_9384 459
1120 3300046452 Ga0495617_000939 Ga0495617_000939_8759_10150 459
1121 3300046460 Ga0495638_0000153 Ga0495638_0000153_100124_101515 459
1122 3300046460 Ga0495638_0072264 Ga0495638_0072264_218_1624 459
1123 3300046471 Ga0495650_0030228 Ga0495650_0030228_958_2349 459
1124 3300046491 Ga0495584_0002465 Ga0495584_0002465_8623_10014 459
1125 3300046492 Ga0495585_0000104 Ga0495585_0000104_63825_65216 459
1126 3300046492 Ga0495585_0008229 Ga0495585_0008229_2349_3740 459
1127 3300046501 Ga0495607_0000211 Ga0495607_0000211_52219_53610 459
1128 3300046501 Ga0495607_0002313 Ga0495607_0002313_7998_9389 459
1129 3300046501 Ga0495607_0010293 Ga0495607_0010293_1982_3376 459
1130 3300046507 Ga0495606_0004520 Ga0495606_0004520_9205_10596 459
1131 3300046507 Ga0495606_0006836 Ga0495606_0006836_2733_4124 459
1132 3300046513 Ga0495616_0000086 Ga0495616_0000086_8306_9697 459
1133 3300046515 Ga0495620_0001564 Ga0495620_0001564_9135_10526 459
1134 3300046515 Ga0495620_0006441 Ga0495620_0006441_1592_2983 459
1135 3300046518 Ga0495631_0001785 Ga0495631_0001785_3411_4802 459
1136 3300046518 Ga0495631_0001835 Ga0495631_0001835_2478_3869 459
1137 3300046519 Ga0495632_0000004 Ga0495632_0000004_149601_150992 459
1138 3300046519 Ga0495632_0011223 Ga0495632_0011223_1904_3295 459
1139 3300046519 Ga0495632_0022825 Ga0495632_0022825_337_1728 459
1140 3300046519 Ga0495632_0085193 Ga0495632_0085193_20_1411 459
1141 3300046520 Ga0495637_0010551 Ga0495637_0010551_2037_3428 459
1142 3300046524 Ga0495648_0002502 Ga0495648_0002502_3925_5316 459
1143 3300046524 Ga0495648_0004770 Ga0495648_0004770_1042_2433 459
1144 3300046648 Ga0495611_0000001 Ga0495611_0000001_2171330_2172721 459
1145 3300046648 Ga0495611_0000105 Ga0495611_0000105_21754_23145 459
1146 3300046660 Ga0495625_0000022 Ga0495625_0000022_84062_85453 459
1147 3300046660 Ga0495625_0010863 Ga0495625_0010863_2652_4043 459
1148 3300046665 Ga0495661_0000199 Ga0495661_0000199_35213_36604 459
1149 3300046691 Ga0495670_0006841 Ga0495670_0006841_213_1604 459
1150 3300046691 Ga0495670_0014938 Ga0495670_0014938_1028_2419 459
1151 3300046692 Ga0495671_0000372 Ga0495671_0000372_26893_28284 459
1152 3300046794 Ga0495589_0000059 Ga0495589_0000059_58046_59437 459
1153 3300046810 Ga0495660_0000745 Ga0495660_0000745_2484_3875 459
1154 3300047323 Ga0495683_0007577 Ga0495683_0007577_3070_4461 459
1155 3300047446 Ga0495679_000004 Ga0495679_000004_282102_283493 459
1156 3300047469 Ga0495673_0000048 Ga0495673_0000048_83132_84523 459
1157 3300047469 Ga0495673_0002942 Ga0495673_0002942_7635_9026 459
1158 3300047472 Ga0495686_0000017 Ga0495686_0000017_201040_202431 459
1159 3300047472 Ga0495686_0001206 Ga0495686_0001206_19096_20487 459
1160 3300047472 Ga0495686_0008204 Ga0495686_0008204_5219_6610 459
1161 3300047472 Ga0495686_0047619 Ga0495686_0047619_1018_2409 459
1162 3300048907 Ga0496104_0000011 Ga0496104_0000011_257609_259087 459
1163 3300048908 Ga0496105_0000071 Ga0496105_0000071_36762_38240 459
1164 3300048920 Ga0496117_0019263 Ga0496117_0019263_3880_5271 459
1165 3300048920 Ga0496117_0022804 Ga0496117_0022804_1383_2774 459
1166 3300048921 Ga0496118_0001724 Ga0496118_0001724_929_2320 459
1167 3300048921 Ga0496118_0008793 Ga0496118_0008793_2423_3814 459
1168 3300048924 Ga0496121_0000878 Ga0496121_0000878_21994_23385 459
1169 3300048924 Ga0496121_0005536 Ga0496121_0005536_6756_8147 459
1170 3300048924 Ga0496121_0019136 Ga0496121_0019136_20_1411 459
1171 3300048925 Ga0496122_0006843 Ga0496122_0006843_7805_9196 459
1172 3300048927 Ga0496124_0021085 Ga0496124_0021085_3101_4492 459
1173 3300048928 Ga0496125_0007864 Ga0496125_0007864_5449_6840 459
1174 3300048929 Ga0496126_0011781 Ga0496126_0011781_6155_7546 459
1175 3300049459 Ga0495678_000237 Ga0495678_000237_20843_22234 459
1176 3300049460 Ga0495682_0002463 Ga0495682_0002463_2431_3822 459
1177 3300049460 Ga0495682_0012905 Ga0495682_0012905_685_2076 459
1178 3300050491 nmdc:mga00v17_1548_c1 nmdc:mga00v17_1548_c1_1235_2629 459
1179 3300053087 Ga0500643_000020 Ga0500643_000020_27479_28870 459
1180 3300053103 Ga0500555_000336 Ga0500555_000336_11061_12452 459
1181 3300053730 Ga0500645_008678 Ga0500645_008678_698_2089 459
1182 iso_pu_bacteria 8002869464 8002871702 459
1183 3300031911 Ga0307412_10080530 Ga0307412_100805302 460
1184 3300032004 Ga0307414_10044756 Ga0307414_100447562 460
1185 3300032126 Ga0307415_100180522 Ga0307415_1001805221 460
1186 3300046615 Ga0495656_0007758 Ga0495656_0007758_1447_2856 460
1187 iso_pu_bacteria 2643221579 2643905735 460
1188 iso_pu_bacteria 2842780639 2842783526 460
1189 2162886007 SwRhRL2b_contig_3055844 SwRhRL2b_0833.00004690 461
1190 3300003856 Ga0058692_1000017 Ga0058692_1000017177 461
1191 3300005289 Ga0065704_10000275 Ga0065704_1000027546 461
1192 3300005331 Ga0070670_100005186 Ga0070670_1000051866 461
1193 3300009011 Ga0105251_10000219 Ga0105251_100002192 461
1194 3300009148 Ga0105243_10003262 Ga0105243_100032627 461
1195 3300025735 Ga0207713_1000393 Ga0207713_100039323 461
1196 3300025925 Ga0207650_10021393 Ga0207650_100213933 461
1197 3300027312 Ga0209371_1000044 Ga0209371_1000044232 461
1198 3300030500 Ga0268256_1000046 Ga0268256_1000046232 461
1199 3300041459 Ga0451800_0416601 Ga0451800_0416601_1557_2957 461
1200 3300041462 Ga0451806_541229 Ga0451806_541229_2611_4011 461
1201 3300041463 Ga0451804_0746312 Ga0451804_0746312_930_2330 461
1202 3300048920 Ga0496117_0001420 Ga0496117_0001420_25925_27310 461
1203 3300048922 Ga0496119_0002453 Ga0496119_0002453_12383_13768 461
1204 3300048923 Ga0496120_0002147 Ga0496120_0002147_7252_8637 461
1205 3300048925 Ga0496122_0003345 Ga0496122_0003345_12619_14004 461
1206 3300048926 Ga0496123_0002721 Ga0496123_0002721_12577_13962 461
1207 3300048927 Ga0496124_0003791 Ga0496124_0003791_9617_11002 461
1208 iso_pu_bacteria 2894414249 2894414674 461

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF18073

Rubredoxin_2

Rubredoxin metal binding domain

8

35

0.98

PF13541

ChlI

Subunit ChlI of Mg-chelatase

334

428

0.91

PF06745

ATPase

KaiC

78

167

0.88

PF13401

AAA_22

AAA domain

94

223

0.82

PF13481

AAA_25

AAA domain

65

227

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
5h45-assembly1.cif.gz_B crystal structure of the c-terminal lon protease-like domain of thermus thermophilus rada/sms 0.945 295 461
5h45-assembly1.cif.gz_B crystal structure of the c-terminal lon protease-like domain of thermus thermophilus rada/sms 0.9102 295 461
8dvh-assembly1.cif.gz_B crystal structure of atp-dependent lon protease from bacillus subtillis (bslonba) 0.8873 295 457
5lkq-assembly1.cif.gz_B protease domain of rada 0.8855 285 457
5lkq-assembly1.cif.gz_B protease domain of rada 0.8613 285 457
ID Description Score Start End Superfamily
af_P24554_314_459_3.30.230.10 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; 0.9892 316 457 3.30.230.10
af_P24554_64_278_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9815 65 279 3.40.50.300
af_F4K8X8_240_443_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9773 85 281 3.40.50.300
af_P24554_64_278_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.977 65 279 3.40.50.300
af_P9WHJ9_288_461_3.30.230.10 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; 0.9698 295 457 3.30.230.10
ID Description Score Start End GO Terms
AF-A0A482F3K9-F1-model_v4 DNA repair protein RadA 1.003 315 461 GO:0000725
GO:0005829
AF-T1A795-F1-model_v4 DNA repair protein RadA 0.9967 311 402 GO:0000725
GO:0005829
AF-W1XIA3-F1-model_v4 DNA repair protein RadA 0.9966 301 409 GO:0000725
GO:0005829
AF-G5N717-F1-model_v4 DNA repair protein RadA 0.9899 302 460 GO:0000725
GO:0005829
AF-A0A2H9RGE8-F1-model_v4 DNA repair protein RadA 0.9861 83 457 GO:0000725
GO:0003684
GO:0005524
GO:0005829
GO:0016887
GO:0046872
GO:0140664

Feature Viewer

pLDDT pTM Quality
85.22 0.72 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map