F491494
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1194 | 548 | 1135 | 196 |
Family's Representative Sequence
| Representative Sequence | 3300005355|Ga0070671_100003978|Ga0070671_10000397810 |
| Length | 211 |
| Sequence | LRPSPGSDALTDGTTCVAEPSLDALVDALRRLPGVGVKSAQRMAFHLLQHDREGARRIAKSLEAAVSAIRHCERCHTFTEAPVCSICLNPARDVRQLCVVETPADQAALERTGSYRGLYFVLMGRLSPLDGIGPRDVGADQLLARASDGVTEEVIIATNFTAEGEATAHVLAQALKSRGVRVTRLARGVPIGSELEYVDLGTIAHALVDRR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2511231002 | Polaromonas sp. CF318 | Isolate | Rhizosphere |
| 2 | 2547132374 | Acidovorax radicis N35 | Isolate | Unclassified |
| 3 | 2599185214 | Variovorax sp. NFACC26 | Isolate | Rhizoplane |
| 4 | 2599185226 | Variovorax sp. NFACC27 | Isolate | Rhizoplane |
| 5 | 2599185227 | Variovorax sp. NFACC28 | Isolate | Rhizoplane |
| 6 | 2599185229 | Variovorax sp. NFACC29 | Isolate | Endosphere |
| 7 | 2643221570 | Acidovorax sp. Root568 | Isolate | Unclassified |
| 8 | 2643221585 | Pelomonas sp. Root662 | Isolate | Unclassified |
| 9 | 2643221596 | Acidovorax sp. Root70 | Isolate | Unclassified |
| 10 | 2643221609 | Acidovorax sp. Root217 | Isolate | Unclassified |
| 11 | 2643221611 | Acidovorax sp. Root219 | Isolate | Unclassified |
| 12 | 2643221628 | Variovorax sp. Root318D1 | Isolate | Unclassified |
| 13 | 2643221639 | Pelomonas sp. Root1217 | Isolate | Unclassified |
| 14 | 2643221646 | Pelomonas sp. Root1237 | Isolate | Unclassified |
| 15 | 2643221652 | Acidovorax sp. Root402 | Isolate | Unclassified |
| 16 | 2643221654 | Rhizobacter sp. Root404 | Isolate | Unclassified |
| 17 | 2643221656 | Pelomonas sp. Root405 | Isolate | Unclassified |
| 18 | 2643221660 | Methylibium sp. Root1272 | Isolate | Unclassified |
| 19 | 2643221717 | Acidovorax sp. Root267 | Isolate | Unclassified |
| 20 | 2721755523 | Delftia sp. HK171 | Isolate | Unclassified |
| 21 | 2738541277 | Variovorax sp. GV051 | Isolate | Unclassified |
| 22 | 2738541337 | Pelomonas sp. BT06 | Isolate | Unclassified |
| 23 | 2738543012 | Acidovorax sp. CF301 | Isolate | Unclassified |
| 24 | 2738543013 | Variovorax sp. BT01 | Isolate | Unclassified |
| 25 | 2738543019 | Variovorax sp. GV040 | Isolate | Unclassified |
| 26 | 2816332133 | Acidovorax radicis 2721A | Isolate | Unclassified |
| 27 | 2818991446 | Variovorax sp. 1180 | Isolate | Unclassified |
| 28 | 2831265667 | Variovorax guangxiensis DSM 27352 | Isolate | Rhizosphere |
| 29 | 2831864461 | Roseateles noduli HZ7 | Isolate | Nodule |
| 30 | 2838054893 | Variovorax guangxiensis 34/80 | Isolate | Nodule |
| 31 | 2839138175 | Delftia acidovorans B15 | Isolate | Rhizosphere |
| 32 | 2842677519 | Variovorax sp. R-72495 | Isolate | Unclassified |
| 33 | 2842718218 | Acidovorax sp. R-73343 | Isolate | Unclassified |
| 34 | 2857576091 | Pigmentiphaga sp. R-72090 | Isolate | Unclassified |
| 35 | 2881101125 | Ramlibacter rhizophilus CCTCC AB2015357 | Isolate | Rhizosphere |
| 36 | 2885192300 | Variovorax sp. MHTC-1 | Isolate | Rhizosphere |
| 37 | 2885198086 | Variovorax sp. 679 | Isolate | Unclassified |
| 38 | 2885211737 | Variovorax sp. 553 | Isolate | Unclassified |
| 39 | 2899924645 | Variovorax sp. 369 | Isolate | Unclassified |
| 40 | 2904449895 | Variovorax sp. 1763 | Isolate | Rhizosphere |
| 41 | 2904456579 | Variovorax sp. 2002 | Isolate | Unclassified |
| 42 | 2904479285 | Comamonas sediminis 4487 | Isolate | Rhizosphere |
| 43 | 2904541872 | Variovorax sp. 1615 | Isolate | Rhizosphere |
| 44 | 2919462493 | Variovorax sp. 3319 | Isolate | Rhizosphere |
| 45 | 2928037797 | Variovorax sp. 1126 | Isolate | Unclassified |
| 46 | 2928044640 | Variovorax sp. 1128 | Isolate | Unclassified |
| 47 | 2928051484 | Variovorax sp. 1133 | Isolate | Unclassified |
| 48 | 2928064002 | Variovorax sp. 1140 | Isolate | Rhizosphere |
| 49 | 2928070936 | Variovorax gossypii 1167 | Isolate | Unclassified |
| 50 | 2928084124 | Variovorax paradoxus 1218 | Isolate | Unclassified |
| 51 | 2928115317 | Pseudacidovorax sp. 1753 | Isolate | Rhizosphere |
| 52 | 2929160207 | Variovorax sp. R-72349 Hybrid assembly | Isolate | Unclassified |
| 53 | 2929520902 | Variovorax beijingensis 502 | Isolate | Unclassified |
| 54 | 2939631187 | Ottowia thiooxydans 2709 | Isolate | Rhizosphere |
| 55 | 2945945610 | Variovorax paradoxus W1I18 | Isolate | Rhizosphere |
| 56 | 2945972063 | Variovorax paradoxus W2I8 | Isolate | Rhizosphere |
| 57 | 2954767861 | Variovorax sp. TBS-050B | Isolate | Rhizosphere |
| 58 | 2974320154 | Acidovorax wautersii SORGH_AS 335 | Isolate | Unclassified |
| 59 | 2990710928 | Acidovorax delafieldii SLBN-75 | Isolate | Rhizosphere |
| 60 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 61 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 62 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 63 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 64 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 65 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 66 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 67 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 68 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 69 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 70 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 71 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 72 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 73 | 3300003347 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM | Metagenome | Rhizosphere |
| 74 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 75 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 76 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 77 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 78 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 79 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 80 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 81 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 82 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 83 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 84 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 85 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 86 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 87 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 88 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 89 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 90 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 91 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 92 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 93 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 94 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 95 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 96 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 97 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 98 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 99 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 100 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 101 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 102 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 103 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 104 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 105 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 106 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 107 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 108 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 109 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 110 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 111 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 112 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 113 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 114 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 115 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 116 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 117 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 118 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 119 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 120 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 121 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 122 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 123 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 124 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 125 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 126 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 127 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 128 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 129 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 130 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 131 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 132 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 133 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 134 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 135 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 136 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 137 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 138 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 139 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 140 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 141 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 142 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 143 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 144 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 145 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 146 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 147 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 148 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 149 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 151 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 152 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 153 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 154 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 156 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 157 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 158 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 159 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 160 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 162 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 163 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 164 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 165 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 166 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 167 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 168 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 169 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 170 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 171 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 172 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 173 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 174 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 175 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 176 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 177 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 178 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 179 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 180 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 181 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 182 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 183 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 184 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 185 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 186 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 187 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 188 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 189 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 190 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 191 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 192 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 193 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 194 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 195 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 196 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 197 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 198 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 199 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 200 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 201 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 202 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 203 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 204 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 205 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 206 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 207 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 208 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 209 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 210 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 211 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 212 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 213 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 258 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 259 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 260 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 261 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 262 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 263 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 264 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 265 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 266 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 267 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 268 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 269 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 270 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 271 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 272 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 273 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 274 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 275 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 276 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 277 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 278 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 279 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 280 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 281 | 3300030736 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 | Metagenome | Rhizosphere |
| 282 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 283 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 284 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 285 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 286 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 287 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 288 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 289 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 290 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 291 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 292 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 293 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 294 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 295 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 296 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 297 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 298 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 299 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 300 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 301 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 302 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 303 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 304 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 305 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 306 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 307 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 308 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 309 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 310 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 311 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 312 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 313 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 314 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 315 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 316 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 317 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 318 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 319 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 320 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 321 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 322 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 323 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 324 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 325 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 326 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 327 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 328 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 329 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 330 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 331 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 332 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 333 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 334 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 335 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 336 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 337 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 338 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 339 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 340 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 341 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 342 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 343 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 344 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 345 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 346 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 347 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 348 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 349 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 350 | 3300042000 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 | Metagenome | Rhizosphere |
| 351 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 352 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 353 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 354 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 355 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 356 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 357 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 358 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 359 | 3300042119 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218L_E14_082316_1902 | Metagenome | Rhizosphere |
| 360 | 3300042123 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 | Metagenome | Rhizosphere |
| 361 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 362 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 363 | 3300042128 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 | Metagenome | Rhizosphere |
| 364 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 365 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 366 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 367 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 368 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 369 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 370 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 371 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 372 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 373 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 374 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 375 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 376 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 377 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 378 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 379 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 380 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 381 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 382 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 383 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 384 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 385 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 386 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 387 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 388 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 389 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 390 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 391 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 392 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 393 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 422 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 423 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 424 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 425 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 426 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 427 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 428 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 429 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 430 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 431 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 432 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 433 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 434 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 435 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 436 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 437 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 438 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 439 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 440 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 441 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 442 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 443 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 444 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 445 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 446 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 447 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 448 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 449 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 450 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 451 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 452 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 453 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 454 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 455 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 456 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 457 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 458 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 459 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 460 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 461 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 462 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 463 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 464 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 465 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 466 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 467 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 468 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 469 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 470 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 471 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 472 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 473 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 474 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 475 | 3300049658 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought | Metagenome | Rhizosphere |
| 476 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 477 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 478 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 479 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 480 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 481 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 482 | 3300049706 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control | Metagenome | Rhizosphere |
| 483 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 484 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 485 | 3300049762 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control | Metagenome | Rhizosphere |
| 486 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 487 | 3300049764 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control | Metagenome | Rhizosphere |
| 488 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 489 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 490 | 3300049769 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought | Metagenome | Rhizosphere |
| 491 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 492 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 493 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 494 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 495 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 496 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 497 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 498 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 499 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 500 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 501 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 502 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 503 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 504 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 505 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 506 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 507 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 508 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 509 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 510 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 511 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 512 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 513 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 514 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 515 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 516 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 517 | 3300053110 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere | Metagenome | Endosphere |
| 518 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 519 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 520 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 521 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 522 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 523 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 524 | 3300053128 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere | Metagenome | Endosphere |
| 525 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 526 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 527 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 528 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 529 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 530 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 531 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 532 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 533 | 3300053141 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere | Metagenome | Endosphere |
| 534 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 535 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 536 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 537 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 538 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 539 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 540 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 541 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 542 | 3300053734 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 endosphere | Metagenome | Endosphere |
| 543 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 544 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 545 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 546 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 547 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 548 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.64 |
| Metatranscriptomes | 0.42 |
| Isolates | 4.94 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 26.8 |
| Nodule | 0.67 |
| Rhizoplane | 2.68 |
| Rhizosphere | 57.62 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 12.23 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24739J22299_10045504 | 3300001989 | Bacteria | 1440 |
| 2 | JGI25155J39150_1000049 | 3300002704 | Bacteria | 78961 |
| 3 | JGI25156J39149_1000023 | 3300002705 | Bacteria | 146831 |
| 4 | JGI25154J39366_1000036 | 3300002738 | Bacteria | 161697 |
| 5 | JGI25158J39367_1009499 | 3300002739 | Bacteria | 1332 |
| 6 | JGI25157J39369_1000023 | 3300002741 | Bacteria | 161697 |
| 7 | JGI25152J39213_1005976 | 3300002773 | Bacteria | 3417 |
| 8 | JGI25150J39212_1004774 | 3300002774 | Bacteria | 2971 |
| 9 | JGI25150J39212_1005484 | 3300002774 | Bacteria | 2702 |
| 10 | JGI25159J45721_1001073 | 3300002987 | Bacteria | 11684 |
| 11 | JGI25159J45721_1001804 | 3300002987 | Bacteria | 8589 |
| 12 | JGI25159J45721_1011457 | 3300002987 | Bacteria | 2173 |
| 13 | JGI25159J45721_1011861 | 3300002987 | Bacteria | 2109 |
| 14 | JGI25151J46595_10004016 | 3300003187 | Bacteria | 7904 |
| 15 | JGI25151J46595_10005717 | 3300003187 | Bacteria | 6380 |
| 16 | JGI25151J46595_10010198 | 3300003187 | Bacteria | 4383 |
| 17 | JGI25151J46595_10010227 | 3300003187 | Bacteria | 4373 |
| 18 | JGI25151J46595_10016678 | 3300003187 | Bacteria | 3205 |
| 19 | JGI25151J46595_10121997 | 3300003187 | Bacteria | 663 |
| 20 | JGI25153J46596_10009858 | 3300003215 | Bacteria | 4384 |
| 21 | JGI25153J46596_10017105 | 3300003215 | Bacteria | 2871 |
| 22 | rootL2_10075892 | 3300003322 | Bacteria | 1863 |
| 23 | rootL2_10092820 | 3300003322 | Bacteria | 2620 |
| 24 | rootH1_10033192 | 3300003323 | Bacteria | 8571 |
| 25 | JGI26128J50194_1001258 | 3300003347 | Bacteria | 1589 |
| 26 | JGI25160J50197_1000260 | 3300003354 | Bacteria | 39829 |
| 27 | JGI25160J50197_1018470 | 3300003354 | Bacteria | 2173 |
| 28 | JGI25160J50197_1019095 | 3300003354 | Bacteria | 2112 |
| 29 | JGI25161J50226_1000015 | 3300003374 | Bacteria | 183773 |
| 30 | JGI25161J50226_1004468 | 3300003374 | Bacteria | 2920 |
| 31 | JGI25161J50226_1006316 | 3300003374 | Bacteria | 2162 |
| 32 | Ga0006562J51391_1051948 | 3300003578 | Bacteria | 900 |
| 33 | Ga0006562J51391_1076372 | 3300003578 | Bacteria | 1132 |
| 34 | Ga0055525_1000013 | 3300003759 | Bacteria | 440870 |
| 35 | Ga0055535_1003358 | 3300003761 | Bacteria | 4596 |
| 36 | Ga0055542_1000114 | 3300003762 | Bacteria | 107058 |
| 37 | Ga0055526_1010148 | 3300003771 | Bacteria | 4419 |
| 38 | Ga0055526_1010246 | 3300003771 | Bacteria | 4384 |
| 39 | Ga0055526_1030310 | 3300003771 | Bacteria | 1581 |
| 40 | Ga0055526_1030458 | 3300003771 | Bacteria | 1572 |
| 41 | Ga0055537_1000135 | 3300003773 | Bacteria | 55914 |
| 42 | Ga0055537_1000972 | 3300003773 | Bacteria | 13040 |
| 43 | Ga0055537_1009351 | 3300003773 | Bacteria | 2173 |
| 44 | Ga0055524_1000016 | 3300003775 | Bacteria | 244926 |
| 45 | Ga0055524_1021067 | 3300003775 | Bacteria | 2173 |
| 46 | Ga0055524_1021783 | 3300003775 | Bacteria | 2112 |
| 47 | Ga0055536_1013137 | 3300003781 | Bacteria | 3012 |
| 48 | Ga0055536_1020005 | 3300003781 | Bacteria | 2083 |
| 49 | Ga0055534_1000222 | 3300003784 | Bacteria | 41454 |
| 50 | Ga0055534_1003233 | 3300003784 | Bacteria | 5219 |
| 51 | Ga0055534_1003401 | 3300003784 | Bacteria | 5009 |
| 52 | Ga0055534_1004961 | 3300003784 | Bacteria | 3700 |
| 53 | Ga0055534_1008294 | 3300003784 | Bacteria | 2369 |
| 54 | Ga0055534_1011817 | 3300003784 | Bacteria | 1756 |
| 55 | Ga0055528_1000423 | 3300003790 | Bacteria | 33986 |
| 56 | Ga0055528_1006109 | 3300003790 | Bacteria | 5501 |
| 57 | Ga0055528_1020177 | 3300003790 | Bacteria | 2173 |
| 58 | Ga0055530_10000293 | 3300003791 | Bacteria | 45497 |
| 59 | Ga0055530_10000951 | 3300003791 | Bacteria | 23683 |
| 60 | Ga0055530_10066105 | 3300003791 | Bacteria | 792 |
| 61 | Ga0055540_1000144 | 3300003792 | Bacteria | 71420 |
| 62 | Ga0055540_1009989 | 3300003792 | Bacteria | 3204 |
| 63 | Ga0055540_1016495 | 3300003792 | Bacteria | 2100 |
| 64 | Ga0055531_10003930 | 3300003794 | Bacteria | 9242 |
| 65 | Ga0055531_10021503 | 3300003794 | Bacteria | 2499 |
| 66 | Ga0055531_10025349 | 3300003794 | Bacteria | 2157 |
| 67 | Ga0055543_1000807 | 3300004625 | Bacteria | 15447 |
| 68 | Ga0055543_1000874 | 3300004625 | Bacteria | 14431 |
| 69 | Ga0055543_1012562 | 3300004625 | Bacteria | 1698 |
| 70 | Ga0058862_10046891 | 3300004803 | Bacteria | 2222 |
| 71 | Ga0065165_1002967 | 3300005262 | Bacteria | 12902 |
| 72 | Ga0065165_1005926 | 3300005262 | Bacteria | 6626 |
| 73 | Ga0065165_1050224 | 3300005262 | Bacteria | 1188 |
| 74 | Ga0065165_1050229 | 3300005262 | Bacteria | 1188 |
| 75 | Ga0065714_10075522 | 3300005288 | Bacteria | 2898 |
| 76 | Ga0065704_10081107 | 3300005289 | Bacteria | 3818 |
| 77 | Ga0070676_10003470 | 3300005328 | Bacteria | 8215 |
| 78 | Ga0070676_10040798 | 3300005328 | Bacteria | 2689 |
| 79 | Ga0070676_10060101 | 3300005328 | Bacteria | 2256 |
| 80 | Ga0070683_100797880 | 3300005329 | Bacteria | 905 |
| 81 | Ga0070670_100084096 | 3300005331 | Bacteria | 2734 |
| 82 | Ga0070670_100185094 | 3300005331 | Bacteria | 1808 |
| 83 | Ga0070670_100264501 | 3300005331 | Bacteria | 1500 |
| 84 | Ga0070677_10004753 | 3300005333 | Bacteria | 4448 |
| 85 | Ga0068869_100008869 | 3300005334 | Bacteria | 6506 |
| 86 | Ga0068869_100162787 | 3300005334 | Bacteria | 1738 |
| 87 | Ga0068869_100330288 | 3300005334 | Bacteria | 1239 |
| 88 | Ga0068869_100780356 | 3300005334 | Bacteria | 820 |
| 89 | Ga0070680_100097964 | 3300005336 | Bacteria | 2432 |
| 90 | Ga0070682_100097617 | 3300005337 | Bacteria | 1934 |
| 91 | Ga0068868_100020836 | 3300005338 | Bacteria | 4934 |
| 92 | Ga0068868_100025065 | 3300005338 | Bacteria | 4530 |
| 93 | Ga0068868_100052998 | 3300005338 | Bacteria | 3195 |
| 94 | Ga0068868_100109948 | 3300005338 | Bacteria | 2239 |
| 95 | Ga0068868_100427582 | 3300005338 | Bacteria | 1148 |
| 96 | Ga0070660_100879503 | 3300005339 | Bacteria | 755 |
| 97 | Ga0070661_100003164 | 3300005344 | Bacteria | 11331 |
| 98 | Ga0070668_100572987 | 3300005347 | Bacteria | 985 |
| 99 | Ga0070669_100029036 | 3300005353 | Bacteria | 3986 |
| 100 | Ga0070675_100007410 | 3300005354 | Bacteria | 8475 |
| 101 | Ga0070675_100018213 | 3300005354 | Bacteria | 5590 |
| 102 | Ga0070675_100177695 | 3300005354 | Bacteria | 1839 |
| 103 | Ga0070675_100243530 | 3300005354 | Bacteria | 1572 |
| 104 | Ga0070671_100003978 | 3300005355 | Bacteria | 11639 |
| 105 | Ga0070671_100022049 | 3300005355 | Bacteria | 5203 |
| 106 | Ga0070671_100024548 | 3300005355 | Bacteria | 4937 |
| 107 | Ga0070671_100077674 | 3300005355 | Bacteria | 2775 |
| 108 | Ga0070671_100451836 | 3300005355 | Bacteria | 1102 |
| 109 | Ga0070674_100001350 | 3300005356 | Bacteria | 12930 |
| 110 | Ga0070674_100005970 | 3300005356 | Bacteria | 7079 |
| 111 | Ga0070673_100002284 | 3300005364 | Bacteria | 11625 |
| 112 | Ga0070673_100018990 | 3300005364 | Bacteria | 4928 |
| 113 | Ga0070673_100060889 | 3300005364 | Bacteria | 2993 |
| 114 | Ga0070659_100001056 | 3300005366 | Bacteria | 20135 |
| 115 | Ga0070667_100000427 | 3300005367 | Bacteria | 44426 |
| 116 | Ga0070667_100135591 | 3300005367 | Bacteria | 2152 |
| 117 | Ga0070667_100301939 | 3300005367 | Bacteria | 1442 |
| 118 | Ga0070714_100253673 | 3300005435 | Bacteria | 1627 |
| 119 | Ga0070663_100014432 | 3300005455 | Bacteria | 5070 |
| 120 | Ga0070663_100408778 | 3300005455 | Bacteria | 1111 |
| 121 | Ga0070678_100082262 | 3300005456 | Bacteria | 2444 |
| 122 | Ga0070678_100130002 | 3300005456 | Bacteria | 1999 |
| 123 | Ga0070678_100306146 | 3300005456 | Bacteria | 1352 |
| 124 | Ga0070678_100649736 | 3300005456 | Bacteria | 946 |
| 125 | Ga0070678_100766899 | 3300005456 | Bacteria | 873 |
| 126 | Ga0070662_100007285 | 3300005457 | Bacteria | 7169 |
| 127 | Ga0070662_100015383 | 3300005457 | Bacteria | 5123 |
| 128 | Ga0070662_100811032 | 3300005457 | Bacteria | 796 |
| 129 | Ga0070681_10129127 | 3300005458 | Bacteria | 2460 |
| 130 | Ga0068867_100000176 | 3300005459 | Bacteria | 41815 |
| 131 | Ga0068867_100002046 | 3300005459 | Bacteria | 14127 |
| 132 | Ga0068867_100021358 | 3300005459 | Bacteria | 4619 |
| 133 | Ga0068867_100041869 | 3300005459 | Bacteria | 3347 |
| 134 | Ga0068867_100065677 | 3300005459 | Bacteria | 2701 |
| 135 | Ga0070706_100000533 | 3300005467 | Bacteria | 44257 |
| 136 | Ga0070706_100637749 | 3300005467 | Bacteria | 989 |
| 137 | Ga0070707_100003061 | 3300005468 | Bacteria | 15843 |
| 138 | Ga0070707_100248358 | 3300005468 | Bacteria | 1732 |
| 139 | Ga0070707_100285174 | 3300005468 | Unclassified | 1605 |
| 140 | Ga0070707_101128036 | 3300005468 | Unclassified | 750 |
| 141 | Ga0070698_100147223 | 3300005471 | Bacteria | 2303 |
| 142 | Ga0070699_100466197 | 3300005518 | Bacteria | 1146 |
| 143 | Ga0070679_100083306 | 3300005530 | Bacteria | 3187 |
| 144 | Ga0070679_100131957 | 3300005530 | Bacteria | 2479 |
| 145 | Ga0068853_100045549 | 3300005539 | Bacteria | 3757 |
| 146 | Ga0068853_100158904 | 3300005539 | Bacteria | 2038 |
| 147 | Ga0068853_100599883 | 3300005539 | Bacteria | 1046 |
| 148 | Ga0070672_100000317 | 3300005543 | Bacteria | 27420 |
| 149 | Ga0070672_100011281 | 3300005543 | Bacteria | 6232 |
| 150 | Ga0070672_100212578 | 3300005543 | Bacteria | 1620 |
| 151 | Ga0070665_100113706 | 3300005548 | Bacteria | 2710 |
| 152 | Ga0070665_100221204 | 3300005548 | Bacteria | 1894 |
| 153 | Ga0068855_100022837 | 3300005563 | Bacteria | 7497 |
| 154 | Ga0068855_100526400 | 3300005563 | Bacteria | 1282 |
| 155 | Ga0070664_100056396 | 3300005564 | Bacteria | 3338 |
| 156 | Ga0070664_100083036 | 3300005564 | Bacteria | 2763 |
| 157 | Ga0068857_100016010 | 3300005577 | Bacteria | 6567 |
| 158 | Ga0068857_100279711 | 3300005577 | Bacteria | 1535 |
| 159 | Ga0068854_100406257 | 3300005578 | Bacteria | 1128 |
| 160 | Ga0068856_100153017 | 3300005614 | Bacteria | 2316 |
| 161 | Ga0068852_100036324 | 3300005616 | Bacteria | 4121 |
| 162 | Ga0068852_101011126 | 3300005616 | Bacteria | 850 |
| 163 | Ga0068859_100214678 | 3300005617 | Bacteria | 2011 |
| 164 | Ga0068859_100448748 | 3300005617 | Bacteria | 1386 |
| 165 | Ga0068864_100107072 | 3300005618 | Bacteria | 2486 |
| 166 | Ga0068864_100552087 | 3300005618 | Bacteria | 1113 |
| 167 | Ga0068851_10026610 | 3300005834 | Bacteria | 2844 |
| 168 | Ga0068870_10129674 | 3300005840 | Bacteria | 1463 |
| 169 | Ga0068863_100070689 | 3300005841 | Bacteria | 3301 |
| 170 | Ga0068863_100109497 | 3300005841 | Bacteria | 2630 |
| 171 | Ga0068863_100112570 | 3300005841 | Bacteria | 2592 |
| 172 | Ga0068863_100164624 | 3300005841 | Bacteria | 2126 |
| 173 | Ga0068858_101004194 | 3300005842 | Bacteria | 818 |
| 174 | Ga0068860_100111478 | 3300005843 | Bacteria | 2616 |
| 175 | Ga0068860_100147016 | 3300005843 | Bacteria | 2268 |
| 176 | Ga0068862_100044186 | 3300005844 | Bacteria | 3800 |
| 177 | Ga0075365_10022086 | 3300006038 | Bacteria | 3981 |
| 178 | Ga0075365_10038916 | 3300006038 | Bacteria | 3093 |
| 179 | Ga0075365_10213872 | 3300006038 | Bacteria | 1352 |
| 180 | Ga0075365_10380687 | 3300006038 | Bacteria | 995 |
| 181 | Ga0075368_10074866 | 3300006042 | Bacteria | 1372 |
| 182 | Ga0075363_100018438 | 3300006048 | Bacteria | 3478 |
| 183 | Ga0075363_100029136 | 3300006048 | Bacteria | 2847 |
| 184 | Ga0075363_100047658 | 3300006048 | Bacteria | 2277 |
| 185 | Ga0075363_100049721 | 3300006048 | Bacteria | 2233 |
| 186 | Ga0075363_100099920 | 3300006048 | Bacteria | 1605 |
| 187 | Ga0075363_100319854 | 3300006048 | Bacteria | 903 |
| 188 | Ga0075363_100370862 | 3300006048 | Bacteria | 838 |
| 189 | Ga0075363_100409579 | 3300006048 | Bacteria | 797 |
| 190 | Ga0075363_100497202 | 3300006048 | Bacteria | 724 |
| 191 | Ga0075364_10011971 | 3300006051 | Bacteria | 5288 |
| 192 | Ga0075364_10031776 | 3300006051 | Bacteria | 3391 |
| 193 | Ga0075364_10140479 | 3300006051 | Bacteria | 1624 |
| 194 | Ga0075432_10012009 | 3300006058 | Bacteria | 2943 |
| 195 | Ga0075362_10013562 | 3300006177 | Bacteria | 3265 |
| 196 | Ga0075362_10029529 | 3300006177 | Bacteria | 2363 |
| 197 | Ga0075362_10054075 | 3300006177 | Bacteria | 1803 |
| 198 | Ga0075362_10087552 | 3300006177 | Bacteria | 1442 |
| 199 | Ga0075362_10230315 | 3300006177 | Bacteria | 907 |
| 200 | Ga0075367_10014302 | 3300006178 | Bacteria | 4293 |
| 201 | Ga0075367_10022283 | 3300006178 | Bacteria | 3551 |
| 202 | Ga0075367_10023123 | 3300006178 | Bacteria | 3494 |
| 203 | Ga0075367_10278883 | 3300006178 | Bacteria | 1050 |
| 204 | Ga0075369_10029608 | 3300006186 | Bacteria | 2301 |
| 205 | Ga0075369_10235421 | 3300006186 | Bacteria | 849 |
| 206 | Ga0075366_10002632 | 3300006195 | Bacteria | 9240 |
| 207 | Ga0075366_10003790 | 3300006195 | Bacteria | 8041 |
| 208 | Ga0075366_10014189 | 3300006195 | Bacteria | 4548 |
| 209 | Ga0075366_10029732 | 3300006195 | Bacteria | 3211 |
| 210 | Ga0075366_10030092 | 3300006195 | Bacteria | 3191 |
| 211 | Ga0075366_10053809 | 3300006195 | Bacteria | 2391 |
| 212 | Ga0075366_10063373 | 3300006195 | Bacteria | 2197 |
| 213 | Ga0075366_10088325 | 3300006195 | Bacteria | 1856 |
| 214 | Ga0075366_10105887 | 3300006195 | Bacteria | 1691 |
| 215 | Ga0075366_10141305 | 3300006195 | Bacteria | 1456 |
| 216 | Ga0075366_10194498 | 3300006195 | Bacteria | 1233 |
| 217 | Ga0075366_10325805 | 3300006195 | Bacteria | 941 |
| 218 | Ga0075366_10326259 | 3300006195 | Bacteria | 941 |
| 219 | Ga0075366_10342530 | 3300006195 | Bacteria | 917 |
| 220 | Ga0075366_10362715 | 3300006195 | Bacteria | 890 |
| 221 | Ga0097621_100669246 | 3300006237 | Bacteria | 954 |
| 222 | Ga0075370_10000340 | 3300006353 | Bacteria | 16849 |
| 223 | Ga0075370_10004393 | 3300006353 | Bacteria | 6839 |
| 224 | Ga0075370_10014349 | 3300006353 | Bacteria | 4224 |
| 225 | Ga0075370_10015657 | 3300006353 | Bacteria | 4065 |
| 226 | Ga0075370_10016575 | 3300006353 | Bacteria | 3966 |
| 227 | Ga0075370_10021748 | 3300006353 | Bacteria | 3515 |
| 228 | Ga0075370_10027748 | 3300006353 | Bacteria | 3144 |
| 229 | Ga0075370_10035475 | 3300006353 | Bacteria | 2799 |
| 230 | Ga0075370_10035897 | 3300006353 | Bacteria | 2783 |
| 231 | Ga0075370_10057161 | 3300006353 | Bacteria | 2217 |
| 232 | Ga0075370_10063856 | 3300006353 | Bacteria | 2099 |
| 233 | Ga0075370_10089692 | 3300006353 | Bacteria | 1773 |
| 234 | Ga0075370_10316080 | 3300006353 | Bacteria | 930 |
| 235 | Ga0075433_10014085 | 3300006852 | Bacteria | 6520 |
| 236 | Ga0075429_100003305 | 3300006880 | Bacteria | 13729 |
| 237 | Ga0075429_100144676 | 3300006880 | Bacteria | 2081 |
| 238 | Ga0068865_100148994 | 3300006881 | Bacteria | 1773 |
| 239 | Ga0068865_100710951 | 3300006881 | Bacteria | 859 |
| 240 | Ga0097620_100214679 | 3300006931 | Bacteria | 2011 |
| 241 | Ga0097620_100448755 | 3300006931 | Bacteria | 1386 |
| 242 | Ga0079104_1000025 | 3300006946 | Bacteria | 218785 |
| 243 | Ga0099826_10004782 | 3300006948 | Bacteria | 9564 |
| 244 | Ga0099826_10035017 | 3300006948 | Bacteria | 3576 |
| 245 | Ga0105250_10001558 | 3300009092 | Bacteria | 12319 |
| 246 | Ga0105240_10002847 | 3300009093 | Bacteria | 27330 |
| 247 | Ga0105240_10253253 | 3300009093 | Bacteria | 2035 |
| 248 | Ga0105240_10441232 | 3300009093 | Bacteria | 1459 |
| 249 | Ga0105240_10706803 | 3300009093 | Bacteria | 1100 |
| 250 | Ga0105240_11408337 | 3300009093 | Bacteria | 733 |
| 251 | Ga0105245_10142180 | 3300009098 | Bacteria | 2261 |
| 252 | Ga0105245_10169653 | 3300009098 | Bacteria | 2077 |
| 253 | Ga0105245_10571237 | 3300009098 | Bacteria | 1154 |
| 254 | Ga0114129_10597217 | 3300009147 | Bacteria | 1431 |
| 255 | Ga0105243_10001022 | 3300009148 | Bacteria | 25857 |
| 256 | Ga0105243_10003493 | 3300009148 | Bacteria | 12696 |
| 257 | Ga0105243_10104817 | 3300009148 | Bacteria | 2354 |
| 258 | Ga0105243_10117133 | 3300009148 | Bacteria | 2239 |
| 259 | Ga0105241_10347205 | 3300009174 | Bacteria | 1287 |
| 260 | Ga0105242_10337028 | 3300009176 | Bacteria | 1389 |
| 261 | Ga0105242_10398738 | 3300009176 | Bacteria | 1283 |
| 262 | Ga0105242_10406864 | 3300009176 | Bacteria | 1271 |
| 263 | Ga0105248_10002775 | 3300009177 | Bacteria | 19479 |
| 264 | Ga0105237_10017662 | 3300009545 | Bacteria | 7393 |
| 265 | Ga0105238_10097245 | 3300009551 | Bacteria | 2930 |
| 266 | Ga0105249_10504625 | 3300009553 | Bacteria | 1255 |
| 267 | Ga0105249_11252465 | 3300009553 | Bacteria | 813 |
| 268 | Ga0105239_10116457 | 3300010375 | Bacteria | 2965 |
| 269 | Ga0105239_10123828 | 3300010375 | Bacteria | 2872 |
| 270 | Ga0105239_10682831 | 3300010375 | Bacteria | 1174 |
| 271 | Ga0105246_10127800 | 3300011119 | Bacteria | 1894 |
| 272 | Ga0157373_10039046 | 3300013100 | Bacteria | 3400 |
| 273 | Ga0157373_10682842 | 3300013100 | Bacteria | 751 |
| 274 | Ga0157371_10031344 | 3300013102 | Bacteria | 3830 |
| 275 | Ga0157370_10870570 | 3300013104 | Bacteria | 818 |
| 276 | Ga0157374_10276013 | 3300013296 | Bacteria | 1658 |
| 277 | Ga0157374_11070683 | 3300013296 | Bacteria | 826 |
| 278 | Ga0157378_11023617 | 3300013297 | Bacteria | 861 |
| 279 | Ga0157378_11281888 | 3300013297 | Bacteria | 773 |
| 280 | Ga0163162_10241820 | 3300013306 | Bacteria | 1936 |
| 281 | Ga0163162_10526524 | 3300013306 | Bacteria | 1311 |
| 282 | Ga0163162_11010942 | 3300013306 | Bacteria | 940 |
| 283 | Ga0157372_11537264 | 3300013307 | Bacteria | 766 |
| 284 | Ga0157375_10385129 | 3300013308 | Bacteria | 1569 |
| 285 | Ga0182008_10003871 | 3300014497 | Bacteria | 8892 |
| 286 | Ga0182008_10017897 | 3300014497 | Bacteria | 3671 |
| 287 | Ga0157377_10000055 | 3300014745 | Bacteria | 88103 |
| 288 | Ga0157379_10149577 | 3300014968 | Bacteria | 2106 |
| 289 | Ga0157379_10266203 | 3300014968 | Bacteria | 1558 |
| 290 | Ga0157379_10342976 | 3300014968 | Bacteria | 1367 |
| 291 | Ga0157379_10517974 | 3300014968 | Bacteria | 1107 |
| 292 | Ga0157376_10010210 | 3300014969 | Bacteria | 6857 |
| 293 | Ga0157376_10020357 | 3300014969 | Bacteria | 5131 |
| 294 | Ga0157376_10996815 | 3300014969 | Bacteria | 860 |
| 295 | Ga0182007_10000539 | 3300015262 | Bacteria | 22341 |
| 296 | Ga0182007_10130798 | 3300015262 | Bacteria | 844 |
| 297 | Ga0182005_1022729 | 3300015265 | Bacteria | 1717 |
| 298 | Ga0163161_10024535 | 3300017792 | Bacteria | 4261 |
| 299 | Ga0163161_10042396 | 3300017792 | Bacteria | 3273 |
| 300 | Ga0163161_10044819 | 3300017792 | Bacteria | 3187 |
| 301 | Ga0163161_10065207 | 3300017792 | Bacteria | 2658 |
| 302 | Ga0163161_10297551 | 3300017792 | Bacteria | 1270 |
| 303 | Ga0206350_10885651 | 3300020080 | Bacteria | 1945 |
| 304 | Ga0213872_10000003 | 3300021361 | Bacteria | 366948 |
| 305 | Ga0213872_10000044 | 3300021361 | Bacteria | 114843 |
| 306 | Ga0213872_10000064 | 3300021361 | Bacteria | 97443 |
| 307 | Ga0213872_10000163 | 3300021361 | Bacteria | 61122 |
| 308 | Ga0213872_10076932 | 3300021361 | Bacteria | 1500 |
| 309 | Ga0224712_10002149 | 3300022467 | Bacteria | 4800 |
| 310 | Ga0209435_100001 | 3300025206 | Bacteria | 1424171 |
| 311 | Ga0209436_103103 | 3300025208 | Bacteria | 4568 |
| 312 | Ga0209436_105165 | 3300025208 | Bacteria | 3053 |
| 313 | Ga0209436_111682 | 3300025208 | Bacteria | 1529 |
| 314 | Ga0209672_101186 | 3300025228 | Bacteria | 10604 |
| 315 | Ga0209147_101683 | 3300025229 | Bacteria | 7234 |
| 316 | Ga0209563_100025 | 3300025230 | Bacteria | 596456 |
| 317 | Ga0209258_100225 | 3300025242 | Bacteria | 107138 |
| 318 | Ga0207425_1000530 | 3300025245 | Bacteria | 23292 |
| 319 | Ga0207425_1002265 | 3300025245 | Bacteria | 6940 |
| 320 | Ga0207425_1004703 | 3300025245 | Bacteria | 4030 |
| 321 | Ga0209646_1000001 | 3300025246 | Bacteria | 3092932 |
| 322 | Ga0209026_1000003 | 3300025250 | Bacteria | 1060571 |
| 323 | Ga0209148_1000040 | 3300025254 | Bacteria | 473531 |
| 324 | Ga0209759_1000001 | 3300025256 | Bacteria | 2799452 |
| 325 | Ga0209129_1000007 | 3300025258 | Bacteria | 771325 |
| 326 | Ga0209129_1002542 | 3300025258 | Bacteria | 8837 |
| 327 | Ga0209129_1004981 | 3300025258 | Bacteria | 4906 |
| 328 | Ga0209129_1006720 | 3300025258 | Bacteria | 3630 |
| 329 | Ga0209565_1000004 | 3300025263 | Bacteria | 983150 |
| 330 | Ga0209565_1000085 | 3300025263 | Bacteria | 153075 |
| 331 | Ga0209565_1000365 | 3300025263 | Bacteria | 38942 |
| 332 | Ga0209565_1000394 | 3300025263 | Bacteria | 36822 |
| 333 | Ga0209565_1005992 | 3300025263 | Bacteria | 3473 |
| 334 | Ga0209673_1000045 | 3300025273 | Bacteria | 290531 |
| 335 | Ga0209673_1000133 | 3300025273 | Bacteria | 161740 |
| 336 | Ga0209673_1000445 | 3300025273 | Bacteria | 70702 |
| 337 | Ga0209673_1002436 | 3300025273 | Bacteria | 12916 |
| 338 | Ga0209673_1006995 | 3300025273 | Bacteria | 5312 |
| 339 | Ga0209130_1000056 | 3300025284 | Bacteria | 210851 |
| 340 | Ga0209130_1000070 | 3300025284 | Bacteria | 179057 |
| 341 | Ga0209130_1000634 | 3300025284 | Bacteria | 33021 |
| 342 | Ga0209130_1001057 | 3300025284 | Bacteria | 20883 |
| 343 | Ga0209130_1014947 | 3300025284 | Bacteria | 1930 |
| 344 | Ga0209675_1000083 | 3300025291 | Bacteria | 153075 |
| 345 | Ga0209675_1000185 | 3300025291 | Bacteria | 68701 |
| 346 | Ga0209675_1000411 | 3300025291 | Bacteria | 35155 |
| 347 | Ga0209675_1001654 | 3300025291 | Bacteria | 12399 |
| 348 | Ga0209675_1002876 | 3300025291 | Bacteria | 8533 |
| 349 | Ga0209675_1003496 | 3300025291 | Bacteria | 7427 |
| 350 | Ga0209675_1011667 | 3300025291 | Bacteria | 2898 |
| 351 | Ga0209675_1024463 | 3300025291 | Bacteria | 1542 |
| 352 | Ga0209676_1000004 | 3300025292 | Bacteria | 1138360 |
| 353 | Ga0209676_1000007 | 3300025292 | Bacteria | 1029371 |
| 354 | Ga0209676_1006494 | 3300025292 | Bacteria | 5755 |
| 355 | Ga0209676_1009992 | 3300025292 | Bacteria | 4015 |
| 356 | Ga0209676_1020213 | 3300025292 | Bacteria | 2269 |
| 357 | Ga0209676_1022106 | 3300025292 | Bacteria | 2115 |
| 358 | Ga0209676_1025485 | 3300025292 | Bacteria | 1896 |
| 359 | Ga0209025_1000111 | 3300025294 | Bacteria | 218982 |
| 360 | Ga0209025_1000455 | 3300025294 | Bacteria | 79964 |
| 361 | Ga0209025_1000529 | 3300025294 | Bacteria | 72736 |
| 362 | Ga0209025_1003293 | 3300025294 | Bacteria | 15544 |
| 363 | Ga0209025_1007672 | 3300025294 | Bacteria | 7971 |
| 364 | Ga0209025_1013159 | 3300025294 | Bacteria | 5225 |
| 365 | Ga0209025_1014754 | 3300025294 | Bacteria | 4774 |
| 366 | Ga0209025_1034080 | 3300025294 | Bacteria | 2336 |
| 367 | Ga0209025_1040260 | 3300025294 | Bacteria | 2024 |
| 368 | Ga0209564_1000005 | 3300025295 | Bacteria | 1147192 |
| 369 | Ga0209564_1000153 | 3300025295 | Bacteria | 166910 |
| 370 | Ga0209564_1000337 | 3300025295 | Bacteria | 90545 |
| 371 | Ga0209564_1000772 | 3300025295 | Bacteria | 44476 |
| 372 | Ga0209564_1000962 | 3300025295 | Bacteria | 36603 |
| 373 | Ga0209564_1029151 | 3300025295 | Bacteria | 1745 |
| 374 | Ga0209758_1000025 | 3300025297 | Bacteria | 586687 |
| 375 | Ga0209758_1007230 | 3300025297 | Bacteria | 7641 |
| 376 | Ga0209758_1020573 | 3300025297 | Bacteria | 3114 |
| 377 | Ga0209758_1049373 | 3300025297 | Bacteria | 1486 |
| 378 | Ga0209050_1000002 | 3300025298 | Bacteria | 1792849 |
| 379 | Ga0209050_1000003 | 3300025298 | Bacteria | 1609245 |
| 380 | Ga0209050_1005366 | 3300025298 | Bacteria | 8100 |
| 381 | Ga0209050_1014719 | 3300025298 | Bacteria | 3344 |
| 382 | Ga0209050_1025986 | 3300025298 | Bacteria | 1973 |
| 383 | Ga0209256_1000001 | 3300025299 | Bacteria | 2166974 |
| 384 | Ga0209256_1000050 | 3300025299 | Bacteria | 308622 |
| 385 | Ga0209256_1000063 | 3300025299 | Bacteria | 252716 |
| 386 | Ga0207426_1000001 | 3300025302 | Bacteria | 1341301 |
| 387 | Ga0207426_1000025 | 3300025302 | Bacteria | 532921 |
| 388 | Ga0207426_1000028 | 3300025302 | Bacteria | 483955 |
| 389 | Ga0207426_1004695 | 3300025302 | Bacteria | 6545 |
| 390 | Ga0207426_1096965 | 3300025302 | Bacteria | 768 |
| 391 | Ga0209051_1000002 | 3300025303 | Bacteria | 1631846 |
| 392 | Ga0209051_1000003 | 3300025303 | Bacteria | 1609245 |
| 393 | Ga0209051_1000653 | 3300025303 | Bacteria | 39211 |
| 394 | Ga0209051_1003020 | 3300025303 | Bacteria | 11403 |
| 395 | Ga0209051_1005176 | 3300025303 | Bacteria | 7726 |
| 396 | Ga0209051_1008451 | 3300025303 | Bacteria | 5447 |
| 397 | Ga0209051_1079431 | 3300025303 | Bacteria | 952 |
| 398 | Ga0209257_1000002 | 3300025304 | Bacteria | 1767052 |
| 399 | Ga0209257_1000018 | 3300025304 | Bacteria | 836016 |
| 400 | Ga0209257_1000094 | 3300025304 | Bacteria | 262243 |
| 401 | Ga0209257_1001358 | 3300025304 | Bacteria | 29602 |
| 402 | Ga0209257_1003661 | 3300025304 | Bacteria | 12887 |
| 403 | Ga0209257_1016346 | 3300025304 | Bacteria | 3006 |
| 404 | Ga0209257_1024020 | 3300025304 | Bacteria | 2123 |
| 405 | Ga0207697_10089027 | 3300025315 | Bacteria | 1307 |
| 406 | Ga0207656_10160910 | 3300025321 | Bacteria | 1068 |
| 407 | Ga0207696_1014771 | 3300025711 | Bacteria | 2666 |
| 408 | Ga0207682_10004814 | 3300025893 | Bacteria | 5595 |
| 409 | Ga0207682_10018054 | 3300025893 | Bacteria | 2755 |
| 410 | Ga0207682_10130552 | 3300025893 | Bacteria | 1121 |
| 411 | Ga0207688_10192120 | 3300025901 | Bacteria | 1221 |
| 412 | Ga0207645_10034117 | 3300025907 | Bacteria | 3269 |
| 413 | Ga0207643_10118905 | 3300025908 | Bacteria | 1563 |
| 414 | Ga0207705_10470832 | 3300025909 | Bacteria | 975 |
| 415 | Ga0207705_10734690 | 3300025909 | Bacteria | 767 |
| 416 | Ga0207684_10003382 | 3300025910 | Bacteria | 15630 |
| 417 | Ga0207684_10294930 | 3300025910 | Bacteria | 1398 |
| 418 | Ga0207654_10681212 | 3300025911 | Bacteria | 738 |
| 419 | Ga0207707_10278387 | 3300025912 | Bacteria | 1449 |
| 420 | Ga0207695_10089619 | 3300025913 | Bacteria | 3093 |
| 421 | Ga0207695_10229914 | 3300025913 | Bacteria | 1759 |
| 422 | Ga0207695_10450756 | 3300025913 | Bacteria | 1170 |
| 423 | Ga0207695_10631781 | 3300025913 | Bacteria | 952 |
| 424 | Ga0207657_10192044 | 3300025919 | Bacteria | 1646 |
| 425 | Ga0207649_10087815 | 3300025920 | Bacteria | 2029 |
| 426 | Ga0207652_10065943 | 3300025921 | Bacteria | 3136 |
| 427 | Ga0207646_10228362 | 3300025922 | Bacteria | 1682 |
| 428 | Ga0207646_10239797 | 3300025922 | Unclassified | 1638 |
| 429 | Ga0207681_10041661 | 3300025923 | Bacteria | 3063 |
| 430 | Ga0207694_10491776 | 3300025924 | Bacteria | 1027 |
| 431 | Ga0207650_10187259 | 3300025925 | Bacteria | 1652 |
| 432 | Ga0207650_10205436 | 3300025925 | Bacteria | 1580 |
| 433 | Ga0207650_10720927 | 3300025925 | Bacteria | 843 |
| 434 | Ga0207659_10012775 | 3300025926 | Bacteria | 5360 |
| 435 | Ga0207659_10172205 | 3300025926 | Bacteria | 1708 |
| 436 | Ga0207687_10011980 | 3300025927 | Bacteria | 5671 |
| 437 | Ga0207687_10301119 | 3300025927 | Bacteria | 1292 |
| 438 | Ga0207687_10373784 | 3300025927 | Bacteria | 1166 |
| 439 | Ga0207687_10428532 | 3300025927 | Bacteria | 1093 |
| 440 | Ga0207664_10096770 | 3300025929 | Bacteria | 2431 |
| 441 | Ga0207644_10037459 | 3300025931 | Bacteria | 3412 |
| 442 | Ga0207644_10053981 | 3300025931 | Bacteria | 2893 |
| 443 | Ga0207644_10185710 | 3300025931 | Bacteria | 1632 |
| 444 | Ga0207690_10001069 | 3300025932 | Bacteria | 17533 |
| 445 | Ga0207690_10523913 | 3300025932 | Bacteria | 961 |
| 446 | Ga0207706_10008133 | 3300025933 | Bacteria | 9680 |
| 447 | Ga0207706_10015176 | 3300025933 | Bacteria | 6971 |
| 448 | Ga0207706_10227795 | 3300025933 | Bacteria | 1631 |
| 449 | Ga0207706_10825006 | 3300025933 | Bacteria | 787 |
| 450 | Ga0207709_10000170 | 3300025935 | Bacteria | 87011 |
| 451 | Ga0207709_10008589 | 3300025935 | Bacteria | 5641 |
| 452 | Ga0207709_10073192 | 3300025935 | Bacteria | 2182 |
| 453 | Ga0207709_10147514 | 3300025935 | Bacteria | 1625 |
| 454 | Ga0207669_10009564 | 3300025937 | Bacteria | 4626 |
| 455 | Ga0207669_10054346 | 3300025937 | Bacteria | 2418 |
| 456 | Ga0207669_10164339 | 3300025937 | Bacteria | 1572 |
| 457 | Ga0207704_10024047 | 3300025938 | Bacteria | 3295 |
| 458 | Ga0207704_10588143 | 3300025938 | Bacteria | 909 |
| 459 | Ga0207691_10001479 | 3300025940 | Bacteria | 23445 |
| 460 | Ga0207691_10012115 | 3300025940 | Bacteria | 8266 |
| 461 | Ga0207691_10193143 | 3300025940 | Bacteria | 1775 |
| 462 | Ga0207691_10244738 | 3300025940 | Bacteria | 1549 |
| 463 | Ga0207691_10330458 | 3300025940 | Bacteria | 1306 |
| 464 | Ga0207711_10145746 | 3300025941 | Bacteria | 2133 |
| 465 | Ga0207689_10011918 | 3300025942 | Bacteria | 7450 |
| 466 | Ga0207689_10065458 | 3300025942 | Bacteria | 2989 |
| 467 | Ga0207689_10070393 | 3300025942 | Bacteria | 2874 |
| 468 | Ga0207679_10184593 | 3300025945 | Bacteria | 1728 |
| 469 | Ga0207679_10351089 | 3300025945 | Bacteria | 1286 |
| 470 | Ga0207667_10151272 | 3300025949 | Bacteria | 2389 |
| 471 | Ga0207667_10428261 | 3300025949 | Bacteria | 1346 |
| 472 | Ga0207667_11049366 | 3300025949 | Bacteria | 800 |
| 473 | Ga0207651_10026540 | 3300025960 | Bacteria | 3621 |
| 474 | Ga0207651_10083778 | 3300025960 | Bacteria | 2307 |
| 475 | Ga0207651_10268445 | 3300025960 | Bacteria | 1404 |
| 476 | Ga0207712_10061159 | 3300025961 | Bacteria | 2672 |
| 477 | Ga0207712_10750084 | 3300025961 | Bacteria | 855 |
| 478 | Ga0207640_10130917 | 3300025981 | Bacteria | 1813 |
| 479 | Ga0207658_10001754 | 3300025986 | Bacteria | 16311 |
| 480 | Ga0207658_10070307 | 3300025986 | Bacteria | 2648 |
| 481 | Ga0207677_10031227 | 3300026023 | Bacteria | 3410 |
| 482 | Ga0207677_10078663 | 3300026023 | Bacteria | 2355 |
| 483 | Ga0207677_10288148 | 3300026023 | Bacteria | 1351 |
| 484 | Ga0207677_10378047 | 3300026023 | Bacteria | 1195 |
| 485 | Ga0207677_11078053 | 3300026023 | Bacteria | 731 |
| 486 | Ga0207703_10741925 | 3300026035 | Bacteria | 935 |
| 487 | Ga0207639_10005602 | 3300026041 | Bacteria | 8497 |
| 488 | Ga0207639_10278328 | 3300026041 | Bacteria | 1471 |
| 489 | Ga0207678_10010239 | 3300026067 | Bacteria | 8231 |
| 490 | Ga0207678_10029766 | 3300026067 | Bacteria | 4767 |
| 491 | Ga0207678_10427873 | 3300026067 | Bacteria | 1148 |
| 492 | Ga0207702_10041297 | 3300026078 | Bacteria | 3868 |
| 493 | Ga0207702_10273984 | 3300026078 | Bacteria | 1593 |
| 494 | Ga0207641_10103540 | 3300026088 | Bacteria | 2511 |
| 495 | Ga0207648_10004256 | 3300026089 | Bacteria | 14783 |
| 496 | Ga0207648_10004711 | 3300026089 | Bacteria | 13949 |
| 497 | Ga0207648_10010739 | 3300026089 | Bacteria | 8656 |
| 498 | Ga0207648_10029870 | 3300026089 | Bacteria | 4833 |
| 499 | Ga0207648_10045152 | 3300026089 | Bacteria | 3865 |
| 500 | Ga0207648_10061286 | 3300026089 | Bacteria | 3280 |
| 501 | Ga0207648_10902011 | 3300026089 | Bacteria | 826 |
| 502 | Ga0207676_10178109 | 3300026095 | Bacteria | 1859 |
| 503 | Ga0207676_10421095 | 3300026095 | Bacteria | 1252 |
| 504 | Ga0207674_10043824 | 3300026116 | Bacteria | 4611 |
| 505 | Ga0207674_10280884 | 3300026116 | Bacteria | 1613 |
| 506 | Ga0207674_11168596 | 3300026116 | Bacteria | 739 |
| 507 | Ga0207683_10443347 | 3300026121 | Bacteria | 1196 |
| 508 | Ga0207683_10829936 | 3300026121 | Bacteria | 858 |
| 509 | Ga0207698_10220121 | 3300026142 | Bacteria | 1715 |
| 510 | Ga0207698_10355755 | 3300026142 | Bacteria | 1385 |
| 511 | Ga0207698_10375955 | 3300026142 | Bacteria | 1350 |
| 512 | Ga0207698_10732009 | 3300026142 | Bacteria | 986 |
| 513 | Ga0207698_10964130 | 3300026142 | Bacteria | 862 |
| 514 | Ga0209281_1000007 | 3300027111 | Bacteria | 938265 |
| 515 | Ga0209371_1031130 | 3300027312 | Bacteria | 1161 |
| 516 | Ga0209996_1007609 | 3300027395 | Bacteria | 1413 |
| 517 | Ga0209968_1000412 | 3300027526 | Bacteria | 7007 |
| 518 | Ga0209999_1028184 | 3300027543 | Bacteria | 1041 |
| 519 | Ga0209970_1000478 | 3300027614 | Bacteria | 6827 |
| 520 | Ga0209282_1006184 | 3300027666 | Bacteria | 7419 |
| 521 | Ga0209282_1114443 | 3300027666 | Bacteria | 1362 |
| 522 | Ga0209971_1023181 | 3300027682 | Bacteria | 1480 |
| 523 | Ga0209966_1000040 | 3300027695 | Bacteria | 54404 |
| 524 | Ga0209974_10012044 | 3300027876 | Bacteria | 2896 |
| 525 | Ga0209974_10049704 | 3300027876 | Bacteria | 1407 |
| 526 | Ga0209974_10130739 | 3300027876 | Bacteria | 895 |
| 527 | Ga0207428_10386576 | 3300027907 | Bacteria | 1026 |
| 528 | Ga0268266_10425845 | 3300028379 | Bacteria | 1258 |
| 529 | Ga0268265_10027745 | 3300028380 | Bacteria | 4045 |
| 530 | Ga0268265_11115192 | 3300028380 | Bacteria | 784 |
| 531 | Ga0268264_10039869 | 3300028381 | Bacteria | 3880 |
| 532 | Ga0268264_10319517 | 3300028381 | Bacteria | 1467 |
| 533 | Ga0307517_10000052 | 3300028786 | Bacteria | 155904 |
| 534 | Ga0307515_10000022 | 3300028794 | Bacteria | 404064 |
| 535 | Ga0307515_10000428 | 3300028794 | Bacteria | 101247 |
| 536 | Ga0307515_10002861 | 3300028794 | Bacteria | 36711 |
| 537 | Ga0307515_10009473 | 3300028794 | Bacteria | 18820 |
| 538 | Ga0307515_10012346 | 3300028794 | Bacteria | 16075 |
| 539 | Ga0307515_10020511 | 3300028794 | Bacteria | 11783 |
| 540 | Ga0307515_10021948 | 3300028794 | Bacteria | 11287 |
| 541 | Ga0307515_10022871 | 3300028794 | Bacteria | 10995 |
| 542 | Ga0307515_10038241 | 3300028794 | Bacteria | 7684 |
| 543 | Ga0307515_10053977 | 3300028794 | Bacteria | 5911 |
| 544 | Ga0307515_10096158 | 3300028794 | Bacteria | 3636 |
| 545 | Ga0307515_10115958 | 3300028794 | Bacteria | 3079 |
| 546 | Ga0307515_10127462 | 3300028794 | Bacteria | 2831 |
| 547 | Ga0307515_10131159 | 3300028794 | Bacteria | 2759 |
| 548 | Ga0307515_10157684 | 3300028794 | Bacteria | 2333 |
| 549 | Ga0307515_10471766 | 3300028794 | Bacteria | 868 |
| 550 | Ga0268256_1028319 | 3300030500 | Bacteria | 1385 |
| 551 | Ga0307512_10047813 | 3300030522 | Bacteria | 3472 |
| 552 | Ga0307512_10233363 | 3300030522 | Bacteria | 942 |
| 553 | Ga0307512_10337723 | 3300030522 | Bacteria | 673 |
| 554 | Ga0316177_1092166 | 3300030731 | Bacteria | 3877 |
| 555 | Ga0314311_1139236 | 3300030733 | Bacteria | 10237 |
| 556 | Ga0316180_1077645 | 3300030736 | Bacteria | 2235 |
| 557 | Ga0316183_1002371 | 3300030742 | Bacteria | 3264 |
| 558 | Ga0316183_1154909 | 3300030742 | Bacteria | 825 |
| 559 | Ga0316181_1009854 | 3300030744 | Bacteria | 2866 |
| 560 | Ga0316181_1111584 | 3300030744 | Bacteria | 1670 |
| 561 | Ga0316182_1087061 | 3300030745 | Bacteria | 1242 |
| 562 | Ga0265332_10000033 | 3300031238 | Bacteria | 153334 |
| 563 | Ga0265328_10035265 | 3300031239 | Bacteria | 1850 |
| 564 | Ga0265328_10051830 | 3300031239 | Bacteria | 1507 |
| 565 | Ga0265331_10007350 | 3300031250 | Bacteria | 6382 |
| 566 | Ga0265327_10000043 | 3300031251 | Bacteria | 285108 |
| 567 | Ga0265327_10000689 | 3300031251 | Bacteria | 54050 |
| 568 | Ga0265327_10016727 | 3300031251 | Bacteria | 4639 |
| 569 | Ga0307513_10000010 | 3300031456 | Bacteria | 360812 |
| 570 | Ga0307513_10000121 | 3300031456 | Bacteria | 109551 |
| 571 | Ga0307513_10010831 | 3300031456 | Bacteria | 11389 |
| 572 | Ga0307513_10024262 | 3300031456 | Bacteria | 7058 |
| 573 | Ga0307513_10093400 | 3300031456 | Bacteria | 3058 |
| 574 | Ga0307513_10177467 | 3300031456 | Bacteria | 1998 |
| 575 | Ga0307513_10233189 | 3300031456 | Bacteria | 1652 |
| 576 | Ga0307509_10000180 | 3300031507 | Bacteria | 98647 |
| 577 | Ga0307509_10014553 | 3300031507 | Bacteria | 9241 |
| 578 | Ga0307509_10022019 | 3300031507 | Bacteria | 7195 |
| 579 | Ga0307509_10047940 | 3300031507 | Bacteria | 4592 |
| 580 | Ga0307509_10068505 | 3300031507 | Bacteria | 3714 |
| 581 | Ga0307509_10134541 | 3300031507 | Bacteria | 2420 |
| 582 | Ga0307509_10214152 | 3300031507 | Bacteria | 1748 |
| 583 | Ga0307509_10391022 | 3300031507 | Bacteria | 1100 |
| 584 | Ga0307408_100000068 | 3300031548 | Bacteria | 120700 |
| 585 | Ga0307408_100041773 | 3300031548 | Bacteria | 3253 |
| 586 | Ga0307408_100051392 | 3300031548 | Bacteria | 2968 |
| 587 | Ga0307408_100060884 | 3300031548 | Bacteria | 2753 |
| 588 | Ga0307408_100153651 | 3300031548 | Bacteria | 1819 |
| 589 | Ga0307408_100679971 | 3300031548 | Bacteria | 923 |
| 590 | Ga0307508_10000017 | 3300031616 | Bacteria | 203567 |
| 591 | Ga0307508_10021388 | 3300031616 | Bacteria | 5881 |
| 592 | Ga0307508_10045867 | 3300031616 | Bacteria | 3903 |
| 593 | Ga0307508_10172409 | 3300031616 | Bacteria | 1766 |
| 594 | Ga0307508_10322843 | 3300031616 | Bacteria | 1136 |
| 595 | Ga0307514_10000869 | 3300031649 | Bacteria | 47727 |
| 596 | Ga0307514_10003946 | 3300031649 | Bacteria | 13866 |
| 597 | Ga0307514_10017552 | 3300031649 | Bacteria | 5885 |
| 598 | Ga0307514_10065104 | 3300031649 | Bacteria | 2762 |
| 599 | Ga0265314_10038784 | 3300031711 | Bacteria | 3439 |
| 600 | Ga0307516_10000525 | 3300031730 | Bacteria | 51244 |
| 601 | Ga0307516_10002317 | 3300031730 | Bacteria | 25638 |
| 602 | Ga0307516_10004998 | 3300031730 | Bacteria | 16089 |
| 603 | Ga0307516_10012723 | 3300031730 | Bacteria | 9044 |
| 604 | Ga0307516_10037761 | 3300031730 | Bacteria | 4826 |
| 605 | Ga0307516_10047914 | 3300031730 | Bacteria | 4207 |
| 606 | Ga0307516_10301837 | 3300031730 | Bacteria | 1277 |
| 607 | Ga0307405_10011424 | 3300031731 | Bacteria | 4653 |
| 608 | Ga0307405_10148449 | 3300031731 | Bacteria | 1645 |
| 609 | Ga0307405_10249208 | 3300031731 | Bacteria | 1320 |
| 610 | Ga0307405_10370510 | 3300031731 | Bacteria | 1111 |
| 611 | Ga0307405_10466740 | 3300031731 | Bacteria | 1004 |
| 612 | Ga0307405_10723442 | 3300031731 | Bacteria | 827 |
| 613 | Ga0307413_10200729 | 3300031824 | Bacteria | 1440 |
| 614 | Ga0307413_10294029 | 3300031824 | Bacteria | 1228 |
| 615 | Ga0307413_11298326 | 3300031824 | Bacteria | 637 |
| 616 | Ga0307410_10004378 | 3300031852 | Bacteria | 7292 |
| 617 | Ga0307410_10119318 | 3300031852 | Bacteria | 1921 |
| 618 | Ga0307410_10281124 | 3300031852 | Bacteria | 1306 |
| 619 | Ga0307406_10000135 | 3300031901 | Bacteria | 43972 |
| 620 | Ga0307406_10001827 | 3300031901 | Bacteria | 11607 |
| 621 | Ga0307406_10005443 | 3300031901 | Bacteria | 6966 |
| 622 | Ga0307406_10119502 | 3300031901 | Bacteria | 1829 |
| 623 | Ga0307406_10270774 | 3300031901 | Bacteria | 1290 |
| 624 | Ga0307407_10007263 | 3300031903 | Bacteria | 5007 |
| 625 | Ga0307407_10103535 | 3300031903 | Bacteria | 1772 |
| 626 | Ga0307412_10024590 | 3300031911 | Bacteria | 3720 |
| 627 | Ga0307412_10042559 | 3300031911 | Bacteria | 2952 |
| 628 | Ga0307412_10081872 | 3300031911 | Bacteria | 2233 |
| 629 | Ga0307412_10174538 | 3300031911 | Bacteria | 1610 |
| 630 | Ga0307412_10944127 | 3300031911 | Bacteria | 759 |
| 631 | Ga0307409_100002830 | 3300031995 | Bacteria | 9173 |
| 632 | Ga0307409_100032289 | 3300031995 | Bacteria | 3794 |
| 633 | Ga0307409_100349231 | 3300031995 | Bacteria | 1395 |
| 634 | Ga0307409_100534658 | 3300031995 | Bacteria | 1148 |
| 635 | Ga0307416_100007284 | 3300032002 | Bacteria | 7017 |
| 636 | Ga0307416_100217996 | 3300032002 | Bacteria | 1827 |
| 637 | Ga0307416_100770241 | 3300032002 | Bacteria | 1056 |
| 638 | Ga0307416_100858262 | 3300032002 | Bacteria | 1006 |
| 639 | Ga0307416_101541060 | 3300032002 | Bacteria | 770 |
| 640 | Ga0307414_10302559 | 3300032004 | Bacteria | 1353 |
| 641 | Ga0307414_10960949 | 3300032004 | Bacteria | 785 |
| 642 | Ga0307411_10003656 | 3300032005 | Bacteria | 7197 |
| 643 | Ga0307411_10022245 | 3300032005 | Bacteria | 3728 |
| 644 | Ga0307411_10125955 | 3300032005 | Bacteria | 1863 |
| 645 | Ga0307411_10185912 | 3300032005 | Bacteria | 1582 |
| 646 | Ga0307411_10471918 | 3300032005 | Bacteria | 1054 |
| 647 | Ga0307507_10045759 | 3300033179 | Bacteria | 4300 |
| 648 | Ga0307507_10051383 | 3300033179 | Bacteria | 3968 |
| 649 | Ga0307510_10003830 | 3300033180 | Bacteria | 17622 |
| 650 | Ga0307510_10027563 | 3300033180 | Bacteria | 6507 |
| 651 | Ga0307510_10056376 | 3300033180 | Bacteria | 4093 |
| 652 | Ga0307510_10289848 | 3300033180 | Bacteria | 1103 |
| 653 | Ga0373948_0001130 | 3300034817 | Bacteria | 3609 |
| 654 | Ga0373959_0010699 | 3300034820 | Bacteria | 1608 |
| 655 | Ga0373951_0007149 | 3300035091 | Bacteria | 2539 |
| 656 | Ga0373932_0016625 | 3300035112 | Bacteria | 1879 |
| 657 | Ga0373932_0117784 | 3300035112 | Bacteria | 883 |
| 658 | Ga0373939_0000474 | 3300035114 | Bacteria | 10142 |
| 659 | Ga0373954_0063777 | 3300035118 | Bacteria | 1741 |
| 660 | Ga0373956_0000036 | 3300035119 | Bacteria | 43642 |
| 661 | Ga0373960_0008985 | 3300035121 | Bacteria | 2410 |
| 662 | Ga0373946_0105899 | 3300035171 | Bacteria | 1267 |
| 663 | Ga0373961_0008752 | 3300035241 | Bacteria | 2465 |
| 664 | Ga0373962_0021091 | 3300035242 | Bacteria | 1717 |
| 665 | Ga0373962_0056200 | 3300035242 | Bacteria | 1145 |
| 666 | Ga0373931_0026906 | 3300035691 | Bacteria | 2931 |
| 667 | Ga0373927_0000005 | 3300035695 | Bacteria | 221415 |
| 668 | Ga0373933_0003669 | 3300035724 | Bacteria | 8501 |
| 669 | Ga0373937_0083859 | 3300036401 | Bacteria | 2949 |
| 670 | Ga0373925_0072618 | 3300037068 | Bacteria | 2603 |
| 671 | Ga0395899_0029446 | 3300037312 | Bacteria | 4129 |
| 672 | Ga0395899_0047362 | 3300037312 | Bacteria | 3201 |
| 673 | Ga0395899_0109122 | 3300037312 | Bacteria | 1991 |
| 674 | Ga0395899_0538411 | 3300037312 | Bacteria | 752 |
| 675 | Ga0395900_0000046 | 3300037418 | Bacteria | 230114 |
| 676 | Ga0395900_0028766 | 3300037418 | Bacteria | 5697 |
| 677 | Ga0395900_0081609 | 3300037418 | Bacteria | 3322 |
| 678 | Ga0395900_0146577 | 3300037418 | Bacteria | 2413 |
| 679 | Ga0395900_0327536 | 3300037418 | Bacteria | 1510 |
| 680 | Ga0395898_0006527 | 3300037466 | Bacteria | 12459 |
| 681 | Ga0395898_0025414 | 3300037466 | Bacteria | 5967 |
| 682 | Ga0395898_0270869 | 3300037466 | Bacteria | 1619 |
| 683 | Ga0395905_0000766 | 3300037471 | Bacteria | 42342 |
| 684 | Ga0395905_0015449 | 3300037471 | Bacteria | 7258 |
| 685 | Ga0395905_0028165 | 3300037471 | Bacteria | 5295 |
| 686 | Ga0395905_0049363 | 3300037471 | Bacteria | 3943 |
| 687 | Ga0395905_0063205 | 3300037471 | Bacteria | 3463 |
| 688 | Ga0395905_0063315 | 3300037471 | Bacteria | 3460 |
| 689 | Ga0395905_0070092 | 3300037471 | Bacteria | 3284 |
| 690 | Ga0395905_0103004 | 3300037471 | Bacteria | 2680 |
| 691 | Ga0395905_0181049 | 3300037471 | Bacteria | 1978 |
| 692 | Ga0395905_0231019 | 3300037471 | Bacteria | 1729 |
| 693 | Ga0395905_0254731 | 3300037471 | Bacteria | 1639 |
| 694 | Ga0395905_0535299 | 3300037471 | Bacteria | 1072 |
| 695 | Ga0395901_0030760 | 3300038443 | Bacteria | 5532 |
| 696 | Ga0395901_0124753 | 3300038443 | Bacteria | 2705 |
| 697 | Ga0395901_0156605 | 3300038443 | Bacteria | 2393 |
| 698 | Ga0395901_0212438 | 3300038443 | Bacteria | 2024 |
| 699 | Ga0395901_0292465 | 3300038443 | Bacteria | 1690 |
| 700 | Ga0395901_0372685 | 3300038443 | Bacteria | 1470 |
| 701 | Ga0395901_0653880 | 3300038443 | Bacteria | 1054 |
| 702 | Ga0400490_05408 | 3300038726 | Bacteria | 14275 |
| 703 | Ga0400486_06505 | 3300038742 | Bacteria | 21133 |
| 704 | Ga0400483_120900 | 3300039062 | Bacteria | 1256 |
| 705 | Ga0436361_0163926 | 3300039447 | Bacteria | 22625 |
| 706 | Ga0436361_0657686 | 3300039447 | Bacteria | 74387 |
| 707 | Ga0436361_0886712 | 3300039447 | Bacteria | 114879 |
| 708 | Ga0436361_1061851 | 3300039447 | Bacteria | 60009 |
| 709 | Ga0436361_1215716 | 3300039447 | Bacteria | 7625 |
| 710 | Ga0439436_0000168 | 3300041404 | Bacteria | 15481 |
| 711 | Ga0439436_0000271 | 3300041404 | Bacteria | 12488 |
| 712 | Ga0439438_030265 | 3300041405 | Bacteria | 1444 |
| 713 | Ga0439447_019703 | 3300041407 | Bacteria | 1796 |
| 714 | Ga0439447_033049 | 3300041407 | Bacteria | 1291 |
| 715 | Ga0439461_0003984 | 3300041410 | Bacteria | 2451 |
| 716 | Ga0439461_0043794 | 3300041410 | Bacteria | 974 |
| 717 | Ga0439466_0006959 | 3300041411 | Bacteria | 4288 |
| 718 | Ga0439466_0011797 | 3300041411 | Bacteria | 3227 |
| 719 | Ga0439466_0059239 | 3300041411 | Bacteria | 1237 |
| 720 | Ga0439465_0004740 | 3300041413 | Bacteria | 4381 |
| 721 | Ga0439465_0032324 | 3300041413 | Bacteria | 1670 |
| 722 | Ga0451787_408354 | 3300041441 | Bacteria | 960 |
| 723 | Ga0451789_0115708 | 3300041443 | Bacteria | 1377 |
| 724 | Ga0451789_0257727 | 3300041443 | Bacteria | 801 |
| 725 | Ga0451789_1294079 | 3300041443 | Bacteria | 666 |
| 726 | Ga0451793_0622605 | 3300041452 | Bacteria | 723 |
| 727 | Ga0451793_0754529 | 3300041452 | Bacteria | 1636 |
| 728 | Ga0451797_1105889 | 3300041453 | Bacteria | 796 |
| 729 | Ga0451797_1374203 | 3300041453 | Bacteria | 798 |
| 730 | Ga0451804_1015395 | 3300041463 | Bacteria | 890 |
| 731 | Ga0451807_0207679 | 3300041486 | Bacteria | 2140 |
| 732 | Ga0451807_0709245 | 3300041486 | Bacteria | 1008 |
| 733 | Ga0451833_0337859 | 3300041491 | Bacteria | 1574 |
| 734 | Ga0451833_0357612 | 3300041491 | Bacteria | 1254 |
| 735 | Ga0451841_1115077 | 3300041498 | Bacteria | 650 |
| 736 | Ga0451841_1434301 | 3300041498 | Bacteria | 937 |
| 737 | Ga0451853_1417758 | 3300041512 | Bacteria | 1466 |
| 738 | Ga0439431_0002491 | 3300041997 | Bacteria | 4075 |
| 739 | Ga0439431_0015132 | 3300041997 | Bacteria | 1794 |
| 740 | Ga0439433_0003486 | 3300041999 | Bacteria | 3376 |
| 741 | Ga0439433_0014808 | 3300041999 | Bacteria | 1720 |
| 742 | Ga0439433_0016870 | 3300041999 | Bacteria | 1619 |
| 743 | Ga0439437_006661 | 3300042000 | Bacteria | 1280 |
| 744 | Ga0439437_020525 | 3300042000 | Bacteria | 798 |
| 745 | Ga0439441_037513 | 3300042001 | Bacteria | 961 |
| 746 | Ga0439441_080379 | 3300042001 | Bacteria | 709 |
| 747 | Ga0439445_0000101 | 3300042004 | Bacteria | 14009 |
| 748 | Ga0439432_000403 | 3300042006 | Bacteria | 16009 |
| 749 | Ga0439432_006778 | 3300042006 | Bacteria | 4076 |
| 750 | Ga0439449_0002611 | 3300042007 | Bacteria | 7021 |
| 751 | Ga0439449_0004558 | 3300042007 | Bacteria | 5355 |
| 752 | Ga0439449_0048086 | 3300042007 | Bacteria | 1579 |
| 753 | Ga0439449_0053123 | 3300042007 | Bacteria | 1498 |
| 754 | Ga0439452_001575 | 3300042010 | Bacteria | 9083 |
| 755 | Ga0439452_003824 | 3300042010 | Bacteria | 5171 |
| 756 | Ga0439455_0049163 | 3300042012 | Bacteria | 1098 |
| 757 | Ga0439457_011619 | 3300042014 | Bacteria | 1998 |
| 758 | Ga0439462_0004271 | 3300042015 | Bacteria | 3476 |
| 759 | Ga0439462_0009364 | 3300042015 | Bacteria | 2476 |
| 760 | Ga0439462_0060284 | 3300042015 | Bacteria | 1027 |
| 761 | Ga0450915_000412 | 3300042119 | Bacteria | 1515 |
| 762 | Ga0450921_002869 | 3300042123 | Bacteria | 1179 |
| 763 | Ga0450921_006250 | 3300042123 | Bacteria | 922 |
| 764 | Ga0450923_132748 | 3300042125 | Bacteria | 594 |
| 765 | Ga0450890_007246 | 3300042127 | Bacteria | 1416 |
| 766 | Ga0450897_001501 | 3300042128 | Bacteria | 1598 |
| 767 | Ga0450898_006886 | 3300042134 | Bacteria | 1757 |
| 768 | Ga0450904_021122 | 3300042139 | Bacteria | 661 |
| 769 | Ga0450906_007802 | 3300042145 | Bacteria | 2099 |
| 770 | Ga0450907_005115 | 3300042146 | Bacteria | 2224 |
| 771 | Ga0450910_008320 | 3300042147 | Bacteria | 1457 |
| 772 | Ga0450910_032418 | 3300042147 | Bacteria | 824 |
| 773 | Ga0439446_0010534 | 3300042156 | Bacteria | 2492 |
| 774 | Ga0439446_0028713 | 3300042156 | Bacteria | 1602 |
| 775 | Ga0439446_0054417 | 3300042156 | Bacteria | 1200 |
| 776 | Ga0439446_0165514 | 3300042156 | Bacteria | 733 |
| 777 | Ga0450908_002817 | 3300042184 | Bacteria | 3380 |
| 778 | Ga0450908_010910 | 3300042184 | Bacteria | 1669 |
| 779 | Ga0450908_024202 | 3300042184 | Bacteria | 1062 |
| 780 | Ga0450909_006970 | 3300042185 | Bacteria | 1631 |
| 781 | Ga0439434_0005859 | 3300042435 | Bacteria | 3592 |
| 782 | Ga0439434_0039391 | 3300042435 | Bacteria | 1450 |
| 783 | Ga0439435_0089923 | 3300042436 | Bacteria | 931 |
| 784 | Ga0439459_0004461 | 3300042438 | Bacteria | 2251 |
| 785 | Ga0439464_0021604 | 3300042439 | Bacteria | 1767 |
| 786 | Ga0439460_0014558 | 3300042461 | Bacteria | 2068 |
| 787 | Ga0450918_000258 | 3300042531 | Bacteria | 11913 |
| 788 | Ga0450893_0022948 | 3300042532 | Bacteria | 1083 |
| 789 | Ga0451577_0000142 | 3300042876 | Bacteria | 160598 |
| 790 | Ga0451577_0034474 | 3300042876 | Bacteria | 4562 |
| 791 | Ga0451577_0043363 | 3300042876 | Bacteria | 4029 |
| 792 | Ga0451577_0619466 | 3300042876 | Bacteria | 982 |
| 793 | Ga0451577_0748359 | 3300042876 | Bacteria | 884 |
| 794 | Ga0451577_0888545 | 3300042876 | Bacteria | 803 |
| 795 | Ga0451577_1130764 | 3300042876 | Bacteria | 700 |
| 796 | Ga0466969_0002791 | 3300044656 | Bacteria | 9332 |
| 797 | Ga0466969_0003266 | 3300044656 | Bacteria | 8619 |
| 798 | Ga0466969_0077129 | 3300044656 | Bacteria | 1595 |
| 799 | Ga0466972_0002267 | 3300044658 | Bacteria | 9455 |
| 800 | Ga0466972_0126829 | 3300044658 | Bacteria | 1202 |
| 801 | Ga0466972_0135029 | 3300044658 | Bacteria | 1161 |
| 802 | Ga0466972_0418832 | 3300044658 | Bacteria | 628 |
| 803 | Ga0453683_0003262 | 3300044673 | Bacteria | 12057 |
| 804 | Ga0453683_0227683 | 3300044673 | Bacteria | 1186 |
| 805 | Ga0466965_0015331 | 3300044683 | Bacteria | 3640 |
| 806 | Ga0466965_0085449 | 3300044683 | Bacteria | 1599 |
| 807 | Ga0466965_0122230 | 3300044683 | Bacteria | 1345 |
| 808 | Ga0466966_0003451 | 3300044684 | Bacteria | 10419 |
| 809 | Ga0466966_0032471 | 3300044684 | Bacteria | 3383 |
| 810 | Ga0466966_0131119 | 3300044684 | Bacteria | 1535 |
| 811 | Ga0466966_0424411 | 3300044684 | Bacteria | 799 |
| 812 | Ga0466961_0034555 | 3300044693 | Bacteria | 3245 |
| 813 | Ga0453684_0000126 | 3300044712 | Bacteria | 336395 |
| 814 | Ga0453684_0006580 | 3300044712 | Bacteria | 21987 |
| 815 | Ga0453684_0185189 | 3300044712 | Bacteria | 2441 |
| 816 | Ga0453684_0190345 | 3300044712 | Bacteria | 2401 |
| 817 | Ga0453684_0277181 | 3300044712 | Bacteria | 1914 |
| 818 | Ga0453684_0285841 | 3300044712 | Bacteria | 1879 |
| 819 | Ga0453684_1084309 | 3300044712 | Bacteria | 847 |
| 820 | Ga0466971_0020326 | 3300044719 | Bacteria | 2952 |
| 821 | Ga0466968_0003167 | 3300044735 | Bacteria | 6070 |
| 822 | Ga0466968_0049588 | 3300044735 | Bacteria | 1789 |
| 823 | Ga0466970_0395314 | 3300044765 | Bacteria | 788 |
| 824 | Ga0466957_0055801 | 3300044842 | Bacteria | 2414 |
| 825 | Ga0466957_0224614 | 3300044842 | Bacteria | 1241 |
| 826 | Ga0466959_0017917 | 3300045049 | Bacteria | 5195 |
| 827 | Ga0466959_0030003 | 3300045049 | Bacteria | 4028 |
| 828 | Ga0466959_0109517 | 3300045049 | Bacteria | 1972 |
| 829 | Ga0451576_0003200 | 3300045051 | Bacteria | 22845 |
| 830 | Ga0451576_0102005 | 3300045051 | Bacteria | 2984 |
| 831 | Ga0451576_0108769 | 3300045051 | Bacteria | 2885 |
| 832 | Ga0451576_0144753 | 3300045051 | Bacteria | 2478 |
| 833 | Ga0451576_0163553 | 3300045051 | Bacteria | 2322 |
| 834 | Ga0451576_0625731 | 3300045051 | Bacteria | 1131 |
| 835 | Ga0451576_1474007 | 3300045051 | Bacteria | 707 |
| 836 | Ga0495627_024136 | 3300046453 | Bacteria | 1984 |
| 837 | Ga0495592_0000542 | 3300046454 | Bacteria | 26890 |
| 838 | Ga0495592_0107932 | 3300046454 | Bacteria | 1974 |
| 839 | Ga0495590_0045336 | 3300046457 | Bacteria | 1534 |
| 840 | Ga0495629_0220833 | 3300046459 | Bacteria | 1307 |
| 841 | Ga0495629_0350512 | 3300046459 | Bacteria | 1007 |
| 842 | Ga0495638_0027431 | 3300046460 | Bacteria | 3686 |
| 843 | Ga0495638_0083003 | 3300046460 | Bacteria | 1942 |
| 844 | Ga0495641_0122185 | 3300046461 | Bacteria | 1162 |
| 845 | Ga0495650_0057968 | 3300046471 | Bacteria | 1565 |
| 846 | Ga0495650_0232266 | 3300046471 | Bacteria | 632 |
| 847 | Ga0495582_0216652 | 3300046473 | Bacteria | 1095 |
| 848 | Ga0495605_0075325 | 3300046474 | Bacteria | 1587 |
| 849 | Ga0495607_0000104 | 3300046501 | Bacteria | 89641 |
| 850 | Ga0495610_0022848 | 3300046512 | Bacteria | 3411 |
| 851 | Ga0495616_0001588 | 3300046513 | Bacteria | 15594 |
| 852 | Ga0495620_0021209 | 3300046515 | Bacteria | 3158 |
| 853 | Ga0495620_0164194 | 3300046515 | Bacteria | 862 |
| 854 | Ga0495620_0172871 | 3300046515 | Bacteria | 837 |
| 855 | Ga0495630_0018102 | 3300046517 | Bacteria | 5171 |
| 856 | Ga0495632_0016688 | 3300046519 | Bacteria | 4076 |
| 857 | Ga0495632_0037114 | 3300046519 | Bacteria | 2475 |
| 858 | Ga0495632_0173628 | 3300046519 | Bacteria | 989 |
| 859 | Ga0495637_0012385 | 3300046520 | Bacteria | 4079 |
| 860 | Ga0495637_0048343 | 3300046520 | Bacteria | 1792 |
| 861 | Ga0495643_0098704 | 3300046522 | Bacteria | 1499 |
| 862 | Ga0495648_0140457 | 3300046524 | Bacteria | 1272 |
| 863 | Ga0495663_0030403 | 3300046525 | Bacteria | 1600 |
| 864 | Ga0495663_0036184 | 3300046525 | Bacteria | 1485 |
| 865 | Ga0495642_0106865 | 3300046528 | Bacteria | 1194 |
| 866 | Ga0495654_0031744 | 3300046530 | Bacteria | 2680 |
| 867 | Ga0495654_0085535 | 3300046530 | Bacteria | 1471 |
| 868 | Ga0495586_0234582 | 3300046535 | Bacteria | 1045 |
| 869 | Ga0495598_0056598 | 3300046537 | Bacteria | 1197 |
| 870 | Ga0495621_0072853 | 3300046539 | Bacteria | 1269 |
| 871 | Ga0495621_0172642 | 3300046539 | Bacteria | 860 |
| 872 | Ga0495621_0204500 | 3300046539 | Bacteria | 795 |
| 873 | Ga0495621_0296408 | 3300046539 | Bacteria | 669 |
| 874 | Ga0495597_0006996 | 3300046542 | Bacteria | 5780 |
| 875 | Ga0495597_0011456 | 3300046542 | Bacteria | 4299 |
| 876 | Ga0495622_0096402 | 3300046557 | Bacteria | 1357 |
| 877 | Ga0495633_0176192 | 3300046558 | Bacteria | 985 |
| 878 | Ga0495656_0000075 | 3300046615 | Bacteria | 44355 |
| 879 | Ga0495668_0102701 | 3300046616 | Bacteria | 1564 |
| 880 | Ga0495668_0389651 | 3300046616 | Bacteria | 765 |
| 881 | Ga0495611_0020870 | 3300046648 | Bacteria | 2824 |
| 882 | Ga0495625_0000811 | 3300046660 | Bacteria | 43302 |
| 883 | Ga0495625_0005727 | 3300046660 | Bacteria | 11236 |
| 884 | Ga0495625_0006383 | 3300046660 | Bacteria | 10514 |
| 885 | Ga0495625_0025717 | 3300046660 | Bacteria | 4460 |
| 886 | Ga0495661_0161144 | 3300046665 | Bacteria | 1204 |
| 887 | Ga0495588_0037942 | 3300046674 | Bacteria | 2450 |
| 888 | Ga0495588_0195429 | 3300046674 | Bacteria | 1068 |
| 889 | Ga0495646_0041243 | 3300046680 | Bacteria | 2837 |
| 890 | Ga0495658_0064752 | 3300046683 | Bacteria | 2107 |
| 891 | Ga0495658_0245030 | 3300046683 | Bacteria | 1126 |
| 892 | Ga0495669_0149372 | 3300046684 | Bacteria | 1106 |
| 893 | Ga0495669_0376968 | 3300046684 | Bacteria | 686 |
| 894 | Ga0495613_0119004 | 3300046689 | Bacteria | 1898 |
| 895 | Ga0495670_0176854 | 3300046691 | Bacteria | 1125 |
| 896 | Ga0495670_0179599 | 3300046691 | Bacteria | 1117 |
| 897 | Ga0495671_0034019 | 3300046692 | Bacteria | 2594 |
| 898 | Ga0495649_0004026 | 3300046694 | Bacteria | 9679 |
| 899 | Ga0495600_0166072 | 3300046809 | Bacteria | 1426 |
| 900 | Ga0495660_0036857 | 3300046810 | Bacteria | 2726 |
| 901 | Ga0495660_0134110 | 3300046810 | Bacteria | 1239 |
| 902 | Ga0495660_0203165 | 3300046810 | Bacteria | 945 |
| 903 | Ga0495676_0012666 | 3300047321 | Bacteria | 7590 |
| 904 | Ga0495676_0013327 | 3300047321 | Bacteria | 7388 |
| 905 | Ga0495676_0610245 | 3300047321 | Bacteria | 710 |
| 906 | Ga0495683_0189780 | 3300047323 | Bacteria | 933 |
| 907 | Ga0495687_000232 | 3300047443 | Bacteria | 77572 |
| 908 | Ga0495687_042590 | 3300047443 | Bacteria | 1982 |
| 909 | Ga0495687_042591 | 3300047443 | Bacteria | 1982 |
| 910 | Ga0495677_0129611 | 3300047445 | Bacteria | 965 |
| 911 | Ga0495677_0158594 | 3300047445 | Bacteria | 873 |
| 912 | Ga0495686_0001800 | 3300047472 | Bacteria | 21696 |
| 913 | Ga0495686_0180542 | 3300047472 | Bacteria | 1223 |
| 914 | Ga0495686_0182770 | 3300047472 | Bacteria | 1214 |
| 915 | Ga0495686_0438635 | 3300047472 | Bacteria | 695 |
| 916 | Ga0495593_0007103 | 3300047673 | Bacteria | 6565 |
| 917 | Ga0495593_0024332 | 3300047673 | Bacteria | 3357 |
| 918 | Ga0495615_0027624 | 3300048090 | Bacteria | 1333 |
| 919 | Ga0495615_0030520 | 3300048090 | Bacteria | 1287 |
| 920 | Ga0495626_0036930 | 3300048091 | Bacteria | 2325 |
| 921 | Ga0495626_0102736 | 3300048091 | Bacteria | 1245 |
| 922 | Ga0495626_0144435 | 3300048091 | Bacteria | 1007 |
| 923 | Ga0496100_0634095 | 3300048903 | Bacteria | 831 |
| 924 | Ga0496101_0135784 | 3300048904 | Bacteria | 1871 |
| 925 | Ga0496101_0250344 | 3300048904 | Bacteria | 1380 |
| 926 | Ga0496101_0874784 | 3300048904 | Bacteria | 708 |
| 927 | Ga0496102_0003141 | 3300048905 | Bacteria | 14013 |
| 928 | Ga0496104_0806923 | 3300048907 | Bacteria | 844 |
| 929 | Ga0496105_0414311 | 3300048908 | Bacteria | 1068 |
| 930 | Ga0496106_0032663 | 3300048909 | Bacteria | 3882 |
| 931 | Ga0496106_1053740 | 3300048909 | Bacteria | 638 |
| 932 | Ga0496107_0208558 | 3300048910 | Bacteria | 1453 |
| 933 | Ga0496107_0567709 | 3300048910 | Bacteria | 840 |
| 934 | Ga0496108_0122184 | 3300048911 | Bacteria | 2234 |
| 935 | Ga0496109_0282174 | 3300048912 | Bacteria | 1565 |
| 936 | Ga0496109_0762741 | 3300048912 | Bacteria | 905 |
| 937 | Ga0496110_0049361 | 3300048913 | Bacteria | 3691 |
| 938 | Ga0496112_0088286 | 3300048915 | Bacteria | 3068 |
| 939 | Ga0496112_0737718 | 3300048915 | Bacteria | 912 |
| 940 | Ga0496113_0392990 | 3300048916 | Bacteria | 1113 |
| 941 | Ga0496117_0053691 | 3300048920 | Bacteria | 2829 |
| 942 | Ga0496117_0054270 | 3300048920 | Bacteria | 2808 |
| 943 | Ga0496118_0023589 | 3300048921 | Bacteria | 5339 |
| 944 | Ga0496118_0163086 | 3300048921 | Bacteria | 1375 |
| 945 | Ga0496118_0235335 | 3300048921 | Bacteria | 1053 |
| 946 | Ga0496121_0059956 | 3300048924 | Bacteria | 3134 |
| 947 | Ga0496121_0082583 | 3300048924 | Bacteria | 2539 |
| 948 | Ga0496121_0093571 | 3300048924 | Bacteria | 2339 |
| 949 | Ga0496121_0624240 | 3300048924 | Bacteria | 661 |
| 950 | Ga0496122_0007254 | 3300048925 | Bacteria | 12399 |
| 951 | Ga0496122_0169070 | 3300048925 | Bacteria | 1321 |
| 952 | Ga0496122_0302757 | 3300048925 | Bacteria | 861 |
| 953 | Ga0496123_0019596 | 3300048926 | Bacteria | 5329 |
| 954 | Ga0496123_0184818 | 3300048926 | Bacteria | 1084 |
| 955 | Ga0496123_0210948 | 3300048926 | Bacteria | 987 |
| 956 | Ga0496123_0307688 | 3300048926 | Bacteria | 753 |
| 957 | Ga0496123_0366102 | 3300048926 | Bacteria | 666 |
| 958 | Ga0496124_0000419 | 3300048927 | Bacteria | 76012 |
| 959 | Ga0496124_0010638 | 3300048927 | Bacteria | 9288 |
| 960 | Ga0496124_0030743 | 3300048927 | Bacteria | 4760 |
| 961 | Ga0496124_0043016 | 3300048927 | Bacteria | 3885 |
| 962 | Ga0496124_0063813 | 3300048927 | Bacteria | 3076 |
| 963 | Ga0496124_0268157 | 3300048927 | Bacteria | 1252 |
| 964 | Ga0496125_0000729 | 3300048928 | Bacteria | 54486 |
| 965 | Ga0496125_0007984 | 3300048928 | Bacteria | 11179 |
| 966 | Ga0496125_0009773 | 3300048928 | Bacteria | 9784 |
| 967 | Ga0496125_0149046 | 3300048928 | Bacteria | 1611 |
| 968 | Ga0496125_0218074 | 3300048928 | Bacteria | 1232 |
| 969 | Ga0496126_0011869 | 3300048929 | Bacteria | 8959 |
| 970 | Ga0496126_0137726 | 3300048929 | Bacteria | 2104 |
| 971 | Ga0496126_0533963 | 3300048929 | Bacteria | 933 |
| 972 | Ga0501031_0016869 | 3300049568 | Bacteria | 4742 |
| 973 | Ga0501032_0312990 | 3300049569 | Bacteria | 1014 |
| 974 | Ga0501033_0037738 | 3300049570 | Bacteria | 3615 |
| 975 | Ga0501034_0047142 | 3300049571 | Bacteria | 4353 |
| 976 | Ga0501034_0459620 | 3300049571 | Bacteria | 1190 |
| 977 | Ga0501038_0105036 | 3300049574 | Bacteria | 2347 |
| 978 | Ga0501038_0483931 | 3300049574 | Bacteria | 948 |
| 979 | Ga0501039_0192502 | 3300049575 | Bacteria | 1604 |
| 980 | Ga0501039_0509663 | 3300049575 | Bacteria | 945 |
| 981 | Ga0501043_0000010 | 3300049579 | Bacteria | 206374 |
| 982 | Ga0501043_0070521 | 3300049579 | Bacteria | 2745 |
| 983 | Ga0501043_0786944 | 3300049579 | Bacteria | 689 |
| 984 | Ga0501046_0000132 | 3300049580 | Bacteria | 79506 |
| 985 | Ga0501047_0000026 | 3300049581 | Bacteria | 225296 |
| 986 | Ga0501047_0043844 | 3300049581 | Bacteria | 4320 |
| 987 | Ga0501047_0108451 | 3300049581 | Bacteria | 2659 |
| 988 | Ga0501048_0002295 | 3300049582 | Bacteria | 14590 |
| 989 | Ga0501198_000021 | 3300049649 | Bacteria | 70854 |
| 990 | Ga0501206_005470 | 3300049653 | Bacteria | 1635 |
| 991 | Ga0501211_002920 | 3300049658 | Bacteria | 1785 |
| 992 | Ga0501222_000018 | 3300049662 | Bacteria | 71805 |
| 993 | Ga0501223_024920 | 3300049663 | Bacteria | 1163 |
| 994 | Ga0501223_044236 | 3300049663 | Bacteria | 864 |
| 995 | Ga0501227_040773 | 3300049665 | Bacteria | 1146 |
| 996 | Ga0501233_020618 | 3300049668 | Bacteria | 1408 |
| 997 | Ga0501249_011588 | 3300049679 | Bacteria | 1853 |
| 998 | Ga0501221_002783 | 3300049704 | Bacteria | 2877 |
| 999 | Ga0501229_015593 | 3300049706 | Bacteria | 986 |
| 1000 | Ga0501080_0311204 | 3300049742 | Bacteria | 1427 |
| 1001 | Ga0501262_000181 | 3300049759 | Bacteria | 7854 |
| 1002 | Ga0501262_010289 | 3300049759 | Bacteria | 1170 |
| 1003 | Ga0501265_006836 | 3300049762 | Bacteria | 1333 |
| 1004 | Ga0501266_003400 | 3300049763 | Bacteria | 1980 |
| 1005 | Ga0501267_000637 | 3300049764 | Bacteria | 2791 |
| 1006 | Ga0501268_006366 | 3300049765 | Bacteria | 1730 |
| 1007 | Ga0501269_002556 | 3300049766 | Bacteria | 2232 |
| 1008 | Ga0501272_001061 | 3300049769 | Bacteria | 2533 |
| 1009 | Ga0501279_019949 | 3300049775 | Bacteria | 951 |
| 1010 | Ga0501035_0082387 | 3300049822 | Bacteria | 2839 |
| 1011 | Ga0501035_0203423 | 3300049822 | Bacteria | 1697 |
| 1012 | Ga0501035_0572226 | 3300049822 | Bacteria | 923 |
| 1013 | Ga0501044_0222559 | 3300049823 | Bacteria | 1837 |
| 1014 | Ga0501045_0064907 | 3300049824 | Bacteria | 2680 |
| 1015 | nmdc:mga03683_105766_c1 | 3300050489 | Bacteria | 1240 |
| 1016 | nmdc:mga03683_168245_c1 | 3300050489 | Bacteria | 995 |
| 1017 | nmdc:mga03683_28055_c1 | 3300050489 | Bacteria | 2235 |
| 1018 | nmdc:mga03683_4655_c1 | 3300050489 | Bacteria | 4570 |
| 1019 | nmdc:mga03683_80324_c1 | 3300050489 | Bacteria | 1407 |
| 1020 | nmdc:mga03n38_11104_c1 | 3300050490 | Bacteria | 3343 |
| 1021 | nmdc:mga03n38_14169_c1 | 3300050490 | Bacteria | 3049 |
| 1022 | nmdc:mga03n38_287493_c1 | 3300050490 | Bacteria | 879 |
| 1023 | nmdc:mga03n38_318641_c1 | 3300050490 | Bacteria | 839 |
| 1024 | nmdc:mga03n38_322053_c1 | 3300050490 | Bacteria | 835 |
| 1025 | nmdc:mga03n38_327336_c1 | 3300050490 | Bacteria | 829 |
| 1026 | nmdc:mga00v17_18255_c1 | 3300050491 | Bacteria | 3981 |
| 1027 | nmdc:mga00v17_21586_c1 | 3300050491 | Bacteria | 3703 |
| 1028 | nmdc:mga00v17_24625_c1 | 3300050491 | Bacteria | 3492 |
| 1029 | nmdc:mga00v17_26471_c1 | 3300050491 | Bacteria | 3380 |
| 1030 | nmdc:mga00v17_388190_c1 | 3300050491 | Bacteria | 907 |
| 1031 | nmdc:mga00v17_501477_c1 | 3300050491 | Bacteria | 787 |
| 1032 | nmdc:mga0yw44_520711_c1 | 3300050492 | Bacteria | 807 |
| 1033 | nmdc:mga0yw44_85613_c1 | 3300050492 | Bacteria | 1983 |
| 1034 | nmdc:mga0yw44_99857_c1 | 3300050492 | Bacteria | 1847 |
| 1035 | nmdc:mga0k408_10600_c1 | 3300050493 | Bacteria | 4990 |
| 1036 | nmdc:mga0k408_1468_c1 | 3300050493 | Bacteria | 12734 |
| 1037 | nmdc:mga0k408_20126_c1 | 3300050493 | Bacteria | 3735 |
| 1038 | nmdc:mga0k408_212002_c1 | 3300050493 | Bacteria | 1156 |
| 1039 | nmdc:mga0k408_27872_c1 | 3300050493 | Bacteria | 2643 |
| 1040 | nmdc:mga0k408_318795_c1 | 3300050493 | Bacteria | 927 |
| 1041 | nmdc:mga0k408_41035_c1 | 3300050493 | Bacteria | 2664 |
| 1042 | nmdc:mga0k408_41187_c1 | 3300050493 | Bacteria | 2659 |
| 1043 | nmdc:mga0k408_4551_c1 | 3300050493 | Bacteria | 7363 |
| 1044 | nmdc:mga0k408_4876_c1 | 3300050493 | Bacteria | 7117 |
| 1045 | nmdc:mga0k408_565556_c1 | 3300050493 | Bacteria | 672 |
| 1046 | nmdc:mga0k408_91449_c1 | 3300050493 | Bacteria | 1788 |
| 1047 | nmdc:mga06z11_154016_c1 | 3300050494 | Bacteria | 1309 |
| 1048 | nmdc:mga06z11_157361_c1 | 3300050494 | Bacteria | 1296 |
| 1049 | nmdc:mga06z11_18549_c1 | 3300050494 | Bacteria | 3180 |
| 1050 | nmdc:mga06z11_339670_c1 | 3300050494 | Bacteria | 898 |
| 1051 | nmdc:mga04h51_77083_c1 | 3300050495 | Bacteria | 1176 |
| 1052 | nmdc:mga07m45_151297_c1 | 3300050496 | Bacteria | 1346 |
| 1053 | nmdc:mga07m45_153943_c1 | 3300050496 | Bacteria | 1333 |
| 1054 | nmdc:mga07m45_15745_c1 | 3300050496 | Bacteria | 4041 |
| 1055 | nmdc:mga07m45_248009_c1 | 3300050496 | Bacteria | 1036 |
| 1056 | nmdc:mga07m45_33307_c1 | 3300050496 | Bacteria | 2861 |
| 1057 | nmdc:mga07m45_3337_c1 | 3300050496 | Bacteria | 7735 |
| 1058 | nmdc:mga07m45_336911_c1 | 3300050496 | Bacteria | 877 |
| 1059 | nmdc:mga07m45_429226_c1 | 3300050496 | Bacteria | 767 |
| 1060 | nmdc:mga07m45_7015_c1 | 3300050496 | Bacteria | 5730 |
| 1061 | nmdc:mga07m45_8540_c1 | 3300050496 | Bacteria | 5270 |
| 1062 | nmdc:mga07m45_880_c1 | 3300050496 | Bacteria | 13106 |
| 1063 | nmdc:mga07m45_9064_c1 | 3300050496 | Bacteria | 5142 |
| 1064 | nmdc:mga07m45_9089_c1 | 3300050496 | Bacteria | 5135 |
| 1065 | nmdc:mga07m45_94070_c1 | 3300050496 | Bacteria | 1718 |
| 1066 | nmdc:mga05p37_46673_c1 | 3300050507 | Bacteria | 5325 |
| 1067 | nmdc:mga09592_1237_c1 | 3300050508 | Bacteria | 20472 |
| 1068 | nmdc:mga09592_75745_c1 | 3300050508 | Bacteria | 2861 |
| 1069 | nmdc:mga0qj67_104256_c1 | 3300050509 | Bacteria | 2288 |
| 1070 | nmdc:mga06r32_337655_c1 | 3300050510 | Bacteria | 1491 |
| 1071 | nmdc:mga0a205_59811_c2 | 3300050515 | Bacteria | 1549 |
| 1072 | nmdc:mga0sz30_133398_c1 | 3300050516 | Bacteria | 1095 |
| 1073 | nmdc:mga0sz30_23985_c1 | 3300050516 | Bacteria | 2487 |
| 1074 | nmdc:mga0sz30_276988_c1 | 3300050516 | Bacteria | 747 |
| 1075 | nmdc:mga0sz30_296530_c1 | 3300050516 | Bacteria | 721 |
| 1076 | nmdc:mga0sz30_91096_c1 | 3300050516 | Bacteria | 1327 |
| 1077 | Ga0500610_0005460 | 3300053079 | Bacteria | 5212 |
| 1078 | Ga0500610_0009289 | 3300053079 | Bacteria | 4346 |
| 1079 | Ga0500643_004846 | 3300053087 | Bacteria | 5942 |
| 1080 | Ga0500644_0018748 | 3300053088 | Bacteria | 2032 |
| 1081 | Ga0500644_0113281 | 3300053088 | Bacteria | 1047 |
| 1082 | Ga0500644_0114356 | 3300053088 | Bacteria | 1043 |
| 1083 | Ga0500646_0195040 | 3300053090 | Bacteria | 692 |
| 1084 | Ga0500647_0229049 | 3300053091 | Bacteria | 828 |
| 1085 | Ga0500651_0049299 | 3300053093 | Bacteria | 2645 |
| 1086 | Ga0500566_0096110 | 3300053094 | Bacteria | 1631 |
| 1087 | Ga0500562_014934 | 3300053108 | Bacteria | 1990 |
| 1088 | Ga0500571_000080 | 3300053110 | Bacteria | 30359 |
| 1089 | Ga0500593_000694 | 3300053117 | Bacteria | 12808 |
| 1090 | Ga0500593_004435 | 3300053117 | Bacteria | 5431 |
| 1091 | Ga0500594_0003168 | 3300053118 | Bacteria | 3601 |
| 1092 | Ga0500594_0005379 | 3300053118 | Bacteria | 2838 |
| 1093 | Ga0500597_193218 | 3300053120 | Bacteria | 858 |
| 1094 | Ga0500607_010298 | 3300053121 | Bacteria | 5579 |
| 1095 | Ga0500607_017986 | 3300053121 | Bacteria | 4019 |
| 1096 | Ga0500608_037758 | 3300053122 | Bacteria | 2308 |
| 1097 | Ga0500608_045642 | 3300053122 | Bacteria | 2105 |
| 1098 | Ga0500608_096081 | 3300053122 | Bacteria | 1378 |
| 1099 | Ga0500618_024750 | 3300053125 | Bacteria | 1444 |
| 1100 | Ga0500626_152735 | 3300053128 | Bacteria | 957 |
| 1101 | Ga0500628_042312 | 3300053129 | Bacteria | 1046 |
| 1102 | Ga0500652_015873 | 3300053131 | Bacteria | 2729 |
| 1103 | Ga0500655_001531 | 3300053133 | Bacteria | 4376 |
| 1104 | Ga0500658_0000210 | 3300053134 | Bacteria | 27749 |
| 1105 | Ga0500658_0000493 | 3300053134 | Bacteria | 16873 |
| 1106 | Ga0500658_0044423 | 3300053134 | Bacteria | 1793 |
| 1107 | Ga0500658_0211496 | 3300053134 | Bacteria | 888 |
| 1108 | Ga0500559_0000986 | 3300053136 | Bacteria | 17748 |
| 1109 | Ga0500559_0010425 | 3300053136 | Bacteria | 3988 |
| 1110 | Ga0500561_0072104 | 3300053137 | Bacteria | 990 |
| 1111 | Ga0500564_018756 | 3300053138 | Bacteria | 3158 |
| 1112 | Ga0500568_0001699 | 3300053139 | Bacteria | 13727 |
| 1113 | Ga0500568_0076257 | 3300053139 | Bacteria | 1277 |
| 1114 | Ga0500574_054872 | 3300053141 | Bacteria | 1146 |
| 1115 | Ga0500590_053213 | 3300053148 | Bacteria | 2053 |
| 1116 | Ga0500604_0082388 | 3300053151 | Bacteria | 1041 |
| 1117 | Ga0500616_0031819 | 3300053153 | Bacteria | 2886 |
| 1118 | Ga0500619_000052 | 3300053154 | Bacteria | 35466 |
| 1119 | Ga0500622_0024965 | 3300053156 | Bacteria | 3159 |
| 1120 | Ga0500622_0043216 | 3300053156 | Bacteria | 2337 |
| 1121 | Ga0500627_0017357 | 3300053158 | Bacteria | 2826 |
| 1122 | Ga0500627_0054405 | 3300053158 | Bacteria | 1751 |
| 1123 | Ga0500634_0005197 | 3300053161 | Bacteria | 6145 |
| 1124 | Ga0500634_0006307 | 3300053161 | Bacteria | 5725 |
| 1125 | Ga0500645_000769 | 3300053730 | Bacteria | 19474 |
| 1126 | Ga0500645_007527 | 3300053730 | Bacteria | 3783 |
| 1127 | Ga0500645_012144 | 3300053730 | Bacteria | 2790 |
| 1128 | Ga0500645_031534 | 3300053730 | Bacteria | 1592 |
| 1129 | Ga0500565_001904 | 3300053734 | Bacteria | 1484 |
| 1130 | Ga0500587_002166 | 3300053739 | Bacteria | 2800 |
| 1131 | Ga0590071_003320 | 3300059421 | Bacteria | 3963 |
| 1132 | Ga0590074_001555 | 3300059423 | Bacteria | 3722 |
| 1133 | Ga0590075_026483 | 3300059424 | Bacteria | 1460 |
| 1134 | Ga0501082_0420838 | 3300060353 | Bacteria | 1167 |
| 1135 | Ga0466962_0002096 | 3300061719 | Bacteria | 9428 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300050516 | nmdc:mga0sz30_276988_c1 | nmdc:mga0sz30_276988_c1_225_731 | 156 |
| 2 | 3300005338 | Ga0068868_100109948 | Ga0068868_1001099482 | 169 |
| 3 | 3300006353 | Ga0075370_10316080 | Ga0075370_103160801 | 169 |
| 4 | 3300006880 | Ga0075429_100144676 | Ga0075429_1001446763 | 169 |
| 5 | 3300031548 | Ga0307408_100679971 | Ga0307408_1006799711 | 169 |
| 6 | 3300038726 | Ga0400490_05408 | Ga0400490_05408_12038_12553 | 169 |
| 7 | 3300038742 | Ga0400486_06505 | Ga0400486_06505_2905_3420 | 169 |
| 8 | 3300039062 | Ga0400483_120900 | Ga0400483_120900_492_1007 | 169 |
| 9 | 3300042125 | Ga0450923_132748 | Ga0450923_132748_58_573 | 169 |
| 10 | 3300045049 | Ga0466959_0109517 | Ga0466959_0109517_11_526 | 169 |
| 11 | 3300050515 | nmdc:mga0a205_59811_c2 | nmdc:mga0a205_59811_c2_626_1168 | 169 |
| 12 | 3300005564 | Ga0070664_100083036 | Ga0070664_1000830363 | 174 |
| 13 | 3300037471 | Ga0395905_0181049 | Ga0395905_0181049_583_1164 | 175 |
| 14 | 3300042876 | Ga0451577_1130764 | Ga0451577_1130764_10_573 | 175 |
| 15 | 3300042184 | Ga0450908_024202 | Ga0450908_024202_24_563 | 177 |
| 16 | 3300045051 | Ga0451576_0108769 | Ga0451576_0108769_561_1142 | 180 |
| 17 | 3300041498 | Ga0451841_1115077 | Ga0451841_1115077_75_626 | 183 |
| 18 | 3300041999 | Ga0439433_0016870 | Ga0439433_0016870_529_1119 | 184 |
| 19 | 3300042007 | Ga0439449_0053123 | Ga0439449_0053123_298_888 | 184 |
| 20 | 3300046459 | Ga0495629_0220833 | Ga0495629_0220833_721_1281 | 186 |
| 21 | 3300046473 | Ga0495582_0216652 | Ga0495582_0216652_492_1052 | 186 |
| 22 | 3300046517 | Ga0495630_0018102 | Ga0495630_0018102_884_1444 | 186 |
| 23 | 3300046557 | Ga0495622_0096402 | Ga0495622_0096402_68_628 | 186 |
| 24 | 3300046683 | Ga0495658_0064752 | Ga0495658_0064752_248_808 | 186 |
| 25 | 3300046689 | Ga0495613_0119004 | Ga0495613_0119004_938_1498 | 186 |
| 26 | 3300047321 | Ga0495676_0013327 | Ga0495676_0013327_4542_5102 | 186 |
| 27 | 3300047673 | Ga0495593_0024332 | Ga0495593_0024332_1887_2447 | 186 |
| 28 | 3300028794 | Ga0307515_10022871 | Ga0307515_100228713 | 187 |
| 29 | 3300031731 | Ga0307405_10148449 | Ga0307405_101484492 | 187 |
| 30 | 3300044673 | Ga0453683_0003262 | Ga0453683_0003262_907_1476 | 187 |
| 31 | 3300045051 | Ga0451576_0163553 | Ga0451576_0163553_1734_2303 | 187 |
| 32 | 3300005614 | Ga0068856_100153017 | Ga0068856_1001530173 | 188 |
| 33 | 3300026078 | Ga0207702_10041297 | Ga0207702_100412973 | 188 |
| 34 | iso_pu_bacteria | 2643221585 | 2643936129 | 189 |
| 35 | iso_pu_bacteria | 2643221639 | 2644217787 | 189 |
| 36 | iso_pu_bacteria | 2643221646 | 2644258473 | 189 |
| 37 | iso_pu_bacteria | 2643221656 | 2644316774 | 189 |
| 38 | iso_pu_bacteria | 2738541337 | 2739056850 | 189 |
| 39 | iso_pu_bacteria | 2831864461 | 2831868519 | 189 |
| 40 | iso_pu_bacteria | 2904479285 | 2904480735 | 190 |
| 41 | iso_pu_bacteria | 2643221654 | 2644304427 | 191 |
| 42 | iso_pu_bacteria | 2881101125 | 2881103223 | 191 |
| 43 | iso_pu_bacteria | 2939631187 | 2939636496 | 191 |
| 44 | 3300044712 | Ga0453684_0285841 | Ga0453684_0285841_1186_1764 | 192 |
| 45 | iso_pu_bacteria | 2511231002 | 2511245806 | 192 |
| 46 | iso_pu_bacteria | 2547132374 | 2548496968 | 192 |
| 47 | iso_pu_bacteria | 2599185214 | 2599623485 | 192 |
| 48 | iso_pu_bacteria | 2599185226 | 2599671897 | 192 |
| 49 | iso_pu_bacteria | 2599185227 | 2599681090 | 192 |
| 50 | iso_pu_bacteria | 2599185229 | 2599693506 | 192 |
| 51 | iso_pu_bacteria | 2643221570 | 2643864929 | 192 |
| 52 | iso_pu_bacteria | 2643221596 | 2643990408 | 192 |
| 53 | iso_pu_bacteria | 2643221628 | 2644160667 | 192 |
| 54 | iso_pu_bacteria | 2643221652 | 2644296050 | 192 |
| 55 | iso_pu_bacteria | 2643221660 | 2644340734 | 192 |
| 56 | iso_pu_bacteria | 2643221717 | 2644645528 | 192 |
| 57 | iso_pu_bacteria | 2721755523 | 2722882604 | 192 |
| 58 | iso_pu_bacteria | 2738541277 | 2738717566 | 192 |
| 59 | iso_pu_bacteria | 2738543013 | 2739250569 | 192 |
| 60 | iso_pu_bacteria | 2738543019 | 2739278252 | 192 |
| 61 | iso_pu_bacteria | 2818991446 | 2819597052 | 192 |
| 62 | iso_pu_bacteria | 2831265667 | 2831266171 | 192 |
| 63 | iso_pu_bacteria | 2838054893 | 2838057719 | 192 |
| 64 | iso_pu_bacteria | 2839138175 | 2839141132 | 192 |
| 65 | iso_pu_bacteria | 2842677519 | 2842678983 | 192 |
| 66 | iso_pu_bacteria | 2842718218 | 2842720015 | 192 |
| 67 | iso_pu_bacteria | 2885192300 | 2885192338 | 192 |
| 68 | iso_pu_bacteria | 2885198086 | 2885204287 | 192 |
| 69 | iso_pu_bacteria | 2885211737 | 2885217940 | 192 |
| 70 | iso_pu_bacteria | 2899924645 | 2899930207 | 192 |
| 71 | iso_pu_bacteria | 2904449895 | 2904456133 | 192 |
| 72 | iso_pu_bacteria | 2904456579 | 2904457683 | 192 |
| 73 | iso_pu_bacteria | 2904541872 | 2904543549 | 192 |
| 74 | iso_pu_bacteria | 2919462493 | 2919467475 | 192 |
| 75 | iso_pu_bacteria | 2928037797 | 2928039320 | 192 |
| 76 | iso_pu_bacteria | 2928044640 | 2928045075 | 192 |
| 77 | iso_pu_bacteria | 2928051484 | 2928052881 | 192 |
| 78 | iso_pu_bacteria | 2928064002 | 2928064448 | 192 |
| 79 | iso_pu_bacteria | 2928070936 | 2928071902 | 192 |
| 80 | iso_pu_bacteria | 2928084124 | 2928084161 | 192 |
| 81 | iso_pu_bacteria | 2928115317 | 2928115999 | 192 |
| 82 | iso_pu_bacteria | 2929160207 | 2929162916 | 192 |
| 83 | iso_pu_bacteria | 2929520902 | 2929527275 | 192 |
| 84 | iso_pu_bacteria | 2945945610 | 2945947584 | 192 |
| 85 | iso_pu_bacteria | 2945972063 | 2945977547 | 192 |
| 86 | iso_pu_bacteria | 2954767861 | 2954772569 | 192 |
| 87 | iso_pu_bacteria | 2974320154 | 2974323032 | 192 |
| 88 | iso_pu_bacteria | 2990710928 | 2990711930 | 192 |
| 89 | 3300003322 | rootL2_10092820 | rootL2_100928202 | 193 |
| 90 | 3300003323 | rootH1_10033192 | rootH1_1003319210 | 193 |
| 91 | 3300003759 | Ga0055525_1000013 | Ga0055525_1000013378 | 193 |
| 92 | 3300005337 | Ga0070682_100097617 | Ga0070682_1000976173 | 193 |
| 93 | 3300005344 | Ga0070661_100003164 | Ga0070661_1000031644 | 193 |
| 94 | 3300005366 | Ga0070659_100001056 | Ga0070659_10000105619 | 193 |
| 95 | 3300005564 | Ga0070664_100056396 | Ga0070664_1000563963 | 193 |
| 96 | 3300006195 | Ga0075366_10342530 | Ga0075366_103425301 | 193 |
| 97 | 3300006353 | Ga0075370_10000340 | Ga0075370_1000034010 | 193 |
| 98 | 3300006353 | Ga0075370_10015657 | Ga0075370_100156573 | 193 |
| 99 | 3300014969 | Ga0157376_10996815 | Ga0157376_109968151 | 193 |
| 100 | 3300021361 | Ga0213872_10000003 | Ga0213872_10000003248 | 193 |
| 101 | 3300021361 | Ga0213872_10000044 | Ga0213872_1000004426 | 193 |
| 102 | 3300021361 | Ga0213872_10000064 | Ga0213872_1000006420 | 193 |
| 103 | 3300021361 | Ga0213872_10000163 | Ga0213872_1000016344 | 193 |
| 104 | 3300021361 | Ga0213872_10076932 | Ga0213872_100769321 | 193 |
| 105 | 3300025230 | Ga0209563_100025 | Ga0209563_100025209 | 193 |
| 106 | 3300025273 | Ga0209673_1006995 | Ga0209673_10069953 | 193 |
| 107 | 3300025295 | Ga0209564_1000005 | Ga0209564_1000005144 | 193 |
| 108 | 3300025298 | Ga0209050_1005366 | Ga0209050_10053663 | 193 |
| 109 | 3300025303 | Ga0209051_1003020 | Ga0209051_10030205 | 193 |
| 110 | 3300025304 | Ga0209257_1000094 | Ga0209257_1000094121 | 193 |
| 111 | 3300025913 | Ga0207695_10631781 | Ga0207695_106317812 | 193 |
| 112 | 3300025919 | Ga0207657_10192044 | Ga0207657_101920442 | 193 |
| 113 | 3300025920 | Ga0207649_10087815 | Ga0207649_100878153 | 193 |
| 114 | 3300025932 | Ga0207690_10001069 | Ga0207690_100010693 | 193 |
| 115 | 3300025945 | Ga0207679_10184593 | Ga0207679_101845932 | 193 |
| 116 | 3300027312 | Ga0209371_1031130 | Ga0209371_10311302 | 193 |
| 117 | 3300028794 | Ga0307515_10020511 | Ga0307515_100205117 | 193 |
| 118 | 3300028794 | Ga0307515_10053977 | Ga0307515_100539773 | 193 |
| 119 | 3300030500 | Ga0268256_1028319 | Ga0268256_10283192 | 193 |
| 120 | 3300031239 | Ga0265328_10035265 | Ga0265328_100352653 | 193 |
| 121 | 3300031250 | Ga0265331_10007350 | Ga0265331_100073502 | 193 |
| 122 | 3300031251 | Ga0265327_10000043 | Ga0265327_10000043160 | 193 |
| 123 | 3300031507 | Ga0307509_10214152 | Ga0307509_102141523 | 193 |
| 124 | 3300031548 | Ga0307408_100041773 | Ga0307408_1000417733 | 193 |
| 125 | 3300031730 | Ga0307516_10000525 | Ga0307516_1000052553 | 193 |
| 126 | 3300031730 | Ga0307516_10002317 | Ga0307516_100023175 | 193 |
| 127 | 3300031911 | Ga0307412_10944127 | Ga0307412_109441271 | 193 |
| 128 | 3300032005 | Ga0307411_10003656 | Ga0307411_100036564 | 193 |
| 129 | 3300034817 | Ga0373948_0001130 | Ga0373948_0001130_1815_2396 | 193 |
| 130 | 3300035091 | Ga0373951_0007149 | Ga0373951_0007149_1042_1623 | 193 |
| 131 | 3300035114 | Ga0373939_0000474 | Ga0373939_0000474_6279_6860 | 193 |
| 132 | 3300035241 | Ga0373961_0008752 | Ga0373961_0008752_441_1022 | 193 |
| 133 | 3300035242 | Ga0373962_0021091 | Ga0373962_0021091_11_592 | 193 |
| 134 | 3300035691 | Ga0373931_0026906 | Ga0373931_0026906_442_1023 | 193 |
| 135 | 3300037471 | Ga0395905_0063205 | Ga0395905_0063205_1223_1804 | 193 |
| 136 | 3300039447 | Ga0436361_0163926 | Ga0436361_0163926_18999_19580 | 193 |
| 137 | 3300039447 | Ga0436361_0657686 | Ga0436361_0657686_45857_46438 | 193 |
| 138 | 3300039447 | Ga0436361_0886712 | Ga0436361_0886712_25815_26396 | 193 |
| 139 | 3300039447 | Ga0436361_1061851 | Ga0436361_1061851_36798_37379 | 193 |
| 140 | 3300039447 | Ga0436361_1215716 | Ga0436361_1215716_2526_3107 | 193 |
| 141 | 3300042119 | Ga0450915_000412 | Ga0450915_000412_114_701 | 193 |
| 142 | 3300042127 | Ga0450890_007246 | Ga0450890_007246_784_1371 | 193 |
| 143 | 3300042436 | Ga0439435_0089923 | Ga0439435_0089923_188_775 | 193 |
| 144 | 3300042438 | Ga0439459_0004461 | Ga0439459_0004461_1152_1739 | 193 |
| 145 | 3300044658 | Ga0466972_0126829 | Ga0466972_0126829_133_714 | 193 |
| 146 | 3300046691 | Ga0495670_0176854 | Ga0495670_0176854_365_952 | 193 |
| 147 | 3300048912 | Ga0496109_0762741 | Ga0496109_0762741_122_709 | 193 |
| 148 | 3300048927 | Ga0496124_0010638 | Ga0496124_0010638_7870_8457 | 193 |
| 149 | 3300048929 | Ga0496126_0137726 | Ga0496126_0137726_468_1055 | 193 |
| 150 | 3300049658 | Ga0501211_002920 | Ga0501211_002920_567_1148 | 193 |
| 151 | 3300049663 | Ga0501223_024920 | Ga0501223_024920_17_598 | 193 |
| 152 | 3300049665 | Ga0501227_040773 | Ga0501227_040773_69_650 | 193 |
| 153 | 3300049668 | Ga0501233_020618 | Ga0501233_020618_732_1313 | 193 |
| 154 | 3300049679 | Ga0501249_011588 | Ga0501249_011588_823_1404 | 193 |
| 155 | 3300049704 | Ga0501221_002783 | Ga0501221_002783_577_1158 | 193 |
| 156 | 3300049706 | Ga0501229_015593 | Ga0501229_015593_24_605 | 193 |
| 157 | 3300049759 | Ga0501262_010289 | Ga0501262_010289_541_1122 | 193 |
| 158 | 3300049762 | Ga0501265_006836 | Ga0501265_006836_497_1078 | 193 |
| 159 | 3300049764 | Ga0501267_000637 | Ga0501267_000637_1769_2350 | 193 |
| 160 | 3300049765 | Ga0501268_006366 | Ga0501268_006366_355_936 | 193 |
| 161 | 3300049766 | Ga0501269_002556 | Ga0501269_002556_726_1307 | 193 |
| 162 | 3300049769 | Ga0501272_001061 | Ga0501272_001061_1259_1840 | 193 |
| 163 | 3300049775 | Ga0501279_019949 | Ga0501279_019949_174_755 | 193 |
| 164 | 3300050496 | nmdc:mga07m45_248009_c1 | nmdc:mga07m45_248009_c1_139_720 | 193 |
| 165 | 3300050496 | nmdc:mga07m45_3337_c1 | nmdc:mga07m45_3337_c1_1878_2459 | 193 |
| 166 | 3300053137 | Ga0500561_0072104 | Ga0500561_0072104_114_695 | 193 |
| 167 | 3300053156 | Ga0500622_0024965 | Ga0500622_0024965_547_1134 | 193 |
| 168 | 3300053158 | Ga0500627_0054405 | Ga0500627_0054405_993_1574 | 193 |
| 169 | 3300059421 | Ga0590071_003320 | Ga0590071_003320_3260_3841 | 193 |
| 170 | 3300059423 | Ga0590074_001555 | Ga0590074_001555_2213_2794 | 193 |
| 171 | 3300059424 | Ga0590075_026483 | Ga0590075_026483_447_1028 | 193 |
| 172 | 3300005339 | Ga0070660_100879503 | Ga0070660_1008795031 | 194 |
| 173 | 3300005353 | Ga0070669_100029036 | Ga0070669_1000290364 | 194 |
| 174 | 3300005354 | Ga0070675_100177695 | Ga0070675_1001776953 | 194 |
| 175 | 3300005364 | Ga0070673_100060889 | Ga0070673_1000608892 | 194 |
| 176 | 3300005456 | Ga0070678_100130002 | Ga0070678_1001300022 | 194 |
| 177 | 3300006038 | Ga0075365_10038916 | Ga0075365_100389163 | 194 |
| 178 | 3300006042 | Ga0075368_10074866 | Ga0075368_100748662 | 194 |
| 179 | 3300006048 | Ga0075363_100099920 | Ga0075363_1000999203 | 194 |
| 180 | 3300006048 | Ga0075363_100497202 | Ga0075363_1004972021 | 194 |
| 181 | 3300006177 | Ga0075362_10087552 | Ga0075362_100875522 | 194 |
| 182 | 3300006195 | Ga0075366_10326259 | Ga0075366_103262592 | 194 |
| 183 | 3300025909 | Ga0207705_10470832 | Ga0207705_104708322 | 194 |
| 184 | 3300025932 | Ga0207690_10523913 | Ga0207690_105239131 | 194 |
| 185 | 3300025937 | Ga0207669_10164339 | Ga0207669_101643393 | 194 |
| 186 | 3300025960 | Ga0207651_10083778 | Ga0207651_100837782 | 194 |
| 187 | 3300028380 | Ga0268265_11115192 | Ga0268265_111151921 | 194 |
| 188 | 3300031711 | Ga0265314_10038784 | Ga0265314_100387844 | 194 |
| 189 | 3300044656 | Ga0466969_0077129 | Ga0466969_0077129_635_1219 | 194 |
| 190 | 3300044658 | Ga0466972_0418832 | Ga0466972_0418832_18_602 | 194 |
| 191 | 3300044684 | Ga0466966_0131119 | Ga0466966_0131119_709_1293 | 194 |
| 192 | 3300044684 | Ga0466966_0424411 | Ga0466966_0424411_121_705 | 194 |
| 193 | 3300044735 | Ga0466968_0003167 | Ga0466968_0003167_893_1477 | 194 |
| 194 | 3300044842 | Ga0466957_0224614 | Ga0466957_0224614_167_751 | 194 |
| 195 | 3300049571 | Ga0501034_0047142 | Ga0501034_0047142_3599_4189 | 194 |
| 196 | 3300049574 | Ga0501038_0483931 | Ga0501038_0483931_247_831 | 194 |
| 197 | 3300049575 | Ga0501039_0509663 | Ga0501039_0509663_88_672 | 194 |
| 198 | 3300049579 | Ga0501043_0070521 | Ga0501043_0070521_123_707 | 194 |
| 199 | 3300049581 | Ga0501047_0043844 | Ga0501047_0043844_1279_1863 | 194 |
| 200 | 3300049742 | Ga0501080_0311204 | Ga0501080_0311204_225_809 | 194 |
| 201 | 3300049822 | Ga0501035_0203423 | Ga0501035_0203423_994_1578 | 194 |
| 202 | 3300050494 | nmdc:mga06z11_154016_c1 | nmdc:mga06z11_154016_c1_479_1063 | 194 |
| 203 | 3300050495 | nmdc:mga04h51_77083_c1 | nmdc:mga04h51_77083_c1_29_613 | 194 |
| 204 | iso_pu_bacteria | 2643221609 | 2644062533 | 194 |
| 205 | iso_pu_bacteria | 2643221611 | 2644076436 | 194 |
| 206 | iso_pu_bacteria | 2816332133 | 2816474725 | 194 |
| 207 | iso_pu_bacteria | 2857576091 | 2857578402 | 194 |
| 208 | 3300003347 | JGI26128J50194_1001258 | JGI26128J50194_10012581 | 195 |
| 209 | 3300004803 | Ga0058862_10046891 | Ga0058862_100468913 | 195 |
| 210 | 3300005328 | Ga0070676_10003470 | Ga0070676_100034705 | 195 |
| 211 | 3300005328 | Ga0070676_10040798 | Ga0070676_100407983 | 195 |
| 212 | 3300005328 | Ga0070676_10060101 | Ga0070676_100601012 | 195 |
| 213 | 3300005331 | Ga0070670_100084096 | Ga0070670_1000840962 | 195 |
| 214 | 3300005331 | Ga0070670_100185094 | Ga0070670_1001850941 | 195 |
| 215 | 3300005331 | Ga0070670_100264501 | Ga0070670_1002645012 | 195 |
| 216 | 3300005333 | Ga0070677_10004753 | Ga0070677_100047532 | 195 |
| 217 | 3300005334 | Ga0068869_100008869 | Ga0068869_1000088695 | 195 |
| 218 | 3300005334 | Ga0068869_100162787 | Ga0068869_1001627872 | 195 |
| 219 | 3300005334 | Ga0068869_100780356 | Ga0068869_1007803562 | 195 |
| 220 | 3300005338 | Ga0068868_100020836 | Ga0068868_1000208365 | 195 |
| 221 | 3300005338 | Ga0068868_100025065 | Ga0068868_1000250654 | 195 |
| 222 | 3300005338 | Ga0068868_100052998 | Ga0068868_1000529982 | 195 |
| 223 | 3300005338 | Ga0068868_100427582 | Ga0068868_1004275822 | 195 |
| 224 | 3300005354 | Ga0070675_100007410 | Ga0070675_1000074105 | 195 |
| 225 | 3300005354 | Ga0070675_100018213 | Ga0070675_1000182132 | 195 |
| 226 | 3300005355 | Ga0070671_100003978 | Ga0070671_10000397810 | 195 |
| 227 | 3300005355 | Ga0070671_100022049 | Ga0070671_1000220493 | 195 |
| 228 | 3300005355 | Ga0070671_100077674 | Ga0070671_1000776743 | 195 |
| 229 | 3300005355 | Ga0070671_100451836 | Ga0070671_1004518362 | 195 |
| 230 | 3300005356 | Ga0070674_100001350 | Ga0070674_1000013504 | 195 |
| 231 | 3300005356 | Ga0070674_100005970 | Ga0070674_1000059706 | 195 |
| 232 | 3300005364 | Ga0070673_100002284 | Ga0070673_1000022843 | 195 |
| 233 | 3300005364 | Ga0070673_100018990 | Ga0070673_1000189904 | 195 |
| 234 | 3300005367 | Ga0070667_100000427 | Ga0070667_10000042735 | 195 |
| 235 | 3300005367 | Ga0070667_100135591 | Ga0070667_1001355912 | 195 |
| 236 | 3300005367 | Ga0070667_100301939 | Ga0070667_1003019392 | 195 |
| 237 | 3300005455 | Ga0070663_100014432 | Ga0070663_1000144321 | 195 |
| 238 | 3300005455 | Ga0070663_100408778 | Ga0070663_1004087782 | 195 |
| 239 | 3300005456 | Ga0070678_100306146 | Ga0070678_1003061461 | 195 |
| 240 | 3300005456 | Ga0070678_100649736 | Ga0070678_1006497361 | 195 |
| 241 | 3300005457 | Ga0070662_100007285 | Ga0070662_1000072853 | 195 |
| 242 | 3300005457 | Ga0070662_100015383 | Ga0070662_1000153837 | 195 |
| 243 | 3300005457 | Ga0070662_100811032 | Ga0070662_1008110321 | 195 |
| 244 | 3300005459 | Ga0068867_100000176 | Ga0068867_10000017610 | 195 |
| 245 | 3300005459 | Ga0068867_100002046 | Ga0068867_10000204613 | 195 |
| 246 | 3300005459 | Ga0068867_100021358 | Ga0068867_1000213582 | 195 |
| 247 | 3300005459 | Ga0068867_100041869 | Ga0068867_1000418693 | 195 |
| 248 | 3300005459 | Ga0068867_100065677 | Ga0068867_1000656773 | 195 |
| 249 | 3300005467 | Ga0070706_100000533 | Ga0070706_10000053318 | 195 |
| 250 | 3300005468 | Ga0070707_100003061 | Ga0070707_1000030614 | 195 |
| 251 | 3300005468 | Ga0070707_100285174 | Ga0070707_1002851741 | 195 |
| 252 | 3300005468 | Ga0070707_101128036 | Ga0070707_1011280361 | 195 |
| 253 | 3300005471 | Ga0070698_100147223 | Ga0070698_1001472233 | 195 |
| 254 | 3300005518 | Ga0070699_100466197 | Ga0070699_1004661972 | 195 |
| 255 | 3300005539 | Ga0068853_100158904 | Ga0068853_1001589042 | 195 |
| 256 | 3300005543 | Ga0070672_100000317 | Ga0070672_10000031710 | 195 |
| 257 | 3300005543 | Ga0070672_100011281 | Ga0070672_1000112813 | 195 |
| 258 | 3300005543 | Ga0070672_100212578 | Ga0070672_1002125783 | 195 |
| 259 | 3300005548 | Ga0070665_100221204 | Ga0070665_1002212042 | 195 |
| 260 | 3300005563 | Ga0068855_100526400 | Ga0068855_1005264002 | 195 |
| 261 | 3300005577 | Ga0068857_100016010 | Ga0068857_1000160102 | 195 |
| 262 | 3300005577 | Ga0068857_100279711 | Ga0068857_1002797112 | 195 |
| 263 | 3300005578 | Ga0068854_100406257 | Ga0068854_1004062572 | 195 |
| 264 | 3300005616 | Ga0068852_100036324 | Ga0068852_1000363242 | 195 |
| 265 | 3300005616 | Ga0068852_101011126 | Ga0068852_1010111262 | 195 |
| 266 | 3300005617 | Ga0068859_100214678 | Ga0068859_1002146783 | 195 |
| 267 | 3300005617 | Ga0068859_100448748 | Ga0068859_1004487482 | 195 |
| 268 | 3300005618 | Ga0068864_100107072 | Ga0068864_1001070722 | 195 |
| 269 | 3300005618 | Ga0068864_100552087 | Ga0068864_1005520871 | 195 |
| 270 | 3300005840 | Ga0068870_10129674 | Ga0068870_101296742 | 195 |
| 271 | 3300005841 | Ga0068863_100070689 | Ga0068863_1000706892 | 195 |
| 272 | 3300005841 | Ga0068863_100112570 | Ga0068863_1001125702 | 195 |
| 273 | 3300005841 | Ga0068863_100164624 | Ga0068863_1001646244 | 195 |
| 274 | 3300005842 | Ga0068858_101004194 | Ga0068858_1010041941 | 195 |
| 275 | 3300005843 | Ga0068860_100111478 | Ga0068860_1001114782 | 195 |
| 276 | 3300005843 | Ga0068860_100147016 | Ga0068860_1001470163 | 195 |
| 277 | 3300006038 | Ga0075365_10022086 | Ga0075365_100220864 | 195 |
| 278 | 3300006048 | Ga0075363_100018438 | Ga0075363_1000184383 | 195 |
| 279 | 3300006048 | Ga0075363_100047658 | Ga0075363_1000476581 | 195 |
| 280 | 3300006048 | Ga0075363_100319854 | Ga0075363_1003198542 | 195 |
| 281 | 3300006051 | Ga0075364_10031776 | Ga0075364_100317763 | 195 |
| 282 | 3300006177 | Ga0075362_10013562 | Ga0075362_100135622 | 195 |
| 283 | 3300006177 | Ga0075362_10054075 | Ga0075362_100540753 | 195 |
| 284 | 3300006178 | Ga0075367_10014302 | Ga0075367_100143022 | 195 |
| 285 | 3300006178 | Ga0075367_10022283 | Ga0075367_100222833 | 195 |
| 286 | 3300006178 | Ga0075367_10023123 | Ga0075367_100231233 | 195 |
| 287 | 3300006186 | Ga0075369_10029608 | Ga0075369_100296082 | 195 |
| 288 | 3300006195 | Ga0075366_10002632 | Ga0075366_100026324 | 195 |
| 289 | 3300006195 | Ga0075366_10003790 | Ga0075366_100037902 | 195 |
| 290 | 3300006195 | Ga0075366_10014189 | Ga0075366_100141892 | 195 |
| 291 | 3300006195 | Ga0075366_10030092 | Ga0075366_100300923 | 195 |
| 292 | 3300006195 | Ga0075366_10053809 | Ga0075366_100538092 | 195 |
| 293 | 3300006195 | Ga0075366_10105887 | Ga0075366_101058871 | 195 |
| 294 | 3300006195 | Ga0075366_10141305 | Ga0075366_101413053 | 195 |
| 295 | 3300006195 | Ga0075366_10325805 | Ga0075366_103258052 | 195 |
| 296 | 3300006195 | Ga0075366_10362715 | Ga0075366_103627151 | 195 |
| 297 | 3300006237 | Ga0097621_100669246 | Ga0097621_1006692462 | 195 |
| 298 | 3300006353 | Ga0075370_10014349 | Ga0075370_100143493 | 195 |
| 299 | 3300006353 | Ga0075370_10016575 | Ga0075370_100165753 | 195 |
| 300 | 3300006353 | Ga0075370_10021748 | Ga0075370_100217482 | 195 |
| 301 | 3300006353 | Ga0075370_10035897 | Ga0075370_100358973 | 195 |
| 302 | 3300006353 | Ga0075370_10089692 | Ga0075370_100896922 | 195 |
| 303 | 3300006852 | Ga0075433_10014085 | Ga0075433_100140858 | 195 |
| 304 | 3300006880 | Ga0075429_100003305 | Ga0075429_10000330514 | 195 |
| 305 | 3300006881 | Ga0068865_100148994 | Ga0068865_1001489942 | 195 |
| 306 | 3300006881 | Ga0068865_100710951 | Ga0068865_1007109512 | 195 |
| 307 | 3300006931 | Ga0097620_100214679 | Ga0097620_1002146793 | 195 |
| 308 | 3300006931 | Ga0097620_100448755 | Ga0097620_1004487552 | 195 |
| 309 | 3300006946 | Ga0079104_1000025 | Ga0079104_100002554 | 195 |
| 310 | 3300009092 | Ga0105250_10001558 | Ga0105250_100015583 | 195 |
| 311 | 3300009093 | Ga0105240_10253253 | Ga0105240_102532532 | 195 |
| 312 | 3300009093 | Ga0105240_10706803 | Ga0105240_107068032 | 195 |
| 313 | 3300009098 | Ga0105245_10142180 | Ga0105245_101421802 | 195 |
| 314 | 3300009098 | Ga0105245_10169653 | Ga0105245_101696532 | 195 |
| 315 | 3300009098 | Ga0105245_10571237 | Ga0105245_105712372 | 195 |
| 316 | 3300009148 | Ga0105243_10001022 | Ga0105243_1000102224 | 195 |
| 317 | 3300009148 | Ga0105243_10003493 | Ga0105243_100034938 | 195 |
| 318 | 3300009148 | Ga0105243_10117133 | Ga0105243_101171332 | 195 |
| 319 | 3300009174 | Ga0105241_10347205 | Ga0105241_103472052 | 195 |
| 320 | 3300009176 | Ga0105242_10406864 | Ga0105242_104068642 | 195 |
| 321 | 3300009545 | Ga0105237_10017662 | Ga0105237_100176628 | 195 |
| 322 | 3300009553 | Ga0105249_10504625 | Ga0105249_105046253 | 195 |
| 323 | 3300009553 | Ga0105249_11252465 | Ga0105249_112524652 | 195 |
| 324 | 3300010375 | Ga0105239_10116457 | Ga0105239_101164574 | 195 |
| 325 | 3300010375 | Ga0105239_10123828 | Ga0105239_101238283 | 195 |
| 326 | 3300011119 | Ga0105246_10127800 | Ga0105246_101278001 | 195 |
| 327 | 3300013296 | Ga0157374_10276013 | Ga0157374_102760132 | 195 |
| 328 | 3300013296 | Ga0157374_11070683 | Ga0157374_110706832 | 195 |
| 329 | 3300013297 | Ga0157378_11023617 | Ga0157378_110236171 | 195 |
| 330 | 3300013297 | Ga0157378_11281888 | Ga0157378_112818882 | 195 |
| 331 | 3300013306 | Ga0163162_10526524 | Ga0163162_105265241 | 195 |
| 332 | 3300013306 | Ga0163162_11010942 | Ga0163162_110109421 | 195 |
| 333 | 3300013308 | Ga0157375_10385129 | Ga0157375_103851292 | 195 |
| 334 | 3300014745 | Ga0157377_10000055 | Ga0157377_1000005519 | 195 |
| 335 | 3300014968 | Ga0157379_10149577 | Ga0157379_101495772 | 195 |
| 336 | 3300014968 | Ga0157379_10266203 | Ga0157379_102662032 | 195 |
| 337 | 3300014968 | Ga0157379_10342976 | Ga0157379_103429761 | 195 |
| 338 | 3300014968 | Ga0157379_10517974 | Ga0157379_105179742 | 195 |
| 339 | 3300014969 | Ga0157376_10010210 | Ga0157376_100102105 | 195 |
| 340 | 3300014969 | Ga0157376_10020357 | Ga0157376_100203576 | 195 |
| 341 | 3300017792 | Ga0163161_10042396 | Ga0163161_100423962 | 195 |
| 342 | 3300020080 | Ga0206350_10885651 | Ga0206350_108856512 | 195 |
| 343 | 3300022467 | Ga0224712_10002149 | Ga0224712_100021493 | 195 |
| 344 | 3300025303 | Ga0209051_1008451 | Ga0209051_10084512 | 195 |
| 345 | 3300025304 | Ga0209257_1024020 | Ga0209257_10240202 | 195 |
| 346 | 3300025315 | Ga0207697_10089027 | Ga0207697_100890272 | 195 |
| 347 | 3300025321 | Ga0207656_10160910 | Ga0207656_101609102 | 195 |
| 348 | 3300025711 | Ga0207696_1014771 | Ga0207696_10147713 | 195 |
| 349 | 3300025893 | Ga0207682_10004814 | Ga0207682_100048142 | 195 |
| 350 | 3300025893 | Ga0207682_10130552 | Ga0207682_101305521 | 195 |
| 351 | 3300025901 | Ga0207688_10192120 | Ga0207688_101921202 | 195 |
| 352 | 3300025907 | Ga0207645_10034117 | Ga0207645_100341173 | 195 |
| 353 | 3300025908 | Ga0207643_10118905 | Ga0207643_101189052 | 195 |
| 354 | 3300025909 | Ga0207705_10734690 | Ga0207705_107346902 | 195 |
| 355 | 3300025910 | Ga0207684_10003382 | Ga0207684_1000338214 | 195 |
| 356 | 3300025911 | Ga0207654_10681212 | Ga0207654_106812122 | 195 |
| 357 | 3300025913 | Ga0207695_10450756 | Ga0207695_104507562 | 195 |
| 358 | 3300025922 | Ga0207646_10239797 | Ga0207646_102397972 | 195 |
| 359 | 3300025923 | Ga0207681_10041661 | Ga0207681_100416613 | 195 |
| 360 | 3300025924 | Ga0207694_10491776 | Ga0207694_104917762 | 195 |
| 361 | 3300025925 | Ga0207650_10187259 | Ga0207650_101872592 | 195 |
| 362 | 3300025925 | Ga0207650_10205436 | Ga0207650_102054362 | 195 |
| 363 | 3300025925 | Ga0207650_10720927 | Ga0207650_107209271 | 195 |
| 364 | 3300025926 | Ga0207659_10012775 | Ga0207659_100127753 | 195 |
| 365 | 3300025926 | Ga0207659_10172205 | Ga0207659_101722051 | 195 |
| 366 | 3300025927 | Ga0207687_10011980 | Ga0207687_100119806 | 195 |
| 367 | 3300025927 | Ga0207687_10301119 | Ga0207687_103011192 | 195 |
| 368 | 3300025927 | Ga0207687_10373784 | Ga0207687_103737842 | 195 |
| 369 | 3300025927 | Ga0207687_10428532 | Ga0207687_104285322 | 195 |
| 370 | 3300025931 | Ga0207644_10053981 | Ga0207644_100539813 | 195 |
| 371 | 3300025931 | Ga0207644_10185710 | Ga0207644_101857102 | 195 |
| 372 | 3300025933 | Ga0207706_10008133 | Ga0207706_100081335 | 195 |
| 373 | 3300025933 | Ga0207706_10015176 | Ga0207706_100151763 | 195 |
| 374 | 3300025933 | Ga0207706_10825006 | Ga0207706_108250061 | 195 |
| 375 | 3300025935 | Ga0207709_10000170 | Ga0207709_1000017026 | 195 |
| 376 | 3300025935 | Ga0207709_10008589 | Ga0207709_100085893 | 195 |
| 377 | 3300025935 | Ga0207709_10073192 | Ga0207709_100731922 | 195 |
| 378 | 3300025935 | Ga0207709_10147514 | Ga0207709_101475141 | 195 |
| 379 | 3300025937 | Ga0207669_10009564 | Ga0207669_100095643 | 195 |
| 380 | 3300025937 | Ga0207669_10054346 | Ga0207669_100543463 | 195 |
| 381 | 3300025938 | Ga0207704_10024047 | Ga0207704_100240473 | 195 |
| 382 | 3300025938 | Ga0207704_10588143 | Ga0207704_105881431 | 195 |
| 383 | 3300025940 | Ga0207691_10001479 | Ga0207691_1000147910 | 195 |
| 384 | 3300025940 | Ga0207691_10012115 | Ga0207691_100121153 | 195 |
| 385 | 3300025940 | Ga0207691_10244738 | Ga0207691_102447381 | 195 |
| 386 | 3300025942 | Ga0207689_10011918 | Ga0207689_100119186 | 195 |
| 387 | 3300025942 | Ga0207689_10065458 | Ga0207689_100654582 | 195 |
| 388 | 3300025942 | Ga0207689_10070393 | Ga0207689_100703934 | 195 |
| 389 | 3300025945 | Ga0207679_10351089 | Ga0207679_103510892 | 195 |
| 390 | 3300025949 | Ga0207667_10428261 | Ga0207667_104282612 | 195 |
| 391 | 3300025960 | Ga0207651_10026540 | Ga0207651_100265401 | 195 |
| 392 | 3300025960 | Ga0207651_10268445 | Ga0207651_102684452 | 195 |
| 393 | 3300025961 | Ga0207712_10061159 | Ga0207712_100611592 | 195 |
| 394 | 3300025961 | Ga0207712_10750084 | Ga0207712_107500842 | 195 |
| 395 | 3300025981 | Ga0207640_10130917 | Ga0207640_101309173 | 195 |
| 396 | 3300025986 | Ga0207658_10001754 | Ga0207658_100017545 | 195 |
| 397 | 3300025986 | Ga0207658_10070307 | Ga0207658_100703072 | 195 |
| 398 | 3300026023 | Ga0207677_10031227 | Ga0207677_100312274 | 195 |
| 399 | 3300026023 | Ga0207677_10078663 | Ga0207677_100786633 | 195 |
| 400 | 3300026023 | Ga0207677_10288148 | Ga0207677_102881482 | 195 |
| 401 | 3300026023 | Ga0207677_10378047 | Ga0207677_103780472 | 195 |
| 402 | 3300026023 | Ga0207677_11078053 | Ga0207677_110780532 | 195 |
| 403 | 3300026035 | Ga0207703_10741925 | Ga0207703_107419252 | 195 |
| 404 | 3300026067 | Ga0207678_10010239 | Ga0207678_100102395 | 195 |
| 405 | 3300026067 | Ga0207678_10029766 | Ga0207678_100297668 | 195 |
| 406 | 3300026067 | Ga0207678_10427873 | Ga0207678_104278732 | 195 |
| 407 | 3300026078 | Ga0207702_10273984 | Ga0207702_102739842 | 195 |
| 408 | 3300026088 | Ga0207641_10103540 | Ga0207641_101035401 | 195 |
| 409 | 3300026089 | Ga0207648_10004256 | Ga0207648_100042564 | 195 |
| 410 | 3300026089 | Ga0207648_10004711 | Ga0207648_100047114 | 195 |
| 411 | 3300026089 | Ga0207648_10010739 | Ga0207648_100107395 | 195 |
| 412 | 3300026089 | Ga0207648_10029870 | Ga0207648_100298702 | 195 |
| 413 | 3300026089 | Ga0207648_10045152 | Ga0207648_100451523 | 195 |
| 414 | 3300026089 | Ga0207648_10061286 | Ga0207648_100612863 | 195 |
| 415 | 3300026089 | Ga0207648_10902011 | Ga0207648_109020112 | 195 |
| 416 | 3300026095 | Ga0207676_10421095 | Ga0207676_104210951 | 195 |
| 417 | 3300026116 | Ga0207674_10043824 | Ga0207674_100438243 | 195 |
| 418 | 3300026116 | Ga0207674_10280884 | Ga0207674_102808843 | 195 |
| 419 | 3300026121 | Ga0207683_10443347 | Ga0207683_104433472 | 195 |
| 420 | 3300026142 | Ga0207698_10220121 | Ga0207698_102201213 | 195 |
| 421 | 3300026142 | Ga0207698_10355755 | Ga0207698_103557551 | 195 |
| 422 | 3300026142 | Ga0207698_10732009 | Ga0207698_107320092 | 195 |
| 423 | 3300026142 | Ga0207698_10964130 | Ga0207698_109641302 | 195 |
| 424 | 3300027111 | Ga0209281_1000007 | Ga0209281_1000007167 | 195 |
| 425 | 3300027395 | Ga0209996_1007609 | Ga0209996_10076093 | 195 |
| 426 | 3300027526 | Ga0209968_1000412 | Ga0209968_10004123 | 195 |
| 427 | 3300027543 | Ga0209999_1028184 | Ga0209999_10281842 | 195 |
| 428 | 3300027682 | Ga0209971_1023181 | Ga0209971_10231812 | 195 |
| 429 | 3300027695 | Ga0209966_1000040 | Ga0209966_100004018 | 195 |
| 430 | 3300027876 | Ga0209974_10012044 | Ga0209974_100120442 | 195 |
| 431 | 3300028379 | Ga0268266_10425845 | Ga0268266_104258453 | 195 |
| 432 | 3300028381 | Ga0268264_10039869 | Ga0268264_100398693 | 195 |
| 433 | 3300028381 | Ga0268264_10319517 | Ga0268264_103195173 | 195 |
| 434 | 3300028786 | Ga0307517_10000052 | Ga0307517_10000052140 | 195 |
| 435 | 3300028794 | Ga0307515_10000022 | Ga0307515_1000002277 | 195 |
| 436 | 3300028794 | Ga0307515_10009473 | Ga0307515_1000947313 | 195 |
| 437 | 3300028794 | Ga0307515_10012346 | Ga0307515_100123463 | 195 |
| 438 | 3300028794 | Ga0307515_10021948 | Ga0307515_100219482 | 195 |
| 439 | 3300028794 | Ga0307515_10038241 | Ga0307515_100382416 | 195 |
| 440 | 3300028794 | Ga0307515_10096158 | Ga0307515_100961582 | 195 |
| 441 | 3300028794 | Ga0307515_10115958 | Ga0307515_101159583 | 195 |
| 442 | 3300028794 | Ga0307515_10127462 | Ga0307515_101274622 | 195 |
| 443 | 3300028794 | Ga0307515_10157684 | Ga0307515_101576843 | 195 |
| 444 | 3300028794 | Ga0307515_10471766 | Ga0307515_104717661 | 195 |
| 445 | 3300030522 | Ga0307512_10047813 | Ga0307512_100478132 | 195 |
| 446 | 3300030522 | Ga0307512_10337723 | Ga0307512_103377231 | 195 |
| 447 | 3300031456 | Ga0307513_10024262 | Ga0307513_100242626 | 195 |
| 448 | 3300031456 | Ga0307513_10177467 | Ga0307513_101774672 | 195 |
| 449 | 3300031456 | Ga0307513_10233189 | Ga0307513_102331893 | 195 |
| 450 | 3300031507 | Ga0307509_10000180 | Ga0307509_1000018035 | 195 |
| 451 | 3300031507 | Ga0307509_10014553 | Ga0307509_100145537 | 195 |
| 452 | 3300031507 | Ga0307509_10022019 | Ga0307509_100220192 | 195 |
| 453 | 3300031507 | Ga0307509_10047940 | Ga0307509_100479403 | 195 |
| 454 | 3300031507 | Ga0307509_10068505 | Ga0307509_100685053 | 195 |
| 455 | 3300031507 | Ga0307509_10134541 | Ga0307509_101345412 | 195 |
| 456 | 3300031507 | Ga0307509_10391022 | Ga0307509_103910222 | 195 |
| 457 | 3300031616 | Ga0307508_10000017 | Ga0307508_1000001786 | 195 |
| 458 | 3300031616 | Ga0307508_10021388 | Ga0307508_100213883 | 195 |
| 459 | 3300031616 | Ga0307508_10045867 | Ga0307508_100458674 | 195 |
| 460 | 3300031616 | Ga0307508_10172409 | Ga0307508_101724093 | 195 |
| 461 | 3300031616 | Ga0307508_10322843 | Ga0307508_103228432 | 195 |
| 462 | 3300031649 | Ga0307514_10003946 | Ga0307514_1000394610 | 195 |
| 463 | 3300031649 | Ga0307514_10065104 | Ga0307514_100651042 | 195 |
| 464 | 3300031730 | Ga0307516_10004998 | Ga0307516_1000499815 | 195 |
| 465 | 3300031730 | Ga0307516_10012723 | Ga0307516_100127239 | 195 |
| 466 | 3300031730 | Ga0307516_10037761 | Ga0307516_100377615 | 195 |
| 467 | 3300031731 | Ga0307405_10011424 | Ga0307405_100114242 | 195 |
| 468 | 3300031731 | Ga0307405_10723442 | Ga0307405_107234422 | 195 |
| 469 | 3300031852 | Ga0307410_10004378 | Ga0307410_100043786 | 195 |
| 470 | 3300031852 | Ga0307410_10119318 | Ga0307410_101193182 | 195 |
| 471 | 3300031852 | Ga0307410_10281124 | Ga0307410_102811242 | 195 |
| 472 | 3300031901 | Ga0307406_10001827 | Ga0307406_100018278 | 195 |
| 473 | 3300031903 | Ga0307407_10007263 | Ga0307407_100072632 | 195 |
| 474 | 3300031911 | Ga0307412_10024590 | Ga0307412_100245903 | 195 |
| 475 | 3300031911 | Ga0307412_10081872 | Ga0307412_100818722 | 195 |
| 476 | 3300031911 | Ga0307412_10174538 | Ga0307412_101745383 | 195 |
| 477 | 3300031995 | Ga0307409_100002830 | Ga0307409_1000028304 | 195 |
| 478 | 3300031995 | Ga0307409_100032289 | Ga0307409_1000322892 | 195 |
| 479 | 3300031995 | Ga0307409_100349231 | Ga0307409_1003492312 | 195 |
| 480 | 3300031995 | Ga0307409_100534658 | Ga0307409_1005346581 | 195 |
| 481 | 3300032002 | Ga0307416_100007284 | Ga0307416_1000072845 | 195 |
| 482 | 3300032002 | Ga0307416_100858262 | Ga0307416_1008582622 | 195 |
| 483 | 3300032002 | Ga0307416_101541060 | Ga0307416_1015410601 | 195 |
| 484 | 3300032005 | Ga0307411_10022245 | Ga0307411_100222453 | 195 |
| 485 | 3300033179 | Ga0307507_10045759 | Ga0307507_100457592 | 195 |
| 486 | 3300033179 | Ga0307507_10051383 | Ga0307507_100513834 | 195 |
| 487 | 3300033180 | Ga0307510_10003830 | Ga0307510_100038303 | 195 |
| 488 | 3300033180 | Ga0307510_10027563 | Ga0307510_100275635 | 195 |
| 489 | 3300033180 | Ga0307510_10056376 | Ga0307510_100563763 | 195 |
| 490 | 3300033180 | Ga0307510_10289848 | Ga0307510_102898482 | 195 |
| 491 | 3300034820 | Ga0373959_0010699 | Ga0373959_0010699_381_968 | 195 |
| 492 | 3300035112 | Ga0373932_0016625 | Ga0373932_0016625_257_844 | 195 |
| 493 | 3300035112 | Ga0373932_0117784 | Ga0373932_0117784_115_702 | 195 |
| 494 | 3300035118 | Ga0373954_0063777 | Ga0373954_0063777_1121_1720 | 195 |
| 495 | 3300035119 | Ga0373956_0000036 | Ga0373956_0000036_1819_2418 | 195 |
| 496 | 3300035121 | Ga0373960_0008985 | Ga0373960_0008985_1654_2241 | 195 |
| 497 | 3300035171 | Ga0373946_0105899 | Ga0373946_0105899_629_1216 | 195 |
| 498 | 3300035242 | Ga0373962_0056200 | Ga0373962_0056200_507_1094 | 195 |
| 499 | 3300035695 | Ga0373927_0000005 | Ga0373927_0000005_108576_109175 | 195 |
| 500 | 3300035724 | Ga0373933_0003669 | Ga0373933_0003669_6595_7194 | 195 |
| 501 | 3300036401 | Ga0373937_0083859 | Ga0373937_0083859_653_1240 | 195 |
| 502 | 3300037068 | Ga0373925_0072618 | Ga0373925_0072618_1918_2505 | 195 |
| 503 | 3300037312 | Ga0395899_0029446 | Ga0395899_0029446_2511_3104 | 195 |
| 504 | 3300037312 | Ga0395899_0047362 | Ga0395899_0047362_2558_3145 | 195 |
| 505 | 3300037312 | Ga0395899_0109122 | Ga0395899_0109122_44_631 | 195 |
| 506 | 3300037312 | Ga0395899_0538411 | Ga0395899_0538411_78_671 | 195 |
| 507 | 3300037418 | Ga0395900_0000046 | Ga0395900_0000046_172539_173126 | 195 |
| 508 | 3300037418 | Ga0395900_0028766 | Ga0395900_0028766_3330_3917 | 195 |
| 509 | 3300037418 | Ga0395900_0081609 | Ga0395900_0081609_1845_2438 | 195 |
| 510 | 3300037418 | Ga0395900_0146577 | Ga0395900_0146577_110_703 | 195 |
| 511 | 3300037418 | Ga0395900_0327536 | Ga0395900_0327536_448_1035 | 195 |
| 512 | 3300037466 | Ga0395898_0006527 | Ga0395898_0006527_1793_2380 | 195 |
| 513 | 3300037466 | Ga0395898_0025414 | Ga0395898_0025414_3248_3835 | 195 |
| 514 | 3300037466 | Ga0395898_0270869 | Ga0395898_0270869_761_1354 | 195 |
| 515 | 3300037471 | Ga0395905_0000766 | Ga0395905_0000766_11820_12407 | 195 |
| 516 | 3300037471 | Ga0395905_0015449 | Ga0395905_0015449_3767_4360 | 195 |
| 517 | 3300037471 | Ga0395905_0028165 | Ga0395905_0028165_1775_2362 | 195 |
| 518 | 3300037471 | Ga0395905_0049363 | Ga0395905_0049363_1954_2541 | 195 |
| 519 | 3300037471 | Ga0395905_0063315 | Ga0395905_0063315_935_1522 | 195 |
| 520 | 3300037471 | Ga0395905_0070092 | Ga0395905_0070092_2641_3228 | 195 |
| 521 | 3300037471 | Ga0395905_0103004 | Ga0395905_0103004_232_825 | 195 |
| 522 | 3300037471 | Ga0395905_0231019 | Ga0395905_0231019_790_1383 | 195 |
| 523 | 3300037471 | Ga0395905_0535299 | Ga0395905_0535299_318_905 | 195 |
| 524 | 3300038443 | Ga0395901_0030760 | Ga0395901_0030760_2958_3545 | 195 |
| 525 | 3300038443 | Ga0395901_0124753 | Ga0395901_0124753_1599_2186 | 195 |
| 526 | 3300038443 | Ga0395901_0212438 | Ga0395901_0212438_761_1354 | 195 |
| 527 | 3300038443 | Ga0395901_0292465 | Ga0395901_0292465_306_899 | 195 |
| 528 | 3300038443 | Ga0395901_0372685 | Ga0395901_0372685_843_1430 | 195 |
| 529 | 3300038443 | Ga0395901_0653880 | Ga0395901_0653880_353_940 | 195 |
| 530 | 3300041441 | Ga0451787_408354 | Ga0451787_408354_203_820 | 195 |
| 531 | 3300041452 | Ga0451793_0622605 | Ga0451793_0622605_81_668 | 195 |
| 532 | 3300041452 | Ga0451793_0754529 | Ga0451793_0754529_95_712 | 195 |
| 533 | 3300041486 | Ga0451807_0709245 | Ga0451807_0709245_218_805 | 195 |
| 534 | 3300041491 | Ga0451833_0337859 | Ga0451833_0337859_598_1215 | 195 |
| 535 | 3300041512 | Ga0451853_1417758 | Ga0451853_1417758_398_1015 | 195 |
| 536 | 3300042000 | Ga0439437_006661 | Ga0439437_006661_627_1220 | 195 |
| 537 | 3300042000 | Ga0439437_020525 | Ga0439437_020525_17_604 | 195 |
| 538 | 3300042001 | Ga0439441_037513 | Ga0439441_037513_101_694 | 195 |
| 539 | 3300042001 | Ga0439441_080379 | Ga0439441_080379_78_665 | 195 |
| 540 | 3300042012 | Ga0439455_0049163 | Ga0439455_0049163_332_919 | 195 |
| 541 | 3300042015 | Ga0439462_0060284 | Ga0439462_0060284_377_970 | 195 |
| 542 | 3300042123 | Ga0450921_002869 | Ga0450921_002869_111_704 | 195 |
| 543 | 3300042134 | Ga0450898_006886 | Ga0450898_006886_945_1538 | 195 |
| 544 | 3300042139 | Ga0450904_021122 | Ga0450904_021122_17_610 | 195 |
| 545 | 3300042156 | Ga0439446_0028713 | Ga0439446_0028713_63_656 | 195 |
| 546 | 3300042185 | Ga0450909_006970 | Ga0450909_006970_673_1266 | 195 |
| 547 | 3300042435 | Ga0439434_0005859 | Ga0439434_0005859_765_1358 | 195 |
| 548 | 3300042439 | Ga0439464_0021604 | Ga0439464_0021604_1077_1670 | 195 |
| 549 | 3300042461 | Ga0439460_0014558 | Ga0439460_0014558_235_828 | 195 |
| 550 | 3300042876 | Ga0451577_0034474 | Ga0451577_0034474_317_904 | 195 |
| 551 | 3300042876 | Ga0451577_0043363 | Ga0451577_0043363_2403_2990 | 195 |
| 552 | 3300042876 | Ga0451577_0888545 | Ga0451577_0888545_66_653 | 195 |
| 553 | 3300044656 | Ga0466969_0002791 | Ga0466969_0002791_6160_6747 | 195 |
| 554 | 3300044656 | Ga0466969_0003266 | Ga0466969_0003266_1164_1751 | 195 |
| 555 | 3300044658 | Ga0466972_0002267 | Ga0466972_0002267_999_1586 | 195 |
| 556 | 3300044658 | Ga0466972_0135029 | Ga0466972_0135029_553_1140 | 195 |
| 557 | 3300044683 | Ga0466965_0085449 | Ga0466965_0085449_756_1343 | 195 |
| 558 | 3300044683 | Ga0466965_0122230 | Ga0466965_0122230_192_779 | 195 |
| 559 | 3300044684 | Ga0466966_0003451 | Ga0466966_0003451_5953_6540 | 195 |
| 560 | 3300044684 | Ga0466966_0032471 | Ga0466966_0032471_1448_2035 | 195 |
| 561 | 3300044693 | Ga0466961_0034555 | Ga0466961_0034555_1219_1806 | 195 |
| 562 | 3300044712 | Ga0453684_0006580 | Ga0453684_0006580_17497_18087 | 195 |
| 563 | 3300044712 | Ga0453684_0185189 | Ga0453684_0185189_1122_1709 | 195 |
| 564 | 3300044712 | Ga0453684_0190345 | Ga0453684_0190345_617_1204 | 195 |
| 565 | 3300044712 | Ga0453684_0277181 | Ga0453684_0277181_1194_1781 | 195 |
| 566 | 3300044719 | Ga0466971_0020326 | Ga0466971_0020326_74_661 | 195 |
| 567 | 3300044735 | Ga0466968_0049588 | Ga0466968_0049588_870_1457 | 195 |
| 568 | 3300044765 | Ga0466970_0395314 | Ga0466970_0395314_111_698 | 195 |
| 569 | 3300044842 | Ga0466957_0055801 | Ga0466957_0055801_913_1500 | 195 |
| 570 | 3300045049 | Ga0466959_0017917 | Ga0466959_0017917_3389_3976 | 195 |
| 571 | 3300045049 | Ga0466959_0030003 | Ga0466959_0030003_1826_2413 | 195 |
| 572 | 3300045051 | Ga0451576_0102005 | Ga0451576_0102005_1321_1908 | 195 |
| 573 | 3300045051 | Ga0451576_0625731 | Ga0451576_0625731_392_979 | 195 |
| 574 | 3300046454 | Ga0495592_0000542 | Ga0495592_0000542_21601_22188 | 195 |
| 575 | 3300046454 | Ga0495592_0107932 | Ga0495592_0107932_430_1017 | 195 |
| 576 | 3300046457 | Ga0495590_0045336 | Ga0495590_0045336_222_809 | 195 |
| 577 | 3300046460 | Ga0495638_0083003 | Ga0495638_0083003_242_829 | 195 |
| 578 | 3300046461 | Ga0495641_0122185 | Ga0495641_0122185_14_601 | 195 |
| 579 | 3300046471 | Ga0495650_0057968 | Ga0495650_0057968_538_1143 | 195 |
| 580 | 3300046471 | Ga0495650_0232266 | Ga0495650_0232266_10_597 | 195 |
| 581 | 3300046474 | Ga0495605_0075325 | Ga0495605_0075325_116_703 | 195 |
| 582 | 3300046512 | Ga0495610_0022848 | Ga0495610_0022848_1741_2358 | 195 |
| 583 | 3300046515 | Ga0495620_0164194 | Ga0495620_0164194_49_636 | 195 |
| 584 | 3300046519 | Ga0495632_0016688 | Ga0495632_0016688_1683_2270 | 195 |
| 585 | 3300046519 | Ga0495632_0037114 | Ga0495632_0037114_1587_2204 | 195 |
| 586 | 3300046519 | Ga0495632_0173628 | Ga0495632_0173628_196_783 | 195 |
| 587 | 3300046524 | Ga0495648_0140457 | Ga0495648_0140457_328_915 | 195 |
| 588 | 3300046525 | Ga0495663_0030403 | Ga0495663_0030403_604_1191 | 195 |
| 589 | 3300046525 | Ga0495663_0036184 | Ga0495663_0036184_817_1404 | 195 |
| 590 | 3300046535 | Ga0495586_0234582 | Ga0495586_0234582_28_615 | 195 |
| 591 | 3300046539 | Ga0495621_0172642 | Ga0495621_0172642_247_840 | 195 |
| 592 | 3300046539 | Ga0495621_0296408 | Ga0495621_0296408_42_629 | 195 |
| 593 | 3300046542 | Ga0495597_0006996 | Ga0495597_0006996_966_1553 | 195 |
| 594 | 3300046542 | Ga0495597_0011456 | Ga0495597_0011456_2125_2712 | 195 |
| 595 | 3300046616 | Ga0495668_0102701 | Ga0495668_0102701_631_1218 | 195 |
| 596 | 3300046616 | Ga0495668_0389651 | Ga0495668_0389651_79_666 | 195 |
| 597 | 3300046648 | Ga0495611_0020870 | Ga0495611_0020870_2150_2737 | 195 |
| 598 | 3300046660 | Ga0495625_0005727 | Ga0495625_0005727_8559_9176 | 195 |
| 599 | 3300046660 | Ga0495625_0006383 | Ga0495625_0006383_2177_2764 | 195 |
| 600 | 3300046674 | Ga0495588_0037942 | Ga0495588_0037942_1061_1648 | 195 |
| 601 | 3300046680 | Ga0495646_0041243 | Ga0495646_0041243_1703_2290 | 195 |
| 602 | 3300046683 | Ga0495658_0245030 | Ga0495658_0245030_239_826 | 195 |
| 603 | 3300046684 | Ga0495669_0376968 | Ga0495669_0376968_80_667 | 195 |
| 604 | 3300046694 | Ga0495649_0004026 | Ga0495649_0004026_5002_5589 | 195 |
| 605 | 3300046810 | Ga0495660_0036857 | Ga0495660_0036857_908_1495 | 195 |
| 606 | 3300046810 | Ga0495660_0203165 | Ga0495660_0203165_207_794 | 195 |
| 607 | 3300047323 | Ga0495683_0189780 | Ga0495683_0189780_37_624 | 195 |
| 608 | 3300047443 | Ga0495687_000232 | Ga0495687_000232_17304_17891 | 195 |
| 609 | 3300047443 | Ga0495687_042590 | Ga0495687_042590_132_719 | 195 |
| 610 | 3300047443 | Ga0495687_042591 | Ga0495687_042591_1264_1851 | 195 |
| 611 | 3300047445 | Ga0495677_0129611 | Ga0495677_0129611_167_754 | 195 |
| 612 | 3300047445 | Ga0495677_0158594 | Ga0495677_0158594_64_651 | 195 |
| 613 | 3300047472 | Ga0495686_0180542 | Ga0495686_0180542_117_734 | 195 |
| 614 | 3300047472 | Ga0495686_0182770 | Ga0495686_0182770_173_760 | 195 |
| 615 | 3300047472 | Ga0495686_0438635 | Ga0495686_0438635_68_655 | 195 |
| 616 | 3300048090 | Ga0495615_0027624 | Ga0495615_0027624_237_824 | 195 |
| 617 | 3300048091 | Ga0495626_0036930 | Ga0495626_0036930_1252_1839 | 195 |
| 618 | 3300048091 | Ga0495626_0102736 | Ga0495626_0102736_409_996 | 195 |
| 619 | 3300048905 | Ga0496102_0003141 | Ga0496102_0003141_3170_3757 | 195 |
| 620 | 3300048908 | Ga0496105_0414311 | Ga0496105_0414311_24_611 | 195 |
| 621 | 3300048909 | Ga0496106_0032663 | Ga0496106_0032663_1352_1939 | 195 |
| 622 | 3300048910 | Ga0496107_0567709 | Ga0496107_0567709_21_608 | 195 |
| 623 | 3300048916 | Ga0496113_0392990 | Ga0496113_0392990_510_1097 | 195 |
| 624 | 3300048921 | Ga0496118_0235335 | Ga0496118_0235335_452_1039 | 195 |
| 625 | 3300048924 | Ga0496121_0082583 | Ga0496121_0082583_937_1524 | 195 |
| 626 | 3300048926 | Ga0496123_0307688 | Ga0496123_0307688_64_651 | 195 |
| 627 | 3300048927 | Ga0496124_0000419 | Ga0496124_0000419_53132_53719 | 195 |
| 628 | 3300048927 | Ga0496124_0043016 | Ga0496124_0043016_1428_2033 | 195 |
| 629 | 3300048928 | Ga0496125_0007984 | Ga0496125_0007984_5520_6107 | 195 |
| 630 | 3300048928 | Ga0496125_0149046 | Ga0496125_0149046_934_1521 | 195 |
| 631 | 3300048929 | Ga0496126_0533963 | Ga0496126_0533963_217_804 | 195 |
| 632 | 3300049569 | Ga0501032_0312990 | Ga0501032_0312990_14_607 | 195 |
| 633 | 3300049570 | Ga0501033_0037738 | Ga0501033_0037738_1499_2092 | 195 |
| 634 | 3300049571 | Ga0501034_0459620 | Ga0501034_0459620_198_791 | 195 |
| 635 | 3300049574 | Ga0501038_0105036 | Ga0501038_0105036_880_1473 | 195 |
| 636 | 3300049575 | Ga0501039_0192502 | Ga0501039_0192502_67_660 | 195 |
| 637 | 3300049579 | Ga0501043_0000010 | Ga0501043_0000010_164568_165155 | 195 |
| 638 | 3300049579 | Ga0501043_0786944 | Ga0501043_0786944_80_673 | 195 |
| 639 | 3300049580 | Ga0501046_0000132 | Ga0501046_0000132_18711_19298 | 195 |
| 640 | 3300049581 | Ga0501047_0000026 | Ga0501047_0000026_60201_60788 | 195 |
| 641 | 3300049581 | Ga0501047_0108451 | Ga0501047_0108451_1985_2578 | 195 |
| 642 | 3300049582 | Ga0501048_0002295 | Ga0501048_0002295_8266_8853 | 195 |
| 643 | 3300049649 | Ga0501198_000021 | Ga0501198_000021_703_1290 | 195 |
| 644 | 3300049653 | Ga0501206_005470 | Ga0501206_005470_651_1238 | 195 |
| 645 | 3300049662 | Ga0501222_000018 | Ga0501222_000018_69367_69954 | 195 |
| 646 | 3300049822 | Ga0501035_0082387 | Ga0501035_0082387_1609_2196 | 195 |
| 647 | 3300049822 | Ga0501035_0572226 | Ga0501035_0572226_229_816 | 195 |
| 648 | 3300049823 | Ga0501044_0222559 | Ga0501044_0222559_686_1279 | 195 |
| 649 | 3300049824 | Ga0501045_0064907 | Ga0501045_0064907_1411_1998 | 195 |
| 650 | 3300050489 | nmdc:mga03683_105766_c1 | nmdc:mga03683_105766_c1_111_704 | 195 |
| 651 | 3300050489 | nmdc:mga03683_28055_c1 | nmdc:mga03683_28055_c1_386_973 | 195 |
| 652 | 3300050490 | nmdc:mga03n38_11104_c1 | nmdc:mga03n38_11104_c1_677_1264 | 195 |
| 653 | 3300050490 | nmdc:mga03n38_327336_c1 | nmdc:mga03n38_327336_c1_71_658 | 195 |
| 654 | 3300050491 | nmdc:mga00v17_24625_c1 | nmdc:mga00v17_24625_c1_802_1389 | 195 |
| 655 | 3300050491 | nmdc:mga00v17_26471_c1 | nmdc:mga00v17_26471_c1_422_1009 | 195 |
| 656 | 3300050491 | nmdc:mga00v17_388190_c1 | nmdc:mga00v17_388190_c1_20_613 | 195 |
| 657 | 3300050492 | nmdc:mga0yw44_520711_c1 | nmdc:mga0yw44_520711_c1_85_678 | 195 |
| 658 | 3300050492 | nmdc:mga0yw44_85613_c1 | nmdc:mga0yw44_85613_c1_1141_1728 | 195 |
| 659 | 3300050493 | nmdc:mga0k408_10600_c1 | nmdc:mga0k408_10600_c1_2603_3190 | 195 |
| 660 | 3300050493 | nmdc:mga0k408_1468_c1 | nmdc:mga0k408_1468_c1_1368_1955 | 195 |
| 661 | 3300050493 | nmdc:mga0k408_20126_c1 | nmdc:mga0k408_20126_c1_1402_1989 | 195 |
| 662 | 3300050493 | nmdc:mga0k408_212002_c1 | nmdc:mga0k408_212002_c1_291_878 | 195 |
| 663 | 3300050493 | nmdc:mga0k408_318795_c1 | nmdc:mga0k408_318795_c1_82_669 | 195 |
| 664 | 3300050493 | nmdc:mga0k408_41035_c1 | nmdc:mga0k408_41035_c1_753_1340 | 195 |
| 665 | 3300050493 | nmdc:mga0k408_41187_c1 | nmdc:mga0k408_41187_c1_1931_2518 | 195 |
| 666 | 3300050493 | nmdc:mga0k408_4551_c1 | nmdc:mga0k408_4551_c1_5804_6391 | 195 |
| 667 | 3300050493 | nmdc:mga0k408_4876_c1 | nmdc:mga0k408_4876_c1_6059_6646 | 195 |
| 668 | 3300050493 | nmdc:mga0k408_565556_c1 | nmdc:mga0k408_565556_c1_72_659 | 195 |
| 669 | 3300050493 | nmdc:mga0k408_91449_c1 | nmdc:mga0k408_91449_c1_866_1483 | 195 |
| 670 | 3300050494 | nmdc:mga06z11_18549_c1 | nmdc:mga06z11_18549_c1_1841_2428 | 195 |
| 671 | 3300050494 | nmdc:mga06z11_339670_c1 | nmdc:mga06z11_339670_c1_201_788 | 195 |
| 672 | 3300050496 | nmdc:mga07m45_15745_c1 | nmdc:mga07m45_15745_c1_2128_2715 | 195 |
| 673 | 3300050496 | nmdc:mga07m45_429226_c1 | nmdc:mga07m45_429226_c1_72_659 | 195 |
| 674 | 3300050496 | nmdc:mga07m45_8540_c1 | nmdc:mga07m45_8540_c1_1673_2260 | 195 |
| 675 | 3300050496 | nmdc:mga07m45_880_c1 | nmdc:mga07m45_880_c1_5440_6027 | 195 |
| 676 | 3300050496 | nmdc:mga07m45_94070_c1 | nmdc:mga07m45_94070_c1_231_818 | 195 |
| 677 | 3300050507 | nmdc:mga05p37_46673_c1 | nmdc:mga05p37_46673_c1_868_1455 | 195 |
| 678 | 3300050508 | nmdc:mga09592_1237_c1 | nmdc:mga09592_1237_c1_680_1267 | 195 |
| 679 | 3300050508 | nmdc:mga09592_75745_c1 | nmdc:mga09592_75745_c1_693_1286 | 195 |
| 680 | 3300050509 | nmdc:mga0qj67_104256_c1 | nmdc:mga0qj67_104256_c1_907_1494 | 195 |
| 681 | 3300050510 | nmdc:mga06r32_337655_c1 | nmdc:mga06r32_337655_c1_881_1474 | 195 |
| 682 | 3300050516 | nmdc:mga0sz30_133398_c1 | nmdc:mga0sz30_133398_c1_51_638 | 195 |
| 683 | 3300050516 | nmdc:mga0sz30_91096_c1 | nmdc:mga0sz30_91096_c1_370_957 | 195 |
| 684 | 3300053088 | Ga0500644_0018748 | Ga0500644_0018748_156_743 | 195 |
| 685 | 3300053090 | Ga0500646_0195040 | Ga0500646_0195040_68_655 | 195 |
| 686 | 3300053091 | Ga0500647_0229049 | Ga0500647_0229049_223_810 | 195 |
| 687 | 3300053093 | Ga0500651_0049299 | Ga0500651_0049299_1244_1831 | 195 |
| 688 | 3300053118 | Ga0500594_0005379 | Ga0500594_0005379_2117_2704 | 195 |
| 689 | 3300053131 | Ga0500652_015873 | Ga0500652_015873_1829_2416 | 195 |
| 690 | 3300053134 | Ga0500658_0044423 | Ga0500658_0044423_756_1343 | 195 |
| 691 | 3300053134 | Ga0500658_0211496 | Ga0500658_0211496_251_868 | 195 |
| 692 | 3300053136 | Ga0500559_0000986 | Ga0500559_0000986_1026_1613 | 195 |
| 693 | 3300053139 | Ga0500568_0076257 | Ga0500568_0076257_122_709 | 195 |
| 694 | 3300053148 | Ga0500590_053213 | Ga0500590_053213_1155_1742 | 195 |
| 695 | 3300053154 | Ga0500619_000052 | Ga0500619_000052_11571_12158 | 195 |
| 696 | 3300053156 | Ga0500622_0043216 | Ga0500622_0043216_944_1531 | 195 |
| 697 | 3300053730 | Ga0500645_031534 | Ga0500645_031534_95_682 | 195 |
| 698 | 3300053739 | Ga0500587_002166 | Ga0500587_002166_807_1424 | 195 |
| 699 | 3300060353 | Ga0501082_0420838 | Ga0501082_0420838_148_741 | 195 |
| 700 | 3300061719 | Ga0466962_0002096 | Ga0466962_0002096_778_1365 | 195 |
| 701 | iso_pu_bacteria | 2738543012 | 2739245360 | 195 |
| 702 | 3300001989 | JGI24739J22299_10045504 | JGI24739J22299_100455042 | 196 |
| 703 | 3300002704 | JGI25155J39150_1000049 | JGI25155J39150_100004949 | 196 |
| 704 | 3300002705 | JGI25156J39149_1000023 | JGI25156J39149_100002395 | 196 |
| 705 | 3300002738 | JGI25154J39366_1000036 | JGI25154J39366_100003663 | 196 |
| 706 | 3300002739 | JGI25158J39367_1009499 | JGI25158J39367_10094992 | 196 |
| 707 | 3300002741 | JGI25157J39369_1000023 | JGI25157J39369_100002395 | 196 |
| 708 | 3300002773 | JGI25152J39213_1005976 | JGI25152J39213_10059764 | 196 |
| 709 | 3300002774 | JGI25150J39212_1004774 | JGI25150J39212_10047743 | 196 |
| 710 | 3300002774 | JGI25150J39212_1005484 | JGI25150J39212_10054843 | 196 |
| 711 | 3300002987 | JGI25159J45721_1001073 | JGI25159J45721_10010733 | 196 |
| 712 | 3300002987 | JGI25159J45721_1001804 | JGI25159J45721_10018044 | 196 |
| 713 | 3300002987 | JGI25159J45721_1011457 | JGI25159J45721_10114572 | 196 |
| 714 | 3300002987 | JGI25159J45721_1011861 | JGI25159J45721_10118612 | 196 |
| 715 | 3300003187 | JGI25151J46595_10004016 | JGI25151J46595_100040163 | 196 |
| 716 | 3300003187 | JGI25151J46595_10005717 | JGI25151J46595_100057175 | 196 |
| 717 | 3300003187 | JGI25151J46595_10010198 | JGI25151J46595_100101983 | 196 |
| 718 | 3300003187 | JGI25151J46595_10010227 | JGI25151J46595_100102275 | 196 |
| 719 | 3300003187 | JGI25151J46595_10016678 | JGI25151J46595_100166783 | 196 |
| 720 | 3300003187 | JGI25151J46595_10121997 | JGI25151J46595_101219971 | 196 |
| 721 | 3300003215 | JGI25153J46596_10009858 | JGI25153J46596_100098583 | 196 |
| 722 | 3300003215 | JGI25153J46596_10017105 | JGI25153J46596_100171053 | 196 |
| 723 | 3300003322 | rootL2_10075892 | rootL2_100758923 | 196 |
| 724 | 3300003354 | JGI25160J50197_1000260 | JGI25160J50197_100026020 | 196 |
| 725 | 3300003354 | JGI25160J50197_1018470 | JGI25160J50197_10184702 | 196 |
| 726 | 3300003354 | JGI25160J50197_1019095 | JGI25160J50197_10190953 | 196 |
| 727 | 3300003374 | JGI25161J50226_1000015 | JGI25161J50226_100001565 | 196 |
| 728 | 3300003374 | JGI25161J50226_1004468 | JGI25161J50226_10044683 | 196 |
| 729 | 3300003374 | JGI25161J50226_1006316 | JGI25161J50226_10063163 | 196 |
| 730 | 3300003578 | Ga0006562J51391_1051948 | Ga0006562J51391_10519482 | 196 |
| 731 | 3300003578 | Ga0006562J51391_1076372 | Ga0006562J51391_10763722 | 196 |
| 732 | 3300003761 | Ga0055535_1003358 | Ga0055535_10033584 | 196 |
| 733 | 3300003762 | Ga0055542_1000114 | Ga0055542_100011495 | 196 |
| 734 | 3300003771 | Ga0055526_1010148 | Ga0055526_10101483 | 196 |
| 735 | 3300003771 | Ga0055526_1010246 | Ga0055526_10102463 | 196 |
| 736 | 3300003771 | Ga0055526_1030310 | Ga0055526_10303102 | 196 |
| 737 | 3300003771 | Ga0055526_1030458 | Ga0055526_10304582 | 196 |
| 738 | 3300003773 | Ga0055537_1000135 | Ga0055537_100013533 | 196 |
| 739 | 3300003773 | Ga0055537_1000972 | Ga0055537_10009723 | 196 |
| 740 | 3300003773 | Ga0055537_1009351 | Ga0055537_10093512 | 196 |
| 741 | 3300003775 | Ga0055524_1000016 | Ga0055524_1000016178 | 196 |
| 742 | 3300003775 | Ga0055524_1021067 | Ga0055524_10210672 | 196 |
| 743 | 3300003775 | Ga0055524_1021783 | Ga0055524_10217833 | 196 |
| 744 | 3300003781 | Ga0055536_1013137 | Ga0055536_10131374 | 196 |
| 745 | 3300003781 | Ga0055536_1020005 | Ga0055536_10200052 | 196 |
| 746 | 3300003784 | Ga0055534_1000222 | Ga0055534_100022241 | 196 |
| 747 | 3300003784 | Ga0055534_1003233 | Ga0055534_10032334 | 196 |
| 748 | 3300003784 | Ga0055534_1003401 | Ga0055534_10034013 | 196 |
| 749 | 3300003784 | Ga0055534_1004961 | Ga0055534_10049611 | 196 |
| 750 | 3300003784 | Ga0055534_1008294 | Ga0055534_10082942 | 196 |
| 751 | 3300003784 | Ga0055534_1011817 | Ga0055534_10118172 | 196 |
| 752 | 3300003790 | Ga0055528_1000423 | Ga0055528_10004233 | 196 |
| 753 | 3300003790 | Ga0055528_1006109 | Ga0055528_10061094 | 196 |
| 754 | 3300003790 | Ga0055528_1020177 | Ga0055528_10201772 | 196 |
| 755 | 3300003791 | Ga0055530_10000293 | Ga0055530_1000029347 | 196 |
| 756 | 3300003791 | Ga0055530_10000951 | Ga0055530_1000095113 | 196 |
| 757 | 3300003791 | Ga0055530_10066105 | Ga0055530_100661051 | 196 |
| 758 | 3300003792 | Ga0055540_1000144 | Ga0055540_100014458 | 196 |
| 759 | 3300003792 | Ga0055540_1009989 | Ga0055540_10099894 | 196 |
| 760 | 3300003792 | Ga0055540_1016495 | Ga0055540_10164952 | 196 |
| 761 | 3300003794 | Ga0055531_10003930 | Ga0055531_100039303 | 196 |
| 762 | 3300003794 | Ga0055531_10021503 | Ga0055531_100215033 | 196 |
| 763 | 3300003794 | Ga0055531_10025349 | Ga0055531_100253492 | 196 |
| 764 | 3300004625 | Ga0055543_1000807 | Ga0055543_10008075 | 196 |
| 765 | 3300004625 | Ga0055543_1000874 | Ga0055543_10008748 | 196 |
| 766 | 3300004625 | Ga0055543_1012562 | Ga0055543_10125621 | 196 |
| 767 | 3300005262 | Ga0065165_1002967 | Ga0065165_10029673 | 196 |
| 768 | 3300005262 | Ga0065165_1005926 | Ga0065165_10059265 | 196 |
| 769 | 3300005262 | Ga0065165_1050224 | Ga0065165_10502241 | 196 |
| 770 | 3300005262 | Ga0065165_1050229 | Ga0065165_10502291 | 196 |
| 771 | 3300005288 | Ga0065714_10075522 | Ga0065714_100755223 | 196 |
| 772 | 3300005289 | Ga0065704_10081107 | Ga0065704_100811073 | 196 |
| 773 | 3300005329 | Ga0070683_100797880 | Ga0070683_1007978802 | 196 |
| 774 | 3300005334 | Ga0068869_100330288 | Ga0068869_1003302882 | 196 |
| 775 | 3300005336 | Ga0070680_100097964 | Ga0070680_1000979643 | 196 |
| 776 | 3300005347 | Ga0070668_100572987 | Ga0070668_1005729872 | 196 |
| 777 | 3300005354 | Ga0070675_100243530 | Ga0070675_1002435301 | 196 |
| 778 | 3300005355 | Ga0070671_100024548 | Ga0070671_1000245483 | 196 |
| 779 | 3300005435 | Ga0070714_100253673 | Ga0070714_1002536733 | 196 |
| 780 | 3300005456 | Ga0070678_100082262 | Ga0070678_1000822622 | 196 |
| 781 | 3300005456 | Ga0070678_100766899 | Ga0070678_1007668991 | 196 |
| 782 | 3300005458 | Ga0070681_10129127 | Ga0070681_101291273 | 196 |
| 783 | 3300005467 | Ga0070706_100637749 | Ga0070706_1006377491 | 196 |
| 784 | 3300005468 | Ga0070707_100248358 | Ga0070707_1002483582 | 196 |
| 785 | 3300005530 | Ga0070679_100083306 | Ga0070679_1000833063 | 196 |
| 786 | 3300005530 | Ga0070679_100131957 | Ga0070679_1001319572 | 196 |
| 787 | 3300005539 | Ga0068853_100045549 | Ga0068853_1000455492 | 196 |
| 788 | 3300005539 | Ga0068853_100599883 | Ga0068853_1005998832 | 196 |
| 789 | 3300005548 | Ga0070665_100113706 | Ga0070665_1001137062 | 196 |
| 790 | 3300005563 | Ga0068855_100022837 | Ga0068855_1000228373 | 196 |
| 791 | 3300005834 | Ga0068851_10026610 | Ga0068851_100266103 | 196 |
| 792 | 3300005841 | Ga0068863_100109497 | Ga0068863_1001094973 | 196 |
| 793 | 3300005844 | Ga0068862_100044186 | Ga0068862_1000441863 | 196 |
| 794 | 3300006038 | Ga0075365_10213872 | Ga0075365_102138723 | 196 |
| 795 | 3300006038 | Ga0075365_10380687 | Ga0075365_103806872 | 196 |
| 796 | 3300006048 | Ga0075363_100029136 | Ga0075363_1000291361 | 196 |
| 797 | 3300006048 | Ga0075363_100049721 | Ga0075363_1000497212 | 196 |
| 798 | 3300006048 | Ga0075363_100370862 | Ga0075363_1003708621 | 196 |
| 799 | 3300006048 | Ga0075363_100409579 | Ga0075363_1004095792 | 196 |
| 800 | 3300006051 | Ga0075364_10011971 | Ga0075364_100119713 | 196 |
| 801 | 3300006051 | Ga0075364_10140479 | Ga0075364_101404793 | 196 |
| 802 | 3300006058 | Ga0075432_10012009 | Ga0075432_100120093 | 196 |
| 803 | 3300006177 | Ga0075362_10029529 | Ga0075362_100295292 | 196 |
| 804 | 3300006177 | Ga0075362_10230315 | Ga0075362_102303151 | 196 |
| 805 | 3300006178 | Ga0075367_10278883 | Ga0075367_102788832 | 196 |
| 806 | 3300006186 | Ga0075369_10235421 | Ga0075369_102354212 | 196 |
| 807 | 3300006195 | Ga0075366_10029732 | Ga0075366_100297322 | 196 |
| 808 | 3300006195 | Ga0075366_10063373 | Ga0075366_100633732 | 196 |
| 809 | 3300006195 | Ga0075366_10088325 | Ga0075366_100883253 | 196 |
| 810 | 3300006195 | Ga0075366_10194498 | Ga0075366_101944982 | 196 |
| 811 | 3300006353 | Ga0075370_10004393 | Ga0075370_100043932 | 196 |
| 812 | 3300006353 | Ga0075370_10027748 | Ga0075370_100277483 | 196 |
| 813 | 3300006353 | Ga0075370_10035475 | Ga0075370_100354754 | 196 |
| 814 | 3300006353 | Ga0075370_10057161 | Ga0075370_100571613 | 196 |
| 815 | 3300006353 | Ga0075370_10063856 | Ga0075370_100638562 | 196 |
| 816 | 3300006948 | Ga0099826_10004782 | Ga0099826_100047826 | 196 |
| 817 | 3300006948 | Ga0099826_10035017 | Ga0099826_100350173 | 196 |
| 818 | 3300009093 | Ga0105240_10002847 | Ga0105240_1000284716 | 196 |
| 819 | 3300009093 | Ga0105240_10441232 | Ga0105240_104412323 | 196 |
| 820 | 3300009093 | Ga0105240_11408337 | Ga0105240_114083371 | 196 |
| 821 | 3300009147 | Ga0114129_10597217 | Ga0114129_105972172 | 196 |
| 822 | 3300009148 | Ga0105243_10104817 | Ga0105243_101048172 | 196 |
| 823 | 3300009176 | Ga0105242_10337028 | Ga0105242_103370282 | 196 |
| 824 | 3300009176 | Ga0105242_10398738 | Ga0105242_103987382 | 196 |
| 825 | 3300009177 | Ga0105248_10002775 | Ga0105248_1000277515 | 196 |
| 826 | 3300009551 | Ga0105238_10097245 | Ga0105238_100972453 | 196 |
| 827 | 3300010375 | Ga0105239_10682831 | Ga0105239_106828312 | 196 |
| 828 | 3300013100 | Ga0157373_10039046 | Ga0157373_100390463 | 196 |
| 829 | 3300013100 | Ga0157373_10682842 | Ga0157373_106828422 | 196 |
| 830 | 3300013102 | Ga0157371_10031344 | Ga0157371_100313442 | 196 |
| 831 | 3300013104 | Ga0157370_10870570 | Ga0157370_108705701 | 196 |
| 832 | 3300013306 | Ga0163162_10241820 | Ga0163162_102418202 | 196 |
| 833 | 3300013307 | Ga0157372_11537264 | Ga0157372_115372641 | 196 |
| 834 | 3300014497 | Ga0182008_10003871 | Ga0182008_100038712 | 196 |
| 835 | 3300014497 | Ga0182008_10017897 | Ga0182008_100178973 | 196 |
| 836 | 3300015262 | Ga0182007_10000539 | Ga0182007_1000053918 | 196 |
| 837 | 3300015262 | Ga0182007_10130798 | Ga0182007_101307982 | 196 |
| 838 | 3300015265 | Ga0182005_1022729 | Ga0182005_10227292 | 196 |
| 839 | 3300017792 | Ga0163161_10024535 | Ga0163161_100245353 | 196 |
| 840 | 3300017792 | Ga0163161_10044819 | Ga0163161_100448192 | 196 |
| 841 | 3300017792 | Ga0163161_10065207 | Ga0163161_100652074 | 196 |
| 842 | 3300017792 | Ga0163161_10297551 | Ga0163161_102975512 | 196 |
| 843 | 3300025206 | Ga0209435_100001 | Ga0209435_100001309 | 196 |
| 844 | 3300025208 | Ga0209436_103103 | Ga0209436_1031033 | 196 |
| 845 | 3300025208 | Ga0209436_105165 | Ga0209436_1051653 | 196 |
| 846 | 3300025208 | Ga0209436_111682 | Ga0209436_1116821 | 196 |
| 847 | 3300025228 | Ga0209672_101186 | Ga0209672_10118611 | 196 |
| 848 | 3300025229 | Ga0209147_101683 | Ga0209147_1016835 | 196 |
| 849 | 3300025242 | Ga0209258_100225 | Ga0209258_10022596 | 196 |
| 850 | 3300025245 | Ga0207425_1000530 | Ga0207425_100053014 | 196 |
| 851 | 3300025245 | Ga0207425_1002265 | Ga0207425_10022654 | 196 |
| 852 | 3300025245 | Ga0207425_1004703 | Ga0207425_10047034 | 196 |
| 853 | 3300025246 | Ga0209646_1000001 | Ga0209646_1000001678 | 196 |
| 854 | 3300025250 | Ga0209026_1000003 | Ga0209026_1000003309 | 196 |
| 855 | 3300025254 | Ga0209148_1000040 | Ga0209148_1000040382 | 196 |
| 856 | 3300025256 | Ga0209759_1000001 | Ga0209759_1000001309 | 196 |
| 857 | 3300025258 | Ga0209129_1000007 | Ga0209129_1000007290 | 196 |
| 858 | 3300025258 | Ga0209129_1002542 | Ga0209129_100254210 | 196 |
| 859 | 3300025258 | Ga0209129_1004981 | Ga0209129_10049815 | 196 |
| 860 | 3300025258 | Ga0209129_1006720 | Ga0209129_10067203 | 196 |
| 861 | 3300025263 | Ga0209565_1000004 | Ga0209565_1000004215 | 196 |
| 862 | 3300025263 | Ga0209565_1000085 | Ga0209565_100008577 | 196 |
| 863 | 3300025263 | Ga0209565_1000365 | Ga0209565_100036527 | 196 |
| 864 | 3300025263 | Ga0209565_1000394 | Ga0209565_100039424 | 196 |
| 865 | 3300025263 | Ga0209565_1005992 | Ga0209565_10059923 | 196 |
| 866 | 3300025273 | Ga0209673_1000045 | Ga0209673_1000045156 | 196 |
| 867 | 3300025273 | Ga0209673_1000133 | Ga0209673_100013347 | 196 |
| 868 | 3300025273 | Ga0209673_1000445 | Ga0209673_100044533 | 196 |
| 869 | 3300025273 | Ga0209673_1002436 | Ga0209673_10024363 | 196 |
| 870 | 3300025284 | Ga0209130_1000056 | Ga0209130_1000056127 | 196 |
| 871 | 3300025284 | Ga0209130_1000070 | Ga0209130_1000070127 | 196 |
| 872 | 3300025284 | Ga0209130_1000634 | Ga0209130_100063418 | 196 |
| 873 | 3300025284 | Ga0209130_1001057 | Ga0209130_10010579 | 196 |
| 874 | 3300025284 | Ga0209130_1014947 | Ga0209130_10149473 | 196 |
| 875 | 3300025291 | Ga0209675_1000083 | Ga0209675_100008377 | 196 |
| 876 | 3300025291 | Ga0209675_1000185 | Ga0209675_100018567 | 196 |
| 877 | 3300025291 | Ga0209675_1000411 | Ga0209675_100041123 | 196 |
| 878 | 3300025291 | Ga0209675_1001654 | Ga0209675_10016543 | 196 |
| 879 | 3300025291 | Ga0209675_1002876 | Ga0209675_10028764 | 196 |
| 880 | 3300025291 | Ga0209675_1003496 | Ga0209675_10034964 | 196 |
| 881 | 3300025291 | Ga0209675_1011667 | Ga0209675_10116673 | 196 |
| 882 | 3300025291 | Ga0209675_1024463 | Ga0209675_10244632 | 196 |
| 883 | 3300025292 | Ga0209676_1000004 | Ga0209676_10000041029 | 196 |
| 884 | 3300025292 | Ga0209676_1000007 | Ga0209676_1000007755 | 196 |
| 885 | 3300025292 | Ga0209676_1006494 | Ga0209676_10064946 | 196 |
| 886 | 3300025292 | Ga0209676_1009992 | Ga0209676_10099923 | 196 |
| 887 | 3300025292 | Ga0209676_1020213 | Ga0209676_10202133 | 196 |
| 888 | 3300025292 | Ga0209676_1022106 | Ga0209676_10221062 | 196 |
| 889 | 3300025292 | Ga0209676_1025485 | Ga0209676_10254852 | 196 |
| 890 | 3300025294 | Ga0209025_1000111 | Ga0209025_1000111126 | 196 |
| 891 | 3300025294 | Ga0209025_1000455 | Ga0209025_100045562 | 196 |
| 892 | 3300025294 | Ga0209025_1000529 | Ga0209025_100052961 | 196 |
| 893 | 3300025294 | Ga0209025_1003293 | Ga0209025_10032939 | 196 |
| 894 | 3300025294 | Ga0209025_1007672 | Ga0209025_10076727 | 196 |
| 895 | 3300025294 | Ga0209025_1013159 | Ga0209025_10131594 | 196 |
| 896 | 3300025294 | Ga0209025_1014754 | Ga0209025_10147543 | 196 |
| 897 | 3300025294 | Ga0209025_1034080 | Ga0209025_10340803 | 196 |
| 898 | 3300025294 | Ga0209025_1040260 | Ga0209025_10402602 | 196 |
| 899 | 3300025295 | Ga0209564_1000153 | Ga0209564_10001535 | 196 |
| 900 | 3300025295 | Ga0209564_1000337 | Ga0209564_10003375 | 196 |
| 901 | 3300025295 | Ga0209564_1000772 | Ga0209564_100077219 | 196 |
| 902 | 3300025295 | Ga0209564_1000962 | Ga0209564_10009622 | 196 |
| 903 | 3300025295 | Ga0209564_1029151 | Ga0209564_10291513 | 196 |
| 904 | 3300025297 | Ga0209758_1000025 | Ga0209758_1000025236 | 196 |
| 905 | 3300025297 | Ga0209758_1007230 | Ga0209758_10072305 | 196 |
| 906 | 3300025297 | Ga0209758_1020573 | Ga0209758_10205732 | 196 |
| 907 | 3300025297 | Ga0209758_1049373 | Ga0209758_10493732 | 196 |
| 908 | 3300025298 | Ga0209050_1000002 | Ga0209050_10000021539 | 196 |
| 909 | 3300025298 | Ga0209050_1000003 | Ga0209050_1000003752 | 196 |
| 910 | 3300025298 | Ga0209050_1014719 | Ga0209050_10147194 | 196 |
| 911 | 3300025298 | Ga0209050_1025986 | Ga0209050_10259863 | 196 |
| 912 | 3300025299 | Ga0209256_1000001 | Ga0209256_1000001752 | 196 |
| 913 | 3300025299 | Ga0209256_1000050 | Ga0209256_1000050302 | 196 |
| 914 | 3300025299 | Ga0209256_1000063 | Ga0209256_10000633 | 196 |
| 915 | 3300025302 | Ga0207426_1000001 | Ga0207426_1000001401 | 196 |
| 916 | 3300025302 | Ga0207426_1000025 | Ga0207426_1000025195 | 196 |
| 917 | 3300025302 | Ga0207426_1000028 | Ga0207426_1000028221 | 196 |
| 918 | 3300025302 | Ga0207426_1004695 | Ga0207426_10046953 | 196 |
| 919 | 3300025302 | Ga0207426_1096965 | Ga0207426_10969652 | 196 |
| 920 | 3300025303 | Ga0209051_1000002 | Ga0209051_10000021309 | 196 |
| 921 | 3300025303 | Ga0209051_1000003 | Ga0209051_1000003752 | 196 |
| 922 | 3300025303 | Ga0209051_1000653 | Ga0209051_100065327 | 196 |
| 923 | 3300025303 | Ga0209051_1005176 | Ga0209051_10051767 | 196 |
| 924 | 3300025303 | Ga0209051_1079431 | Ga0209051_10794312 | 196 |
| 925 | 3300025304 | Ga0209257_1000002 | Ga0209257_10000021450 | 196 |
| 926 | 3300025304 | Ga0209257_1000018 | Ga0209257_1000018752 | 196 |
| 927 | 3300025304 | Ga0209257_1001358 | Ga0209257_100135820 | 196 |
| 928 | 3300025304 | Ga0209257_1003661 | Ga0209257_10036613 | 196 |
| 929 | 3300025304 | Ga0209257_1016346 | Ga0209257_10163463 | 196 |
| 930 | 3300025893 | Ga0207682_10018054 | Ga0207682_100180543 | 196 |
| 931 | 3300025910 | Ga0207684_10294930 | Ga0207684_102949302 | 196 |
| 932 | 3300025912 | Ga0207707_10278387 | Ga0207707_102783873 | 196 |
| 933 | 3300025913 | Ga0207695_10089619 | Ga0207695_100896194 | 196 |
| 934 | 3300025913 | Ga0207695_10229914 | Ga0207695_102299143 | 196 |
| 935 | 3300025921 | Ga0207652_10065943 | Ga0207652_100659434 | 196 |
| 936 | 3300025922 | Ga0207646_10228362 | Ga0207646_102283622 | 196 |
| 937 | 3300025929 | Ga0207664_10096770 | Ga0207664_100967702 | 196 |
| 938 | 3300025931 | Ga0207644_10037459 | Ga0207644_100374593 | 196 |
| 939 | 3300025933 | Ga0207706_10227795 | Ga0207706_102277951 | 196 |
| 940 | 3300025940 | Ga0207691_10193143 | Ga0207691_101931432 | 196 |
| 941 | 3300025940 | Ga0207691_10330458 | Ga0207691_103304582 | 196 |
| 942 | 3300025941 | Ga0207711_10145746 | Ga0207711_101457463 | 196 |
| 943 | 3300025949 | Ga0207667_10151272 | Ga0207667_101512721 | 196 |
| 944 | 3300025949 | Ga0207667_11049366 | Ga0207667_110493662 | 196 |
| 945 | 3300026041 | Ga0207639_10005602 | Ga0207639_100056027 | 196 |
| 946 | 3300026041 | Ga0207639_10278328 | Ga0207639_102783283 | 196 |
| 947 | 3300026095 | Ga0207676_10178109 | Ga0207676_101781092 | 196 |
| 948 | 3300026116 | Ga0207674_11168596 | Ga0207674_111685961 | 196 |
| 949 | 3300026121 | Ga0207683_10829936 | Ga0207683_108299362 | 196 |
| 950 | 3300026142 | Ga0207698_10375955 | Ga0207698_103759552 | 196 |
| 951 | 3300027614 | Ga0209970_1000478 | Ga0209970_10004787 | 196 |
| 952 | 3300027666 | Ga0209282_1006184 | Ga0209282_10061848 | 196 |
| 953 | 3300027666 | Ga0209282_1114443 | Ga0209282_11144432 | 196 |
| 954 | 3300027876 | Ga0209974_10049704 | Ga0209974_100497043 | 196 |
| 955 | 3300027876 | Ga0209974_10130739 | Ga0209974_101307391 | 196 |
| 956 | 3300027907 | Ga0207428_10386576 | Ga0207428_103865762 | 196 |
| 957 | 3300028380 | Ga0268265_10027745 | Ga0268265_100277453 | 196 |
| 958 | 3300028794 | Ga0307515_10000428 | Ga0307515_1000042840 | 196 |
| 959 | 3300028794 | Ga0307515_10002861 | Ga0307515_1000286129 | 196 |
| 960 | 3300028794 | Ga0307515_10131159 | Ga0307515_101311593 | 196 |
| 961 | 3300030522 | Ga0307512_10233363 | Ga0307512_102333632 | 196 |
| 962 | 3300030731 | Ga0316177_1092166 | Ga0316177_10921663 | 196 |
| 963 | 3300030733 | Ga0314311_1139236 | Ga0314311_113923610 | 196 |
| 964 | 3300030736 | Ga0316180_1077645 | Ga0316180_10776452 | 196 |
| 965 | 3300030742 | Ga0316183_1002371 | Ga0316183_10023714 | 196 |
| 966 | 3300030742 | Ga0316183_1154909 | Ga0316183_11549091 | 196 |
| 967 | 3300030744 | Ga0316181_1009854 | Ga0316181_10098544 | 196 |
| 968 | 3300030744 | Ga0316181_1111584 | Ga0316181_11115843 | 196 |
| 969 | 3300030745 | Ga0316182_1087061 | Ga0316182_10870612 | 196 |
| 970 | 3300031238 | Ga0265332_10000033 | Ga0265332_1000003387 | 196 |
| 971 | 3300031239 | Ga0265328_10051830 | Ga0265328_100518303 | 196 |
| 972 | 3300031251 | Ga0265327_10000689 | Ga0265327_1000068924 | 196 |
| 973 | 3300031251 | Ga0265327_10016727 | Ga0265327_100167273 | 196 |
| 974 | 3300031456 | Ga0307513_10000010 | Ga0307513_10000010321 | 196 |
| 975 | 3300031456 | Ga0307513_10000121 | Ga0307513_1000012112 | 196 |
| 976 | 3300031456 | Ga0307513_10010831 | Ga0307513_100108313 | 196 |
| 977 | 3300031456 | Ga0307513_10093400 | Ga0307513_100934002 | 196 |
| 978 | 3300031548 | Ga0307408_100000068 | Ga0307408_10000006852 | 196 |
| 979 | 3300031548 | Ga0307408_100051392 | Ga0307408_1000513923 | 196 |
| 980 | 3300031548 | Ga0307408_100060884 | Ga0307408_1000608843 | 196 |
| 981 | 3300031548 | Ga0307408_100153651 | Ga0307408_1001536512 | 196 |
| 982 | 3300031649 | Ga0307514_10000869 | Ga0307514_1000086911 | 196 |
| 983 | 3300031649 | Ga0307514_10017552 | Ga0307514_100175523 | 196 |
| 984 | 3300031730 | Ga0307516_10047914 | Ga0307516_100479144 | 196 |
| 985 | 3300031730 | Ga0307516_10301837 | Ga0307516_103018372 | 196 |
| 986 | 3300031731 | Ga0307405_10249208 | Ga0307405_102492081 | 196 |
| 987 | 3300031731 | Ga0307405_10370510 | Ga0307405_103705102 | 196 |
| 988 | 3300031731 | Ga0307405_10466740 | Ga0307405_104667402 | 196 |
| 989 | 3300031824 | Ga0307413_10200729 | Ga0307413_102007293 | 196 |
| 990 | 3300031824 | Ga0307413_10294029 | Ga0307413_102940292 | 196 |
| 991 | 3300031824 | Ga0307413_11298326 | Ga0307413_112983261 | 196 |
| 992 | 3300031901 | Ga0307406_10000135 | Ga0307406_100001359 | 196 |
| 993 | 3300031901 | Ga0307406_10005443 | Ga0307406_100054433 | 196 |
| 994 | 3300031901 | Ga0307406_10119502 | Ga0307406_101195022 | 196 |
| 995 | 3300031901 | Ga0307406_10270774 | Ga0307406_102707742 | 196 |
| 996 | 3300031903 | Ga0307407_10103535 | Ga0307407_101035352 | 196 |
| 997 | 3300031911 | Ga0307412_10042559 | Ga0307412_100425594 | 196 |
| 998 | 3300032002 | Ga0307416_100217996 | Ga0307416_1002179963 | 196 |
| 999 | 3300032002 | Ga0307416_100770241 | Ga0307416_1007702412 | 196 |
| 1000 | 3300032004 | Ga0307414_10302559 | Ga0307414_103025593 | 196 |
| 1001 | 3300032004 | Ga0307414_10960949 | Ga0307414_109609492 | 196 |
| 1002 | 3300032005 | Ga0307411_10125955 | Ga0307411_101259553 | 196 |
| 1003 | 3300032005 | Ga0307411_10185912 | Ga0307411_101859121 | 196 |
| 1004 | 3300032005 | Ga0307411_10471918 | Ga0307411_104719181 | 196 |
| 1005 | 3300037471 | Ga0395905_0254731 | Ga0395905_0254731_466_1062 | 196 |
| 1006 | 3300038443 | Ga0395901_0156605 | Ga0395901_0156605_66_656 | 196 |
| 1007 | 3300041404 | Ga0439436_0000168 | Ga0439436_0000168_2890_3486 | 196 |
| 1008 | 3300041404 | Ga0439436_0000271 | Ga0439436_0000271_785_1375 | 196 |
| 1009 | 3300041405 | Ga0439438_030265 | Ga0439438_030265_503_1093 | 196 |
| 1010 | 3300041407 | Ga0439447_019703 | Ga0439447_019703_333_929 | 196 |
| 1011 | 3300041407 | Ga0439447_033049 | Ga0439447_033049_267_857 | 196 |
| 1012 | 3300041410 | Ga0439461_0003984 | Ga0439461_0003984_1553_2149 | 196 |
| 1013 | 3300041410 | Ga0439461_0043794 | Ga0439461_0043794_194_784 | 196 |
| 1014 | 3300041411 | Ga0439466_0006959 | Ga0439466_0006959_3268_3858 | 196 |
| 1015 | 3300041411 | Ga0439466_0011797 | Ga0439466_0011797_431_1027 | 196 |
| 1016 | 3300041411 | Ga0439466_0059239 | Ga0439466_0059239_618_1208 | 196 |
| 1017 | 3300041413 | Ga0439465_0004740 | Ga0439465_0004740_392_988 | 196 |
| 1018 | 3300041413 | Ga0439465_0032324 | Ga0439465_0032324_680_1270 | 196 |
| 1019 | 3300041443 | Ga0451789_0115708 | Ga0451789_0115708_298_888 | 196 |
| 1020 | 3300041443 | Ga0451789_0257727 | Ga0451789_0257727_77_703 | 196 |
| 1021 | 3300041443 | Ga0451789_1294079 | Ga0451789_1294079_60_650 | 196 |
| 1022 | 3300041453 | Ga0451797_1105889 | Ga0451797_1105889_36_626 | 196 |
| 1023 | 3300041453 | Ga0451797_1374203 | Ga0451797_1374203_67_657 | 196 |
| 1024 | 3300041463 | Ga0451804_1015395 | Ga0451804_1015395_250_876 | 196 |
| 1025 | 3300041486 | Ga0451807_0207679 | Ga0451807_0207679_448_1074 | 196 |
| 1026 | 3300041491 | Ga0451833_0357612 | Ga0451833_0357612_70_660 | 196 |
| 1027 | 3300041498 | Ga0451841_1434301 | Ga0451841_1434301_79_705 | 196 |
| 1028 | 3300041997 | Ga0439431_0002491 | Ga0439431_0002491_219_815 | 196 |
| 1029 | 3300041997 | Ga0439431_0015132 | Ga0439431_0015132_301_891 | 196 |
| 1030 | 3300041999 | Ga0439433_0003486 | Ga0439433_0003486_943_1539 | 196 |
| 1031 | 3300041999 | Ga0439433_0014808 | Ga0439433_0014808_757_1347 | 196 |
| 1032 | 3300042004 | Ga0439445_0000101 | Ga0439445_0000101_1014_1610 | 196 |
| 1033 | 3300042006 | Ga0439432_000403 | Ga0439432_000403_15316_15912 | 196 |
| 1034 | 3300042006 | Ga0439432_006778 | Ga0439432_006778_3218_3808 | 196 |
| 1035 | 3300042007 | Ga0439449_0002611 | Ga0439449_0002611_3511_4140 | 196 |
| 1036 | 3300042007 | Ga0439449_0004558 | Ga0439449_0004558_1329_1925 | 196 |
| 1037 | 3300042007 | Ga0439449_0048086 | Ga0439449_0048086_361_951 | 196 |
| 1038 | 3300042010 | Ga0439452_001575 | Ga0439452_001575_3804_4400 | 196 |
| 1039 | 3300042010 | Ga0439452_003824 | Ga0439452_003824_104_694 | 196 |
| 1040 | 3300042014 | Ga0439457_011619 | Ga0439457_011619_764_1360 | 196 |
| 1041 | 3300042015 | Ga0439462_0004271 | Ga0439462_0004271_156_752 | 196 |
| 1042 | 3300042015 | Ga0439462_0009364 | Ga0439462_0009364_90_680 | 196 |
| 1043 | 3300042123 | Ga0450921_006250 | Ga0450921_006250_296_886 | 196 |
| 1044 | 3300042128 | Ga0450897_001501 | Ga0450897_001501_963_1553 | 196 |
| 1045 | 3300042145 | Ga0450906_007802 | Ga0450906_007802_106_696 | 196 |
| 1046 | 3300042146 | Ga0450907_005115 | Ga0450907_005115_989_1579 | 196 |
| 1047 | 3300042147 | Ga0450910_008320 | Ga0450910_008320_391_981 | 196 |
| 1048 | 3300042147 | Ga0450910_032418 | Ga0450910_032418_74_664 | 196 |
| 1049 | 3300042156 | Ga0439446_0010534 | Ga0439446_0010534_68_664 | 196 |
| 1050 | 3300042156 | Ga0439446_0054417 | Ga0439446_0054417_521_1111 | 196 |
| 1051 | 3300042156 | Ga0439446_0165514 | Ga0439446_0165514_13_603 | 196 |
| 1052 | 3300042184 | Ga0450908_002817 | Ga0450908_002817_1885_2475 | 196 |
| 1053 | 3300042184 | Ga0450908_010910 | Ga0450908_010910_763_1353 | 196 |
| 1054 | 3300042435 | Ga0439434_0039391 | Ga0439434_0039391_121_711 | 196 |
| 1055 | 3300042531 | Ga0450918_000258 | Ga0450918_000258_3451_4041 | 196 |
| 1056 | 3300042532 | Ga0450893_0022948 | Ga0450893_0022948_243_833 | 196 |
| 1057 | 3300042876 | Ga0451577_0000142 | Ga0451577_0000142_101417_102049 | 196 |
| 1058 | 3300042876 | Ga0451577_0619466 | Ga0451577_0619466_275_865 | 196 |
| 1059 | 3300042876 | Ga0451577_0748359 | Ga0451577_0748359_166_756 | 196 |
| 1060 | 3300044673 | Ga0453683_0227683 | Ga0453683_0227683_558_1148 | 196 |
| 1061 | 3300044683 | Ga0466965_0015331 | Ga0466965_0015331_2183_2773 | 196 |
| 1062 | 3300044712 | Ga0453684_0000126 | Ga0453684_0000126_277214_277846 | 196 |
| 1063 | 3300044712 | Ga0453684_1084309 | Ga0453684_1084309_153_743 | 196 |
| 1064 | 3300045051 | Ga0451576_0003200 | Ga0451576_0003200_1169_1801 | 196 |
| 1065 | 3300045051 | Ga0451576_0144753 | Ga0451576_0144753_1024_1614 | 196 |
| 1066 | 3300045051 | Ga0451576_1474007 | Ga0451576_1474007_25_615 | 196 |
| 1067 | 3300046453 | Ga0495627_024136 | Ga0495627_024136_1213_1803 | 196 |
| 1068 | 3300046459 | Ga0495629_0350512 | Ga0495629_0350512_167_757 | 196 |
| 1069 | 3300046460 | Ga0495638_0027431 | Ga0495638_0027431_1300_1890 | 196 |
| 1070 | 3300046501 | Ga0495607_0000104 | Ga0495607_0000104_51865_52470 | 196 |
| 1071 | 3300046513 | Ga0495616_0001588 | Ga0495616_0001588_10647_11237 | 196 |
| 1072 | 3300046515 | Ga0495620_0021209 | Ga0495620_0021209_2217_2807 | 196 |
| 1073 | 3300046515 | Ga0495620_0172871 | Ga0495620_0172871_184_774 | 196 |
| 1074 | 3300046520 | Ga0495637_0012385 | Ga0495637_0012385_191_781 | 196 |
| 1075 | 3300046520 | Ga0495637_0048343 | Ga0495637_0048343_54_644 | 196 |
| 1076 | 3300046522 | Ga0495643_0098704 | Ga0495643_0098704_835_1425 | 196 |
| 1077 | 3300046528 | Ga0495642_0106865 | Ga0495642_0106865_132_722 | 196 |
| 1078 | 3300046530 | Ga0495654_0031744 | Ga0495654_0031744_1493_2083 | 196 |
| 1079 | 3300046530 | Ga0495654_0085535 | Ga0495654_0085535_47_637 | 196 |
| 1080 | 3300046537 | Ga0495598_0056598 | Ga0495598_0056598_311_901 | 196 |
| 1081 | 3300046539 | Ga0495621_0072853 | Ga0495621_0072853_452_1042 | 196 |
| 1082 | 3300046539 | Ga0495621_0204500 | Ga0495621_0204500_172_762 | 196 |
| 1083 | 3300046558 | Ga0495633_0176192 | Ga0495633_0176192_162_752 | 196 |
| 1084 | 3300046615 | Ga0495656_0000075 | Ga0495656_0000075_13550_14140 | 196 |
| 1085 | 3300046660 | Ga0495625_0000811 | Ga0495625_0000811_36054_36644 | 196 |
| 1086 | 3300046660 | Ga0495625_0025717 | Ga0495625_0025717_1317_1907 | 196 |
| 1087 | 3300046665 | Ga0495661_0161144 | Ga0495661_0161144_577_1167 | 196 |
| 1088 | 3300046674 | Ga0495588_0195429 | Ga0495588_0195429_440_1030 | 196 |
| 1089 | 3300046684 | Ga0495669_0149372 | Ga0495669_0149372_417_1007 | 196 |
| 1090 | 3300046691 | Ga0495670_0179599 | Ga0495670_0179599_103_693 | 196 |
| 1091 | 3300046692 | Ga0495671_0034019 | Ga0495671_0034019_127_717 | 196 |
| 1092 | 3300046809 | Ga0495600_0166072 | Ga0495600_0166072_652_1242 | 196 |
| 1093 | 3300046810 | Ga0495660_0134110 | Ga0495660_0134110_456_1046 | 196 |
| 1094 | 3300047321 | Ga0495676_0012666 | Ga0495676_0012666_5085_5675 | 196 |
| 1095 | 3300047321 | Ga0495676_0610245 | Ga0495676_0610245_33_623 | 196 |
| 1096 | 3300047472 | Ga0495686_0001800 | Ga0495686_0001800_1323_1913 | 196 |
| 1097 | 3300047673 | Ga0495593_0007103 | Ga0495593_0007103_4208_4798 | 196 |
| 1098 | 3300048090 | Ga0495615_0030520 | Ga0495615_0030520_599_1189 | 196 |
| 1099 | 3300048091 | Ga0495626_0144435 | Ga0495626_0144435_174_779 | 196 |
| 1100 | 3300048903 | Ga0496100_0634095 | Ga0496100_0634095_119_709 | 196 |
| 1101 | 3300048904 | Ga0496101_0135784 | Ga0496101_0135784_919_1509 | 196 |
| 1102 | 3300048904 | Ga0496101_0250344 | Ga0496101_0250344_738_1328 | 196 |
| 1103 | 3300048904 | Ga0496101_0874784 | Ga0496101_0874784_90_680 | 196 |
| 1104 | 3300048907 | Ga0496104_0806923 | Ga0496104_0806923_50_640 | 196 |
| 1105 | 3300048909 | Ga0496106_1053740 | Ga0496106_1053740_28_618 | 196 |
| 1106 | 3300048910 | Ga0496107_0208558 | Ga0496107_0208558_727_1317 | 196 |
| 1107 | 3300048911 | Ga0496108_0122184 | Ga0496108_0122184_23_613 | 196 |
| 1108 | 3300048912 | Ga0496109_0282174 | Ga0496109_0282174_483_1073 | 196 |
| 1109 | 3300048913 | Ga0496110_0049361 | Ga0496110_0049361_1749_2339 | 196 |
| 1110 | 3300048915 | Ga0496112_0088286 | Ga0496112_0088286_994_1584 | 196 |
| 1111 | 3300048915 | Ga0496112_0737718 | Ga0496112_0737718_14_604 | 196 |
| 1112 | 3300048920 | Ga0496117_0053691 | Ga0496117_0053691_257_847 | 196 |
| 1113 | 3300048920 | Ga0496117_0054270 | Ga0496117_0054270_1919_2530 | 196 |
| 1114 | 3300048921 | Ga0496118_0023589 | Ga0496118_0023589_2402_2992 | 196 |
| 1115 | 3300048921 | Ga0496118_0163086 | Ga0496118_0163086_774_1364 | 196 |
| 1116 | 3300048924 | Ga0496121_0059956 | Ga0496121_0059956_1033_1644 | 196 |
| 1117 | 3300048924 | Ga0496121_0093571 | Ga0496121_0093571_267_857 | 196 |
| 1118 | 3300048924 | Ga0496121_0624240 | Ga0496121_0624240_15_641 | 196 |
| 1119 | 3300048925 | Ga0496122_0007254 | Ga0496122_0007254_3241_3834 | 196 |
| 1120 | 3300048925 | Ga0496122_0169070 | Ga0496122_0169070_134_724 | 196 |
| 1121 | 3300048925 | Ga0496122_0302757 | Ga0496122_0302757_109_699 | 196 |
| 1122 | 3300048926 | Ga0496123_0019596 | Ga0496123_0019596_1629_2222 | 196 |
| 1123 | 3300048926 | Ga0496123_0184818 | Ga0496123_0184818_254_865 | 196 |
| 1124 | 3300048926 | Ga0496123_0210948 | Ga0496123_0210948_113_703 | 196 |
| 1125 | 3300048926 | Ga0496123_0366102 | Ga0496123_0366102_41_631 | 196 |
| 1126 | 3300048927 | Ga0496124_0030743 | Ga0496124_0030743_1686_2276 | 196 |
| 1127 | 3300048927 | Ga0496124_0063813 | Ga0496124_0063813_2134_2724 | 196 |
| 1128 | 3300048927 | Ga0496124_0268157 | Ga0496124_0268157_206_799 | 196 |
| 1129 | 3300048928 | Ga0496125_0000729 | Ga0496125_0000729_8638_9231 | 196 |
| 1130 | 3300048928 | Ga0496125_0009773 | Ga0496125_0009773_7165_7755 | 196 |
| 1131 | 3300048928 | Ga0496125_0218074 | Ga0496125_0218074_556_1146 | 196 |
| 1132 | 3300048929 | Ga0496126_0011869 | Ga0496126_0011869_2501_3094 | 196 |
| 1133 | 3300049568 | Ga0501031_0016869 | Ga0501031_0016869_2718_3308 | 196 |
| 1134 | 3300049663 | Ga0501223_044236 | Ga0501223_044236_127_717 | 196 |
| 1135 | 3300049759 | Ga0501262_000181 | Ga0501262_000181_6466_7056 | 196 |
| 1136 | 3300049763 | Ga0501266_003400 | Ga0501266_003400_257_847 | 196 |
| 1137 | 3300050489 | nmdc:mga03683_168245_c1 | nmdc:mga03683_168245_c1_316_906 | 196 |
| 1138 | 3300050489 | nmdc:mga03683_4655_c1 | nmdc:mga03683_4655_c1_284_874 | 196 |
| 1139 | 3300050489 | nmdc:mga03683_80324_c1 | nmdc:mga03683_80324_c1_372_962 | 196 |
| 1140 | 3300050490 | nmdc:mga03n38_14169_c1 | nmdc:mga03n38_14169_c1_2280_2870 | 196 |
| 1141 | 3300050490 | nmdc:mga03n38_287493_c1 | nmdc:mga03n38_287493_c1_19_609 | 196 |
| 1142 | 3300050490 | nmdc:mga03n38_318641_c1 | nmdc:mga03n38_318641_c1_79_705 | 196 |
| 1143 | 3300050490 | nmdc:mga03n38_322053_c1 | nmdc:mga03n38_322053_c1_217_807 | 196 |
| 1144 | 3300050491 | nmdc:mga00v17_18255_c1 | nmdc:mga00v17_18255_c1_758_1348 | 196 |
| 1145 | 3300050491 | nmdc:mga00v17_21586_c1 | nmdc:mga00v17_21586_c1_1871_2461 | 196 |
| 1146 | 3300050491 | nmdc:mga00v17_501477_c1 | nmdc:mga00v17_501477_c1_124_750 | 196 |
| 1147 | 3300050492 | nmdc:mga0yw44_99857_c1 | nmdc:mga0yw44_99857_c1_1242_1832 | 196 |
| 1148 | 3300050493 | nmdc:mga0k408_27872_c1 | nmdc:mga0k408_27872_c1_1819_2409 | 196 |
| 1149 | 3300050494 | nmdc:mga06z11_157361_c1 | nmdc:mga06z11_157361_c1_138_728 | 196 |
| 1150 | 3300050496 | nmdc:mga07m45_151297_c1 | nmdc:mga07m45_151297_c1_745_1335 | 196 |
| 1151 | 3300050496 | nmdc:mga07m45_153943_c1 | nmdc:mga07m45_153943_c1_41_631 | 196 |
| 1152 | 3300050496 | nmdc:mga07m45_33307_c1 | nmdc:mga07m45_33307_c1_320_910 | 196 |
| 1153 | 3300050496 | nmdc:mga07m45_336911_c1 | nmdc:mga07m45_336911_c1_83_709 | 196 |
| 1154 | 3300050496 | nmdc:mga07m45_7015_c1 | nmdc:mga07m45_7015_c1_2066_2656 | 196 |
| 1155 | 3300050496 | nmdc:mga07m45_9064_c1 | nmdc:mga07m45_9064_c1_3584_4174 | 196 |
| 1156 | 3300050496 | nmdc:mga07m45_9089_c1 | nmdc:mga07m45_9089_c1_2802_3392 | 196 |
| 1157 | 3300050516 | nmdc:mga0sz30_23985_c1 | nmdc:mga0sz30_23985_c1_849_1439 | 196 |
| 1158 | 3300050516 | nmdc:mga0sz30_296530_c1 | nmdc:mga0sz30_296530_c1_39_629 | 196 |
| 1159 | 3300053079 | Ga0500610_0005460 | Ga0500610_0005460_2265_2855 | 196 |
| 1160 | 3300053079 | Ga0500610_0009289 | Ga0500610_0009289_303_893 | 196 |
| 1161 | 3300053087 | Ga0500643_004846 | Ga0500643_004846_1051_1641 | 196 |
| 1162 | 3300053088 | Ga0500644_0113281 | Ga0500644_0113281_362_988 | 196 |
| 1163 | 3300053088 | Ga0500644_0114356 | Ga0500644_0114356_152_742 | 196 |
| 1164 | 3300053094 | Ga0500566_0096110 | Ga0500566_0096110_983_1573 | 196 |
| 1165 | 3300053108 | Ga0500562_014934 | Ga0500562_014934_463_1053 | 196 |
| 1166 | 3300053110 | Ga0500571_000080 | Ga0500571_000080_27946_28536 | 196 |
| 1167 | 3300053117 | Ga0500593_000694 | Ga0500593_000694_9135_9761 | 196 |
| 1168 | 3300053117 | Ga0500593_004435 | Ga0500593_004435_2981_3571 | 196 |
| 1169 | 3300053118 | Ga0500594_0003168 | Ga0500594_0003168_1584_2174 | 196 |
| 1170 | 3300053120 | Ga0500597_193218 | Ga0500597_193218_101_691 | 196 |
| 1171 | 3300053121 | Ga0500607_010298 | Ga0500607_010298_3078_3668 | 196 |
| 1172 | 3300053121 | Ga0500607_017986 | Ga0500607_017986_2143_2733 | 196 |
| 1173 | 3300053122 | Ga0500608_037758 | Ga0500608_037758_1364_1954 | 196 |
| 1174 | 3300053122 | Ga0500608_045642 | Ga0500608_045642_338_928 | 196 |
| 1175 | 3300053122 | Ga0500608_096081 | Ga0500608_096081_190_780 | 196 |
| 1176 | 3300053125 | Ga0500618_024750 | Ga0500618_024750_143_733 | 196 |
| 1177 | 3300053128 | Ga0500626_152735 | Ga0500626_152735_210_800 | 196 |
| 1178 | 3300053129 | Ga0500628_042312 | Ga0500628_042312_106_732 | 196 |
| 1179 | 3300053133 | Ga0500655_001531 | Ga0500655_001531_1251_1841 | 196 |
| 1180 | 3300053134 | Ga0500658_0000210 | Ga0500658_0000210_25377_25967 | 196 |
| 1181 | 3300053134 | Ga0500658_0000493 | Ga0500658_0000493_14516_15106 | 196 |
| 1182 | 3300053136 | Ga0500559_0010425 | Ga0500559_0010425_1577_2167 | 196 |
| 1183 | 3300053138 | Ga0500564_018756 | Ga0500564_018756_1523_2113 | 196 |
| 1184 | 3300053139 | Ga0500568_0001699 | Ga0500568_0001699_10491_11081 | 196 |
| 1185 | 3300053141 | Ga0500574_054872 | Ga0500574_054872_378_968 | 196 |
| 1186 | 3300053151 | Ga0500604_0082388 | Ga0500604_0082388_94_720 | 196 |
| 1187 | 3300053153 | Ga0500616_0031819 | Ga0500616_0031819_1278_1868 | 196 |
| 1188 | 3300053158 | Ga0500627_0017357 | Ga0500627_0017357_2121_2711 | 196 |
| 1189 | 3300053161 | Ga0500634_0005197 | Ga0500634_0005197_4220_4810 | 196 |
| 1190 | 3300053161 | Ga0500634_0006307 | Ga0500634_0006307_3360_3950 | 196 |
| 1191 | 3300053730 | Ga0500645_000769 | Ga0500645_000769_689_1315 | 196 |
| 1192 | 3300053730 | Ga0500645_007527 | Ga0500645_007527_2359_2985 | 196 |
| 1193 | 3300053730 | Ga0500645_012144 | Ga0500645_012144_1808_2434 | 196 |
| 1194 | 3300053734 | Ga0500565_001904 | Ga0500565_001904_735_1325 | 196 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8a93-assembly1.cif.gz_F | complex of recf-recr-dna from thermus thermophilus. | 0.9437 | 81 | 169 |
| 8a93-assembly1.cif.gz_F | complex of recf-recr-dna from thermus thermophilus. | 0.904 | 81 | 169 |
| 8a93-assembly1.cif.gz_D | complex of recf-recr-dna from thermus thermophilus. | 0.8863 | 6 | 47 |
| 8ab0-assembly1.cif.gz_F | complex of reco-recr-dna from thermus thermophilus. | 0.8628 | 6 | 169 |
| 8ab0-assembly1.cif.gz_F | complex of reco-recr-dna from thermus thermophilus. | 0.8477 | 6 | 169 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WHI3_76_174_3.40.1360.10 | Alpha Beta;3-Layer(aba) Sandwich;Dna Topoisomerase Vi A Subunit; Chain: A, domain 2; | 0.9511 | 77 | 170 | 3.40.1360.10 |
| af_P0A7H6_77_171_3.40.1360.10 | Alpha Beta;3-Layer(aba) Sandwich;Dna Topoisomerase Vi A Subunit; Chain: A, domain 2; | 0.9466 | 76 | 170 | 3.40.1360.10 |
| af_P0A7H6_77_171_3.40.1360.10 | Alpha Beta;3-Layer(aba) Sandwich;Dna Topoisomerase Vi A Subunit; Chain: A, domain 2; | 0.9371 | 76 | 170 | 3.40.1360.10 |
| 1vddC03 | Alpha Beta;3-Layer(aba) Sandwich;Dna Topoisomerase Vi A Subunit; Chain: A, domain 2; | 0.9196 | 77 | 170 | 3.40.1360.10 |
| 1vddC03 | Alpha Beta;3-Layer(aba) Sandwich;Dna Topoisomerase Vi A Subunit; Chain: A, domain 2; | 0.9102 | 77 | 170 | 3.40.1360.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A5C6XXY0-F1-model_v4 | deleted | 0.986 | 2 | 149 |
|
| AF-A0A3B9BGG3-F1-model_v4 | Recombination protein RecR | 0.9857 | 69 | 154 |
GO:0003677
GO:0006281 GO:0006310 GO:0046872 |
| AF-A0A6P1B0M1-F1-model_v4 | deleted | 0.9844 | 59 | 152 |
|
| AF-A0A5C6ZBJ8-F1-model_v4 | Recombination protein RecR | 0.9808 | 5 | 169 |
GO:0003677
GO:0006281 GO:0006310 GO:0046872 |
| AF-A0A520GTN9-F1-model_v4 | Recombination protein RecR | 0.9752 | 1 | 109 |
GO:0003677
GO:0006281 GO:0006310 GO:0046872 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar