F491494

General Info

Members Datasets Scaffolds Average Seq Length
1194 548 1135 196

Family's Representative Sequence

Representative Sequence 3300005355|Ga0070671_100003978|Ga0070671_10000397810
Length 211
Sequence LRPSPGSDALTDGTTCVAEPSLDALVDALRRLPGVGVKSAQRMAFHLLQHDREGARRIAKSLEAAVSAIRHCERCHTFTEAPVCSICLNPARDVRQLCVVETPADQAALERTGSYRGLYFVLMGRLSPLDGIGPRDVGADQLLARASDGVTEEVIIATNFTAEGEATAHVLAQALKSRGVRVTRLARGVPIGSELEYVDLGTIAHALVDRR

Samples

Sample ID Description Type Environment
1 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
2 2547132374 Acidovorax radicis N35 Isolate Unclassified
3 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
4 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
5 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
6 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
7 2643221570 Acidovorax sp. Root568 Isolate Unclassified
8 2643221585 Pelomonas sp. Root662 Isolate Unclassified
9 2643221596 Acidovorax sp. Root70 Isolate Unclassified
10 2643221609 Acidovorax sp. Root217 Isolate Unclassified
11 2643221611 Acidovorax sp. Root219 Isolate Unclassified
12 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
13 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
14 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
15 2643221652 Acidovorax sp. Root402 Isolate Unclassified
16 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
17 2643221656 Pelomonas sp. Root405 Isolate Unclassified
18 2643221660 Methylibium sp. Root1272 Isolate Unclassified
19 2643221717 Acidovorax sp. Root267 Isolate Unclassified
20 2721755523 Delftia sp. HK171 Isolate Unclassified
21 2738541277 Variovorax sp. GV051 Isolate Unclassified
22 2738541337 Pelomonas sp. BT06 Isolate Unclassified
23 2738543012 Acidovorax sp. CF301 Isolate Unclassified
24 2738543013 Variovorax sp. BT01 Isolate Unclassified
25 2738543019 Variovorax sp. GV040 Isolate Unclassified
26 2816332133 Acidovorax radicis 2721A Isolate Unclassified
27 2818991446 Variovorax sp. 1180 Isolate Unclassified
28 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
29 2831864461 Roseateles noduli HZ7 Isolate Nodule
30 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
31 2839138175 Delftia acidovorans B15 Isolate Rhizosphere
32 2842677519 Variovorax sp. R-72495 Isolate Unclassified
33 2842718218 Acidovorax sp. R-73343 Isolate Unclassified
34 2857576091 Pigmentiphaga sp. R-72090 Isolate Unclassified
35 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
36 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
37 2885198086 Variovorax sp. 679 Isolate Unclassified
38 2885211737 Variovorax sp. 553 Isolate Unclassified
39 2899924645 Variovorax sp. 369 Isolate Unclassified
40 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
41 2904456579 Variovorax sp. 2002 Isolate Unclassified
42 2904479285 Comamonas sediminis 4487 Isolate Rhizosphere
43 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
44 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
45 2928037797 Variovorax sp. 1126 Isolate Unclassified
46 2928044640 Variovorax sp. 1128 Isolate Unclassified
47 2928051484 Variovorax sp. 1133 Isolate Unclassified
48 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
49 2928070936 Variovorax gossypii 1167 Isolate Unclassified
50 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
51 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
52 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
53 2929520902 Variovorax beijingensis 502 Isolate Unclassified
54 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere
55 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
56 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
57 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
58 2974320154 Acidovorax wautersii SORGH_AS 335 Isolate Unclassified
59 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere
60 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
61 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
62 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
63 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
64 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
65 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
66 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
67 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
68 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
69 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
70 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
71 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
72 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
73 3300003347 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM Metagenome Rhizosphere
74 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
75 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
76 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
77 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
78 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
79 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
80 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
81 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
82 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
83 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
84 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
85 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
86 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
87 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
88 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
89 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
90 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
91 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
92 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
93 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
94 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
95 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
96 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
97 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
98 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
99 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
100 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
101 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
102 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
103 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
104 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
105 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
106 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
107 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
108 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
109 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
110 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
111 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
112 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
113 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
114 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
115 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
116 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
117 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
118 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
119 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
120 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
121 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
122 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
123 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
124 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
125 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
126 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
127 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
128 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
129 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
130 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
131 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
132 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
133 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
134 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
135 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
136 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
137 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
138 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
139 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
140 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
141 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
142 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
143 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
144 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
145 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
146 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
147 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
148 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
149 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
150 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
151 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
152 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
153 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
154 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
155 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
156 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
157 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
158 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
159 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
160 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
161 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
162 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
163 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
164 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
165 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
166 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
167 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
168 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
169 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
170 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
171 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
172 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
173 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
174 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
175 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
176 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
177 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
178 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
179 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
180 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
181 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
182 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
183 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
184 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
185 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
186 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
187 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
188 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
189 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
190 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
191 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
192 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
193 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
194 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
195 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
196 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
197 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
198 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
199 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
200 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
201 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
202 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
203 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
204 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
205 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
206 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
207 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
208 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
209 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
210 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
211 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
212 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
213 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
248 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
249 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
250 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
251 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
252 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
253 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
254 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
255 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
256 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
257 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
258 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
259 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
260 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
261 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
262 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
263 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
264 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
265 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
266 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
267 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
268 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
269 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
270 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
271 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
272 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
273 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
274 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
275 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
276 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
277 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
278 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
279 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
280 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
281 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
282 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
283 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
284 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
285 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
286 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
287 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
288 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
289 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
290 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
291 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
292 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
293 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
294 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
295 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
296 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
297 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
298 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
299 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
300 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
301 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
302 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
303 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
304 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
305 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
306 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
307 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
308 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
309 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
310 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
311 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
312 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
313 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
314 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
315 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
316 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
317 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
318 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
319 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
320 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
321 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
322 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
323 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
324 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
325 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
326 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
327 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
328 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
329 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
330 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
331 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
332 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
333 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
334 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
335 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
336 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
337 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
338 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
339 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
340 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
341 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
342 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
343 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
344 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
345 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
346 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
347 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
348 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
349 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
350 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
351 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
352 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
353 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
354 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
355 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
356 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
357 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
358 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
359 3300042119 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218L_E14_082316_1902 Metagenome Rhizosphere
360 3300042123 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 Metagenome Rhizosphere
361 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
362 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
363 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
364 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
365 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
366 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
367 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
368 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
369 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
370 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
371 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
372 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
373 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
374 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
375 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
376 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
377 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
378 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
379 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
380 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
381 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
382 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
383 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
384 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
385 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
386 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
387 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
388 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
389 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
390 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
391 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
392 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
393 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
394 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
395 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
396 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
397 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
398 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
399 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
400 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
401 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
402 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
403 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
404 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
405 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
406 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
407 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
408 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
409 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
410 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
411 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
412 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
413 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
414 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
415 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
416 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
417 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
418 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
419 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
420 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
421 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
422 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
423 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
424 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
425 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
426 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
427 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
428 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
429 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
430 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
431 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
432 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
433 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
434 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
435 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
436 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
437 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
438 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
439 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
440 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
441 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
442 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
443 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
444 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
445 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
446 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
447 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
448 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
449 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
450 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
451 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
452 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
453 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
454 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
455 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
456 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
457 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
458 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
459 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
460 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
461 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
462 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
463 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
464 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
465 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
466 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
467 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
468 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
469 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
470 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
471 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
472 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
473 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
474 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
475 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
476 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
477 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
478 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
479 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
480 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
481 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
482 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
483 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
484 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
485 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
486 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
487 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
488 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
489 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
490 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
491 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
492 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
493 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
494 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
495 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
496 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
497 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
498 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
499 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
500 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
501 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
502 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
503 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
504 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
505 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
506 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
507 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
508 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
509 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
510 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
511 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
512 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
513 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
514 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
515 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
516 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
517 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
518 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
519 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
520 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
521 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
522 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
523 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
524 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
525 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
526 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
527 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
528 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
529 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
530 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
531 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
532 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
533 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
534 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
535 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
536 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
537 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
538 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
539 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
540 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
541 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
542 3300053734 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 endosphere Metagenome Endosphere
543 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
544 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
545 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
546 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
547 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
548 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.64
Metatranscriptomes 0.42
Isolates 4.94

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 26.8
Nodule 0.67
Rhizoplane 2.68
Rhizosphere 57.62
Stem 0
Stem Tuber 0
Unclassified 12.23

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10045504 3300001989 Bacteria 1440
2 JGI25155J39150_1000049 3300002704 Bacteria 78961
3 JGI25156J39149_1000023 3300002705 Bacteria 146831
4 JGI25154J39366_1000036 3300002738 Bacteria 161697
5 JGI25158J39367_1009499 3300002739 Bacteria 1332
6 JGI25157J39369_1000023 3300002741 Bacteria 161697
7 JGI25152J39213_1005976 3300002773 Bacteria 3417
8 JGI25150J39212_1004774 3300002774 Bacteria 2971
9 JGI25150J39212_1005484 3300002774 Bacteria 2702
10 JGI25159J45721_1001073 3300002987 Bacteria 11684
11 JGI25159J45721_1001804 3300002987 Bacteria 8589
12 JGI25159J45721_1011457 3300002987 Bacteria 2173
13 JGI25159J45721_1011861 3300002987 Bacteria 2109
14 JGI25151J46595_10004016 3300003187 Bacteria 7904
15 JGI25151J46595_10005717 3300003187 Bacteria 6380
16 JGI25151J46595_10010198 3300003187 Bacteria 4383
17 JGI25151J46595_10010227 3300003187 Bacteria 4373
18 JGI25151J46595_10016678 3300003187 Bacteria 3205
19 JGI25151J46595_10121997 3300003187 Bacteria 663
20 JGI25153J46596_10009858 3300003215 Bacteria 4384
21 JGI25153J46596_10017105 3300003215 Bacteria 2871
22 rootL2_10075892 3300003322 Bacteria 1863
23 rootL2_10092820 3300003322 Bacteria 2620
24 rootH1_10033192 3300003323 Bacteria 8571
25 JGI26128J50194_1001258 3300003347 Bacteria 1589
26 JGI25160J50197_1000260 3300003354 Bacteria 39829
27 JGI25160J50197_1018470 3300003354 Bacteria 2173
28 JGI25160J50197_1019095 3300003354 Bacteria 2112
29 JGI25161J50226_1000015 3300003374 Bacteria 183773
30 JGI25161J50226_1004468 3300003374 Bacteria 2920
31 JGI25161J50226_1006316 3300003374 Bacteria 2162
32 Ga0006562J51391_1051948 3300003578 Bacteria 900
33 Ga0006562J51391_1076372 3300003578 Bacteria 1132
34 Ga0055525_1000013 3300003759 Bacteria 440870
35 Ga0055535_1003358 3300003761 Bacteria 4596
36 Ga0055542_1000114 3300003762 Bacteria 107058
37 Ga0055526_1010148 3300003771 Bacteria 4419
38 Ga0055526_1010246 3300003771 Bacteria 4384
39 Ga0055526_1030310 3300003771 Bacteria 1581
40 Ga0055526_1030458 3300003771 Bacteria 1572
41 Ga0055537_1000135 3300003773 Bacteria 55914
42 Ga0055537_1000972 3300003773 Bacteria 13040
43 Ga0055537_1009351 3300003773 Bacteria 2173
44 Ga0055524_1000016 3300003775 Bacteria 244926
45 Ga0055524_1021067 3300003775 Bacteria 2173
46 Ga0055524_1021783 3300003775 Bacteria 2112
47 Ga0055536_1013137 3300003781 Bacteria 3012
48 Ga0055536_1020005 3300003781 Bacteria 2083
49 Ga0055534_1000222 3300003784 Bacteria 41454
50 Ga0055534_1003233 3300003784 Bacteria 5219
51 Ga0055534_1003401 3300003784 Bacteria 5009
52 Ga0055534_1004961 3300003784 Bacteria 3700
53 Ga0055534_1008294 3300003784 Bacteria 2369
54 Ga0055534_1011817 3300003784 Bacteria 1756
55 Ga0055528_1000423 3300003790 Bacteria 33986
56 Ga0055528_1006109 3300003790 Bacteria 5501
57 Ga0055528_1020177 3300003790 Bacteria 2173
58 Ga0055530_10000293 3300003791 Bacteria 45497
59 Ga0055530_10000951 3300003791 Bacteria 23683
60 Ga0055530_10066105 3300003791 Bacteria 792
61 Ga0055540_1000144 3300003792 Bacteria 71420
62 Ga0055540_1009989 3300003792 Bacteria 3204
63 Ga0055540_1016495 3300003792 Bacteria 2100
64 Ga0055531_10003930 3300003794 Bacteria 9242
65 Ga0055531_10021503 3300003794 Bacteria 2499
66 Ga0055531_10025349 3300003794 Bacteria 2157
67 Ga0055543_1000807 3300004625 Bacteria 15447
68 Ga0055543_1000874 3300004625 Bacteria 14431
69 Ga0055543_1012562 3300004625 Bacteria 1698
70 Ga0058862_10046891 3300004803 Bacteria 2222
71 Ga0065165_1002967 3300005262 Bacteria 12902
72 Ga0065165_1005926 3300005262 Bacteria 6626
73 Ga0065165_1050224 3300005262 Bacteria 1188
74 Ga0065165_1050229 3300005262 Bacteria 1188
75 Ga0065714_10075522 3300005288 Bacteria 2898
76 Ga0065704_10081107 3300005289 Bacteria 3818
77 Ga0070676_10003470 3300005328 Bacteria 8215
78 Ga0070676_10040798 3300005328 Bacteria 2689
79 Ga0070676_10060101 3300005328 Bacteria 2256
80 Ga0070683_100797880 3300005329 Bacteria 905
81 Ga0070670_100084096 3300005331 Bacteria 2734
82 Ga0070670_100185094 3300005331 Bacteria 1808
83 Ga0070670_100264501 3300005331 Bacteria 1500
84 Ga0070677_10004753 3300005333 Bacteria 4448
85 Ga0068869_100008869 3300005334 Bacteria 6506
86 Ga0068869_100162787 3300005334 Bacteria 1738
87 Ga0068869_100330288 3300005334 Bacteria 1239
88 Ga0068869_100780356 3300005334 Bacteria 820
89 Ga0070680_100097964 3300005336 Bacteria 2432
90 Ga0070682_100097617 3300005337 Bacteria 1934
91 Ga0068868_100020836 3300005338 Bacteria 4934
92 Ga0068868_100025065 3300005338 Bacteria 4530
93 Ga0068868_100052998 3300005338 Bacteria 3195
94 Ga0068868_100109948 3300005338 Bacteria 2239
95 Ga0068868_100427582 3300005338 Bacteria 1148
96 Ga0070660_100879503 3300005339 Bacteria 755
97 Ga0070661_100003164 3300005344 Bacteria 11331
98 Ga0070668_100572987 3300005347 Bacteria 985
99 Ga0070669_100029036 3300005353 Bacteria 3986
100 Ga0070675_100007410 3300005354 Bacteria 8475
101 Ga0070675_100018213 3300005354 Bacteria 5590
102 Ga0070675_100177695 3300005354 Bacteria 1839
103 Ga0070675_100243530 3300005354 Bacteria 1572
104 Ga0070671_100003978 3300005355 Bacteria 11639
105 Ga0070671_100022049 3300005355 Bacteria 5203
106 Ga0070671_100024548 3300005355 Bacteria 4937
107 Ga0070671_100077674 3300005355 Bacteria 2775
108 Ga0070671_100451836 3300005355 Bacteria 1102
109 Ga0070674_100001350 3300005356 Bacteria 12930
110 Ga0070674_100005970 3300005356 Bacteria 7079
111 Ga0070673_100002284 3300005364 Bacteria 11625
112 Ga0070673_100018990 3300005364 Bacteria 4928
113 Ga0070673_100060889 3300005364 Bacteria 2993
114 Ga0070659_100001056 3300005366 Bacteria 20135
115 Ga0070667_100000427 3300005367 Bacteria 44426
116 Ga0070667_100135591 3300005367 Bacteria 2152
117 Ga0070667_100301939 3300005367 Bacteria 1442
118 Ga0070714_100253673 3300005435 Bacteria 1627
119 Ga0070663_100014432 3300005455 Bacteria 5070
120 Ga0070663_100408778 3300005455 Bacteria 1111
121 Ga0070678_100082262 3300005456 Bacteria 2444
122 Ga0070678_100130002 3300005456 Bacteria 1999
123 Ga0070678_100306146 3300005456 Bacteria 1352
124 Ga0070678_100649736 3300005456 Bacteria 946
125 Ga0070678_100766899 3300005456 Bacteria 873
126 Ga0070662_100007285 3300005457 Bacteria 7169
127 Ga0070662_100015383 3300005457 Bacteria 5123
128 Ga0070662_100811032 3300005457 Bacteria 796
129 Ga0070681_10129127 3300005458 Bacteria 2460
130 Ga0068867_100000176 3300005459 Bacteria 41815
131 Ga0068867_100002046 3300005459 Bacteria 14127
132 Ga0068867_100021358 3300005459 Bacteria 4619
133 Ga0068867_100041869 3300005459 Bacteria 3347
134 Ga0068867_100065677 3300005459 Bacteria 2701
135 Ga0070706_100000533 3300005467 Bacteria 44257
136 Ga0070706_100637749 3300005467 Bacteria 989
137 Ga0070707_100003061 3300005468 Bacteria 15843
138 Ga0070707_100248358 3300005468 Bacteria 1732
139 Ga0070707_100285174 3300005468 Unclassified 1605
140 Ga0070707_101128036 3300005468 Unclassified 750
141 Ga0070698_100147223 3300005471 Bacteria 2303
142 Ga0070699_100466197 3300005518 Bacteria 1146
143 Ga0070679_100083306 3300005530 Bacteria 3187
144 Ga0070679_100131957 3300005530 Bacteria 2479
145 Ga0068853_100045549 3300005539 Bacteria 3757
146 Ga0068853_100158904 3300005539 Bacteria 2038
147 Ga0068853_100599883 3300005539 Bacteria 1046
148 Ga0070672_100000317 3300005543 Bacteria 27420
149 Ga0070672_100011281 3300005543 Bacteria 6232
150 Ga0070672_100212578 3300005543 Bacteria 1620
151 Ga0070665_100113706 3300005548 Bacteria 2710
152 Ga0070665_100221204 3300005548 Bacteria 1894
153 Ga0068855_100022837 3300005563 Bacteria 7497
154 Ga0068855_100526400 3300005563 Bacteria 1282
155 Ga0070664_100056396 3300005564 Bacteria 3338
156 Ga0070664_100083036 3300005564 Bacteria 2763
157 Ga0068857_100016010 3300005577 Bacteria 6567
158 Ga0068857_100279711 3300005577 Bacteria 1535
159 Ga0068854_100406257 3300005578 Bacteria 1128
160 Ga0068856_100153017 3300005614 Bacteria 2316
161 Ga0068852_100036324 3300005616 Bacteria 4121
162 Ga0068852_101011126 3300005616 Bacteria 850
163 Ga0068859_100214678 3300005617 Bacteria 2011
164 Ga0068859_100448748 3300005617 Bacteria 1386
165 Ga0068864_100107072 3300005618 Bacteria 2486
166 Ga0068864_100552087 3300005618 Bacteria 1113
167 Ga0068851_10026610 3300005834 Bacteria 2844
168 Ga0068870_10129674 3300005840 Bacteria 1463
169 Ga0068863_100070689 3300005841 Bacteria 3301
170 Ga0068863_100109497 3300005841 Bacteria 2630
171 Ga0068863_100112570 3300005841 Bacteria 2592
172 Ga0068863_100164624 3300005841 Bacteria 2126
173 Ga0068858_101004194 3300005842 Bacteria 818
174 Ga0068860_100111478 3300005843 Bacteria 2616
175 Ga0068860_100147016 3300005843 Bacteria 2268
176 Ga0068862_100044186 3300005844 Bacteria 3800
177 Ga0075365_10022086 3300006038 Bacteria 3981
178 Ga0075365_10038916 3300006038 Bacteria 3093
179 Ga0075365_10213872 3300006038 Bacteria 1352
180 Ga0075365_10380687 3300006038 Bacteria 995
181 Ga0075368_10074866 3300006042 Bacteria 1372
182 Ga0075363_100018438 3300006048 Bacteria 3478
183 Ga0075363_100029136 3300006048 Bacteria 2847
184 Ga0075363_100047658 3300006048 Bacteria 2277
185 Ga0075363_100049721 3300006048 Bacteria 2233
186 Ga0075363_100099920 3300006048 Bacteria 1605
187 Ga0075363_100319854 3300006048 Bacteria 903
188 Ga0075363_100370862 3300006048 Bacteria 838
189 Ga0075363_100409579 3300006048 Bacteria 797
190 Ga0075363_100497202 3300006048 Bacteria 724
191 Ga0075364_10011971 3300006051 Bacteria 5288
192 Ga0075364_10031776 3300006051 Bacteria 3391
193 Ga0075364_10140479 3300006051 Bacteria 1624
194 Ga0075432_10012009 3300006058 Bacteria 2943
195 Ga0075362_10013562 3300006177 Bacteria 3265
196 Ga0075362_10029529 3300006177 Bacteria 2363
197 Ga0075362_10054075 3300006177 Bacteria 1803
198 Ga0075362_10087552 3300006177 Bacteria 1442
199 Ga0075362_10230315 3300006177 Bacteria 907
200 Ga0075367_10014302 3300006178 Bacteria 4293
201 Ga0075367_10022283 3300006178 Bacteria 3551
202 Ga0075367_10023123 3300006178 Bacteria 3494
203 Ga0075367_10278883 3300006178 Bacteria 1050
204 Ga0075369_10029608 3300006186 Bacteria 2301
205 Ga0075369_10235421 3300006186 Bacteria 849
206 Ga0075366_10002632 3300006195 Bacteria 9240
207 Ga0075366_10003790 3300006195 Bacteria 8041
208 Ga0075366_10014189 3300006195 Bacteria 4548
209 Ga0075366_10029732 3300006195 Bacteria 3211
210 Ga0075366_10030092 3300006195 Bacteria 3191
211 Ga0075366_10053809 3300006195 Bacteria 2391
212 Ga0075366_10063373 3300006195 Bacteria 2197
213 Ga0075366_10088325 3300006195 Bacteria 1856
214 Ga0075366_10105887 3300006195 Bacteria 1691
215 Ga0075366_10141305 3300006195 Bacteria 1456
216 Ga0075366_10194498 3300006195 Bacteria 1233
217 Ga0075366_10325805 3300006195 Bacteria 941
218 Ga0075366_10326259 3300006195 Bacteria 941
219 Ga0075366_10342530 3300006195 Bacteria 917
220 Ga0075366_10362715 3300006195 Bacteria 890
221 Ga0097621_100669246 3300006237 Bacteria 954
222 Ga0075370_10000340 3300006353 Bacteria 16849
223 Ga0075370_10004393 3300006353 Bacteria 6839
224 Ga0075370_10014349 3300006353 Bacteria 4224
225 Ga0075370_10015657 3300006353 Bacteria 4065
226 Ga0075370_10016575 3300006353 Bacteria 3966
227 Ga0075370_10021748 3300006353 Bacteria 3515
228 Ga0075370_10027748 3300006353 Bacteria 3144
229 Ga0075370_10035475 3300006353 Bacteria 2799
230 Ga0075370_10035897 3300006353 Bacteria 2783
231 Ga0075370_10057161 3300006353 Bacteria 2217
232 Ga0075370_10063856 3300006353 Bacteria 2099
233 Ga0075370_10089692 3300006353 Bacteria 1773
234 Ga0075370_10316080 3300006353 Bacteria 930
235 Ga0075433_10014085 3300006852 Bacteria 6520
236 Ga0075429_100003305 3300006880 Bacteria 13729
237 Ga0075429_100144676 3300006880 Bacteria 2081
238 Ga0068865_100148994 3300006881 Bacteria 1773
239 Ga0068865_100710951 3300006881 Bacteria 859
240 Ga0097620_100214679 3300006931 Bacteria 2011
241 Ga0097620_100448755 3300006931 Bacteria 1386
242 Ga0079104_1000025 3300006946 Bacteria 218785
243 Ga0099826_10004782 3300006948 Bacteria 9564
244 Ga0099826_10035017 3300006948 Bacteria 3576
245 Ga0105250_10001558 3300009092 Bacteria 12319
246 Ga0105240_10002847 3300009093 Bacteria 27330
247 Ga0105240_10253253 3300009093 Bacteria 2035
248 Ga0105240_10441232 3300009093 Bacteria 1459
249 Ga0105240_10706803 3300009093 Bacteria 1100
250 Ga0105240_11408337 3300009093 Bacteria 733
251 Ga0105245_10142180 3300009098 Bacteria 2261
252 Ga0105245_10169653 3300009098 Bacteria 2077
253 Ga0105245_10571237 3300009098 Bacteria 1154
254 Ga0114129_10597217 3300009147 Bacteria 1431
255 Ga0105243_10001022 3300009148 Bacteria 25857
256 Ga0105243_10003493 3300009148 Bacteria 12696
257 Ga0105243_10104817 3300009148 Bacteria 2354
258 Ga0105243_10117133 3300009148 Bacteria 2239
259 Ga0105241_10347205 3300009174 Bacteria 1287
260 Ga0105242_10337028 3300009176 Bacteria 1389
261 Ga0105242_10398738 3300009176 Bacteria 1283
262 Ga0105242_10406864 3300009176 Bacteria 1271
263 Ga0105248_10002775 3300009177 Bacteria 19479
264 Ga0105237_10017662 3300009545 Bacteria 7393
265 Ga0105238_10097245 3300009551 Bacteria 2930
266 Ga0105249_10504625 3300009553 Bacteria 1255
267 Ga0105249_11252465 3300009553 Bacteria 813
268 Ga0105239_10116457 3300010375 Bacteria 2965
269 Ga0105239_10123828 3300010375 Bacteria 2872
270 Ga0105239_10682831 3300010375 Bacteria 1174
271 Ga0105246_10127800 3300011119 Bacteria 1894
272 Ga0157373_10039046 3300013100 Bacteria 3400
273 Ga0157373_10682842 3300013100 Bacteria 751
274 Ga0157371_10031344 3300013102 Bacteria 3830
275 Ga0157370_10870570 3300013104 Bacteria 818
276 Ga0157374_10276013 3300013296 Bacteria 1658
277 Ga0157374_11070683 3300013296 Bacteria 826
278 Ga0157378_11023617 3300013297 Bacteria 861
279 Ga0157378_11281888 3300013297 Bacteria 773
280 Ga0163162_10241820 3300013306 Bacteria 1936
281 Ga0163162_10526524 3300013306 Bacteria 1311
282 Ga0163162_11010942 3300013306 Bacteria 940
283 Ga0157372_11537264 3300013307 Bacteria 766
284 Ga0157375_10385129 3300013308 Bacteria 1569
285 Ga0182008_10003871 3300014497 Bacteria 8892
286 Ga0182008_10017897 3300014497 Bacteria 3671
287 Ga0157377_10000055 3300014745 Bacteria 88103
288 Ga0157379_10149577 3300014968 Bacteria 2106
289 Ga0157379_10266203 3300014968 Bacteria 1558
290 Ga0157379_10342976 3300014968 Bacteria 1367
291 Ga0157379_10517974 3300014968 Bacteria 1107
292 Ga0157376_10010210 3300014969 Bacteria 6857
293 Ga0157376_10020357 3300014969 Bacteria 5131
294 Ga0157376_10996815 3300014969 Bacteria 860
295 Ga0182007_10000539 3300015262 Bacteria 22341
296 Ga0182007_10130798 3300015262 Bacteria 844
297 Ga0182005_1022729 3300015265 Bacteria 1717
298 Ga0163161_10024535 3300017792 Bacteria 4261
299 Ga0163161_10042396 3300017792 Bacteria 3273
300 Ga0163161_10044819 3300017792 Bacteria 3187
301 Ga0163161_10065207 3300017792 Bacteria 2658
302 Ga0163161_10297551 3300017792 Bacteria 1270
303 Ga0206350_10885651 3300020080 Bacteria 1945
304 Ga0213872_10000003 3300021361 Bacteria 366948
305 Ga0213872_10000044 3300021361 Bacteria 114843
306 Ga0213872_10000064 3300021361 Bacteria 97443
307 Ga0213872_10000163 3300021361 Bacteria 61122
308 Ga0213872_10076932 3300021361 Bacteria 1500
309 Ga0224712_10002149 3300022467 Bacteria 4800
310 Ga0209435_100001 3300025206 Bacteria 1424171
311 Ga0209436_103103 3300025208 Bacteria 4568
312 Ga0209436_105165 3300025208 Bacteria 3053
313 Ga0209436_111682 3300025208 Bacteria 1529
314 Ga0209672_101186 3300025228 Bacteria 10604
315 Ga0209147_101683 3300025229 Bacteria 7234
316 Ga0209563_100025 3300025230 Bacteria 596456
317 Ga0209258_100225 3300025242 Bacteria 107138
318 Ga0207425_1000530 3300025245 Bacteria 23292
319 Ga0207425_1002265 3300025245 Bacteria 6940
320 Ga0207425_1004703 3300025245 Bacteria 4030
321 Ga0209646_1000001 3300025246 Bacteria 3092932
322 Ga0209026_1000003 3300025250 Bacteria 1060571
323 Ga0209148_1000040 3300025254 Bacteria 473531
324 Ga0209759_1000001 3300025256 Bacteria 2799452
325 Ga0209129_1000007 3300025258 Bacteria 771325
326 Ga0209129_1002542 3300025258 Bacteria 8837
327 Ga0209129_1004981 3300025258 Bacteria 4906
328 Ga0209129_1006720 3300025258 Bacteria 3630
329 Ga0209565_1000004 3300025263 Bacteria 983150
330 Ga0209565_1000085 3300025263 Bacteria 153075
331 Ga0209565_1000365 3300025263 Bacteria 38942
332 Ga0209565_1000394 3300025263 Bacteria 36822
333 Ga0209565_1005992 3300025263 Bacteria 3473
334 Ga0209673_1000045 3300025273 Bacteria 290531
335 Ga0209673_1000133 3300025273 Bacteria 161740
336 Ga0209673_1000445 3300025273 Bacteria 70702
337 Ga0209673_1002436 3300025273 Bacteria 12916
338 Ga0209673_1006995 3300025273 Bacteria 5312
339 Ga0209130_1000056 3300025284 Bacteria 210851
340 Ga0209130_1000070 3300025284 Bacteria 179057
341 Ga0209130_1000634 3300025284 Bacteria 33021
342 Ga0209130_1001057 3300025284 Bacteria 20883
343 Ga0209130_1014947 3300025284 Bacteria 1930
344 Ga0209675_1000083 3300025291 Bacteria 153075
345 Ga0209675_1000185 3300025291 Bacteria 68701
346 Ga0209675_1000411 3300025291 Bacteria 35155
347 Ga0209675_1001654 3300025291 Bacteria 12399
348 Ga0209675_1002876 3300025291 Bacteria 8533
349 Ga0209675_1003496 3300025291 Bacteria 7427
350 Ga0209675_1011667 3300025291 Bacteria 2898
351 Ga0209675_1024463 3300025291 Bacteria 1542
352 Ga0209676_1000004 3300025292 Bacteria 1138360
353 Ga0209676_1000007 3300025292 Bacteria 1029371
354 Ga0209676_1006494 3300025292 Bacteria 5755
355 Ga0209676_1009992 3300025292 Bacteria 4015
356 Ga0209676_1020213 3300025292 Bacteria 2269
357 Ga0209676_1022106 3300025292 Bacteria 2115
358 Ga0209676_1025485 3300025292 Bacteria 1896
359 Ga0209025_1000111 3300025294 Bacteria 218982
360 Ga0209025_1000455 3300025294 Bacteria 79964
361 Ga0209025_1000529 3300025294 Bacteria 72736
362 Ga0209025_1003293 3300025294 Bacteria 15544
363 Ga0209025_1007672 3300025294 Bacteria 7971
364 Ga0209025_1013159 3300025294 Bacteria 5225
365 Ga0209025_1014754 3300025294 Bacteria 4774
366 Ga0209025_1034080 3300025294 Bacteria 2336
367 Ga0209025_1040260 3300025294 Bacteria 2024
368 Ga0209564_1000005 3300025295 Bacteria 1147192
369 Ga0209564_1000153 3300025295 Bacteria 166910
370 Ga0209564_1000337 3300025295 Bacteria 90545
371 Ga0209564_1000772 3300025295 Bacteria 44476
372 Ga0209564_1000962 3300025295 Bacteria 36603
373 Ga0209564_1029151 3300025295 Bacteria 1745
374 Ga0209758_1000025 3300025297 Bacteria 586687
375 Ga0209758_1007230 3300025297 Bacteria 7641
376 Ga0209758_1020573 3300025297 Bacteria 3114
377 Ga0209758_1049373 3300025297 Bacteria 1486
378 Ga0209050_1000002 3300025298 Bacteria 1792849
379 Ga0209050_1000003 3300025298 Bacteria 1609245
380 Ga0209050_1005366 3300025298 Bacteria 8100
381 Ga0209050_1014719 3300025298 Bacteria 3344
382 Ga0209050_1025986 3300025298 Bacteria 1973
383 Ga0209256_1000001 3300025299 Bacteria 2166974
384 Ga0209256_1000050 3300025299 Bacteria 308622
385 Ga0209256_1000063 3300025299 Bacteria 252716
386 Ga0207426_1000001 3300025302 Bacteria 1341301
387 Ga0207426_1000025 3300025302 Bacteria 532921
388 Ga0207426_1000028 3300025302 Bacteria 483955
389 Ga0207426_1004695 3300025302 Bacteria 6545
390 Ga0207426_1096965 3300025302 Bacteria 768
391 Ga0209051_1000002 3300025303 Bacteria 1631846
392 Ga0209051_1000003 3300025303 Bacteria 1609245
393 Ga0209051_1000653 3300025303 Bacteria 39211
394 Ga0209051_1003020 3300025303 Bacteria 11403
395 Ga0209051_1005176 3300025303 Bacteria 7726
396 Ga0209051_1008451 3300025303 Bacteria 5447
397 Ga0209051_1079431 3300025303 Bacteria 952
398 Ga0209257_1000002 3300025304 Bacteria 1767052
399 Ga0209257_1000018 3300025304 Bacteria 836016
400 Ga0209257_1000094 3300025304 Bacteria 262243
401 Ga0209257_1001358 3300025304 Bacteria 29602
402 Ga0209257_1003661 3300025304 Bacteria 12887
403 Ga0209257_1016346 3300025304 Bacteria 3006
404 Ga0209257_1024020 3300025304 Bacteria 2123
405 Ga0207697_10089027 3300025315 Bacteria 1307
406 Ga0207656_10160910 3300025321 Bacteria 1068
407 Ga0207696_1014771 3300025711 Bacteria 2666
408 Ga0207682_10004814 3300025893 Bacteria 5595
409 Ga0207682_10018054 3300025893 Bacteria 2755
410 Ga0207682_10130552 3300025893 Bacteria 1121
411 Ga0207688_10192120 3300025901 Bacteria 1221
412 Ga0207645_10034117 3300025907 Bacteria 3269
413 Ga0207643_10118905 3300025908 Bacteria 1563
414 Ga0207705_10470832 3300025909 Bacteria 975
415 Ga0207705_10734690 3300025909 Bacteria 767
416 Ga0207684_10003382 3300025910 Bacteria 15630
417 Ga0207684_10294930 3300025910 Bacteria 1398
418 Ga0207654_10681212 3300025911 Bacteria 738
419 Ga0207707_10278387 3300025912 Bacteria 1449
420 Ga0207695_10089619 3300025913 Bacteria 3093
421 Ga0207695_10229914 3300025913 Bacteria 1759
422 Ga0207695_10450756 3300025913 Bacteria 1170
423 Ga0207695_10631781 3300025913 Bacteria 952
424 Ga0207657_10192044 3300025919 Bacteria 1646
425 Ga0207649_10087815 3300025920 Bacteria 2029
426 Ga0207652_10065943 3300025921 Bacteria 3136
427 Ga0207646_10228362 3300025922 Bacteria 1682
428 Ga0207646_10239797 3300025922 Unclassified 1638
429 Ga0207681_10041661 3300025923 Bacteria 3063
430 Ga0207694_10491776 3300025924 Bacteria 1027
431 Ga0207650_10187259 3300025925 Bacteria 1652
432 Ga0207650_10205436 3300025925 Bacteria 1580
433 Ga0207650_10720927 3300025925 Bacteria 843
434 Ga0207659_10012775 3300025926 Bacteria 5360
435 Ga0207659_10172205 3300025926 Bacteria 1708
436 Ga0207687_10011980 3300025927 Bacteria 5671
437 Ga0207687_10301119 3300025927 Bacteria 1292
438 Ga0207687_10373784 3300025927 Bacteria 1166
439 Ga0207687_10428532 3300025927 Bacteria 1093
440 Ga0207664_10096770 3300025929 Bacteria 2431
441 Ga0207644_10037459 3300025931 Bacteria 3412
442 Ga0207644_10053981 3300025931 Bacteria 2893
443 Ga0207644_10185710 3300025931 Bacteria 1632
444 Ga0207690_10001069 3300025932 Bacteria 17533
445 Ga0207690_10523913 3300025932 Bacteria 961
446 Ga0207706_10008133 3300025933 Bacteria 9680
447 Ga0207706_10015176 3300025933 Bacteria 6971
448 Ga0207706_10227795 3300025933 Bacteria 1631
449 Ga0207706_10825006 3300025933 Bacteria 787
450 Ga0207709_10000170 3300025935 Bacteria 87011
451 Ga0207709_10008589 3300025935 Bacteria 5641
452 Ga0207709_10073192 3300025935 Bacteria 2182
453 Ga0207709_10147514 3300025935 Bacteria 1625
454 Ga0207669_10009564 3300025937 Bacteria 4626
455 Ga0207669_10054346 3300025937 Bacteria 2418
456 Ga0207669_10164339 3300025937 Bacteria 1572
457 Ga0207704_10024047 3300025938 Bacteria 3295
458 Ga0207704_10588143 3300025938 Bacteria 909
459 Ga0207691_10001479 3300025940 Bacteria 23445
460 Ga0207691_10012115 3300025940 Bacteria 8266
461 Ga0207691_10193143 3300025940 Bacteria 1775
462 Ga0207691_10244738 3300025940 Bacteria 1549
463 Ga0207691_10330458 3300025940 Bacteria 1306
464 Ga0207711_10145746 3300025941 Bacteria 2133
465 Ga0207689_10011918 3300025942 Bacteria 7450
466 Ga0207689_10065458 3300025942 Bacteria 2989
467 Ga0207689_10070393 3300025942 Bacteria 2874
468 Ga0207679_10184593 3300025945 Bacteria 1728
469 Ga0207679_10351089 3300025945 Bacteria 1286
470 Ga0207667_10151272 3300025949 Bacteria 2389
471 Ga0207667_10428261 3300025949 Bacteria 1346
472 Ga0207667_11049366 3300025949 Bacteria 800
473 Ga0207651_10026540 3300025960 Bacteria 3621
474 Ga0207651_10083778 3300025960 Bacteria 2307
475 Ga0207651_10268445 3300025960 Bacteria 1404
476 Ga0207712_10061159 3300025961 Bacteria 2672
477 Ga0207712_10750084 3300025961 Bacteria 855
478 Ga0207640_10130917 3300025981 Bacteria 1813
479 Ga0207658_10001754 3300025986 Bacteria 16311
480 Ga0207658_10070307 3300025986 Bacteria 2648
481 Ga0207677_10031227 3300026023 Bacteria 3410
482 Ga0207677_10078663 3300026023 Bacteria 2355
483 Ga0207677_10288148 3300026023 Bacteria 1351
484 Ga0207677_10378047 3300026023 Bacteria 1195
485 Ga0207677_11078053 3300026023 Bacteria 731
486 Ga0207703_10741925 3300026035 Bacteria 935
487 Ga0207639_10005602 3300026041 Bacteria 8497
488 Ga0207639_10278328 3300026041 Bacteria 1471
489 Ga0207678_10010239 3300026067 Bacteria 8231
490 Ga0207678_10029766 3300026067 Bacteria 4767
491 Ga0207678_10427873 3300026067 Bacteria 1148
492 Ga0207702_10041297 3300026078 Bacteria 3868
493 Ga0207702_10273984 3300026078 Bacteria 1593
494 Ga0207641_10103540 3300026088 Bacteria 2511
495 Ga0207648_10004256 3300026089 Bacteria 14783
496 Ga0207648_10004711 3300026089 Bacteria 13949
497 Ga0207648_10010739 3300026089 Bacteria 8656
498 Ga0207648_10029870 3300026089 Bacteria 4833
499 Ga0207648_10045152 3300026089 Bacteria 3865
500 Ga0207648_10061286 3300026089 Bacteria 3280
501 Ga0207648_10902011 3300026089 Bacteria 826
502 Ga0207676_10178109 3300026095 Bacteria 1859
503 Ga0207676_10421095 3300026095 Bacteria 1252
504 Ga0207674_10043824 3300026116 Bacteria 4611
505 Ga0207674_10280884 3300026116 Bacteria 1613
506 Ga0207674_11168596 3300026116 Bacteria 739
507 Ga0207683_10443347 3300026121 Bacteria 1196
508 Ga0207683_10829936 3300026121 Bacteria 858
509 Ga0207698_10220121 3300026142 Bacteria 1715
510 Ga0207698_10355755 3300026142 Bacteria 1385
511 Ga0207698_10375955 3300026142 Bacteria 1350
512 Ga0207698_10732009 3300026142 Bacteria 986
513 Ga0207698_10964130 3300026142 Bacteria 862
514 Ga0209281_1000007 3300027111 Bacteria 938265
515 Ga0209371_1031130 3300027312 Bacteria 1161
516 Ga0209996_1007609 3300027395 Bacteria 1413
517 Ga0209968_1000412 3300027526 Bacteria 7007
518 Ga0209999_1028184 3300027543 Bacteria 1041
519 Ga0209970_1000478 3300027614 Bacteria 6827
520 Ga0209282_1006184 3300027666 Bacteria 7419
521 Ga0209282_1114443 3300027666 Bacteria 1362
522 Ga0209971_1023181 3300027682 Bacteria 1480
523 Ga0209966_1000040 3300027695 Bacteria 54404
524 Ga0209974_10012044 3300027876 Bacteria 2896
525 Ga0209974_10049704 3300027876 Bacteria 1407
526 Ga0209974_10130739 3300027876 Bacteria 895
527 Ga0207428_10386576 3300027907 Bacteria 1026
528 Ga0268266_10425845 3300028379 Bacteria 1258
529 Ga0268265_10027745 3300028380 Bacteria 4045
530 Ga0268265_11115192 3300028380 Bacteria 784
531 Ga0268264_10039869 3300028381 Bacteria 3880
532 Ga0268264_10319517 3300028381 Bacteria 1467
533 Ga0307517_10000052 3300028786 Bacteria 155904
534 Ga0307515_10000022 3300028794 Bacteria 404064
535 Ga0307515_10000428 3300028794 Bacteria 101247
536 Ga0307515_10002861 3300028794 Bacteria 36711
537 Ga0307515_10009473 3300028794 Bacteria 18820
538 Ga0307515_10012346 3300028794 Bacteria 16075
539 Ga0307515_10020511 3300028794 Bacteria 11783
540 Ga0307515_10021948 3300028794 Bacteria 11287
541 Ga0307515_10022871 3300028794 Bacteria 10995
542 Ga0307515_10038241 3300028794 Bacteria 7684
543 Ga0307515_10053977 3300028794 Bacteria 5911
544 Ga0307515_10096158 3300028794 Bacteria 3636
545 Ga0307515_10115958 3300028794 Bacteria 3079
546 Ga0307515_10127462 3300028794 Bacteria 2831
547 Ga0307515_10131159 3300028794 Bacteria 2759
548 Ga0307515_10157684 3300028794 Bacteria 2333
549 Ga0307515_10471766 3300028794 Bacteria 868
550 Ga0268256_1028319 3300030500 Bacteria 1385
551 Ga0307512_10047813 3300030522 Bacteria 3472
552 Ga0307512_10233363 3300030522 Bacteria 942
553 Ga0307512_10337723 3300030522 Bacteria 673
554 Ga0316177_1092166 3300030731 Bacteria 3877
555 Ga0314311_1139236 3300030733 Bacteria 10237
556 Ga0316180_1077645 3300030736 Bacteria 2235
557 Ga0316183_1002371 3300030742 Bacteria 3264
558 Ga0316183_1154909 3300030742 Bacteria 825
559 Ga0316181_1009854 3300030744 Bacteria 2866
560 Ga0316181_1111584 3300030744 Bacteria 1670
561 Ga0316182_1087061 3300030745 Bacteria 1242
562 Ga0265332_10000033 3300031238 Bacteria 153334
563 Ga0265328_10035265 3300031239 Bacteria 1850
564 Ga0265328_10051830 3300031239 Bacteria 1507
565 Ga0265331_10007350 3300031250 Bacteria 6382
566 Ga0265327_10000043 3300031251 Bacteria 285108
567 Ga0265327_10000689 3300031251 Bacteria 54050
568 Ga0265327_10016727 3300031251 Bacteria 4639
569 Ga0307513_10000010 3300031456 Bacteria 360812
570 Ga0307513_10000121 3300031456 Bacteria 109551
571 Ga0307513_10010831 3300031456 Bacteria 11389
572 Ga0307513_10024262 3300031456 Bacteria 7058
573 Ga0307513_10093400 3300031456 Bacteria 3058
574 Ga0307513_10177467 3300031456 Bacteria 1998
575 Ga0307513_10233189 3300031456 Bacteria 1652
576 Ga0307509_10000180 3300031507 Bacteria 98647
577 Ga0307509_10014553 3300031507 Bacteria 9241
578 Ga0307509_10022019 3300031507 Bacteria 7195
579 Ga0307509_10047940 3300031507 Bacteria 4592
580 Ga0307509_10068505 3300031507 Bacteria 3714
581 Ga0307509_10134541 3300031507 Bacteria 2420
582 Ga0307509_10214152 3300031507 Bacteria 1748
583 Ga0307509_10391022 3300031507 Bacteria 1100
584 Ga0307408_100000068 3300031548 Bacteria 120700
585 Ga0307408_100041773 3300031548 Bacteria 3253
586 Ga0307408_100051392 3300031548 Bacteria 2968
587 Ga0307408_100060884 3300031548 Bacteria 2753
588 Ga0307408_100153651 3300031548 Bacteria 1819
589 Ga0307408_100679971 3300031548 Bacteria 923
590 Ga0307508_10000017 3300031616 Bacteria 203567
591 Ga0307508_10021388 3300031616 Bacteria 5881
592 Ga0307508_10045867 3300031616 Bacteria 3903
593 Ga0307508_10172409 3300031616 Bacteria 1766
594 Ga0307508_10322843 3300031616 Bacteria 1136
595 Ga0307514_10000869 3300031649 Bacteria 47727
596 Ga0307514_10003946 3300031649 Bacteria 13866
597 Ga0307514_10017552 3300031649 Bacteria 5885
598 Ga0307514_10065104 3300031649 Bacteria 2762
599 Ga0265314_10038784 3300031711 Bacteria 3439
600 Ga0307516_10000525 3300031730 Bacteria 51244
601 Ga0307516_10002317 3300031730 Bacteria 25638
602 Ga0307516_10004998 3300031730 Bacteria 16089
603 Ga0307516_10012723 3300031730 Bacteria 9044
604 Ga0307516_10037761 3300031730 Bacteria 4826
605 Ga0307516_10047914 3300031730 Bacteria 4207
606 Ga0307516_10301837 3300031730 Bacteria 1277
607 Ga0307405_10011424 3300031731 Bacteria 4653
608 Ga0307405_10148449 3300031731 Bacteria 1645
609 Ga0307405_10249208 3300031731 Bacteria 1320
610 Ga0307405_10370510 3300031731 Bacteria 1111
611 Ga0307405_10466740 3300031731 Bacteria 1004
612 Ga0307405_10723442 3300031731 Bacteria 827
613 Ga0307413_10200729 3300031824 Bacteria 1440
614 Ga0307413_10294029 3300031824 Bacteria 1228
615 Ga0307413_11298326 3300031824 Bacteria 637
616 Ga0307410_10004378 3300031852 Bacteria 7292
617 Ga0307410_10119318 3300031852 Bacteria 1921
618 Ga0307410_10281124 3300031852 Bacteria 1306
619 Ga0307406_10000135 3300031901 Bacteria 43972
620 Ga0307406_10001827 3300031901 Bacteria 11607
621 Ga0307406_10005443 3300031901 Bacteria 6966
622 Ga0307406_10119502 3300031901 Bacteria 1829
623 Ga0307406_10270774 3300031901 Bacteria 1290
624 Ga0307407_10007263 3300031903 Bacteria 5007
625 Ga0307407_10103535 3300031903 Bacteria 1772
626 Ga0307412_10024590 3300031911 Bacteria 3720
627 Ga0307412_10042559 3300031911 Bacteria 2952
628 Ga0307412_10081872 3300031911 Bacteria 2233
629 Ga0307412_10174538 3300031911 Bacteria 1610
630 Ga0307412_10944127 3300031911 Bacteria 759
631 Ga0307409_100002830 3300031995 Bacteria 9173
632 Ga0307409_100032289 3300031995 Bacteria 3794
633 Ga0307409_100349231 3300031995 Bacteria 1395
634 Ga0307409_100534658 3300031995 Bacteria 1148
635 Ga0307416_100007284 3300032002 Bacteria 7017
636 Ga0307416_100217996 3300032002 Bacteria 1827
637 Ga0307416_100770241 3300032002 Bacteria 1056
638 Ga0307416_100858262 3300032002 Bacteria 1006
639 Ga0307416_101541060 3300032002 Bacteria 770
640 Ga0307414_10302559 3300032004 Bacteria 1353
641 Ga0307414_10960949 3300032004 Bacteria 785
642 Ga0307411_10003656 3300032005 Bacteria 7197
643 Ga0307411_10022245 3300032005 Bacteria 3728
644 Ga0307411_10125955 3300032005 Bacteria 1863
645 Ga0307411_10185912 3300032005 Bacteria 1582
646 Ga0307411_10471918 3300032005 Bacteria 1054
647 Ga0307507_10045759 3300033179 Bacteria 4300
648 Ga0307507_10051383 3300033179 Bacteria 3968
649 Ga0307510_10003830 3300033180 Bacteria 17622
650 Ga0307510_10027563 3300033180 Bacteria 6507
651 Ga0307510_10056376 3300033180 Bacteria 4093
652 Ga0307510_10289848 3300033180 Bacteria 1103
653 Ga0373948_0001130 3300034817 Bacteria 3609
654 Ga0373959_0010699 3300034820 Bacteria 1608
655 Ga0373951_0007149 3300035091 Bacteria 2539
656 Ga0373932_0016625 3300035112 Bacteria 1879
657 Ga0373932_0117784 3300035112 Bacteria 883
658 Ga0373939_0000474 3300035114 Bacteria 10142
659 Ga0373954_0063777 3300035118 Bacteria 1741
660 Ga0373956_0000036 3300035119 Bacteria 43642
661 Ga0373960_0008985 3300035121 Bacteria 2410
662 Ga0373946_0105899 3300035171 Bacteria 1267
663 Ga0373961_0008752 3300035241 Bacteria 2465
664 Ga0373962_0021091 3300035242 Bacteria 1717
665 Ga0373962_0056200 3300035242 Bacteria 1145
666 Ga0373931_0026906 3300035691 Bacteria 2931
667 Ga0373927_0000005 3300035695 Bacteria 221415
668 Ga0373933_0003669 3300035724 Bacteria 8501
669 Ga0373937_0083859 3300036401 Bacteria 2949
670 Ga0373925_0072618 3300037068 Bacteria 2603
671 Ga0395899_0029446 3300037312 Bacteria 4129
672 Ga0395899_0047362 3300037312 Bacteria 3201
673 Ga0395899_0109122 3300037312 Bacteria 1991
674 Ga0395899_0538411 3300037312 Bacteria 752
675 Ga0395900_0000046 3300037418 Bacteria 230114
676 Ga0395900_0028766 3300037418 Bacteria 5697
677 Ga0395900_0081609 3300037418 Bacteria 3322
678 Ga0395900_0146577 3300037418 Bacteria 2413
679 Ga0395900_0327536 3300037418 Bacteria 1510
680 Ga0395898_0006527 3300037466 Bacteria 12459
681 Ga0395898_0025414 3300037466 Bacteria 5967
682 Ga0395898_0270869 3300037466 Bacteria 1619
683 Ga0395905_0000766 3300037471 Bacteria 42342
684 Ga0395905_0015449 3300037471 Bacteria 7258
685 Ga0395905_0028165 3300037471 Bacteria 5295
686 Ga0395905_0049363 3300037471 Bacteria 3943
687 Ga0395905_0063205 3300037471 Bacteria 3463
688 Ga0395905_0063315 3300037471 Bacteria 3460
689 Ga0395905_0070092 3300037471 Bacteria 3284
690 Ga0395905_0103004 3300037471 Bacteria 2680
691 Ga0395905_0181049 3300037471 Bacteria 1978
692 Ga0395905_0231019 3300037471 Bacteria 1729
693 Ga0395905_0254731 3300037471 Bacteria 1639
694 Ga0395905_0535299 3300037471 Bacteria 1072
695 Ga0395901_0030760 3300038443 Bacteria 5532
696 Ga0395901_0124753 3300038443 Bacteria 2705
697 Ga0395901_0156605 3300038443 Bacteria 2393
698 Ga0395901_0212438 3300038443 Bacteria 2024
699 Ga0395901_0292465 3300038443 Bacteria 1690
700 Ga0395901_0372685 3300038443 Bacteria 1470
701 Ga0395901_0653880 3300038443 Bacteria 1054
702 Ga0400490_05408 3300038726 Bacteria 14275
703 Ga0400486_06505 3300038742 Bacteria 21133
704 Ga0400483_120900 3300039062 Bacteria 1256
705 Ga0436361_0163926 3300039447 Bacteria 22625
706 Ga0436361_0657686 3300039447 Bacteria 74387
707 Ga0436361_0886712 3300039447 Bacteria 114879
708 Ga0436361_1061851 3300039447 Bacteria 60009
709 Ga0436361_1215716 3300039447 Bacteria 7625
710 Ga0439436_0000168 3300041404 Bacteria 15481
711 Ga0439436_0000271 3300041404 Bacteria 12488
712 Ga0439438_030265 3300041405 Bacteria 1444
713 Ga0439447_019703 3300041407 Bacteria 1796
714 Ga0439447_033049 3300041407 Bacteria 1291
715 Ga0439461_0003984 3300041410 Bacteria 2451
716 Ga0439461_0043794 3300041410 Bacteria 974
717 Ga0439466_0006959 3300041411 Bacteria 4288
718 Ga0439466_0011797 3300041411 Bacteria 3227
719 Ga0439466_0059239 3300041411 Bacteria 1237
720 Ga0439465_0004740 3300041413 Bacteria 4381
721 Ga0439465_0032324 3300041413 Bacteria 1670
722 Ga0451787_408354 3300041441 Bacteria 960
723 Ga0451789_0115708 3300041443 Bacteria 1377
724 Ga0451789_0257727 3300041443 Bacteria 801
725 Ga0451789_1294079 3300041443 Bacteria 666
726 Ga0451793_0622605 3300041452 Bacteria 723
727 Ga0451793_0754529 3300041452 Bacteria 1636
728 Ga0451797_1105889 3300041453 Bacteria 796
729 Ga0451797_1374203 3300041453 Bacteria 798
730 Ga0451804_1015395 3300041463 Bacteria 890
731 Ga0451807_0207679 3300041486 Bacteria 2140
732 Ga0451807_0709245 3300041486 Bacteria 1008
733 Ga0451833_0337859 3300041491 Bacteria 1574
734 Ga0451833_0357612 3300041491 Bacteria 1254
735 Ga0451841_1115077 3300041498 Bacteria 650
736 Ga0451841_1434301 3300041498 Bacteria 937
737 Ga0451853_1417758 3300041512 Bacteria 1466
738 Ga0439431_0002491 3300041997 Bacteria 4075
739 Ga0439431_0015132 3300041997 Bacteria 1794
740 Ga0439433_0003486 3300041999 Bacteria 3376
741 Ga0439433_0014808 3300041999 Bacteria 1720
742 Ga0439433_0016870 3300041999 Bacteria 1619
743 Ga0439437_006661 3300042000 Bacteria 1280
744 Ga0439437_020525 3300042000 Bacteria 798
745 Ga0439441_037513 3300042001 Bacteria 961
746 Ga0439441_080379 3300042001 Bacteria 709
747 Ga0439445_0000101 3300042004 Bacteria 14009
748 Ga0439432_000403 3300042006 Bacteria 16009
749 Ga0439432_006778 3300042006 Bacteria 4076
750 Ga0439449_0002611 3300042007 Bacteria 7021
751 Ga0439449_0004558 3300042007 Bacteria 5355
752 Ga0439449_0048086 3300042007 Bacteria 1579
753 Ga0439449_0053123 3300042007 Bacteria 1498
754 Ga0439452_001575 3300042010 Bacteria 9083
755 Ga0439452_003824 3300042010 Bacteria 5171
756 Ga0439455_0049163 3300042012 Bacteria 1098
757 Ga0439457_011619 3300042014 Bacteria 1998
758 Ga0439462_0004271 3300042015 Bacteria 3476
759 Ga0439462_0009364 3300042015 Bacteria 2476
760 Ga0439462_0060284 3300042015 Bacteria 1027
761 Ga0450915_000412 3300042119 Bacteria 1515
762 Ga0450921_002869 3300042123 Bacteria 1179
763 Ga0450921_006250 3300042123 Bacteria 922
764 Ga0450923_132748 3300042125 Bacteria 594
765 Ga0450890_007246 3300042127 Bacteria 1416
766 Ga0450897_001501 3300042128 Bacteria 1598
767 Ga0450898_006886 3300042134 Bacteria 1757
768 Ga0450904_021122 3300042139 Bacteria 661
769 Ga0450906_007802 3300042145 Bacteria 2099
770 Ga0450907_005115 3300042146 Bacteria 2224
771 Ga0450910_008320 3300042147 Bacteria 1457
772 Ga0450910_032418 3300042147 Bacteria 824
773 Ga0439446_0010534 3300042156 Bacteria 2492
774 Ga0439446_0028713 3300042156 Bacteria 1602
775 Ga0439446_0054417 3300042156 Bacteria 1200
776 Ga0439446_0165514 3300042156 Bacteria 733
777 Ga0450908_002817 3300042184 Bacteria 3380
778 Ga0450908_010910 3300042184 Bacteria 1669
779 Ga0450908_024202 3300042184 Bacteria 1062
780 Ga0450909_006970 3300042185 Bacteria 1631
781 Ga0439434_0005859 3300042435 Bacteria 3592
782 Ga0439434_0039391 3300042435 Bacteria 1450
783 Ga0439435_0089923 3300042436 Bacteria 931
784 Ga0439459_0004461 3300042438 Bacteria 2251
785 Ga0439464_0021604 3300042439 Bacteria 1767
786 Ga0439460_0014558 3300042461 Bacteria 2068
787 Ga0450918_000258 3300042531 Bacteria 11913
788 Ga0450893_0022948 3300042532 Bacteria 1083
789 Ga0451577_0000142 3300042876 Bacteria 160598
790 Ga0451577_0034474 3300042876 Bacteria 4562
791 Ga0451577_0043363 3300042876 Bacteria 4029
792 Ga0451577_0619466 3300042876 Bacteria 982
793 Ga0451577_0748359 3300042876 Bacteria 884
794 Ga0451577_0888545 3300042876 Bacteria 803
795 Ga0451577_1130764 3300042876 Bacteria 700
796 Ga0466969_0002791 3300044656 Bacteria 9332
797 Ga0466969_0003266 3300044656 Bacteria 8619
798 Ga0466969_0077129 3300044656 Bacteria 1595
799 Ga0466972_0002267 3300044658 Bacteria 9455
800 Ga0466972_0126829 3300044658 Bacteria 1202
801 Ga0466972_0135029 3300044658 Bacteria 1161
802 Ga0466972_0418832 3300044658 Bacteria 628
803 Ga0453683_0003262 3300044673 Bacteria 12057
804 Ga0453683_0227683 3300044673 Bacteria 1186
805 Ga0466965_0015331 3300044683 Bacteria 3640
806 Ga0466965_0085449 3300044683 Bacteria 1599
807 Ga0466965_0122230 3300044683 Bacteria 1345
808 Ga0466966_0003451 3300044684 Bacteria 10419
809 Ga0466966_0032471 3300044684 Bacteria 3383
810 Ga0466966_0131119 3300044684 Bacteria 1535
811 Ga0466966_0424411 3300044684 Bacteria 799
812 Ga0466961_0034555 3300044693 Bacteria 3245
813 Ga0453684_0000126 3300044712 Bacteria 336395
814 Ga0453684_0006580 3300044712 Bacteria 21987
815 Ga0453684_0185189 3300044712 Bacteria 2441
816 Ga0453684_0190345 3300044712 Bacteria 2401
817 Ga0453684_0277181 3300044712 Bacteria 1914
818 Ga0453684_0285841 3300044712 Bacteria 1879
819 Ga0453684_1084309 3300044712 Bacteria 847
820 Ga0466971_0020326 3300044719 Bacteria 2952
821 Ga0466968_0003167 3300044735 Bacteria 6070
822 Ga0466968_0049588 3300044735 Bacteria 1789
823 Ga0466970_0395314 3300044765 Bacteria 788
824 Ga0466957_0055801 3300044842 Bacteria 2414
825 Ga0466957_0224614 3300044842 Bacteria 1241
826 Ga0466959_0017917 3300045049 Bacteria 5195
827 Ga0466959_0030003 3300045049 Bacteria 4028
828 Ga0466959_0109517 3300045049 Bacteria 1972
829 Ga0451576_0003200 3300045051 Bacteria 22845
830 Ga0451576_0102005 3300045051 Bacteria 2984
831 Ga0451576_0108769 3300045051 Bacteria 2885
832 Ga0451576_0144753 3300045051 Bacteria 2478
833 Ga0451576_0163553 3300045051 Bacteria 2322
834 Ga0451576_0625731 3300045051 Bacteria 1131
835 Ga0451576_1474007 3300045051 Bacteria 707
836 Ga0495627_024136 3300046453 Bacteria 1984
837 Ga0495592_0000542 3300046454 Bacteria 26890
838 Ga0495592_0107932 3300046454 Bacteria 1974
839 Ga0495590_0045336 3300046457 Bacteria 1534
840 Ga0495629_0220833 3300046459 Bacteria 1307
841 Ga0495629_0350512 3300046459 Bacteria 1007
842 Ga0495638_0027431 3300046460 Bacteria 3686
843 Ga0495638_0083003 3300046460 Bacteria 1942
844 Ga0495641_0122185 3300046461 Bacteria 1162
845 Ga0495650_0057968 3300046471 Bacteria 1565
846 Ga0495650_0232266 3300046471 Bacteria 632
847 Ga0495582_0216652 3300046473 Bacteria 1095
848 Ga0495605_0075325 3300046474 Bacteria 1587
849 Ga0495607_0000104 3300046501 Bacteria 89641
850 Ga0495610_0022848 3300046512 Bacteria 3411
851 Ga0495616_0001588 3300046513 Bacteria 15594
852 Ga0495620_0021209 3300046515 Bacteria 3158
853 Ga0495620_0164194 3300046515 Bacteria 862
854 Ga0495620_0172871 3300046515 Bacteria 837
855 Ga0495630_0018102 3300046517 Bacteria 5171
856 Ga0495632_0016688 3300046519 Bacteria 4076
857 Ga0495632_0037114 3300046519 Bacteria 2475
858 Ga0495632_0173628 3300046519 Bacteria 989
859 Ga0495637_0012385 3300046520 Bacteria 4079
860 Ga0495637_0048343 3300046520 Bacteria 1792
861 Ga0495643_0098704 3300046522 Bacteria 1499
862 Ga0495648_0140457 3300046524 Bacteria 1272
863 Ga0495663_0030403 3300046525 Bacteria 1600
864 Ga0495663_0036184 3300046525 Bacteria 1485
865 Ga0495642_0106865 3300046528 Bacteria 1194
866 Ga0495654_0031744 3300046530 Bacteria 2680
867 Ga0495654_0085535 3300046530 Bacteria 1471
868 Ga0495586_0234582 3300046535 Bacteria 1045
869 Ga0495598_0056598 3300046537 Bacteria 1197
870 Ga0495621_0072853 3300046539 Bacteria 1269
871 Ga0495621_0172642 3300046539 Bacteria 860
872 Ga0495621_0204500 3300046539 Bacteria 795
873 Ga0495621_0296408 3300046539 Bacteria 669
874 Ga0495597_0006996 3300046542 Bacteria 5780
875 Ga0495597_0011456 3300046542 Bacteria 4299
876 Ga0495622_0096402 3300046557 Bacteria 1357
877 Ga0495633_0176192 3300046558 Bacteria 985
878 Ga0495656_0000075 3300046615 Bacteria 44355
879 Ga0495668_0102701 3300046616 Bacteria 1564
880 Ga0495668_0389651 3300046616 Bacteria 765
881 Ga0495611_0020870 3300046648 Bacteria 2824
882 Ga0495625_0000811 3300046660 Bacteria 43302
883 Ga0495625_0005727 3300046660 Bacteria 11236
884 Ga0495625_0006383 3300046660 Bacteria 10514
885 Ga0495625_0025717 3300046660 Bacteria 4460
886 Ga0495661_0161144 3300046665 Bacteria 1204
887 Ga0495588_0037942 3300046674 Bacteria 2450
888 Ga0495588_0195429 3300046674 Bacteria 1068
889 Ga0495646_0041243 3300046680 Bacteria 2837
890 Ga0495658_0064752 3300046683 Bacteria 2107
891 Ga0495658_0245030 3300046683 Bacteria 1126
892 Ga0495669_0149372 3300046684 Bacteria 1106
893 Ga0495669_0376968 3300046684 Bacteria 686
894 Ga0495613_0119004 3300046689 Bacteria 1898
895 Ga0495670_0176854 3300046691 Bacteria 1125
896 Ga0495670_0179599 3300046691 Bacteria 1117
897 Ga0495671_0034019 3300046692 Bacteria 2594
898 Ga0495649_0004026 3300046694 Bacteria 9679
899 Ga0495600_0166072 3300046809 Bacteria 1426
900 Ga0495660_0036857 3300046810 Bacteria 2726
901 Ga0495660_0134110 3300046810 Bacteria 1239
902 Ga0495660_0203165 3300046810 Bacteria 945
903 Ga0495676_0012666 3300047321 Bacteria 7590
904 Ga0495676_0013327 3300047321 Bacteria 7388
905 Ga0495676_0610245 3300047321 Bacteria 710
906 Ga0495683_0189780 3300047323 Bacteria 933
907 Ga0495687_000232 3300047443 Bacteria 77572
908 Ga0495687_042590 3300047443 Bacteria 1982
909 Ga0495687_042591 3300047443 Bacteria 1982
910 Ga0495677_0129611 3300047445 Bacteria 965
911 Ga0495677_0158594 3300047445 Bacteria 873
912 Ga0495686_0001800 3300047472 Bacteria 21696
913 Ga0495686_0180542 3300047472 Bacteria 1223
914 Ga0495686_0182770 3300047472 Bacteria 1214
915 Ga0495686_0438635 3300047472 Bacteria 695
916 Ga0495593_0007103 3300047673 Bacteria 6565
917 Ga0495593_0024332 3300047673 Bacteria 3357
918 Ga0495615_0027624 3300048090 Bacteria 1333
919 Ga0495615_0030520 3300048090 Bacteria 1287
920 Ga0495626_0036930 3300048091 Bacteria 2325
921 Ga0495626_0102736 3300048091 Bacteria 1245
922 Ga0495626_0144435 3300048091 Bacteria 1007
923 Ga0496100_0634095 3300048903 Bacteria 831
924 Ga0496101_0135784 3300048904 Bacteria 1871
925 Ga0496101_0250344 3300048904 Bacteria 1380
926 Ga0496101_0874784 3300048904 Bacteria 708
927 Ga0496102_0003141 3300048905 Bacteria 14013
928 Ga0496104_0806923 3300048907 Bacteria 844
929 Ga0496105_0414311 3300048908 Bacteria 1068
930 Ga0496106_0032663 3300048909 Bacteria 3882
931 Ga0496106_1053740 3300048909 Bacteria 638
932 Ga0496107_0208558 3300048910 Bacteria 1453
933 Ga0496107_0567709 3300048910 Bacteria 840
934 Ga0496108_0122184 3300048911 Bacteria 2234
935 Ga0496109_0282174 3300048912 Bacteria 1565
936 Ga0496109_0762741 3300048912 Bacteria 905
937 Ga0496110_0049361 3300048913 Bacteria 3691
938 Ga0496112_0088286 3300048915 Bacteria 3068
939 Ga0496112_0737718 3300048915 Bacteria 912
940 Ga0496113_0392990 3300048916 Bacteria 1113
941 Ga0496117_0053691 3300048920 Bacteria 2829
942 Ga0496117_0054270 3300048920 Bacteria 2808
943 Ga0496118_0023589 3300048921 Bacteria 5339
944 Ga0496118_0163086 3300048921 Bacteria 1375
945 Ga0496118_0235335 3300048921 Bacteria 1053
946 Ga0496121_0059956 3300048924 Bacteria 3134
947 Ga0496121_0082583 3300048924 Bacteria 2539
948 Ga0496121_0093571 3300048924 Bacteria 2339
949 Ga0496121_0624240 3300048924 Bacteria 661
950 Ga0496122_0007254 3300048925 Bacteria 12399
951 Ga0496122_0169070 3300048925 Bacteria 1321
952 Ga0496122_0302757 3300048925 Bacteria 861
953 Ga0496123_0019596 3300048926 Bacteria 5329
954 Ga0496123_0184818 3300048926 Bacteria 1084
955 Ga0496123_0210948 3300048926 Bacteria 987
956 Ga0496123_0307688 3300048926 Bacteria 753
957 Ga0496123_0366102 3300048926 Bacteria 666
958 Ga0496124_0000419 3300048927 Bacteria 76012
959 Ga0496124_0010638 3300048927 Bacteria 9288
960 Ga0496124_0030743 3300048927 Bacteria 4760
961 Ga0496124_0043016 3300048927 Bacteria 3885
962 Ga0496124_0063813 3300048927 Bacteria 3076
963 Ga0496124_0268157 3300048927 Bacteria 1252
964 Ga0496125_0000729 3300048928 Bacteria 54486
965 Ga0496125_0007984 3300048928 Bacteria 11179
966 Ga0496125_0009773 3300048928 Bacteria 9784
967 Ga0496125_0149046 3300048928 Bacteria 1611
968 Ga0496125_0218074 3300048928 Bacteria 1232
969 Ga0496126_0011869 3300048929 Bacteria 8959
970 Ga0496126_0137726 3300048929 Bacteria 2104
971 Ga0496126_0533963 3300048929 Bacteria 933
972 Ga0501031_0016869 3300049568 Bacteria 4742
973 Ga0501032_0312990 3300049569 Bacteria 1014
974 Ga0501033_0037738 3300049570 Bacteria 3615
975 Ga0501034_0047142 3300049571 Bacteria 4353
976 Ga0501034_0459620 3300049571 Bacteria 1190
977 Ga0501038_0105036 3300049574 Bacteria 2347
978 Ga0501038_0483931 3300049574 Bacteria 948
979 Ga0501039_0192502 3300049575 Bacteria 1604
980 Ga0501039_0509663 3300049575 Bacteria 945
981 Ga0501043_0000010 3300049579 Bacteria 206374
982 Ga0501043_0070521 3300049579 Bacteria 2745
983 Ga0501043_0786944 3300049579 Bacteria 689
984 Ga0501046_0000132 3300049580 Bacteria 79506
985 Ga0501047_0000026 3300049581 Bacteria 225296
986 Ga0501047_0043844 3300049581 Bacteria 4320
987 Ga0501047_0108451 3300049581 Bacteria 2659
988 Ga0501048_0002295 3300049582 Bacteria 14590
989 Ga0501198_000021 3300049649 Bacteria 70854
990 Ga0501206_005470 3300049653 Bacteria 1635
991 Ga0501211_002920 3300049658 Bacteria 1785
992 Ga0501222_000018 3300049662 Bacteria 71805
993 Ga0501223_024920 3300049663 Bacteria 1163
994 Ga0501223_044236 3300049663 Bacteria 864
995 Ga0501227_040773 3300049665 Bacteria 1146
996 Ga0501233_020618 3300049668 Bacteria 1408
997 Ga0501249_011588 3300049679 Bacteria 1853
998 Ga0501221_002783 3300049704 Bacteria 2877
999 Ga0501229_015593 3300049706 Bacteria 986
1000 Ga0501080_0311204 3300049742 Bacteria 1427
1001 Ga0501262_000181 3300049759 Bacteria 7854
1002 Ga0501262_010289 3300049759 Bacteria 1170
1003 Ga0501265_006836 3300049762 Bacteria 1333
1004 Ga0501266_003400 3300049763 Bacteria 1980
1005 Ga0501267_000637 3300049764 Bacteria 2791
1006 Ga0501268_006366 3300049765 Bacteria 1730
1007 Ga0501269_002556 3300049766 Bacteria 2232
1008 Ga0501272_001061 3300049769 Bacteria 2533
1009 Ga0501279_019949 3300049775 Bacteria 951
1010 Ga0501035_0082387 3300049822 Bacteria 2839
1011 Ga0501035_0203423 3300049822 Bacteria 1697
1012 Ga0501035_0572226 3300049822 Bacteria 923
1013 Ga0501044_0222559 3300049823 Bacteria 1837
1014 Ga0501045_0064907 3300049824 Bacteria 2680
1015 nmdc:mga03683_105766_c1 3300050489 Bacteria 1240
1016 nmdc:mga03683_168245_c1 3300050489 Bacteria 995
1017 nmdc:mga03683_28055_c1 3300050489 Bacteria 2235
1018 nmdc:mga03683_4655_c1 3300050489 Bacteria 4570
1019 nmdc:mga03683_80324_c1 3300050489 Bacteria 1407
1020 nmdc:mga03n38_11104_c1 3300050490 Bacteria 3343
1021 nmdc:mga03n38_14169_c1 3300050490 Bacteria 3049
1022 nmdc:mga03n38_287493_c1 3300050490 Bacteria 879
1023 nmdc:mga03n38_318641_c1 3300050490 Bacteria 839
1024 nmdc:mga03n38_322053_c1 3300050490 Bacteria 835
1025 nmdc:mga03n38_327336_c1 3300050490 Bacteria 829
1026 nmdc:mga00v17_18255_c1 3300050491 Bacteria 3981
1027 nmdc:mga00v17_21586_c1 3300050491 Bacteria 3703
1028 nmdc:mga00v17_24625_c1 3300050491 Bacteria 3492
1029 nmdc:mga00v17_26471_c1 3300050491 Bacteria 3380
1030 nmdc:mga00v17_388190_c1 3300050491 Bacteria 907
1031 nmdc:mga00v17_501477_c1 3300050491 Bacteria 787
1032 nmdc:mga0yw44_520711_c1 3300050492 Bacteria 807
1033 nmdc:mga0yw44_85613_c1 3300050492 Bacteria 1983
1034 nmdc:mga0yw44_99857_c1 3300050492 Bacteria 1847
1035 nmdc:mga0k408_10600_c1 3300050493 Bacteria 4990
1036 nmdc:mga0k408_1468_c1 3300050493 Bacteria 12734
1037 nmdc:mga0k408_20126_c1 3300050493 Bacteria 3735
1038 nmdc:mga0k408_212002_c1 3300050493 Bacteria 1156
1039 nmdc:mga0k408_27872_c1 3300050493 Bacteria 2643
1040 nmdc:mga0k408_318795_c1 3300050493 Bacteria 927
1041 nmdc:mga0k408_41035_c1 3300050493 Bacteria 2664
1042 nmdc:mga0k408_41187_c1 3300050493 Bacteria 2659
1043 nmdc:mga0k408_4551_c1 3300050493 Bacteria 7363
1044 nmdc:mga0k408_4876_c1 3300050493 Bacteria 7117
1045 nmdc:mga0k408_565556_c1 3300050493 Bacteria 672
1046 nmdc:mga0k408_91449_c1 3300050493 Bacteria 1788
1047 nmdc:mga06z11_154016_c1 3300050494 Bacteria 1309
1048 nmdc:mga06z11_157361_c1 3300050494 Bacteria 1296
1049 nmdc:mga06z11_18549_c1 3300050494 Bacteria 3180
1050 nmdc:mga06z11_339670_c1 3300050494 Bacteria 898
1051 nmdc:mga04h51_77083_c1 3300050495 Bacteria 1176
1052 nmdc:mga07m45_151297_c1 3300050496 Bacteria 1346
1053 nmdc:mga07m45_153943_c1 3300050496 Bacteria 1333
1054 nmdc:mga07m45_15745_c1 3300050496 Bacteria 4041
1055 nmdc:mga07m45_248009_c1 3300050496 Bacteria 1036
1056 nmdc:mga07m45_33307_c1 3300050496 Bacteria 2861
1057 nmdc:mga07m45_3337_c1 3300050496 Bacteria 7735
1058 nmdc:mga07m45_336911_c1 3300050496 Bacteria 877
1059 nmdc:mga07m45_429226_c1 3300050496 Bacteria 767
1060 nmdc:mga07m45_7015_c1 3300050496 Bacteria 5730
1061 nmdc:mga07m45_8540_c1 3300050496 Bacteria 5270
1062 nmdc:mga07m45_880_c1 3300050496 Bacteria 13106
1063 nmdc:mga07m45_9064_c1 3300050496 Bacteria 5142
1064 nmdc:mga07m45_9089_c1 3300050496 Bacteria 5135
1065 nmdc:mga07m45_94070_c1 3300050496 Bacteria 1718
1066 nmdc:mga05p37_46673_c1 3300050507 Bacteria 5325
1067 nmdc:mga09592_1237_c1 3300050508 Bacteria 20472
1068 nmdc:mga09592_75745_c1 3300050508 Bacteria 2861
1069 nmdc:mga0qj67_104256_c1 3300050509 Bacteria 2288
1070 nmdc:mga06r32_337655_c1 3300050510 Bacteria 1491
1071 nmdc:mga0a205_59811_c2 3300050515 Bacteria 1549
1072 nmdc:mga0sz30_133398_c1 3300050516 Bacteria 1095
1073 nmdc:mga0sz30_23985_c1 3300050516 Bacteria 2487
1074 nmdc:mga0sz30_276988_c1 3300050516 Bacteria 747
1075 nmdc:mga0sz30_296530_c1 3300050516 Bacteria 721
1076 nmdc:mga0sz30_91096_c1 3300050516 Bacteria 1327
1077 Ga0500610_0005460 3300053079 Bacteria 5212
1078 Ga0500610_0009289 3300053079 Bacteria 4346
1079 Ga0500643_004846 3300053087 Bacteria 5942
1080 Ga0500644_0018748 3300053088 Bacteria 2032
1081 Ga0500644_0113281 3300053088 Bacteria 1047
1082 Ga0500644_0114356 3300053088 Bacteria 1043
1083 Ga0500646_0195040 3300053090 Bacteria 692
1084 Ga0500647_0229049 3300053091 Bacteria 828
1085 Ga0500651_0049299 3300053093 Bacteria 2645
1086 Ga0500566_0096110 3300053094 Bacteria 1631
1087 Ga0500562_014934 3300053108 Bacteria 1990
1088 Ga0500571_000080 3300053110 Bacteria 30359
1089 Ga0500593_000694 3300053117 Bacteria 12808
1090 Ga0500593_004435 3300053117 Bacteria 5431
1091 Ga0500594_0003168 3300053118 Bacteria 3601
1092 Ga0500594_0005379 3300053118 Bacteria 2838
1093 Ga0500597_193218 3300053120 Bacteria 858
1094 Ga0500607_010298 3300053121 Bacteria 5579
1095 Ga0500607_017986 3300053121 Bacteria 4019
1096 Ga0500608_037758 3300053122 Bacteria 2308
1097 Ga0500608_045642 3300053122 Bacteria 2105
1098 Ga0500608_096081 3300053122 Bacteria 1378
1099 Ga0500618_024750 3300053125 Bacteria 1444
1100 Ga0500626_152735 3300053128 Bacteria 957
1101 Ga0500628_042312 3300053129 Bacteria 1046
1102 Ga0500652_015873 3300053131 Bacteria 2729
1103 Ga0500655_001531 3300053133 Bacteria 4376
1104 Ga0500658_0000210 3300053134 Bacteria 27749
1105 Ga0500658_0000493 3300053134 Bacteria 16873
1106 Ga0500658_0044423 3300053134 Bacteria 1793
1107 Ga0500658_0211496 3300053134 Bacteria 888
1108 Ga0500559_0000986 3300053136 Bacteria 17748
1109 Ga0500559_0010425 3300053136 Bacteria 3988
1110 Ga0500561_0072104 3300053137 Bacteria 990
1111 Ga0500564_018756 3300053138 Bacteria 3158
1112 Ga0500568_0001699 3300053139 Bacteria 13727
1113 Ga0500568_0076257 3300053139 Bacteria 1277
1114 Ga0500574_054872 3300053141 Bacteria 1146
1115 Ga0500590_053213 3300053148 Bacteria 2053
1116 Ga0500604_0082388 3300053151 Bacteria 1041
1117 Ga0500616_0031819 3300053153 Bacteria 2886
1118 Ga0500619_000052 3300053154 Bacteria 35466
1119 Ga0500622_0024965 3300053156 Bacteria 3159
1120 Ga0500622_0043216 3300053156 Bacteria 2337
1121 Ga0500627_0017357 3300053158 Bacteria 2826
1122 Ga0500627_0054405 3300053158 Bacteria 1751
1123 Ga0500634_0005197 3300053161 Bacteria 6145
1124 Ga0500634_0006307 3300053161 Bacteria 5725
1125 Ga0500645_000769 3300053730 Bacteria 19474
1126 Ga0500645_007527 3300053730 Bacteria 3783
1127 Ga0500645_012144 3300053730 Bacteria 2790
1128 Ga0500645_031534 3300053730 Bacteria 1592
1129 Ga0500565_001904 3300053734 Bacteria 1484
1130 Ga0500587_002166 3300053739 Bacteria 2800
1131 Ga0590071_003320 3300059421 Bacteria 3963
1132 Ga0590074_001555 3300059423 Bacteria 3722
1133 Ga0590075_026483 3300059424 Bacteria 1460
1134 Ga0501082_0420838 3300060353 Bacteria 1167
1135 Ga0466962_0002096 3300061719 Bacteria 9428

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050516 nmdc:mga0sz30_276988_c1 nmdc:mga0sz30_276988_c1_225_731 156
2 3300005338 Ga0068868_100109948 Ga0068868_1001099482 169
3 3300006353 Ga0075370_10316080 Ga0075370_103160801 169
4 3300006880 Ga0075429_100144676 Ga0075429_1001446763 169
5 3300031548 Ga0307408_100679971 Ga0307408_1006799711 169
6 3300038726 Ga0400490_05408 Ga0400490_05408_12038_12553 169
7 3300038742 Ga0400486_06505 Ga0400486_06505_2905_3420 169
8 3300039062 Ga0400483_120900 Ga0400483_120900_492_1007 169
9 3300042125 Ga0450923_132748 Ga0450923_132748_58_573 169
10 3300045049 Ga0466959_0109517 Ga0466959_0109517_11_526 169
11 3300050515 nmdc:mga0a205_59811_c2 nmdc:mga0a205_59811_c2_626_1168 169
12 3300005564 Ga0070664_100083036 Ga0070664_1000830363 174
13 3300037471 Ga0395905_0181049 Ga0395905_0181049_583_1164 175
14 3300042876 Ga0451577_1130764 Ga0451577_1130764_10_573 175
15 3300042184 Ga0450908_024202 Ga0450908_024202_24_563 177
16 3300045051 Ga0451576_0108769 Ga0451576_0108769_561_1142 180
17 3300041498 Ga0451841_1115077 Ga0451841_1115077_75_626 183
18 3300041999 Ga0439433_0016870 Ga0439433_0016870_529_1119 184
19 3300042007 Ga0439449_0053123 Ga0439449_0053123_298_888 184
20 3300046459 Ga0495629_0220833 Ga0495629_0220833_721_1281 186
21 3300046473 Ga0495582_0216652 Ga0495582_0216652_492_1052 186
22 3300046517 Ga0495630_0018102 Ga0495630_0018102_884_1444 186
23 3300046557 Ga0495622_0096402 Ga0495622_0096402_68_628 186
24 3300046683 Ga0495658_0064752 Ga0495658_0064752_248_808 186
25 3300046689 Ga0495613_0119004 Ga0495613_0119004_938_1498 186
26 3300047321 Ga0495676_0013327 Ga0495676_0013327_4542_5102 186
27 3300047673 Ga0495593_0024332 Ga0495593_0024332_1887_2447 186
28 3300028794 Ga0307515_10022871 Ga0307515_100228713 187
29 3300031731 Ga0307405_10148449 Ga0307405_101484492 187
30 3300044673 Ga0453683_0003262 Ga0453683_0003262_907_1476 187
31 3300045051 Ga0451576_0163553 Ga0451576_0163553_1734_2303 187
32 3300005614 Ga0068856_100153017 Ga0068856_1001530173 188
33 3300026078 Ga0207702_10041297 Ga0207702_100412973 188
34 iso_pu_bacteria 2643221585 2643936129 189
35 iso_pu_bacteria 2643221639 2644217787 189
36 iso_pu_bacteria 2643221646 2644258473 189
37 iso_pu_bacteria 2643221656 2644316774 189
38 iso_pu_bacteria 2738541337 2739056850 189
39 iso_pu_bacteria 2831864461 2831868519 189
40 iso_pu_bacteria 2904479285 2904480735 190
41 iso_pu_bacteria 2643221654 2644304427 191
42 iso_pu_bacteria 2881101125 2881103223 191
43 iso_pu_bacteria 2939631187 2939636496 191
44 3300044712 Ga0453684_0285841 Ga0453684_0285841_1186_1764 192
45 iso_pu_bacteria 2511231002 2511245806 192
46 iso_pu_bacteria 2547132374 2548496968 192
47 iso_pu_bacteria 2599185214 2599623485 192
48 iso_pu_bacteria 2599185226 2599671897 192
49 iso_pu_bacteria 2599185227 2599681090 192
50 iso_pu_bacteria 2599185229 2599693506 192
51 iso_pu_bacteria 2643221570 2643864929 192
52 iso_pu_bacteria 2643221596 2643990408 192
53 iso_pu_bacteria 2643221628 2644160667 192
54 iso_pu_bacteria 2643221652 2644296050 192
55 iso_pu_bacteria 2643221660 2644340734 192
56 iso_pu_bacteria 2643221717 2644645528 192
57 iso_pu_bacteria 2721755523 2722882604 192
58 iso_pu_bacteria 2738541277 2738717566 192
59 iso_pu_bacteria 2738543013 2739250569 192
60 iso_pu_bacteria 2738543019 2739278252 192
61 iso_pu_bacteria 2818991446 2819597052 192
62 iso_pu_bacteria 2831265667 2831266171 192
63 iso_pu_bacteria 2838054893 2838057719 192
64 iso_pu_bacteria 2839138175 2839141132 192
65 iso_pu_bacteria 2842677519 2842678983 192
66 iso_pu_bacteria 2842718218 2842720015 192
67 iso_pu_bacteria 2885192300 2885192338 192
68 iso_pu_bacteria 2885198086 2885204287 192
69 iso_pu_bacteria 2885211737 2885217940 192
70 iso_pu_bacteria 2899924645 2899930207 192
71 iso_pu_bacteria 2904449895 2904456133 192
72 iso_pu_bacteria 2904456579 2904457683 192
73 iso_pu_bacteria 2904541872 2904543549 192
74 iso_pu_bacteria 2919462493 2919467475 192
75 iso_pu_bacteria 2928037797 2928039320 192
76 iso_pu_bacteria 2928044640 2928045075 192
77 iso_pu_bacteria 2928051484 2928052881 192
78 iso_pu_bacteria 2928064002 2928064448 192
79 iso_pu_bacteria 2928070936 2928071902 192
80 iso_pu_bacteria 2928084124 2928084161 192
81 iso_pu_bacteria 2928115317 2928115999 192
82 iso_pu_bacteria 2929160207 2929162916 192
83 iso_pu_bacteria 2929520902 2929527275 192
84 iso_pu_bacteria 2945945610 2945947584 192
85 iso_pu_bacteria 2945972063 2945977547 192
86 iso_pu_bacteria 2954767861 2954772569 192
87 iso_pu_bacteria 2974320154 2974323032 192
88 iso_pu_bacteria 2990710928 2990711930 192
89 3300003322 rootL2_10092820 rootL2_100928202 193
90 3300003323 rootH1_10033192 rootH1_1003319210 193
91 3300003759 Ga0055525_1000013 Ga0055525_1000013378 193
92 3300005337 Ga0070682_100097617 Ga0070682_1000976173 193
93 3300005344 Ga0070661_100003164 Ga0070661_1000031644 193
94 3300005366 Ga0070659_100001056 Ga0070659_10000105619 193
95 3300005564 Ga0070664_100056396 Ga0070664_1000563963 193
96 3300006195 Ga0075366_10342530 Ga0075366_103425301 193
97 3300006353 Ga0075370_10000340 Ga0075370_1000034010 193
98 3300006353 Ga0075370_10015657 Ga0075370_100156573 193
99 3300014969 Ga0157376_10996815 Ga0157376_109968151 193
100 3300021361 Ga0213872_10000003 Ga0213872_10000003248 193
101 3300021361 Ga0213872_10000044 Ga0213872_1000004426 193
102 3300021361 Ga0213872_10000064 Ga0213872_1000006420 193
103 3300021361 Ga0213872_10000163 Ga0213872_1000016344 193
104 3300021361 Ga0213872_10076932 Ga0213872_100769321 193
105 3300025230 Ga0209563_100025 Ga0209563_100025209 193
106 3300025273 Ga0209673_1006995 Ga0209673_10069953 193
107 3300025295 Ga0209564_1000005 Ga0209564_1000005144 193
108 3300025298 Ga0209050_1005366 Ga0209050_10053663 193
109 3300025303 Ga0209051_1003020 Ga0209051_10030205 193
110 3300025304 Ga0209257_1000094 Ga0209257_1000094121 193
111 3300025913 Ga0207695_10631781 Ga0207695_106317812 193
112 3300025919 Ga0207657_10192044 Ga0207657_101920442 193
113 3300025920 Ga0207649_10087815 Ga0207649_100878153 193
114 3300025932 Ga0207690_10001069 Ga0207690_100010693 193
115 3300025945 Ga0207679_10184593 Ga0207679_101845932 193
116 3300027312 Ga0209371_1031130 Ga0209371_10311302 193
117 3300028794 Ga0307515_10020511 Ga0307515_100205117 193
118 3300028794 Ga0307515_10053977 Ga0307515_100539773 193
119 3300030500 Ga0268256_1028319 Ga0268256_10283192 193
120 3300031239 Ga0265328_10035265 Ga0265328_100352653 193
121 3300031250 Ga0265331_10007350 Ga0265331_100073502 193
122 3300031251 Ga0265327_10000043 Ga0265327_10000043160 193
123 3300031507 Ga0307509_10214152 Ga0307509_102141523 193
124 3300031548 Ga0307408_100041773 Ga0307408_1000417733 193
125 3300031730 Ga0307516_10000525 Ga0307516_1000052553 193
126 3300031730 Ga0307516_10002317 Ga0307516_100023175 193
127 3300031911 Ga0307412_10944127 Ga0307412_109441271 193
128 3300032005 Ga0307411_10003656 Ga0307411_100036564 193
129 3300034817 Ga0373948_0001130 Ga0373948_0001130_1815_2396 193
130 3300035091 Ga0373951_0007149 Ga0373951_0007149_1042_1623 193
131 3300035114 Ga0373939_0000474 Ga0373939_0000474_6279_6860 193
132 3300035241 Ga0373961_0008752 Ga0373961_0008752_441_1022 193
133 3300035242 Ga0373962_0021091 Ga0373962_0021091_11_592 193
134 3300035691 Ga0373931_0026906 Ga0373931_0026906_442_1023 193
135 3300037471 Ga0395905_0063205 Ga0395905_0063205_1223_1804 193
136 3300039447 Ga0436361_0163926 Ga0436361_0163926_18999_19580 193
137 3300039447 Ga0436361_0657686 Ga0436361_0657686_45857_46438 193
138 3300039447 Ga0436361_0886712 Ga0436361_0886712_25815_26396 193
139 3300039447 Ga0436361_1061851 Ga0436361_1061851_36798_37379 193
140 3300039447 Ga0436361_1215716 Ga0436361_1215716_2526_3107 193
141 3300042119 Ga0450915_000412 Ga0450915_000412_114_701 193
142 3300042127 Ga0450890_007246 Ga0450890_007246_784_1371 193
143 3300042436 Ga0439435_0089923 Ga0439435_0089923_188_775 193
144 3300042438 Ga0439459_0004461 Ga0439459_0004461_1152_1739 193
145 3300044658 Ga0466972_0126829 Ga0466972_0126829_133_714 193
146 3300046691 Ga0495670_0176854 Ga0495670_0176854_365_952 193
147 3300048912 Ga0496109_0762741 Ga0496109_0762741_122_709 193
148 3300048927 Ga0496124_0010638 Ga0496124_0010638_7870_8457 193
149 3300048929 Ga0496126_0137726 Ga0496126_0137726_468_1055 193
150 3300049658 Ga0501211_002920 Ga0501211_002920_567_1148 193
151 3300049663 Ga0501223_024920 Ga0501223_024920_17_598 193
152 3300049665 Ga0501227_040773 Ga0501227_040773_69_650 193
153 3300049668 Ga0501233_020618 Ga0501233_020618_732_1313 193
154 3300049679 Ga0501249_011588 Ga0501249_011588_823_1404 193
155 3300049704 Ga0501221_002783 Ga0501221_002783_577_1158 193
156 3300049706 Ga0501229_015593 Ga0501229_015593_24_605 193
157 3300049759 Ga0501262_010289 Ga0501262_010289_541_1122 193
158 3300049762 Ga0501265_006836 Ga0501265_006836_497_1078 193
159 3300049764 Ga0501267_000637 Ga0501267_000637_1769_2350 193
160 3300049765 Ga0501268_006366 Ga0501268_006366_355_936 193
161 3300049766 Ga0501269_002556 Ga0501269_002556_726_1307 193
162 3300049769 Ga0501272_001061 Ga0501272_001061_1259_1840 193
163 3300049775 Ga0501279_019949 Ga0501279_019949_174_755 193
164 3300050496 nmdc:mga07m45_248009_c1 nmdc:mga07m45_248009_c1_139_720 193
165 3300050496 nmdc:mga07m45_3337_c1 nmdc:mga07m45_3337_c1_1878_2459 193
166 3300053137 Ga0500561_0072104 Ga0500561_0072104_114_695 193
167 3300053156 Ga0500622_0024965 Ga0500622_0024965_547_1134 193
168 3300053158 Ga0500627_0054405 Ga0500627_0054405_993_1574 193
169 3300059421 Ga0590071_003320 Ga0590071_003320_3260_3841 193
170 3300059423 Ga0590074_001555 Ga0590074_001555_2213_2794 193
171 3300059424 Ga0590075_026483 Ga0590075_026483_447_1028 193
172 3300005339 Ga0070660_100879503 Ga0070660_1008795031 194
173 3300005353 Ga0070669_100029036 Ga0070669_1000290364 194
174 3300005354 Ga0070675_100177695 Ga0070675_1001776953 194
175 3300005364 Ga0070673_100060889 Ga0070673_1000608892 194
176 3300005456 Ga0070678_100130002 Ga0070678_1001300022 194
177 3300006038 Ga0075365_10038916 Ga0075365_100389163 194
178 3300006042 Ga0075368_10074866 Ga0075368_100748662 194
179 3300006048 Ga0075363_100099920 Ga0075363_1000999203 194
180 3300006048 Ga0075363_100497202 Ga0075363_1004972021 194
181 3300006177 Ga0075362_10087552 Ga0075362_100875522 194
182 3300006195 Ga0075366_10326259 Ga0075366_103262592 194
183 3300025909 Ga0207705_10470832 Ga0207705_104708322 194
184 3300025932 Ga0207690_10523913 Ga0207690_105239131 194
185 3300025937 Ga0207669_10164339 Ga0207669_101643393 194
186 3300025960 Ga0207651_10083778 Ga0207651_100837782 194
187 3300028380 Ga0268265_11115192 Ga0268265_111151921 194
188 3300031711 Ga0265314_10038784 Ga0265314_100387844 194
189 3300044656 Ga0466969_0077129 Ga0466969_0077129_635_1219 194
190 3300044658 Ga0466972_0418832 Ga0466972_0418832_18_602 194
191 3300044684 Ga0466966_0131119 Ga0466966_0131119_709_1293 194
192 3300044684 Ga0466966_0424411 Ga0466966_0424411_121_705 194
193 3300044735 Ga0466968_0003167 Ga0466968_0003167_893_1477 194
194 3300044842 Ga0466957_0224614 Ga0466957_0224614_167_751 194
195 3300049571 Ga0501034_0047142 Ga0501034_0047142_3599_4189 194
196 3300049574 Ga0501038_0483931 Ga0501038_0483931_247_831 194
197 3300049575 Ga0501039_0509663 Ga0501039_0509663_88_672 194
198 3300049579 Ga0501043_0070521 Ga0501043_0070521_123_707 194
199 3300049581 Ga0501047_0043844 Ga0501047_0043844_1279_1863 194
200 3300049742 Ga0501080_0311204 Ga0501080_0311204_225_809 194
201 3300049822 Ga0501035_0203423 Ga0501035_0203423_994_1578 194
202 3300050494 nmdc:mga06z11_154016_c1 nmdc:mga06z11_154016_c1_479_1063 194
203 3300050495 nmdc:mga04h51_77083_c1 nmdc:mga04h51_77083_c1_29_613 194
204 iso_pu_bacteria 2643221609 2644062533 194
205 iso_pu_bacteria 2643221611 2644076436 194
206 iso_pu_bacteria 2816332133 2816474725 194
207 iso_pu_bacteria 2857576091 2857578402 194
208 3300003347 JGI26128J50194_1001258 JGI26128J50194_10012581 195
209 3300004803 Ga0058862_10046891 Ga0058862_100468913 195
210 3300005328 Ga0070676_10003470 Ga0070676_100034705 195
211 3300005328 Ga0070676_10040798 Ga0070676_100407983 195
212 3300005328 Ga0070676_10060101 Ga0070676_100601012 195
213 3300005331 Ga0070670_100084096 Ga0070670_1000840962 195
214 3300005331 Ga0070670_100185094 Ga0070670_1001850941 195
215 3300005331 Ga0070670_100264501 Ga0070670_1002645012 195
216 3300005333 Ga0070677_10004753 Ga0070677_100047532 195
217 3300005334 Ga0068869_100008869 Ga0068869_1000088695 195
218 3300005334 Ga0068869_100162787 Ga0068869_1001627872 195
219 3300005334 Ga0068869_100780356 Ga0068869_1007803562 195
220 3300005338 Ga0068868_100020836 Ga0068868_1000208365 195
221 3300005338 Ga0068868_100025065 Ga0068868_1000250654 195
222 3300005338 Ga0068868_100052998 Ga0068868_1000529982 195
223 3300005338 Ga0068868_100427582 Ga0068868_1004275822 195
224 3300005354 Ga0070675_100007410 Ga0070675_1000074105 195
225 3300005354 Ga0070675_100018213 Ga0070675_1000182132 195
226 3300005355 Ga0070671_100003978 Ga0070671_10000397810 195
227 3300005355 Ga0070671_100022049 Ga0070671_1000220493 195
228 3300005355 Ga0070671_100077674 Ga0070671_1000776743 195
229 3300005355 Ga0070671_100451836 Ga0070671_1004518362 195
230 3300005356 Ga0070674_100001350 Ga0070674_1000013504 195
231 3300005356 Ga0070674_100005970 Ga0070674_1000059706 195
232 3300005364 Ga0070673_100002284 Ga0070673_1000022843 195
233 3300005364 Ga0070673_100018990 Ga0070673_1000189904 195
234 3300005367 Ga0070667_100000427 Ga0070667_10000042735 195
235 3300005367 Ga0070667_100135591 Ga0070667_1001355912 195
236 3300005367 Ga0070667_100301939 Ga0070667_1003019392 195
237 3300005455 Ga0070663_100014432 Ga0070663_1000144321 195
238 3300005455 Ga0070663_100408778 Ga0070663_1004087782 195
239 3300005456 Ga0070678_100306146 Ga0070678_1003061461 195
240 3300005456 Ga0070678_100649736 Ga0070678_1006497361 195
241 3300005457 Ga0070662_100007285 Ga0070662_1000072853 195
242 3300005457 Ga0070662_100015383 Ga0070662_1000153837 195
243 3300005457 Ga0070662_100811032 Ga0070662_1008110321 195
244 3300005459 Ga0068867_100000176 Ga0068867_10000017610 195
245 3300005459 Ga0068867_100002046 Ga0068867_10000204613 195
246 3300005459 Ga0068867_100021358 Ga0068867_1000213582 195
247 3300005459 Ga0068867_100041869 Ga0068867_1000418693 195
248 3300005459 Ga0068867_100065677 Ga0068867_1000656773 195
249 3300005467 Ga0070706_100000533 Ga0070706_10000053318 195
250 3300005468 Ga0070707_100003061 Ga0070707_1000030614 195
251 3300005468 Ga0070707_100285174 Ga0070707_1002851741 195
252 3300005468 Ga0070707_101128036 Ga0070707_1011280361 195
253 3300005471 Ga0070698_100147223 Ga0070698_1001472233 195
254 3300005518 Ga0070699_100466197 Ga0070699_1004661972 195
255 3300005539 Ga0068853_100158904 Ga0068853_1001589042 195
256 3300005543 Ga0070672_100000317 Ga0070672_10000031710 195
257 3300005543 Ga0070672_100011281 Ga0070672_1000112813 195
258 3300005543 Ga0070672_100212578 Ga0070672_1002125783 195
259 3300005548 Ga0070665_100221204 Ga0070665_1002212042 195
260 3300005563 Ga0068855_100526400 Ga0068855_1005264002 195
261 3300005577 Ga0068857_100016010 Ga0068857_1000160102 195
262 3300005577 Ga0068857_100279711 Ga0068857_1002797112 195
263 3300005578 Ga0068854_100406257 Ga0068854_1004062572 195
264 3300005616 Ga0068852_100036324 Ga0068852_1000363242 195
265 3300005616 Ga0068852_101011126 Ga0068852_1010111262 195
266 3300005617 Ga0068859_100214678 Ga0068859_1002146783 195
267 3300005617 Ga0068859_100448748 Ga0068859_1004487482 195
268 3300005618 Ga0068864_100107072 Ga0068864_1001070722 195
269 3300005618 Ga0068864_100552087 Ga0068864_1005520871 195
270 3300005840 Ga0068870_10129674 Ga0068870_101296742 195
271 3300005841 Ga0068863_100070689 Ga0068863_1000706892 195
272 3300005841 Ga0068863_100112570 Ga0068863_1001125702 195
273 3300005841 Ga0068863_100164624 Ga0068863_1001646244 195
274 3300005842 Ga0068858_101004194 Ga0068858_1010041941 195
275 3300005843 Ga0068860_100111478 Ga0068860_1001114782 195
276 3300005843 Ga0068860_100147016 Ga0068860_1001470163 195
277 3300006038 Ga0075365_10022086 Ga0075365_100220864 195
278 3300006048 Ga0075363_100018438 Ga0075363_1000184383 195
279 3300006048 Ga0075363_100047658 Ga0075363_1000476581 195
280 3300006048 Ga0075363_100319854 Ga0075363_1003198542 195
281 3300006051 Ga0075364_10031776 Ga0075364_100317763 195
282 3300006177 Ga0075362_10013562 Ga0075362_100135622 195
283 3300006177 Ga0075362_10054075 Ga0075362_100540753 195
284 3300006178 Ga0075367_10014302 Ga0075367_100143022 195
285 3300006178 Ga0075367_10022283 Ga0075367_100222833 195
286 3300006178 Ga0075367_10023123 Ga0075367_100231233 195
287 3300006186 Ga0075369_10029608 Ga0075369_100296082 195
288 3300006195 Ga0075366_10002632 Ga0075366_100026324 195
289 3300006195 Ga0075366_10003790 Ga0075366_100037902 195
290 3300006195 Ga0075366_10014189 Ga0075366_100141892 195
291 3300006195 Ga0075366_10030092 Ga0075366_100300923 195
292 3300006195 Ga0075366_10053809 Ga0075366_100538092 195
293 3300006195 Ga0075366_10105887 Ga0075366_101058871 195
294 3300006195 Ga0075366_10141305 Ga0075366_101413053 195
295 3300006195 Ga0075366_10325805 Ga0075366_103258052 195
296 3300006195 Ga0075366_10362715 Ga0075366_103627151 195
297 3300006237 Ga0097621_100669246 Ga0097621_1006692462 195
298 3300006353 Ga0075370_10014349 Ga0075370_100143493 195
299 3300006353 Ga0075370_10016575 Ga0075370_100165753 195
300 3300006353 Ga0075370_10021748 Ga0075370_100217482 195
301 3300006353 Ga0075370_10035897 Ga0075370_100358973 195
302 3300006353 Ga0075370_10089692 Ga0075370_100896922 195
303 3300006852 Ga0075433_10014085 Ga0075433_100140858 195
304 3300006880 Ga0075429_100003305 Ga0075429_10000330514 195
305 3300006881 Ga0068865_100148994 Ga0068865_1001489942 195
306 3300006881 Ga0068865_100710951 Ga0068865_1007109512 195
307 3300006931 Ga0097620_100214679 Ga0097620_1002146793 195
308 3300006931 Ga0097620_100448755 Ga0097620_1004487552 195
309 3300006946 Ga0079104_1000025 Ga0079104_100002554 195
310 3300009092 Ga0105250_10001558 Ga0105250_100015583 195
311 3300009093 Ga0105240_10253253 Ga0105240_102532532 195
312 3300009093 Ga0105240_10706803 Ga0105240_107068032 195
313 3300009098 Ga0105245_10142180 Ga0105245_101421802 195
314 3300009098 Ga0105245_10169653 Ga0105245_101696532 195
315 3300009098 Ga0105245_10571237 Ga0105245_105712372 195
316 3300009148 Ga0105243_10001022 Ga0105243_1000102224 195
317 3300009148 Ga0105243_10003493 Ga0105243_100034938 195
318 3300009148 Ga0105243_10117133 Ga0105243_101171332 195
319 3300009174 Ga0105241_10347205 Ga0105241_103472052 195
320 3300009176 Ga0105242_10406864 Ga0105242_104068642 195
321 3300009545 Ga0105237_10017662 Ga0105237_100176628 195
322 3300009553 Ga0105249_10504625 Ga0105249_105046253 195
323 3300009553 Ga0105249_11252465 Ga0105249_112524652 195
324 3300010375 Ga0105239_10116457 Ga0105239_101164574 195
325 3300010375 Ga0105239_10123828 Ga0105239_101238283 195
326 3300011119 Ga0105246_10127800 Ga0105246_101278001 195
327 3300013296 Ga0157374_10276013 Ga0157374_102760132 195
328 3300013296 Ga0157374_11070683 Ga0157374_110706832 195
329 3300013297 Ga0157378_11023617 Ga0157378_110236171 195
330 3300013297 Ga0157378_11281888 Ga0157378_112818882 195
331 3300013306 Ga0163162_10526524 Ga0163162_105265241 195
332 3300013306 Ga0163162_11010942 Ga0163162_110109421 195
333 3300013308 Ga0157375_10385129 Ga0157375_103851292 195
334 3300014745 Ga0157377_10000055 Ga0157377_1000005519 195
335 3300014968 Ga0157379_10149577 Ga0157379_101495772 195
336 3300014968 Ga0157379_10266203 Ga0157379_102662032 195
337 3300014968 Ga0157379_10342976 Ga0157379_103429761 195
338 3300014968 Ga0157379_10517974 Ga0157379_105179742 195
339 3300014969 Ga0157376_10010210 Ga0157376_100102105 195
340 3300014969 Ga0157376_10020357 Ga0157376_100203576 195
341 3300017792 Ga0163161_10042396 Ga0163161_100423962 195
342 3300020080 Ga0206350_10885651 Ga0206350_108856512 195
343 3300022467 Ga0224712_10002149 Ga0224712_100021493 195
344 3300025303 Ga0209051_1008451 Ga0209051_10084512 195
345 3300025304 Ga0209257_1024020 Ga0209257_10240202 195
346 3300025315 Ga0207697_10089027 Ga0207697_100890272 195
347 3300025321 Ga0207656_10160910 Ga0207656_101609102 195
348 3300025711 Ga0207696_1014771 Ga0207696_10147713 195
349 3300025893 Ga0207682_10004814 Ga0207682_100048142 195
350 3300025893 Ga0207682_10130552 Ga0207682_101305521 195
351 3300025901 Ga0207688_10192120 Ga0207688_101921202 195
352 3300025907 Ga0207645_10034117 Ga0207645_100341173 195
353 3300025908 Ga0207643_10118905 Ga0207643_101189052 195
354 3300025909 Ga0207705_10734690 Ga0207705_107346902 195
355 3300025910 Ga0207684_10003382 Ga0207684_1000338214 195
356 3300025911 Ga0207654_10681212 Ga0207654_106812122 195
357 3300025913 Ga0207695_10450756 Ga0207695_104507562 195
358 3300025922 Ga0207646_10239797 Ga0207646_102397972 195
359 3300025923 Ga0207681_10041661 Ga0207681_100416613 195
360 3300025924 Ga0207694_10491776 Ga0207694_104917762 195
361 3300025925 Ga0207650_10187259 Ga0207650_101872592 195
362 3300025925 Ga0207650_10205436 Ga0207650_102054362 195
363 3300025925 Ga0207650_10720927 Ga0207650_107209271 195
364 3300025926 Ga0207659_10012775 Ga0207659_100127753 195
365 3300025926 Ga0207659_10172205 Ga0207659_101722051 195
366 3300025927 Ga0207687_10011980 Ga0207687_100119806 195
367 3300025927 Ga0207687_10301119 Ga0207687_103011192 195
368 3300025927 Ga0207687_10373784 Ga0207687_103737842 195
369 3300025927 Ga0207687_10428532 Ga0207687_104285322 195
370 3300025931 Ga0207644_10053981 Ga0207644_100539813 195
371 3300025931 Ga0207644_10185710 Ga0207644_101857102 195
372 3300025933 Ga0207706_10008133 Ga0207706_100081335 195
373 3300025933 Ga0207706_10015176 Ga0207706_100151763 195
374 3300025933 Ga0207706_10825006 Ga0207706_108250061 195
375 3300025935 Ga0207709_10000170 Ga0207709_1000017026 195
376 3300025935 Ga0207709_10008589 Ga0207709_100085893 195
377 3300025935 Ga0207709_10073192 Ga0207709_100731922 195
378 3300025935 Ga0207709_10147514 Ga0207709_101475141 195
379 3300025937 Ga0207669_10009564 Ga0207669_100095643 195
380 3300025937 Ga0207669_10054346 Ga0207669_100543463 195
381 3300025938 Ga0207704_10024047 Ga0207704_100240473 195
382 3300025938 Ga0207704_10588143 Ga0207704_105881431 195
383 3300025940 Ga0207691_10001479 Ga0207691_1000147910 195
384 3300025940 Ga0207691_10012115 Ga0207691_100121153 195
385 3300025940 Ga0207691_10244738 Ga0207691_102447381 195
386 3300025942 Ga0207689_10011918 Ga0207689_100119186 195
387 3300025942 Ga0207689_10065458 Ga0207689_100654582 195
388 3300025942 Ga0207689_10070393 Ga0207689_100703934 195
389 3300025945 Ga0207679_10351089 Ga0207679_103510892 195
390 3300025949 Ga0207667_10428261 Ga0207667_104282612 195
391 3300025960 Ga0207651_10026540 Ga0207651_100265401 195
392 3300025960 Ga0207651_10268445 Ga0207651_102684452 195
393 3300025961 Ga0207712_10061159 Ga0207712_100611592 195
394 3300025961 Ga0207712_10750084 Ga0207712_107500842 195
395 3300025981 Ga0207640_10130917 Ga0207640_101309173 195
396 3300025986 Ga0207658_10001754 Ga0207658_100017545 195
397 3300025986 Ga0207658_10070307 Ga0207658_100703072 195
398 3300026023 Ga0207677_10031227 Ga0207677_100312274 195
399 3300026023 Ga0207677_10078663 Ga0207677_100786633 195
400 3300026023 Ga0207677_10288148 Ga0207677_102881482 195
401 3300026023 Ga0207677_10378047 Ga0207677_103780472 195
402 3300026023 Ga0207677_11078053 Ga0207677_110780532 195
403 3300026035 Ga0207703_10741925 Ga0207703_107419252 195
404 3300026067 Ga0207678_10010239 Ga0207678_100102395 195
405 3300026067 Ga0207678_10029766 Ga0207678_100297668 195
406 3300026067 Ga0207678_10427873 Ga0207678_104278732 195
407 3300026078 Ga0207702_10273984 Ga0207702_102739842 195
408 3300026088 Ga0207641_10103540 Ga0207641_101035401 195
409 3300026089 Ga0207648_10004256 Ga0207648_100042564 195
410 3300026089 Ga0207648_10004711 Ga0207648_100047114 195
411 3300026089 Ga0207648_10010739 Ga0207648_100107395 195
412 3300026089 Ga0207648_10029870 Ga0207648_100298702 195
413 3300026089 Ga0207648_10045152 Ga0207648_100451523 195
414 3300026089 Ga0207648_10061286 Ga0207648_100612863 195
415 3300026089 Ga0207648_10902011 Ga0207648_109020112 195
416 3300026095 Ga0207676_10421095 Ga0207676_104210951 195
417 3300026116 Ga0207674_10043824 Ga0207674_100438243 195
418 3300026116 Ga0207674_10280884 Ga0207674_102808843 195
419 3300026121 Ga0207683_10443347 Ga0207683_104433472 195
420 3300026142 Ga0207698_10220121 Ga0207698_102201213 195
421 3300026142 Ga0207698_10355755 Ga0207698_103557551 195
422 3300026142 Ga0207698_10732009 Ga0207698_107320092 195
423 3300026142 Ga0207698_10964130 Ga0207698_109641302 195
424 3300027111 Ga0209281_1000007 Ga0209281_1000007167 195
425 3300027395 Ga0209996_1007609 Ga0209996_10076093 195
426 3300027526 Ga0209968_1000412 Ga0209968_10004123 195
427 3300027543 Ga0209999_1028184 Ga0209999_10281842 195
428 3300027682 Ga0209971_1023181 Ga0209971_10231812 195
429 3300027695 Ga0209966_1000040 Ga0209966_100004018 195
430 3300027876 Ga0209974_10012044 Ga0209974_100120442 195
431 3300028379 Ga0268266_10425845 Ga0268266_104258453 195
432 3300028381 Ga0268264_10039869 Ga0268264_100398693 195
433 3300028381 Ga0268264_10319517 Ga0268264_103195173 195
434 3300028786 Ga0307517_10000052 Ga0307517_10000052140 195
435 3300028794 Ga0307515_10000022 Ga0307515_1000002277 195
436 3300028794 Ga0307515_10009473 Ga0307515_1000947313 195
437 3300028794 Ga0307515_10012346 Ga0307515_100123463 195
438 3300028794 Ga0307515_10021948 Ga0307515_100219482 195
439 3300028794 Ga0307515_10038241 Ga0307515_100382416 195
440 3300028794 Ga0307515_10096158 Ga0307515_100961582 195
441 3300028794 Ga0307515_10115958 Ga0307515_101159583 195
442 3300028794 Ga0307515_10127462 Ga0307515_101274622 195
443 3300028794 Ga0307515_10157684 Ga0307515_101576843 195
444 3300028794 Ga0307515_10471766 Ga0307515_104717661 195
445 3300030522 Ga0307512_10047813 Ga0307512_100478132 195
446 3300030522 Ga0307512_10337723 Ga0307512_103377231 195
447 3300031456 Ga0307513_10024262 Ga0307513_100242626 195
448 3300031456 Ga0307513_10177467 Ga0307513_101774672 195
449 3300031456 Ga0307513_10233189 Ga0307513_102331893 195
450 3300031507 Ga0307509_10000180 Ga0307509_1000018035 195
451 3300031507 Ga0307509_10014553 Ga0307509_100145537 195
452 3300031507 Ga0307509_10022019 Ga0307509_100220192 195
453 3300031507 Ga0307509_10047940 Ga0307509_100479403 195
454 3300031507 Ga0307509_10068505 Ga0307509_100685053 195
455 3300031507 Ga0307509_10134541 Ga0307509_101345412 195
456 3300031507 Ga0307509_10391022 Ga0307509_103910222 195
457 3300031616 Ga0307508_10000017 Ga0307508_1000001786 195
458 3300031616 Ga0307508_10021388 Ga0307508_100213883 195
459 3300031616 Ga0307508_10045867 Ga0307508_100458674 195
460 3300031616 Ga0307508_10172409 Ga0307508_101724093 195
461 3300031616 Ga0307508_10322843 Ga0307508_103228432 195
462 3300031649 Ga0307514_10003946 Ga0307514_1000394610 195
463 3300031649 Ga0307514_10065104 Ga0307514_100651042 195
464 3300031730 Ga0307516_10004998 Ga0307516_1000499815 195
465 3300031730 Ga0307516_10012723 Ga0307516_100127239 195
466 3300031730 Ga0307516_10037761 Ga0307516_100377615 195
467 3300031731 Ga0307405_10011424 Ga0307405_100114242 195
468 3300031731 Ga0307405_10723442 Ga0307405_107234422 195
469 3300031852 Ga0307410_10004378 Ga0307410_100043786 195
470 3300031852 Ga0307410_10119318 Ga0307410_101193182 195
471 3300031852 Ga0307410_10281124 Ga0307410_102811242 195
472 3300031901 Ga0307406_10001827 Ga0307406_100018278 195
473 3300031903 Ga0307407_10007263 Ga0307407_100072632 195
474 3300031911 Ga0307412_10024590 Ga0307412_100245903 195
475 3300031911 Ga0307412_10081872 Ga0307412_100818722 195
476 3300031911 Ga0307412_10174538 Ga0307412_101745383 195
477 3300031995 Ga0307409_100002830 Ga0307409_1000028304 195
478 3300031995 Ga0307409_100032289 Ga0307409_1000322892 195
479 3300031995 Ga0307409_100349231 Ga0307409_1003492312 195
480 3300031995 Ga0307409_100534658 Ga0307409_1005346581 195
481 3300032002 Ga0307416_100007284 Ga0307416_1000072845 195
482 3300032002 Ga0307416_100858262 Ga0307416_1008582622 195
483 3300032002 Ga0307416_101541060 Ga0307416_1015410601 195
484 3300032005 Ga0307411_10022245 Ga0307411_100222453 195
485 3300033179 Ga0307507_10045759 Ga0307507_100457592 195
486 3300033179 Ga0307507_10051383 Ga0307507_100513834 195
487 3300033180 Ga0307510_10003830 Ga0307510_100038303 195
488 3300033180 Ga0307510_10027563 Ga0307510_100275635 195
489 3300033180 Ga0307510_10056376 Ga0307510_100563763 195
490 3300033180 Ga0307510_10289848 Ga0307510_102898482 195
491 3300034820 Ga0373959_0010699 Ga0373959_0010699_381_968 195
492 3300035112 Ga0373932_0016625 Ga0373932_0016625_257_844 195
493 3300035112 Ga0373932_0117784 Ga0373932_0117784_115_702 195
494 3300035118 Ga0373954_0063777 Ga0373954_0063777_1121_1720 195
495 3300035119 Ga0373956_0000036 Ga0373956_0000036_1819_2418 195
496 3300035121 Ga0373960_0008985 Ga0373960_0008985_1654_2241 195
497 3300035171 Ga0373946_0105899 Ga0373946_0105899_629_1216 195
498 3300035242 Ga0373962_0056200 Ga0373962_0056200_507_1094 195
499 3300035695 Ga0373927_0000005 Ga0373927_0000005_108576_109175 195
500 3300035724 Ga0373933_0003669 Ga0373933_0003669_6595_7194 195
501 3300036401 Ga0373937_0083859 Ga0373937_0083859_653_1240 195
502 3300037068 Ga0373925_0072618 Ga0373925_0072618_1918_2505 195
503 3300037312 Ga0395899_0029446 Ga0395899_0029446_2511_3104 195
504 3300037312 Ga0395899_0047362 Ga0395899_0047362_2558_3145 195
505 3300037312 Ga0395899_0109122 Ga0395899_0109122_44_631 195
506 3300037312 Ga0395899_0538411 Ga0395899_0538411_78_671 195
507 3300037418 Ga0395900_0000046 Ga0395900_0000046_172539_173126 195
508 3300037418 Ga0395900_0028766 Ga0395900_0028766_3330_3917 195
509 3300037418 Ga0395900_0081609 Ga0395900_0081609_1845_2438 195
510 3300037418 Ga0395900_0146577 Ga0395900_0146577_110_703 195
511 3300037418 Ga0395900_0327536 Ga0395900_0327536_448_1035 195
512 3300037466 Ga0395898_0006527 Ga0395898_0006527_1793_2380 195
513 3300037466 Ga0395898_0025414 Ga0395898_0025414_3248_3835 195
514 3300037466 Ga0395898_0270869 Ga0395898_0270869_761_1354 195
515 3300037471 Ga0395905_0000766 Ga0395905_0000766_11820_12407 195
516 3300037471 Ga0395905_0015449 Ga0395905_0015449_3767_4360 195
517 3300037471 Ga0395905_0028165 Ga0395905_0028165_1775_2362 195
518 3300037471 Ga0395905_0049363 Ga0395905_0049363_1954_2541 195
519 3300037471 Ga0395905_0063315 Ga0395905_0063315_935_1522 195
520 3300037471 Ga0395905_0070092 Ga0395905_0070092_2641_3228 195
521 3300037471 Ga0395905_0103004 Ga0395905_0103004_232_825 195
522 3300037471 Ga0395905_0231019 Ga0395905_0231019_790_1383 195
523 3300037471 Ga0395905_0535299 Ga0395905_0535299_318_905 195
524 3300038443 Ga0395901_0030760 Ga0395901_0030760_2958_3545 195
525 3300038443 Ga0395901_0124753 Ga0395901_0124753_1599_2186 195
526 3300038443 Ga0395901_0212438 Ga0395901_0212438_761_1354 195
527 3300038443 Ga0395901_0292465 Ga0395901_0292465_306_899 195
528 3300038443 Ga0395901_0372685 Ga0395901_0372685_843_1430 195
529 3300038443 Ga0395901_0653880 Ga0395901_0653880_353_940 195
530 3300041441 Ga0451787_408354 Ga0451787_408354_203_820 195
531 3300041452 Ga0451793_0622605 Ga0451793_0622605_81_668 195
532 3300041452 Ga0451793_0754529 Ga0451793_0754529_95_712 195
533 3300041486 Ga0451807_0709245 Ga0451807_0709245_218_805 195
534 3300041491 Ga0451833_0337859 Ga0451833_0337859_598_1215 195
535 3300041512 Ga0451853_1417758 Ga0451853_1417758_398_1015 195
536 3300042000 Ga0439437_006661 Ga0439437_006661_627_1220 195
537 3300042000 Ga0439437_020525 Ga0439437_020525_17_604 195
538 3300042001 Ga0439441_037513 Ga0439441_037513_101_694 195
539 3300042001 Ga0439441_080379 Ga0439441_080379_78_665 195
540 3300042012 Ga0439455_0049163 Ga0439455_0049163_332_919 195
541 3300042015 Ga0439462_0060284 Ga0439462_0060284_377_970 195
542 3300042123 Ga0450921_002869 Ga0450921_002869_111_704 195
543 3300042134 Ga0450898_006886 Ga0450898_006886_945_1538 195
544 3300042139 Ga0450904_021122 Ga0450904_021122_17_610 195
545 3300042156 Ga0439446_0028713 Ga0439446_0028713_63_656 195
546 3300042185 Ga0450909_006970 Ga0450909_006970_673_1266 195
547 3300042435 Ga0439434_0005859 Ga0439434_0005859_765_1358 195
548 3300042439 Ga0439464_0021604 Ga0439464_0021604_1077_1670 195
549 3300042461 Ga0439460_0014558 Ga0439460_0014558_235_828 195
550 3300042876 Ga0451577_0034474 Ga0451577_0034474_317_904 195
551 3300042876 Ga0451577_0043363 Ga0451577_0043363_2403_2990 195
552 3300042876 Ga0451577_0888545 Ga0451577_0888545_66_653 195
553 3300044656 Ga0466969_0002791 Ga0466969_0002791_6160_6747 195
554 3300044656 Ga0466969_0003266 Ga0466969_0003266_1164_1751 195
555 3300044658 Ga0466972_0002267 Ga0466972_0002267_999_1586 195
556 3300044658 Ga0466972_0135029 Ga0466972_0135029_553_1140 195
557 3300044683 Ga0466965_0085449 Ga0466965_0085449_756_1343 195
558 3300044683 Ga0466965_0122230 Ga0466965_0122230_192_779 195
559 3300044684 Ga0466966_0003451 Ga0466966_0003451_5953_6540 195
560 3300044684 Ga0466966_0032471 Ga0466966_0032471_1448_2035 195
561 3300044693 Ga0466961_0034555 Ga0466961_0034555_1219_1806 195
562 3300044712 Ga0453684_0006580 Ga0453684_0006580_17497_18087 195
563 3300044712 Ga0453684_0185189 Ga0453684_0185189_1122_1709 195
564 3300044712 Ga0453684_0190345 Ga0453684_0190345_617_1204 195
565 3300044712 Ga0453684_0277181 Ga0453684_0277181_1194_1781 195
566 3300044719 Ga0466971_0020326 Ga0466971_0020326_74_661 195
567 3300044735 Ga0466968_0049588 Ga0466968_0049588_870_1457 195
568 3300044765 Ga0466970_0395314 Ga0466970_0395314_111_698 195
569 3300044842 Ga0466957_0055801 Ga0466957_0055801_913_1500 195
570 3300045049 Ga0466959_0017917 Ga0466959_0017917_3389_3976 195
571 3300045049 Ga0466959_0030003 Ga0466959_0030003_1826_2413 195
572 3300045051 Ga0451576_0102005 Ga0451576_0102005_1321_1908 195
573 3300045051 Ga0451576_0625731 Ga0451576_0625731_392_979 195
574 3300046454 Ga0495592_0000542 Ga0495592_0000542_21601_22188 195
575 3300046454 Ga0495592_0107932 Ga0495592_0107932_430_1017 195
576 3300046457 Ga0495590_0045336 Ga0495590_0045336_222_809 195
577 3300046460 Ga0495638_0083003 Ga0495638_0083003_242_829 195
578 3300046461 Ga0495641_0122185 Ga0495641_0122185_14_601 195
579 3300046471 Ga0495650_0057968 Ga0495650_0057968_538_1143 195
580 3300046471 Ga0495650_0232266 Ga0495650_0232266_10_597 195
581 3300046474 Ga0495605_0075325 Ga0495605_0075325_116_703 195
582 3300046512 Ga0495610_0022848 Ga0495610_0022848_1741_2358 195
583 3300046515 Ga0495620_0164194 Ga0495620_0164194_49_636 195
584 3300046519 Ga0495632_0016688 Ga0495632_0016688_1683_2270 195
585 3300046519 Ga0495632_0037114 Ga0495632_0037114_1587_2204 195
586 3300046519 Ga0495632_0173628 Ga0495632_0173628_196_783 195
587 3300046524 Ga0495648_0140457 Ga0495648_0140457_328_915 195
588 3300046525 Ga0495663_0030403 Ga0495663_0030403_604_1191 195
589 3300046525 Ga0495663_0036184 Ga0495663_0036184_817_1404 195
590 3300046535 Ga0495586_0234582 Ga0495586_0234582_28_615 195
591 3300046539 Ga0495621_0172642 Ga0495621_0172642_247_840 195
592 3300046539 Ga0495621_0296408 Ga0495621_0296408_42_629 195
593 3300046542 Ga0495597_0006996 Ga0495597_0006996_966_1553 195
594 3300046542 Ga0495597_0011456 Ga0495597_0011456_2125_2712 195
595 3300046616 Ga0495668_0102701 Ga0495668_0102701_631_1218 195
596 3300046616 Ga0495668_0389651 Ga0495668_0389651_79_666 195
597 3300046648 Ga0495611_0020870 Ga0495611_0020870_2150_2737 195
598 3300046660 Ga0495625_0005727 Ga0495625_0005727_8559_9176 195
599 3300046660 Ga0495625_0006383 Ga0495625_0006383_2177_2764 195
600 3300046674 Ga0495588_0037942 Ga0495588_0037942_1061_1648 195
601 3300046680 Ga0495646_0041243 Ga0495646_0041243_1703_2290 195
602 3300046683 Ga0495658_0245030 Ga0495658_0245030_239_826 195
603 3300046684 Ga0495669_0376968 Ga0495669_0376968_80_667 195
604 3300046694 Ga0495649_0004026 Ga0495649_0004026_5002_5589 195
605 3300046810 Ga0495660_0036857 Ga0495660_0036857_908_1495 195
606 3300046810 Ga0495660_0203165 Ga0495660_0203165_207_794 195
607 3300047323 Ga0495683_0189780 Ga0495683_0189780_37_624 195
608 3300047443 Ga0495687_000232 Ga0495687_000232_17304_17891 195
609 3300047443 Ga0495687_042590 Ga0495687_042590_132_719 195
610 3300047443 Ga0495687_042591 Ga0495687_042591_1264_1851 195
611 3300047445 Ga0495677_0129611 Ga0495677_0129611_167_754 195
612 3300047445 Ga0495677_0158594 Ga0495677_0158594_64_651 195
613 3300047472 Ga0495686_0180542 Ga0495686_0180542_117_734 195
614 3300047472 Ga0495686_0182770 Ga0495686_0182770_173_760 195
615 3300047472 Ga0495686_0438635 Ga0495686_0438635_68_655 195
616 3300048090 Ga0495615_0027624 Ga0495615_0027624_237_824 195
617 3300048091 Ga0495626_0036930 Ga0495626_0036930_1252_1839 195
618 3300048091 Ga0495626_0102736 Ga0495626_0102736_409_996 195
619 3300048905 Ga0496102_0003141 Ga0496102_0003141_3170_3757 195
620 3300048908 Ga0496105_0414311 Ga0496105_0414311_24_611 195
621 3300048909 Ga0496106_0032663 Ga0496106_0032663_1352_1939 195
622 3300048910 Ga0496107_0567709 Ga0496107_0567709_21_608 195
623 3300048916 Ga0496113_0392990 Ga0496113_0392990_510_1097 195
624 3300048921 Ga0496118_0235335 Ga0496118_0235335_452_1039 195
625 3300048924 Ga0496121_0082583 Ga0496121_0082583_937_1524 195
626 3300048926 Ga0496123_0307688 Ga0496123_0307688_64_651 195
627 3300048927 Ga0496124_0000419 Ga0496124_0000419_53132_53719 195
628 3300048927 Ga0496124_0043016 Ga0496124_0043016_1428_2033 195
629 3300048928 Ga0496125_0007984 Ga0496125_0007984_5520_6107 195
630 3300048928 Ga0496125_0149046 Ga0496125_0149046_934_1521 195
631 3300048929 Ga0496126_0533963 Ga0496126_0533963_217_804 195
632 3300049569 Ga0501032_0312990 Ga0501032_0312990_14_607 195
633 3300049570 Ga0501033_0037738 Ga0501033_0037738_1499_2092 195
634 3300049571 Ga0501034_0459620 Ga0501034_0459620_198_791 195
635 3300049574 Ga0501038_0105036 Ga0501038_0105036_880_1473 195
636 3300049575 Ga0501039_0192502 Ga0501039_0192502_67_660 195
637 3300049579 Ga0501043_0000010 Ga0501043_0000010_164568_165155 195
638 3300049579 Ga0501043_0786944 Ga0501043_0786944_80_673 195
639 3300049580 Ga0501046_0000132 Ga0501046_0000132_18711_19298 195
640 3300049581 Ga0501047_0000026 Ga0501047_0000026_60201_60788 195
641 3300049581 Ga0501047_0108451 Ga0501047_0108451_1985_2578 195
642 3300049582 Ga0501048_0002295 Ga0501048_0002295_8266_8853 195
643 3300049649 Ga0501198_000021 Ga0501198_000021_703_1290 195
644 3300049653 Ga0501206_005470 Ga0501206_005470_651_1238 195
645 3300049662 Ga0501222_000018 Ga0501222_000018_69367_69954 195
646 3300049822 Ga0501035_0082387 Ga0501035_0082387_1609_2196 195
647 3300049822 Ga0501035_0572226 Ga0501035_0572226_229_816 195
648 3300049823 Ga0501044_0222559 Ga0501044_0222559_686_1279 195
649 3300049824 Ga0501045_0064907 Ga0501045_0064907_1411_1998 195
650 3300050489 nmdc:mga03683_105766_c1 nmdc:mga03683_105766_c1_111_704 195
651 3300050489 nmdc:mga03683_28055_c1 nmdc:mga03683_28055_c1_386_973 195
652 3300050490 nmdc:mga03n38_11104_c1 nmdc:mga03n38_11104_c1_677_1264 195
653 3300050490 nmdc:mga03n38_327336_c1 nmdc:mga03n38_327336_c1_71_658 195
654 3300050491 nmdc:mga00v17_24625_c1 nmdc:mga00v17_24625_c1_802_1389 195
655 3300050491 nmdc:mga00v17_26471_c1 nmdc:mga00v17_26471_c1_422_1009 195
656 3300050491 nmdc:mga00v17_388190_c1 nmdc:mga00v17_388190_c1_20_613 195
657 3300050492 nmdc:mga0yw44_520711_c1 nmdc:mga0yw44_520711_c1_85_678 195
658 3300050492 nmdc:mga0yw44_85613_c1 nmdc:mga0yw44_85613_c1_1141_1728 195
659 3300050493 nmdc:mga0k408_10600_c1 nmdc:mga0k408_10600_c1_2603_3190 195
660 3300050493 nmdc:mga0k408_1468_c1 nmdc:mga0k408_1468_c1_1368_1955 195
661 3300050493 nmdc:mga0k408_20126_c1 nmdc:mga0k408_20126_c1_1402_1989 195
662 3300050493 nmdc:mga0k408_212002_c1 nmdc:mga0k408_212002_c1_291_878 195
663 3300050493 nmdc:mga0k408_318795_c1 nmdc:mga0k408_318795_c1_82_669 195
664 3300050493 nmdc:mga0k408_41035_c1 nmdc:mga0k408_41035_c1_753_1340 195
665 3300050493 nmdc:mga0k408_41187_c1 nmdc:mga0k408_41187_c1_1931_2518 195
666 3300050493 nmdc:mga0k408_4551_c1 nmdc:mga0k408_4551_c1_5804_6391 195
667 3300050493 nmdc:mga0k408_4876_c1 nmdc:mga0k408_4876_c1_6059_6646 195
668 3300050493 nmdc:mga0k408_565556_c1 nmdc:mga0k408_565556_c1_72_659 195
669 3300050493 nmdc:mga0k408_91449_c1 nmdc:mga0k408_91449_c1_866_1483 195
670 3300050494 nmdc:mga06z11_18549_c1 nmdc:mga06z11_18549_c1_1841_2428 195
671 3300050494 nmdc:mga06z11_339670_c1 nmdc:mga06z11_339670_c1_201_788 195
672 3300050496 nmdc:mga07m45_15745_c1 nmdc:mga07m45_15745_c1_2128_2715 195
673 3300050496 nmdc:mga07m45_429226_c1 nmdc:mga07m45_429226_c1_72_659 195
674 3300050496 nmdc:mga07m45_8540_c1 nmdc:mga07m45_8540_c1_1673_2260 195
675 3300050496 nmdc:mga07m45_880_c1 nmdc:mga07m45_880_c1_5440_6027 195
676 3300050496 nmdc:mga07m45_94070_c1 nmdc:mga07m45_94070_c1_231_818 195
677 3300050507 nmdc:mga05p37_46673_c1 nmdc:mga05p37_46673_c1_868_1455 195
678 3300050508 nmdc:mga09592_1237_c1 nmdc:mga09592_1237_c1_680_1267 195
679 3300050508 nmdc:mga09592_75745_c1 nmdc:mga09592_75745_c1_693_1286 195
680 3300050509 nmdc:mga0qj67_104256_c1 nmdc:mga0qj67_104256_c1_907_1494 195
681 3300050510 nmdc:mga06r32_337655_c1 nmdc:mga06r32_337655_c1_881_1474 195
682 3300050516 nmdc:mga0sz30_133398_c1 nmdc:mga0sz30_133398_c1_51_638 195
683 3300050516 nmdc:mga0sz30_91096_c1 nmdc:mga0sz30_91096_c1_370_957 195
684 3300053088 Ga0500644_0018748 Ga0500644_0018748_156_743 195
685 3300053090 Ga0500646_0195040 Ga0500646_0195040_68_655 195
686 3300053091 Ga0500647_0229049 Ga0500647_0229049_223_810 195
687 3300053093 Ga0500651_0049299 Ga0500651_0049299_1244_1831 195
688 3300053118 Ga0500594_0005379 Ga0500594_0005379_2117_2704 195
689 3300053131 Ga0500652_015873 Ga0500652_015873_1829_2416 195
690 3300053134 Ga0500658_0044423 Ga0500658_0044423_756_1343 195
691 3300053134 Ga0500658_0211496 Ga0500658_0211496_251_868 195
692 3300053136 Ga0500559_0000986 Ga0500559_0000986_1026_1613 195
693 3300053139 Ga0500568_0076257 Ga0500568_0076257_122_709 195
694 3300053148 Ga0500590_053213 Ga0500590_053213_1155_1742 195
695 3300053154 Ga0500619_000052 Ga0500619_000052_11571_12158 195
696 3300053156 Ga0500622_0043216 Ga0500622_0043216_944_1531 195
697 3300053730 Ga0500645_031534 Ga0500645_031534_95_682 195
698 3300053739 Ga0500587_002166 Ga0500587_002166_807_1424 195
699 3300060353 Ga0501082_0420838 Ga0501082_0420838_148_741 195
700 3300061719 Ga0466962_0002096 Ga0466962_0002096_778_1365 195
701 iso_pu_bacteria 2738543012 2739245360 195
702 3300001989 JGI24739J22299_10045504 JGI24739J22299_100455042 196
703 3300002704 JGI25155J39150_1000049 JGI25155J39150_100004949 196
704 3300002705 JGI25156J39149_1000023 JGI25156J39149_100002395 196
705 3300002738 JGI25154J39366_1000036 JGI25154J39366_100003663 196
706 3300002739 JGI25158J39367_1009499 JGI25158J39367_10094992 196
707 3300002741 JGI25157J39369_1000023 JGI25157J39369_100002395 196
708 3300002773 JGI25152J39213_1005976 JGI25152J39213_10059764 196
709 3300002774 JGI25150J39212_1004774 JGI25150J39212_10047743 196
710 3300002774 JGI25150J39212_1005484 JGI25150J39212_10054843 196
711 3300002987 JGI25159J45721_1001073 JGI25159J45721_10010733 196
712 3300002987 JGI25159J45721_1001804 JGI25159J45721_10018044 196
713 3300002987 JGI25159J45721_1011457 JGI25159J45721_10114572 196
714 3300002987 JGI25159J45721_1011861 JGI25159J45721_10118612 196
715 3300003187 JGI25151J46595_10004016 JGI25151J46595_100040163 196
716 3300003187 JGI25151J46595_10005717 JGI25151J46595_100057175 196
717 3300003187 JGI25151J46595_10010198 JGI25151J46595_100101983 196
718 3300003187 JGI25151J46595_10010227 JGI25151J46595_100102275 196
719 3300003187 JGI25151J46595_10016678 JGI25151J46595_100166783 196
720 3300003187 JGI25151J46595_10121997 JGI25151J46595_101219971 196
721 3300003215 JGI25153J46596_10009858 JGI25153J46596_100098583 196
722 3300003215 JGI25153J46596_10017105 JGI25153J46596_100171053 196
723 3300003322 rootL2_10075892 rootL2_100758923 196
724 3300003354 JGI25160J50197_1000260 JGI25160J50197_100026020 196
725 3300003354 JGI25160J50197_1018470 JGI25160J50197_10184702 196
726 3300003354 JGI25160J50197_1019095 JGI25160J50197_10190953 196
727 3300003374 JGI25161J50226_1000015 JGI25161J50226_100001565 196
728 3300003374 JGI25161J50226_1004468 JGI25161J50226_10044683 196
729 3300003374 JGI25161J50226_1006316 JGI25161J50226_10063163 196
730 3300003578 Ga0006562J51391_1051948 Ga0006562J51391_10519482 196
731 3300003578 Ga0006562J51391_1076372 Ga0006562J51391_10763722 196
732 3300003761 Ga0055535_1003358 Ga0055535_10033584 196
733 3300003762 Ga0055542_1000114 Ga0055542_100011495 196
734 3300003771 Ga0055526_1010148 Ga0055526_10101483 196
735 3300003771 Ga0055526_1010246 Ga0055526_10102463 196
736 3300003771 Ga0055526_1030310 Ga0055526_10303102 196
737 3300003771 Ga0055526_1030458 Ga0055526_10304582 196
738 3300003773 Ga0055537_1000135 Ga0055537_100013533 196
739 3300003773 Ga0055537_1000972 Ga0055537_10009723 196
740 3300003773 Ga0055537_1009351 Ga0055537_10093512 196
741 3300003775 Ga0055524_1000016 Ga0055524_1000016178 196
742 3300003775 Ga0055524_1021067 Ga0055524_10210672 196
743 3300003775 Ga0055524_1021783 Ga0055524_10217833 196
744 3300003781 Ga0055536_1013137 Ga0055536_10131374 196
745 3300003781 Ga0055536_1020005 Ga0055536_10200052 196
746 3300003784 Ga0055534_1000222 Ga0055534_100022241 196
747 3300003784 Ga0055534_1003233 Ga0055534_10032334 196
748 3300003784 Ga0055534_1003401 Ga0055534_10034013 196
749 3300003784 Ga0055534_1004961 Ga0055534_10049611 196
750 3300003784 Ga0055534_1008294 Ga0055534_10082942 196
751 3300003784 Ga0055534_1011817 Ga0055534_10118172 196
752 3300003790 Ga0055528_1000423 Ga0055528_10004233 196
753 3300003790 Ga0055528_1006109 Ga0055528_10061094 196
754 3300003790 Ga0055528_1020177 Ga0055528_10201772 196
755 3300003791 Ga0055530_10000293 Ga0055530_1000029347 196
756 3300003791 Ga0055530_10000951 Ga0055530_1000095113 196
757 3300003791 Ga0055530_10066105 Ga0055530_100661051 196
758 3300003792 Ga0055540_1000144 Ga0055540_100014458 196
759 3300003792 Ga0055540_1009989 Ga0055540_10099894 196
760 3300003792 Ga0055540_1016495 Ga0055540_10164952 196
761 3300003794 Ga0055531_10003930 Ga0055531_100039303 196
762 3300003794 Ga0055531_10021503 Ga0055531_100215033 196
763 3300003794 Ga0055531_10025349 Ga0055531_100253492 196
764 3300004625 Ga0055543_1000807 Ga0055543_10008075 196
765 3300004625 Ga0055543_1000874 Ga0055543_10008748 196
766 3300004625 Ga0055543_1012562 Ga0055543_10125621 196
767 3300005262 Ga0065165_1002967 Ga0065165_10029673 196
768 3300005262 Ga0065165_1005926 Ga0065165_10059265 196
769 3300005262 Ga0065165_1050224 Ga0065165_10502241 196
770 3300005262 Ga0065165_1050229 Ga0065165_10502291 196
771 3300005288 Ga0065714_10075522 Ga0065714_100755223 196
772 3300005289 Ga0065704_10081107 Ga0065704_100811073 196
773 3300005329 Ga0070683_100797880 Ga0070683_1007978802 196
774 3300005334 Ga0068869_100330288 Ga0068869_1003302882 196
775 3300005336 Ga0070680_100097964 Ga0070680_1000979643 196
776 3300005347 Ga0070668_100572987 Ga0070668_1005729872 196
777 3300005354 Ga0070675_100243530 Ga0070675_1002435301 196
778 3300005355 Ga0070671_100024548 Ga0070671_1000245483 196
779 3300005435 Ga0070714_100253673 Ga0070714_1002536733 196
780 3300005456 Ga0070678_100082262 Ga0070678_1000822622 196
781 3300005456 Ga0070678_100766899 Ga0070678_1007668991 196
782 3300005458 Ga0070681_10129127 Ga0070681_101291273 196
783 3300005467 Ga0070706_100637749 Ga0070706_1006377491 196
784 3300005468 Ga0070707_100248358 Ga0070707_1002483582 196
785 3300005530 Ga0070679_100083306 Ga0070679_1000833063 196
786 3300005530 Ga0070679_100131957 Ga0070679_1001319572 196
787 3300005539 Ga0068853_100045549 Ga0068853_1000455492 196
788 3300005539 Ga0068853_100599883 Ga0068853_1005998832 196
789 3300005548 Ga0070665_100113706 Ga0070665_1001137062 196
790 3300005563 Ga0068855_100022837 Ga0068855_1000228373 196
791 3300005834 Ga0068851_10026610 Ga0068851_100266103 196
792 3300005841 Ga0068863_100109497 Ga0068863_1001094973 196
793 3300005844 Ga0068862_100044186 Ga0068862_1000441863 196
794 3300006038 Ga0075365_10213872 Ga0075365_102138723 196
795 3300006038 Ga0075365_10380687 Ga0075365_103806872 196
796 3300006048 Ga0075363_100029136 Ga0075363_1000291361 196
797 3300006048 Ga0075363_100049721 Ga0075363_1000497212 196
798 3300006048 Ga0075363_100370862 Ga0075363_1003708621 196
799 3300006048 Ga0075363_100409579 Ga0075363_1004095792 196
800 3300006051 Ga0075364_10011971 Ga0075364_100119713 196
801 3300006051 Ga0075364_10140479 Ga0075364_101404793 196
802 3300006058 Ga0075432_10012009 Ga0075432_100120093 196
803 3300006177 Ga0075362_10029529 Ga0075362_100295292 196
804 3300006177 Ga0075362_10230315 Ga0075362_102303151 196
805 3300006178 Ga0075367_10278883 Ga0075367_102788832 196
806 3300006186 Ga0075369_10235421 Ga0075369_102354212 196
807 3300006195 Ga0075366_10029732 Ga0075366_100297322 196
808 3300006195 Ga0075366_10063373 Ga0075366_100633732 196
809 3300006195 Ga0075366_10088325 Ga0075366_100883253 196
810 3300006195 Ga0075366_10194498 Ga0075366_101944982 196
811 3300006353 Ga0075370_10004393 Ga0075370_100043932 196
812 3300006353 Ga0075370_10027748 Ga0075370_100277483 196
813 3300006353 Ga0075370_10035475 Ga0075370_100354754 196
814 3300006353 Ga0075370_10057161 Ga0075370_100571613 196
815 3300006353 Ga0075370_10063856 Ga0075370_100638562 196
816 3300006948 Ga0099826_10004782 Ga0099826_100047826 196
817 3300006948 Ga0099826_10035017 Ga0099826_100350173 196
818 3300009093 Ga0105240_10002847 Ga0105240_1000284716 196
819 3300009093 Ga0105240_10441232 Ga0105240_104412323 196
820 3300009093 Ga0105240_11408337 Ga0105240_114083371 196
821 3300009147 Ga0114129_10597217 Ga0114129_105972172 196
822 3300009148 Ga0105243_10104817 Ga0105243_101048172 196
823 3300009176 Ga0105242_10337028 Ga0105242_103370282 196
824 3300009176 Ga0105242_10398738 Ga0105242_103987382 196
825 3300009177 Ga0105248_10002775 Ga0105248_1000277515 196
826 3300009551 Ga0105238_10097245 Ga0105238_100972453 196
827 3300010375 Ga0105239_10682831 Ga0105239_106828312 196
828 3300013100 Ga0157373_10039046 Ga0157373_100390463 196
829 3300013100 Ga0157373_10682842 Ga0157373_106828422 196
830 3300013102 Ga0157371_10031344 Ga0157371_100313442 196
831 3300013104 Ga0157370_10870570 Ga0157370_108705701 196
832 3300013306 Ga0163162_10241820 Ga0163162_102418202 196
833 3300013307 Ga0157372_11537264 Ga0157372_115372641 196
834 3300014497 Ga0182008_10003871 Ga0182008_100038712 196
835 3300014497 Ga0182008_10017897 Ga0182008_100178973 196
836 3300015262 Ga0182007_10000539 Ga0182007_1000053918 196
837 3300015262 Ga0182007_10130798 Ga0182007_101307982 196
838 3300015265 Ga0182005_1022729 Ga0182005_10227292 196
839 3300017792 Ga0163161_10024535 Ga0163161_100245353 196
840 3300017792 Ga0163161_10044819 Ga0163161_100448192 196
841 3300017792 Ga0163161_10065207 Ga0163161_100652074 196
842 3300017792 Ga0163161_10297551 Ga0163161_102975512 196
843 3300025206 Ga0209435_100001 Ga0209435_100001309 196
844 3300025208 Ga0209436_103103 Ga0209436_1031033 196
845 3300025208 Ga0209436_105165 Ga0209436_1051653 196
846 3300025208 Ga0209436_111682 Ga0209436_1116821 196
847 3300025228 Ga0209672_101186 Ga0209672_10118611 196
848 3300025229 Ga0209147_101683 Ga0209147_1016835 196
849 3300025242 Ga0209258_100225 Ga0209258_10022596 196
850 3300025245 Ga0207425_1000530 Ga0207425_100053014 196
851 3300025245 Ga0207425_1002265 Ga0207425_10022654 196
852 3300025245 Ga0207425_1004703 Ga0207425_10047034 196
853 3300025246 Ga0209646_1000001 Ga0209646_1000001678 196
854 3300025250 Ga0209026_1000003 Ga0209026_1000003309 196
855 3300025254 Ga0209148_1000040 Ga0209148_1000040382 196
856 3300025256 Ga0209759_1000001 Ga0209759_1000001309 196
857 3300025258 Ga0209129_1000007 Ga0209129_1000007290 196
858 3300025258 Ga0209129_1002542 Ga0209129_100254210 196
859 3300025258 Ga0209129_1004981 Ga0209129_10049815 196
860 3300025258 Ga0209129_1006720 Ga0209129_10067203 196
861 3300025263 Ga0209565_1000004 Ga0209565_1000004215 196
862 3300025263 Ga0209565_1000085 Ga0209565_100008577 196
863 3300025263 Ga0209565_1000365 Ga0209565_100036527 196
864 3300025263 Ga0209565_1000394 Ga0209565_100039424 196
865 3300025263 Ga0209565_1005992 Ga0209565_10059923 196
866 3300025273 Ga0209673_1000045 Ga0209673_1000045156 196
867 3300025273 Ga0209673_1000133 Ga0209673_100013347 196
868 3300025273 Ga0209673_1000445 Ga0209673_100044533 196
869 3300025273 Ga0209673_1002436 Ga0209673_10024363 196
870 3300025284 Ga0209130_1000056 Ga0209130_1000056127 196
871 3300025284 Ga0209130_1000070 Ga0209130_1000070127 196
872 3300025284 Ga0209130_1000634 Ga0209130_100063418 196
873 3300025284 Ga0209130_1001057 Ga0209130_10010579 196
874 3300025284 Ga0209130_1014947 Ga0209130_10149473 196
875 3300025291 Ga0209675_1000083 Ga0209675_100008377 196
876 3300025291 Ga0209675_1000185 Ga0209675_100018567 196
877 3300025291 Ga0209675_1000411 Ga0209675_100041123 196
878 3300025291 Ga0209675_1001654 Ga0209675_10016543 196
879 3300025291 Ga0209675_1002876 Ga0209675_10028764 196
880 3300025291 Ga0209675_1003496 Ga0209675_10034964 196
881 3300025291 Ga0209675_1011667 Ga0209675_10116673 196
882 3300025291 Ga0209675_1024463 Ga0209675_10244632 196
883 3300025292 Ga0209676_1000004 Ga0209676_10000041029 196
884 3300025292 Ga0209676_1000007 Ga0209676_1000007755 196
885 3300025292 Ga0209676_1006494 Ga0209676_10064946 196
886 3300025292 Ga0209676_1009992 Ga0209676_10099923 196
887 3300025292 Ga0209676_1020213 Ga0209676_10202133 196
888 3300025292 Ga0209676_1022106 Ga0209676_10221062 196
889 3300025292 Ga0209676_1025485 Ga0209676_10254852 196
890 3300025294 Ga0209025_1000111 Ga0209025_1000111126 196
891 3300025294 Ga0209025_1000455 Ga0209025_100045562 196
892 3300025294 Ga0209025_1000529 Ga0209025_100052961 196
893 3300025294 Ga0209025_1003293 Ga0209025_10032939 196
894 3300025294 Ga0209025_1007672 Ga0209025_10076727 196
895 3300025294 Ga0209025_1013159 Ga0209025_10131594 196
896 3300025294 Ga0209025_1014754 Ga0209025_10147543 196
897 3300025294 Ga0209025_1034080 Ga0209025_10340803 196
898 3300025294 Ga0209025_1040260 Ga0209025_10402602 196
899 3300025295 Ga0209564_1000153 Ga0209564_10001535 196
900 3300025295 Ga0209564_1000337 Ga0209564_10003375 196
901 3300025295 Ga0209564_1000772 Ga0209564_100077219 196
902 3300025295 Ga0209564_1000962 Ga0209564_10009622 196
903 3300025295 Ga0209564_1029151 Ga0209564_10291513 196
904 3300025297 Ga0209758_1000025 Ga0209758_1000025236 196
905 3300025297 Ga0209758_1007230 Ga0209758_10072305 196
906 3300025297 Ga0209758_1020573 Ga0209758_10205732 196
907 3300025297 Ga0209758_1049373 Ga0209758_10493732 196
908 3300025298 Ga0209050_1000002 Ga0209050_10000021539 196
909 3300025298 Ga0209050_1000003 Ga0209050_1000003752 196
910 3300025298 Ga0209050_1014719 Ga0209050_10147194 196
911 3300025298 Ga0209050_1025986 Ga0209050_10259863 196
912 3300025299 Ga0209256_1000001 Ga0209256_1000001752 196
913 3300025299 Ga0209256_1000050 Ga0209256_1000050302 196
914 3300025299 Ga0209256_1000063 Ga0209256_10000633 196
915 3300025302 Ga0207426_1000001 Ga0207426_1000001401 196
916 3300025302 Ga0207426_1000025 Ga0207426_1000025195 196
917 3300025302 Ga0207426_1000028 Ga0207426_1000028221 196
918 3300025302 Ga0207426_1004695 Ga0207426_10046953 196
919 3300025302 Ga0207426_1096965 Ga0207426_10969652 196
920 3300025303 Ga0209051_1000002 Ga0209051_10000021309 196
921 3300025303 Ga0209051_1000003 Ga0209051_1000003752 196
922 3300025303 Ga0209051_1000653 Ga0209051_100065327 196
923 3300025303 Ga0209051_1005176 Ga0209051_10051767 196
924 3300025303 Ga0209051_1079431 Ga0209051_10794312 196
925 3300025304 Ga0209257_1000002 Ga0209257_10000021450 196
926 3300025304 Ga0209257_1000018 Ga0209257_1000018752 196
927 3300025304 Ga0209257_1001358 Ga0209257_100135820 196
928 3300025304 Ga0209257_1003661 Ga0209257_10036613 196
929 3300025304 Ga0209257_1016346 Ga0209257_10163463 196
930 3300025893 Ga0207682_10018054 Ga0207682_100180543 196
931 3300025910 Ga0207684_10294930 Ga0207684_102949302 196
932 3300025912 Ga0207707_10278387 Ga0207707_102783873 196
933 3300025913 Ga0207695_10089619 Ga0207695_100896194 196
934 3300025913 Ga0207695_10229914 Ga0207695_102299143 196
935 3300025921 Ga0207652_10065943 Ga0207652_100659434 196
936 3300025922 Ga0207646_10228362 Ga0207646_102283622 196
937 3300025929 Ga0207664_10096770 Ga0207664_100967702 196
938 3300025931 Ga0207644_10037459 Ga0207644_100374593 196
939 3300025933 Ga0207706_10227795 Ga0207706_102277951 196
940 3300025940 Ga0207691_10193143 Ga0207691_101931432 196
941 3300025940 Ga0207691_10330458 Ga0207691_103304582 196
942 3300025941 Ga0207711_10145746 Ga0207711_101457463 196
943 3300025949 Ga0207667_10151272 Ga0207667_101512721 196
944 3300025949 Ga0207667_11049366 Ga0207667_110493662 196
945 3300026041 Ga0207639_10005602 Ga0207639_100056027 196
946 3300026041 Ga0207639_10278328 Ga0207639_102783283 196
947 3300026095 Ga0207676_10178109 Ga0207676_101781092 196
948 3300026116 Ga0207674_11168596 Ga0207674_111685961 196
949 3300026121 Ga0207683_10829936 Ga0207683_108299362 196
950 3300026142 Ga0207698_10375955 Ga0207698_103759552 196
951 3300027614 Ga0209970_1000478 Ga0209970_10004787 196
952 3300027666 Ga0209282_1006184 Ga0209282_10061848 196
953 3300027666 Ga0209282_1114443 Ga0209282_11144432 196
954 3300027876 Ga0209974_10049704 Ga0209974_100497043 196
955 3300027876 Ga0209974_10130739 Ga0209974_101307391 196
956 3300027907 Ga0207428_10386576 Ga0207428_103865762 196
957 3300028380 Ga0268265_10027745 Ga0268265_100277453 196
958 3300028794 Ga0307515_10000428 Ga0307515_1000042840 196
959 3300028794 Ga0307515_10002861 Ga0307515_1000286129 196
960 3300028794 Ga0307515_10131159 Ga0307515_101311593 196
961 3300030522 Ga0307512_10233363 Ga0307512_102333632 196
962 3300030731 Ga0316177_1092166 Ga0316177_10921663 196
963 3300030733 Ga0314311_1139236 Ga0314311_113923610 196
964 3300030736 Ga0316180_1077645 Ga0316180_10776452 196
965 3300030742 Ga0316183_1002371 Ga0316183_10023714 196
966 3300030742 Ga0316183_1154909 Ga0316183_11549091 196
967 3300030744 Ga0316181_1009854 Ga0316181_10098544 196
968 3300030744 Ga0316181_1111584 Ga0316181_11115843 196
969 3300030745 Ga0316182_1087061 Ga0316182_10870612 196
970 3300031238 Ga0265332_10000033 Ga0265332_1000003387 196
971 3300031239 Ga0265328_10051830 Ga0265328_100518303 196
972 3300031251 Ga0265327_10000689 Ga0265327_1000068924 196
973 3300031251 Ga0265327_10016727 Ga0265327_100167273 196
974 3300031456 Ga0307513_10000010 Ga0307513_10000010321 196
975 3300031456 Ga0307513_10000121 Ga0307513_1000012112 196
976 3300031456 Ga0307513_10010831 Ga0307513_100108313 196
977 3300031456 Ga0307513_10093400 Ga0307513_100934002 196
978 3300031548 Ga0307408_100000068 Ga0307408_10000006852 196
979 3300031548 Ga0307408_100051392 Ga0307408_1000513923 196
980 3300031548 Ga0307408_100060884 Ga0307408_1000608843 196
981 3300031548 Ga0307408_100153651 Ga0307408_1001536512 196
982 3300031649 Ga0307514_10000869 Ga0307514_1000086911 196
983 3300031649 Ga0307514_10017552 Ga0307514_100175523 196
984 3300031730 Ga0307516_10047914 Ga0307516_100479144 196
985 3300031730 Ga0307516_10301837 Ga0307516_103018372 196
986 3300031731 Ga0307405_10249208 Ga0307405_102492081 196
987 3300031731 Ga0307405_10370510 Ga0307405_103705102 196
988 3300031731 Ga0307405_10466740 Ga0307405_104667402 196
989 3300031824 Ga0307413_10200729 Ga0307413_102007293 196
990 3300031824 Ga0307413_10294029 Ga0307413_102940292 196
991 3300031824 Ga0307413_11298326 Ga0307413_112983261 196
992 3300031901 Ga0307406_10000135 Ga0307406_100001359 196
993 3300031901 Ga0307406_10005443 Ga0307406_100054433 196
994 3300031901 Ga0307406_10119502 Ga0307406_101195022 196
995 3300031901 Ga0307406_10270774 Ga0307406_102707742 196
996 3300031903 Ga0307407_10103535 Ga0307407_101035352 196
997 3300031911 Ga0307412_10042559 Ga0307412_100425594 196
998 3300032002 Ga0307416_100217996 Ga0307416_1002179963 196
999 3300032002 Ga0307416_100770241 Ga0307416_1007702412 196
1000 3300032004 Ga0307414_10302559 Ga0307414_103025593 196
1001 3300032004 Ga0307414_10960949 Ga0307414_109609492 196
1002 3300032005 Ga0307411_10125955 Ga0307411_101259553 196
1003 3300032005 Ga0307411_10185912 Ga0307411_101859121 196
1004 3300032005 Ga0307411_10471918 Ga0307411_104719181 196
1005 3300037471 Ga0395905_0254731 Ga0395905_0254731_466_1062 196
1006 3300038443 Ga0395901_0156605 Ga0395901_0156605_66_656 196
1007 3300041404 Ga0439436_0000168 Ga0439436_0000168_2890_3486 196
1008 3300041404 Ga0439436_0000271 Ga0439436_0000271_785_1375 196
1009 3300041405 Ga0439438_030265 Ga0439438_030265_503_1093 196
1010 3300041407 Ga0439447_019703 Ga0439447_019703_333_929 196
1011 3300041407 Ga0439447_033049 Ga0439447_033049_267_857 196
1012 3300041410 Ga0439461_0003984 Ga0439461_0003984_1553_2149 196
1013 3300041410 Ga0439461_0043794 Ga0439461_0043794_194_784 196
1014 3300041411 Ga0439466_0006959 Ga0439466_0006959_3268_3858 196
1015 3300041411 Ga0439466_0011797 Ga0439466_0011797_431_1027 196
1016 3300041411 Ga0439466_0059239 Ga0439466_0059239_618_1208 196
1017 3300041413 Ga0439465_0004740 Ga0439465_0004740_392_988 196
1018 3300041413 Ga0439465_0032324 Ga0439465_0032324_680_1270 196
1019 3300041443 Ga0451789_0115708 Ga0451789_0115708_298_888 196
1020 3300041443 Ga0451789_0257727 Ga0451789_0257727_77_703 196
1021 3300041443 Ga0451789_1294079 Ga0451789_1294079_60_650 196
1022 3300041453 Ga0451797_1105889 Ga0451797_1105889_36_626 196
1023 3300041453 Ga0451797_1374203 Ga0451797_1374203_67_657 196
1024 3300041463 Ga0451804_1015395 Ga0451804_1015395_250_876 196
1025 3300041486 Ga0451807_0207679 Ga0451807_0207679_448_1074 196
1026 3300041491 Ga0451833_0357612 Ga0451833_0357612_70_660 196
1027 3300041498 Ga0451841_1434301 Ga0451841_1434301_79_705 196
1028 3300041997 Ga0439431_0002491 Ga0439431_0002491_219_815 196
1029 3300041997 Ga0439431_0015132 Ga0439431_0015132_301_891 196
1030 3300041999 Ga0439433_0003486 Ga0439433_0003486_943_1539 196
1031 3300041999 Ga0439433_0014808 Ga0439433_0014808_757_1347 196
1032 3300042004 Ga0439445_0000101 Ga0439445_0000101_1014_1610 196
1033 3300042006 Ga0439432_000403 Ga0439432_000403_15316_15912 196
1034 3300042006 Ga0439432_006778 Ga0439432_006778_3218_3808 196
1035 3300042007 Ga0439449_0002611 Ga0439449_0002611_3511_4140 196
1036 3300042007 Ga0439449_0004558 Ga0439449_0004558_1329_1925 196
1037 3300042007 Ga0439449_0048086 Ga0439449_0048086_361_951 196
1038 3300042010 Ga0439452_001575 Ga0439452_001575_3804_4400 196
1039 3300042010 Ga0439452_003824 Ga0439452_003824_104_694 196
1040 3300042014 Ga0439457_011619 Ga0439457_011619_764_1360 196
1041 3300042015 Ga0439462_0004271 Ga0439462_0004271_156_752 196
1042 3300042015 Ga0439462_0009364 Ga0439462_0009364_90_680 196
1043 3300042123 Ga0450921_006250 Ga0450921_006250_296_886 196
1044 3300042128 Ga0450897_001501 Ga0450897_001501_963_1553 196
1045 3300042145 Ga0450906_007802 Ga0450906_007802_106_696 196
1046 3300042146 Ga0450907_005115 Ga0450907_005115_989_1579 196
1047 3300042147 Ga0450910_008320 Ga0450910_008320_391_981 196
1048 3300042147 Ga0450910_032418 Ga0450910_032418_74_664 196
1049 3300042156 Ga0439446_0010534 Ga0439446_0010534_68_664 196
1050 3300042156 Ga0439446_0054417 Ga0439446_0054417_521_1111 196
1051 3300042156 Ga0439446_0165514 Ga0439446_0165514_13_603 196
1052 3300042184 Ga0450908_002817 Ga0450908_002817_1885_2475 196
1053 3300042184 Ga0450908_010910 Ga0450908_010910_763_1353 196
1054 3300042435 Ga0439434_0039391 Ga0439434_0039391_121_711 196
1055 3300042531 Ga0450918_000258 Ga0450918_000258_3451_4041 196
1056 3300042532 Ga0450893_0022948 Ga0450893_0022948_243_833 196
1057 3300042876 Ga0451577_0000142 Ga0451577_0000142_101417_102049 196
1058 3300042876 Ga0451577_0619466 Ga0451577_0619466_275_865 196
1059 3300042876 Ga0451577_0748359 Ga0451577_0748359_166_756 196
1060 3300044673 Ga0453683_0227683 Ga0453683_0227683_558_1148 196
1061 3300044683 Ga0466965_0015331 Ga0466965_0015331_2183_2773 196
1062 3300044712 Ga0453684_0000126 Ga0453684_0000126_277214_277846 196
1063 3300044712 Ga0453684_1084309 Ga0453684_1084309_153_743 196
1064 3300045051 Ga0451576_0003200 Ga0451576_0003200_1169_1801 196
1065 3300045051 Ga0451576_0144753 Ga0451576_0144753_1024_1614 196
1066 3300045051 Ga0451576_1474007 Ga0451576_1474007_25_615 196
1067 3300046453 Ga0495627_024136 Ga0495627_024136_1213_1803 196
1068 3300046459 Ga0495629_0350512 Ga0495629_0350512_167_757 196
1069 3300046460 Ga0495638_0027431 Ga0495638_0027431_1300_1890 196
1070 3300046501 Ga0495607_0000104 Ga0495607_0000104_51865_52470 196
1071 3300046513 Ga0495616_0001588 Ga0495616_0001588_10647_11237 196
1072 3300046515 Ga0495620_0021209 Ga0495620_0021209_2217_2807 196
1073 3300046515 Ga0495620_0172871 Ga0495620_0172871_184_774 196
1074 3300046520 Ga0495637_0012385 Ga0495637_0012385_191_781 196
1075 3300046520 Ga0495637_0048343 Ga0495637_0048343_54_644 196
1076 3300046522 Ga0495643_0098704 Ga0495643_0098704_835_1425 196
1077 3300046528 Ga0495642_0106865 Ga0495642_0106865_132_722 196
1078 3300046530 Ga0495654_0031744 Ga0495654_0031744_1493_2083 196
1079 3300046530 Ga0495654_0085535 Ga0495654_0085535_47_637 196
1080 3300046537 Ga0495598_0056598 Ga0495598_0056598_311_901 196
1081 3300046539 Ga0495621_0072853 Ga0495621_0072853_452_1042 196
1082 3300046539 Ga0495621_0204500 Ga0495621_0204500_172_762 196
1083 3300046558 Ga0495633_0176192 Ga0495633_0176192_162_752 196
1084 3300046615 Ga0495656_0000075 Ga0495656_0000075_13550_14140 196
1085 3300046660 Ga0495625_0000811 Ga0495625_0000811_36054_36644 196
1086 3300046660 Ga0495625_0025717 Ga0495625_0025717_1317_1907 196
1087 3300046665 Ga0495661_0161144 Ga0495661_0161144_577_1167 196
1088 3300046674 Ga0495588_0195429 Ga0495588_0195429_440_1030 196
1089 3300046684 Ga0495669_0149372 Ga0495669_0149372_417_1007 196
1090 3300046691 Ga0495670_0179599 Ga0495670_0179599_103_693 196
1091 3300046692 Ga0495671_0034019 Ga0495671_0034019_127_717 196
1092 3300046809 Ga0495600_0166072 Ga0495600_0166072_652_1242 196
1093 3300046810 Ga0495660_0134110 Ga0495660_0134110_456_1046 196
1094 3300047321 Ga0495676_0012666 Ga0495676_0012666_5085_5675 196
1095 3300047321 Ga0495676_0610245 Ga0495676_0610245_33_623 196
1096 3300047472 Ga0495686_0001800 Ga0495686_0001800_1323_1913 196
1097 3300047673 Ga0495593_0007103 Ga0495593_0007103_4208_4798 196
1098 3300048090 Ga0495615_0030520 Ga0495615_0030520_599_1189 196
1099 3300048091 Ga0495626_0144435 Ga0495626_0144435_174_779 196
1100 3300048903 Ga0496100_0634095 Ga0496100_0634095_119_709 196
1101 3300048904 Ga0496101_0135784 Ga0496101_0135784_919_1509 196
1102 3300048904 Ga0496101_0250344 Ga0496101_0250344_738_1328 196
1103 3300048904 Ga0496101_0874784 Ga0496101_0874784_90_680 196
1104 3300048907 Ga0496104_0806923 Ga0496104_0806923_50_640 196
1105 3300048909 Ga0496106_1053740 Ga0496106_1053740_28_618 196
1106 3300048910 Ga0496107_0208558 Ga0496107_0208558_727_1317 196
1107 3300048911 Ga0496108_0122184 Ga0496108_0122184_23_613 196
1108 3300048912 Ga0496109_0282174 Ga0496109_0282174_483_1073 196
1109 3300048913 Ga0496110_0049361 Ga0496110_0049361_1749_2339 196
1110 3300048915 Ga0496112_0088286 Ga0496112_0088286_994_1584 196
1111 3300048915 Ga0496112_0737718 Ga0496112_0737718_14_604 196
1112 3300048920 Ga0496117_0053691 Ga0496117_0053691_257_847 196
1113 3300048920 Ga0496117_0054270 Ga0496117_0054270_1919_2530 196
1114 3300048921 Ga0496118_0023589 Ga0496118_0023589_2402_2992 196
1115 3300048921 Ga0496118_0163086 Ga0496118_0163086_774_1364 196
1116 3300048924 Ga0496121_0059956 Ga0496121_0059956_1033_1644 196
1117 3300048924 Ga0496121_0093571 Ga0496121_0093571_267_857 196
1118 3300048924 Ga0496121_0624240 Ga0496121_0624240_15_641 196
1119 3300048925 Ga0496122_0007254 Ga0496122_0007254_3241_3834 196
1120 3300048925 Ga0496122_0169070 Ga0496122_0169070_134_724 196
1121 3300048925 Ga0496122_0302757 Ga0496122_0302757_109_699 196
1122 3300048926 Ga0496123_0019596 Ga0496123_0019596_1629_2222 196
1123 3300048926 Ga0496123_0184818 Ga0496123_0184818_254_865 196
1124 3300048926 Ga0496123_0210948 Ga0496123_0210948_113_703 196
1125 3300048926 Ga0496123_0366102 Ga0496123_0366102_41_631 196
1126 3300048927 Ga0496124_0030743 Ga0496124_0030743_1686_2276 196
1127 3300048927 Ga0496124_0063813 Ga0496124_0063813_2134_2724 196
1128 3300048927 Ga0496124_0268157 Ga0496124_0268157_206_799 196
1129 3300048928 Ga0496125_0000729 Ga0496125_0000729_8638_9231 196
1130 3300048928 Ga0496125_0009773 Ga0496125_0009773_7165_7755 196
1131 3300048928 Ga0496125_0218074 Ga0496125_0218074_556_1146 196
1132 3300048929 Ga0496126_0011869 Ga0496126_0011869_2501_3094 196
1133 3300049568 Ga0501031_0016869 Ga0501031_0016869_2718_3308 196
1134 3300049663 Ga0501223_044236 Ga0501223_044236_127_717 196
1135 3300049759 Ga0501262_000181 Ga0501262_000181_6466_7056 196
1136 3300049763 Ga0501266_003400 Ga0501266_003400_257_847 196
1137 3300050489 nmdc:mga03683_168245_c1 nmdc:mga03683_168245_c1_316_906 196
1138 3300050489 nmdc:mga03683_4655_c1 nmdc:mga03683_4655_c1_284_874 196
1139 3300050489 nmdc:mga03683_80324_c1 nmdc:mga03683_80324_c1_372_962 196
1140 3300050490 nmdc:mga03n38_14169_c1 nmdc:mga03n38_14169_c1_2280_2870 196
1141 3300050490 nmdc:mga03n38_287493_c1 nmdc:mga03n38_287493_c1_19_609 196
1142 3300050490 nmdc:mga03n38_318641_c1 nmdc:mga03n38_318641_c1_79_705 196
1143 3300050490 nmdc:mga03n38_322053_c1 nmdc:mga03n38_322053_c1_217_807 196
1144 3300050491 nmdc:mga00v17_18255_c1 nmdc:mga00v17_18255_c1_758_1348 196
1145 3300050491 nmdc:mga00v17_21586_c1 nmdc:mga00v17_21586_c1_1871_2461 196
1146 3300050491 nmdc:mga00v17_501477_c1 nmdc:mga00v17_501477_c1_124_750 196
1147 3300050492 nmdc:mga0yw44_99857_c1 nmdc:mga0yw44_99857_c1_1242_1832 196
1148 3300050493 nmdc:mga0k408_27872_c1 nmdc:mga0k408_27872_c1_1819_2409 196
1149 3300050494 nmdc:mga06z11_157361_c1 nmdc:mga06z11_157361_c1_138_728 196
1150 3300050496 nmdc:mga07m45_151297_c1 nmdc:mga07m45_151297_c1_745_1335 196
1151 3300050496 nmdc:mga07m45_153943_c1 nmdc:mga07m45_153943_c1_41_631 196
1152 3300050496 nmdc:mga07m45_33307_c1 nmdc:mga07m45_33307_c1_320_910 196
1153 3300050496 nmdc:mga07m45_336911_c1 nmdc:mga07m45_336911_c1_83_709 196
1154 3300050496 nmdc:mga07m45_7015_c1 nmdc:mga07m45_7015_c1_2066_2656 196
1155 3300050496 nmdc:mga07m45_9064_c1 nmdc:mga07m45_9064_c1_3584_4174 196
1156 3300050496 nmdc:mga07m45_9089_c1 nmdc:mga07m45_9089_c1_2802_3392 196
1157 3300050516 nmdc:mga0sz30_23985_c1 nmdc:mga0sz30_23985_c1_849_1439 196
1158 3300050516 nmdc:mga0sz30_296530_c1 nmdc:mga0sz30_296530_c1_39_629 196
1159 3300053079 Ga0500610_0005460 Ga0500610_0005460_2265_2855 196
1160 3300053079 Ga0500610_0009289 Ga0500610_0009289_303_893 196
1161 3300053087 Ga0500643_004846 Ga0500643_004846_1051_1641 196
1162 3300053088 Ga0500644_0113281 Ga0500644_0113281_362_988 196
1163 3300053088 Ga0500644_0114356 Ga0500644_0114356_152_742 196
1164 3300053094 Ga0500566_0096110 Ga0500566_0096110_983_1573 196
1165 3300053108 Ga0500562_014934 Ga0500562_014934_463_1053 196
1166 3300053110 Ga0500571_000080 Ga0500571_000080_27946_28536 196
1167 3300053117 Ga0500593_000694 Ga0500593_000694_9135_9761 196
1168 3300053117 Ga0500593_004435 Ga0500593_004435_2981_3571 196
1169 3300053118 Ga0500594_0003168 Ga0500594_0003168_1584_2174 196
1170 3300053120 Ga0500597_193218 Ga0500597_193218_101_691 196
1171 3300053121 Ga0500607_010298 Ga0500607_010298_3078_3668 196
1172 3300053121 Ga0500607_017986 Ga0500607_017986_2143_2733 196
1173 3300053122 Ga0500608_037758 Ga0500608_037758_1364_1954 196
1174 3300053122 Ga0500608_045642 Ga0500608_045642_338_928 196
1175 3300053122 Ga0500608_096081 Ga0500608_096081_190_780 196
1176 3300053125 Ga0500618_024750 Ga0500618_024750_143_733 196
1177 3300053128 Ga0500626_152735 Ga0500626_152735_210_800 196
1178 3300053129 Ga0500628_042312 Ga0500628_042312_106_732 196
1179 3300053133 Ga0500655_001531 Ga0500655_001531_1251_1841 196
1180 3300053134 Ga0500658_0000210 Ga0500658_0000210_25377_25967 196
1181 3300053134 Ga0500658_0000493 Ga0500658_0000493_14516_15106 196
1182 3300053136 Ga0500559_0010425 Ga0500559_0010425_1577_2167 196
1183 3300053138 Ga0500564_018756 Ga0500564_018756_1523_2113 196
1184 3300053139 Ga0500568_0001699 Ga0500568_0001699_10491_11081 196
1185 3300053141 Ga0500574_054872 Ga0500574_054872_378_968 196
1186 3300053151 Ga0500604_0082388 Ga0500604_0082388_94_720 196
1187 3300053153 Ga0500616_0031819 Ga0500616_0031819_1278_1868 196
1188 3300053158 Ga0500627_0017357 Ga0500627_0017357_2121_2711 196
1189 3300053161 Ga0500634_0005197 Ga0500634_0005197_4220_4810 196
1190 3300053161 Ga0500634_0006307 Ga0500634_0006307_3360_3950 196
1191 3300053730 Ga0500645_000769 Ga0500645_000769_689_1315 196
1192 3300053730 Ga0500645_007527 Ga0500645_007527_2359_2985 196
1193 3300053730 Ga0500645_012144 Ga0500645_012144_1808_2434 196
1194 3300053734 Ga0500565_001904 Ga0500565_001904_735_1325 196

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF21175

RecR_C

RecR, C-terminal

188

211

0.99

PF13662

Toprim_4

Toprim domain

95

186

0.98

PF02132

RecR_ZnF

RecR, Cys4-zinc finger motif

69

89

0.96

PF21176

RecR_HhH

RecR, helix-hairpin-helix

22

66

0.96

PF01751

Toprim

Toprim domain

96

185

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
8a93-assembly1.cif.gz_F complex of recf-recr-dna from thermus thermophilus. 0.9437 81 169
8a93-assembly1.cif.gz_F complex of recf-recr-dna from thermus thermophilus. 0.904 81 169
8a93-assembly1.cif.gz_D complex of recf-recr-dna from thermus thermophilus. 0.8863 6 47
8ab0-assembly1.cif.gz_F complex of reco-recr-dna from thermus thermophilus. 0.8628 6 169
8ab0-assembly1.cif.gz_F complex of reco-recr-dna from thermus thermophilus. 0.8477 6 169
ID Description Score Start End Superfamily
af_P9WHI3_76_174_3.40.1360.10 Alpha Beta;3-Layer(aba) Sandwich;Dna Topoisomerase Vi A Subunit; Chain: A, domain 2; 0.9511 77 170 3.40.1360.10
af_P0A7H6_77_171_3.40.1360.10 Alpha Beta;3-Layer(aba) Sandwich;Dna Topoisomerase Vi A Subunit; Chain: A, domain 2; 0.9466 76 170 3.40.1360.10
af_P0A7H6_77_171_3.40.1360.10 Alpha Beta;3-Layer(aba) Sandwich;Dna Topoisomerase Vi A Subunit; Chain: A, domain 2; 0.9371 76 170 3.40.1360.10
1vddC03 Alpha Beta;3-Layer(aba) Sandwich;Dna Topoisomerase Vi A Subunit; Chain: A, domain 2; 0.9196 77 170 3.40.1360.10
1vddC03 Alpha Beta;3-Layer(aba) Sandwich;Dna Topoisomerase Vi A Subunit; Chain: A, domain 2; 0.9102 77 170 3.40.1360.10
ID Description Score Start End GO Terms
AF-A0A5C6XXY0-F1-model_v4 deleted 0.986 2 149
AF-A0A3B9BGG3-F1-model_v4 Recombination protein RecR 0.9857 69 154 GO:0003677
GO:0006281
GO:0006310
GO:0046872
AF-A0A6P1B0M1-F1-model_v4 deleted 0.9844 59 152
AF-A0A5C6ZBJ8-F1-model_v4 Recombination protein RecR 0.9808 5 169 GO:0003677
GO:0006281
GO:0006310
GO:0046872
AF-A0A520GTN9-F1-model_v4 Recombination protein RecR 0.9752 1 109 GO:0003677
GO:0006281
GO:0006310
GO:0046872

Feature Viewer

pLDDT pTM Quality
87.57 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map