metagRoot

F490532

General Info

Members	Datasets	Scaffolds	Average Seq Length
1130	609	968	92

Family's Representative Sequence

Representative Sequence	3300009094\|Ga0111539_11243213\|Ga0111539_112432132
Length	109
Sequence	MGRSTRKGYYIDGHLLNKVRVAAETRDRRVLRTWSRRSTIIPQMVGLTIAVHNGTKFIPIYVSENMVGHKLGEFAQTRTFRGHSGAGSKTEKRAAPRAGAPGGPGADRG

Samples

	Sample ID	Description	Type	Environment
1	2010549000	Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes	Metagenome	Endosphere
2	2506520007	Serratia plymuthica AS9	Isolate	Rhizosphere
3	2506520008	Serratia plymuthica AS12	Isolate	Unclassified
4	2508501071	Serratia proteamaculans S4	Isolate	Rhizosphere
5	2511231025	Pantoea sp. YR343	Isolate	Rhizosphere
6	2511231035	Pantoea sp. GM01	Isolate	Rhizosphere
7	2523533628	Maridesulfovibrio zosterae DSM 11974	Isolate	Rhizosphere
8	2537561728	Pectobacterium wasabiae CFBP 3304	Isolate	Rhizoplane
9	2547132181	Kosakonia sacchari SP1	Isolate	Stem
10	2547132416	Enterobacter sp. MR1	Isolate	Rhizoplane
11	2554235234	Klebsiella michiganensis SA2	Isolate	Unclassified
12	2561511199	Enterobacter sp. R4-368	Isolate	Nodule
13	2565956521	Vibrio rhizosphaerae DSM 18581	Isolate	Rhizosphere
14	2585427591	Rahnella aquatilis OV744	Isolate	Rhizosphere
15	2585427592	Rahnella aquatilis OV588	Isolate	Rhizosphere
16	2599185169	Klebsiella quasipneumoniae NFPP35	Isolate	Rhizoplane
17	2599185299	Pantoea ananatis NFR11	Isolate	Rhizoplane
18	2600255254	Klebsiella quasipneumoniae NFIX15	Isolate	Rhizoplane
19	2600255255	Klebsiella quasipneumoniae NFIX23	Isolate	Rhizoplane
20	2600255256	Enterobacter sp. NFIX08	Isolate	Rhizoplane
21	2600255257	Enterobacter sp. NFIX03	Isolate	Rhizoplane
22	2600255280	Klebsiella quasipneumoniae NFIX42	Isolate	Rhizoplane
23	2600255281	Klebsiella quasipneumoniae NFIX43	Isolate	Rhizoplane
24	2600255287	Klebsiella quasipneumoniae NFIX11	Isolate	Rhizoplane
25	2600255288	Klebsiella quasipneumoniae NFIX14	Isolate	Rhizoplane
26	2600255289	Klebsiella quasipneumoniae NFIX16	Isolate	Rhizoplane
27	2600255290	Klebsiella quasipneumoniae NFIX17	Isolate	Rhizoplane
28	2600255291	Klebsiella quasipneumoniae NFIX19	Isolate	Rhizoplane
29	2600255298	Klebsiella quasipneumoniae NFIX21	Isolate	Rhizoplane
30	2600255299	Klebsiella quasipneumoniae NFIX22	Isolate	Rhizoplane
31	2600255300	Klebsiella quasipneumoniae NFIX30	Isolate	Rhizoplane
32	2600255301	Klebsiella quasipneumoniae NFIX33	Isolate	Rhizoplane
33	2600255302	Klebsiella quasipneumoniae NFIX35	Isolate	Rhizoplane
34	2600255303	Klebsiella quasipneumoniae NFIX36	Isolate	Rhizoplane
35	2600255304	Klebsiella quasipneumoniae NFIX37	Isolate	Rhizoplane
36	2600255305	Klebsiella quasipneumoniae NFIX41	Isolate	Rhizoplane
37	2600255306	Klebsiella quasipneumoniae NFIX44	Isolate	Rhizoplane
38	2600255307	Klebsiella quasipneumoniae NFIX56	Isolate	Rhizoplane
39	2600255309	Klebsiella sp. NFIX53	Isolate	Rhizoplane
40	2600255310	Enterobacter sp. NFIX06	Isolate	Rhizoplane
41	2600255311	Enterobacter sp. NFIX04	Isolate	Rhizoplane
42	2600255392	Klebsiella quasipneumoniae NFIX54	Isolate	Rhizoplane
43	2602042046	Enterobacter sp. NFIX09	Isolate	Rhizoplane
44	2602042047	Enterobacter sp. NFIX59	Isolate	Rhizoplane
45	2602042052	Klebsiella quasipneumoniae NFIX18	Isolate	Rhizoplane
46	2602042053	Klebsiella quasipneumoniae NFIX12	Isolate	Rhizoplane
47	2602042066	Enterobacter sp. NFIX45	Isolate	Rhizoplane
48	2602042067	Enterobacter sp. NFIX58	Isolate	Rhizoplane
49	2602042103	Klebsiella quasipneumoniae NFIX29	Isolate	Rhizoplane
50	2602042104	Klebsiella quasipneumoniae NFIX26	Isolate	Rhizoplane
51	2602042105	Klebsiella quasipneumoniae NFIX25	Isolate	Rhizoplane
52	2602042106	Klebsiella quasipneumoniae NFIX13	Isolate	Rhizoplane
53	2602042109	Klebsiella aerogenes NFIX39	Isolate	Rhizoplane
54	2602042110	Klebsiella quasipneumoniae NFIX40	Isolate	Rhizoplane
55	2602042111	Klebsiella quasipneumoniae NFIX20	Isolate	Rhizoplane
56	2603880178	Klebsiella quasipneumoniae NFIX34	Isolate	Rhizoplane
57	2603880184	Klebsiella quasipneumoniae NFIX27	Isolate	Rhizoplane
58	2603880202	Klebsiella quasipneumoniae NFIX38	Isolate	Rhizoplane
59	2603880211	Klebsiella quasipneumoniae NFIX24	Isolate	Rhizoplane
60	2608642108	Pantoea agglomerans NFPP29	Isolate	Rhizoplane
61	2609459761	Enterobacter sp. NFR05	Isolate	Rhizoplane
62	2636415599	Klebsiella variicola DX120E	Isolate	Unclassified
63	2648501241	Vibrio splendidus UCD-SED7	Isolate	Rhizosphere
64	2648501693	Pantoea ananatis B1-9	Isolate	Rhizosphere
65	2651869818	Vibrio splendidus UCD-SED10	Isolate	Rhizosphere
66	2654587920	Serratia plymuthica HRO-C48	Isolate	Rhizosphere
67	2667528172	Enterobacteriaceae bacterium NFIX31	Isolate	Rhizoplane
68	2667528173	Rahnella sp. NFIX50	Isolate	Rhizoplane
69	2671180115	Cedecea sp. NFIX57	Isolate	Rhizoplane
70	2675903046	Klebsiella quasipneumoniae NFIX52	Isolate	Rhizoplane
71	2681812866	Enterobacter asburiae NFIX55	Isolate	Rhizoplane
72	2681812869	Enterobacter ludwigii NFPP41	Isolate	Rhizoplane
73	2684622997	Pantoea ananatis NFIX48	Isolate	Rhizoplane
74	2687453601	Serratia plymuthica 3Rp8	Isolate	Unclassified
75	2690315857	Rheinheimera sp. EpRS3	Isolate	Unclassified
76	2706794495	Dickeya zeae ZJU1202	Isolate	Unclassified
77	2711768156	Atlantibacter hermannii DDE1	Isolate	Unclassified
78	2740891818	Desulfofaba hansenii DSM 12642	Isolate	Unclassified
79	2751185917	Enterobacter sp. HK169	Isolate	Unclassified
80	2765235842	Enterobacter ludwigii AA4	Isolate	Unclassified
81	2772190666	Serratia surfactantfaciens YD25	Isolate	Unclassified
82	2775506706	Enterobacter asburiae 1216	Isolate	Unclassified
83	2775507074	Klebsiella sp. D5A	Isolate	Unclassified
84	2791354903	Mangrovibacter phragmitis MP23	Isolate	Unclassified
85	2791355010	Kosakonia pseudosacchari NN143	Isolate	Unclassified
86	2791355275	Enterobacter sp. Sa187	Isolate	Unclassified
87	2806310673	Serratia quinivorans NCTC 13189	Isolate	Rhizosphere
88	2808606414	Pantoea sp. SJZ147	Isolate	Rhizosphere
89	2811995292	Kosakonia oryzae Ola 51	Isolate	Unclassified
90	2814123068	Kosakonia radicincitans GXGL-4A	Isolate	Rhizosphere
91	2821118458	Enterobacter asburiae 609	Isolate	Unclassified
92	2823373977	Enterobacter ludwigii NCR3	Isolate	Rhizosphere
93	2844425489	Enterobacter cloacae SBP-8	Isolate	Rhizosphere
94	2844528606	Pantoea sp. R-72498 v. 2	Isolate	Unclassified
95	2846540461	Photorhabdus luminescens HIM3	Isolate	Rhizosphere
96	2847085930	Erwinia persicina B64	Isolate	Bulb
97	2847797336	Pantoea ananatis NN08200	Isolate	Unclassified
98	2852103415	Edaphovirga cremea DSM 105170	Isolate	Rhizosphere
99	2854601825	Dickeya dianthicola SS70	Isolate	Stem Tuber
100	2855195626	Pectobacterium atrosepticum SS26	Isolate	Stem Tuber
101	2858466076	Pectobacterium polaris SS28	Isolate	Stem Tuber
102	2865014394	Pantoea sp. R-71966	Isolate	Unclassified
103	2869551831	Serratia inhibens PRI-2C	Isolate	Rhizosphere
104	2871272651	Pectobacterium carotovorum SS96	Isolate	Stem Tuber
105	2871282230	Pectobacterium parmentieri SS90	Isolate	Stem Tuber
106	2876601092	Pantoea endophytica 596	Isolate	Unclassified
107	2881609920	Pantoea sp. ARC607	Isolate	Rhizosphere
108	2884086401	Kluyvera sp. PO2S7	Isolate	Rhizosphere
109	2887630918	Psychrosphaera haliotis UCD-MCMsp1aY	Isolate	Unclassified
110	2888366609	Serratia sp. NGAS9	Isolate	Rhizosphere
111	2888373701	Serratia rhizosphaerae KUDC3025	Isolate	Rhizosphere
112	2891670763	Buttiauxella sp. B2	Isolate	Rhizosphere
113	2904474040	Rahnella aquatilis 4485	Isolate	Rhizosphere
114	2904504865	Serratia marcescens 1822	Isolate	Unclassified
115	2904513164	Klebsiella variicola 1431	Isolate	Rhizosphere
116	2908669403	Pantoea coffeiphila 1480	Isolate	Rhizosphere
117	2919108558	Klebsiella sp. 1400	Isolate	Rhizosphere
118	2919150387	Rahnella aceris 1817	Isolate	Unclassified
119	2919493220	Aeromonas salmonicida salmonicida 3466	Isolate	Unclassified
120	2919497567	Shewanella putrefaciens 3469	Isolate	Unclassified
121	2919534386	Rheinheimera pacifica 3879	Isolate	Unclassified
122	2919543075	Aeromonas salmonicida masoucida 4076	Isolate	Unclassified
123	2923525760	Aeromonas caviae SLBN-129	Isolate	Rhizosphere
124	2923634449	Enterobacter kobei SLBN-76	Isolate	Rhizosphere
125	2927143783	Rahnella sp. 2050	Isolate	Unclassified
126	2927833300	Enterobacter sp. SLBN-59	Isolate	Rhizosphere
127	2932406140	Serratia sp. 2723	Isolate	Rhizosphere
128	2935625433	Kosakonia sp. 1610	Isolate	Rhizosphere
129	2937539931	Pantoea sp. LS15	Isolate	Unclassified
130	2937967321	Serratia sp. YC16	Isolate	Unclassified
131	2939568625	Lelliottia sp. 489	Isolate	Rhizosphere
132	2939573065	Citrobacter sp. 506	Isolate	Rhizosphere
133	2939577877	Serratia sp. 509	Isolate	Rhizosphere
134	2939602548	Pantoea dispersa 1175	Isolate	Rhizosphere
135	2939607340	Leclercia sp. 1548	Isolate	Rhizosphere
136	2939617950	Kosakonia cowanii 2056	Isolate	Rhizosphere
137	2939642701	Lelliottia nimipressuralis 2756	Isolate	Rhizosphere
138	2945874760	Phytobacter diazotrophicus UAEU22	Isolate	Rhizosphere
139	2945951305	Pantoea agglomerans W2I1	Isolate	Rhizosphere
140	2969079654	Klebsiella variicola E57-7	Isolate	Unclassified
141	2971820967	Klebsiella sp. MPUS7	Isolate	Rhizosphere
142	2974310843	Enterobacter sp. SORGH_AS 287	Isolate	Unclassified
143	2974435778	Kosakonia cowanii SORGH_AS 304	Isolate	Unclassified
144	2978975091	Pantoea anthophila SORGH_AS 797	Isolate	Unclassified
145	2984494565	Pantoea ananatis SORGH_AS197	Isolate	Aerial Root
146	2984559226	Klebsiella variicola SORGH_AS834	Isolate	Aerial Root
147	2984595703	Klebsiella variicola SORGH_AS1070	Isolate	Aerial Root
148	2990261002	Pantoea ananatis SORGH_AS213	Isolate	Aerial Root
149	3000376612	Enterobacteriaceae bacterium 4M9	Isolate	Rhizosphere
150	3300001904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2	Metagenome	Rhizosphere
151	3300002067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1	Metagenome	Rhizosphere
152	3300002077	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3	Metagenome	Rhizosphere
153	3300002737	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA	Metagenome	Endosphere
154	3300002771	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB	Metagenome	Endosphere
155	3300002772	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS	Metagenome	Endosphere
156	3300002773	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS	Metagenome	Endosphere
157	3300003320	Sugarcane root Sample H2	Metagenome	Unclassified
158	3300003578	Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only)	Metatranscriptome	Unclassified
159	3300003693	Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
160	3300003751	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2	Metagenome	Endosphere
161	3300003752	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2	Metagenome	Endosphere
162	3300003756	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2	Metagenome	Endosphere
163	3300003759	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2	Metagenome	Endosphere
164	3300003841	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2	Metagenome	Endosphere
165	3300003856	Agave microbial communities from Guanajuato, Mexico - At.Am.rz	Metagenome	Rhizosphere
166	3300004785	Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-1 (Metagenome Metatranscriptome)	Metatranscriptome	Unclassified
167	3300004798	Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome)	Metatranscriptome	Unclassified
168	3300004799	Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
169	3300004801	Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome)	Metatranscriptome	Unclassified
170	3300005272	Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1	Metagenome	Rhizosphere
171	3300005288	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2)	Metagenome	Rhizosphere
172	3300005289	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2)	Metagenome	Rhizosphere
173	3300005295	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2)	Metagenome	Rhizosphere
174	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
175	3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Metagenome	Rhizosphere
176	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
177	3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Metagenome	Rhizosphere
178	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
179	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
180	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
181	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
182	3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Metagenome	Rhizosphere
183	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
184	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
185	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
186	3300005341	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG	Metagenome	Rhizosphere
187	3300005343	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG	Metagenome	Rhizosphere
188	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
189	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
190	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
191	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
192	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
193	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
194	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
195	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
196	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
197	3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Metagenome	Rhizosphere
198	3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Metagenome	Rhizosphere
199	3300005437	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG	Metagenome	Rhizosphere
200	3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Metagenome	Rhizosphere
201	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
202	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
203	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
204	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
205	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
206	3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Metagenome	Rhizosphere
207	3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Metagenome	Rhizosphere
208	3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Metagenome	Rhizosphere
209	3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Metagenome	Rhizosphere
210	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
211	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
212	3300005536	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG	Metagenome	Rhizosphere
213	3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Metagenome	Rhizosphere
214	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
215	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
216	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
217	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
218	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
219	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
220	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
221	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
222	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
223	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
224	3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Metagenome	Rhizosphere
225	3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Metagenome	Rhizosphere
226	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
227	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
228	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
229	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
230	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
231	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
232	3300006058	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1	Metagenome	Rhizosphere
233	3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Metagenome	Rhizosphere
234	3300006178	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Metagenome	Endosphere
235	3300006195	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1	Metagenome	Endosphere
236	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
237	3300006353	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5	Metagenome	Endosphere
238	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
239	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
240	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
241	3300006852	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Metagenome	Rhizosphere
242	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
243	3300006880	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Metagenome	Rhizosphere
244	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
245	3300006914	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Metagenome	Rhizosphere
246	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
247	3300006946	Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG	Metagenome	Nodule
248	3300007076	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Metagenome	Rhizosphere
249	3300007265	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1	Metagenome	Rhizosphere
250	3300007788	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2	Metagenome	Rhizosphere
251	3300009011	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG	Metagenome	Rhizosphere
252	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
253	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
254	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
255	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
256	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
257	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
258	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
259	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
260	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
261	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
262	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
263	3300009828	Sorghum rhizosphere soil microbial communities in Albany, CA(condition:control)- sample E	Metatranscriptome	Rhizosphere
264	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
265	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
266	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
267	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
268	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
269	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
270	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
271	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
272	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
273	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
274	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
275	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
276	3300014497	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG	Metagenome	Rhizosphere
277	3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Metagenome	Rhizosphere
278	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
279	3300015261	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG	Metagenome	Rhizosphere
280	3300015262	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG	Metagenome	Rhizosphere
281	3300015679	Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.4_F08	Metagenome	Unclassified
282	3300015680	Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.2_H03	Metagenome	Rhizosphere
283	3300015685	Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12	Metagenome	Unclassified
284	3300015687	Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08	Metagenome	Rhizosphere
285	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
286	3300020070	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
287	3300020077	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
288	3300020078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
289	3300020081	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
290	3300020082	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
291	3300020610	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
292	3300021384	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9	Metagenome	Unclassified
293	3300022467	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
294	3300023304	Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.ctno.R1	Metatranscriptome	Rhizosphere
295	3300023309	Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B2.ctcc.R1	Metatranscriptome	Rhizosphere
296	3300023438	Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B2.stcc	Metatranscriptome	Rhizosphere
297	3300025207	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2)	Metagenome	Endosphere
298	3300025224	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
299	3300025225	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
300	3300025226	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
301	3300025230	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2)	Metagenome	Endosphere
302	3300025231	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2)	Metagenome	Endosphere
303	3300025245	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3)	Metagenome	Endosphere
304	3300025253	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
305	3300025258	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3)	Metagenome	Endosphere
306	3300025261	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2)	Metagenome	Endosphere
307	3300025304	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
308	3300025315	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2)	Metagenome	Rhizosphere
309	3300025321	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
310	3300025711	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
311	3300025728	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
312	3300025735	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
313	3300025900	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
314	3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
315	3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2)	Metagenome	Rhizosphere
316	3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
317	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
318	3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
319	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
320	3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
321	3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
322	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
323	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
324	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
325	3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
326	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
327	3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
328	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
329	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
330	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
331	3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
332	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
333	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
334	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
335	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
336	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
337	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
338	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
339	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
340	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
341	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
342	3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
343	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
344	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
345	3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
346	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
347	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
348	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
349	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
350	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
351	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
352	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
353	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
354	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
355	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
356	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
357	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
358	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
359	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
360	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
361	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
362	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
363	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
364	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
365	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
366	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
367	3300027111	Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2)	Metagenome	Nodule
368	3300027312	Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2)	Metagenome	Rhizosphere
369	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
370	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
371	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
372	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
373	3300028558	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG	Metagenome	Rhizosphere
374	3300028573	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG	Metagenome	Rhizosphere
375	3300028577	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG	Metagenome	Rhizosphere
376	3300028800	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG	Metagenome	Rhizosphere
377	3300029276	Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B1.ctcc.R1	Metatranscriptome	Rhizosphere
378	3300029277	Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.ctcc.R1	Metatranscriptome	Rhizosphere
379	3300030500	Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3)	Metagenome	Rhizosphere
380	3300030733	Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2	Metagenome	Rhizosphere
381	3300030742	Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9	Metagenome	Rhizosphere
382	3300031241	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG	Metagenome	Rhizosphere
383	3300031249	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG	Metagenome	Rhizosphere
384	3300031344	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG	Metagenome	Rhizosphere
385	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
386	3300031595	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG	Metagenome	Rhizosphere
387	3300031665	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3	Metagenome	Rhizosphere
388	3300031691	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA	Metagenome	Rhizosphere
389	3300031727	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5	Metagenome	Rhizosphere
390	3300031728	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC	Metagenome	Rhizosphere
391	3300031730	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM	Metagenome	Unclassified
392	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
393	3300031733	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1	Metagenome	Rhizosphere
394	3300031903	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1	Metagenome	Rhizosphere
395	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
396	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
397	3300032133	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA	Metagenome	Rhizosphere
398	3300032137	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC	Metagenome	Rhizosphere
399	3300032139	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB	Metagenome	Rhizosphere
400	3300032168	Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
401	3300033524	Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
402	3300033527	Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
403	3300033528	Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
404	3300033529	Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
405	3300033541	Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
406	3300035085	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2	Metagenome	Rhizosphere
407	3300035090	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2	Metagenome	Rhizosphere
408	3300035115	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11	Metagenome	Rhizosphere
409	3300035170	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1	Metagenome	Rhizosphere
410	3300035398	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1	Metagenome	Rhizosphere
411	3300035692	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11	Metagenome	Rhizosphere
412	3300035725	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8	Metagenome	Rhizosphere
413	3300036647	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA	Metagenome	Rhizosphere
414	3300036712	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA	Metagenome	Rhizosphere
415	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
416	3300037312	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2	Metagenome	Rhizosphere
417	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
418	3300037588	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA	Metagenome	Rhizosphere
419	3300038725	Seagrass microbial communities from Seahorse Key, FL, USA - HV0818	Metagenome	Unclassified
420	3300038726	Seagrass microbial communities from Seahorse Key, FL, USA - TH0319	Metagenome	Unclassified
421	3300038727	Seagrass microbial communities from Seahorse Key, FL, USA - TV0818	Metagenome	Unclassified
422	3300038735	Seagrass microbial communities from Seahorse Key, FL, USA - SH0319	Metagenome	Unclassified
423	3300038741	Seagrass microbial communities from Seahorse Key, FL, USA - SV0818	Metagenome	Unclassified
424	3300038742	Seagrass microbial communities from Seahorse Key, FL, USA - SH0818	Metagenome	Unclassified
425	3300039062	Seagrass microbial communities from Seahorse Key, FL, USA - HH0818	Metagenome	Unclassified
426	3300039093	Seagrass microbial communities from Seahorse Key, FL, USA - TH0818	Metagenome	Unclassified
427	3300039110	Seagrass microbial communities from Seahorse Key, FL, USA - SV0319	Metagenome	Unclassified
428	3300039437	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2	Metagenome	Unclassified
429	3300041404	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272	Metagenome	Rhizosphere
430	3300041405	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414	Metagenome	Rhizosphere
431	3300041407	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416	Metagenome	Rhizosphere
432	3300041408	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195	Metagenome	Rhizosphere
433	3300041411	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708	Metagenome	Rhizosphere
434	3300041443	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG	Metagenome	Rhizoplane
435	3300041444	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaT	Metatranscriptome	Rhizoplane
436	3300041453	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG	Metagenome	Rhizoplane
437	3300041460	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG	Metagenome	Rhizoplane
438	3300041461	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT	Metatranscriptome	Rhizoplane
439	3300041486	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG	Metagenome	Rhizoplane
440	3300041491	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG	Metagenome	Unclassified
441	3300041492	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG	Metagenome	Unclassified
442	3300041494	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG	Metagenome	Unclassified
443	3300041498	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG	Metagenome	Unclassified
444	3300041501	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG	Metagenome	Unclassified
445	3300041505	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG	Metagenome	Unclassified
446	3300041509	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG	Metagenome	Unclassified
447	3300041510	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaT	Metatranscriptome	Unclassified
448	3300041512	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG	Metagenome	Unclassified
449	3300041916	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaT_extra_run	Metatranscriptome	Unclassified
450	3300041997	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607	Metagenome	Rhizosphere
451	3300042000	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539	Metagenome	Rhizosphere
452	3300042006	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437	Metagenome	Rhizosphere
453	3300042008	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219	Metagenome	Rhizosphere
454	3300042010	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431	Metagenome	Rhizosphere
455	3300042016	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357	Metagenome	Rhizosphere
456	3300042115	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642	Metagenome	Rhizosphere
457	3300042121	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398	Metagenome	Rhizosphere
458	3300042125	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472	Metagenome	Rhizosphere
459	3300042136	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294	Metagenome	Rhizosphere
460	3300042137	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519	Metagenome	Rhizosphere
461	3300042139	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442	Metagenome	Rhizosphere
462	3300042142	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610	Metagenome	Rhizosphere
463	3300042146	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979	Metagenome	Rhizosphere
464	3300042156	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593	Metagenome	Rhizosphere
465	3300042435	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613	Metagenome	Rhizosphere
466	3300042438	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533	Metagenome	Rhizosphere
467	3300042439	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363	Metagenome	Rhizosphere
468	3300042531	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253	Metagenome	Rhizosphere
469	3300042876	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED	Metagenome	Rhizosphere
470	3300044650	Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4E	Metagenome	Unclassified
471	3300044669	Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2E	Metagenome	Unclassified
472	3300044673	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED	Metagenome	Rhizosphere
473	3300044712	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED	Metagenome	Rhizosphere
474	3300044735	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R	Metagenome	Rhizosphere
475	3300044765	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R	Metagenome	Rhizosphere
476	3300044842	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R	Metagenome	Rhizosphere
477	3300045051	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED	Metagenome	Rhizosphere
478	3300046453	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere	Metagenome	Rhizosphere
479	3300046458	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere	Metagenome	Rhizosphere
480	3300046460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere	Metagenome	Rhizosphere
481	3300046471	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere	Metagenome	Rhizosphere
482	3300046474	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere	Metagenome	Rhizosphere
483	3300046491	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere	Metagenome	Rhizosphere
484	3300046492	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere	Metagenome	Rhizosphere
485	3300046500	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere	Metagenome	Rhizosphere
486	3300046501	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere	Metagenome	Rhizosphere
487	3300046507	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere	Metagenome	Rhizosphere
488	3300046511	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere	Metagenome	Rhizosphere
489	3300046513	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere	Metagenome	Rhizosphere
490	3300046515	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere	Metagenome	Rhizosphere
491	3300046517	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere	Metagenome	Rhizosphere
492	3300046518	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere	Metagenome	Rhizosphere
493	3300046519	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere	Metagenome	Rhizosphere
494	3300046522	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere	Metagenome	Rhizosphere
495	3300046523	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere	Metagenome	Rhizosphere
496	3300046524	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere	Metagenome	Rhizosphere
497	3300046526	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere	Metagenome	Rhizosphere
498	3300046530	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere	Metagenome	Rhizosphere
499	3300046538	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere	Metagenome	Rhizosphere
500	3300046539	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere	Metagenome	Rhizosphere
501	3300046542	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere	Metagenome	Rhizosphere
502	3300046616	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere	Metagenome	Rhizosphere
503	3300046660	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere	Metagenome	Rhizosphere
504	3300046674	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere	Metagenome	Rhizosphere
505	3300046679	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere	Metagenome	Rhizosphere
506	3300046692	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere	Metagenome	Rhizosphere
507	3300046694	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere	Metagenome	Rhizosphere
508	3300046794	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere	Metagenome	Rhizosphere
509	3300046810	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere	Metagenome	Rhizosphere
510	3300047318	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere	Metagenome	Rhizosphere
511	3300047320	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere	Metagenome	Rhizosphere
512	3300047323	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere	Metagenome	Rhizosphere
513	3300047446	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere	Metagenome	Rhizosphere
514	3300047469	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere	Metagenome	Rhizosphere
515	3300047470	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere	Metagenome	Rhizosphere
516	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
517	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
518	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
519	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
520	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
521	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
522	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
523	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
524	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
525	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
526	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
527	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
528	3300048919	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled	Metagenome	Unclassified
529	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
530	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
531	3300048922	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15	Metagenome	Unclassified
532	3300048923	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15	Metagenome	Unclassified
533	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
534	3300048925	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled	Metagenome	Unclassified
535	3300048926	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled	Metagenome	Unclassified
536	3300048927	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15	Metagenome	Unclassified
537	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
538	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
539	3300049127	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
540	3300049162	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
541	3300049459	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere	Metagenome	Rhizosphere
542	3300049460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere	Metagenome	Rhizosphere
543	3300049519	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought	Metagenome	Rhizosphere
544	3300049550	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
545	3300049569	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02	Metagenome	Rhizosphere
546	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
547	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
548	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
549	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
550	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
551	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
552	3300049576	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01	Metagenome	Rhizosphere
553	3300049577	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02	Metagenome	Rhizosphere
554	3300049578	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03	Metagenome	Rhizosphere
555	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
556	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
557	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
558	3300049584	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02	Metagenome	Rhizosphere
559	3300049585	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03	Metagenome	Rhizosphere
560	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
561	3300049587	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02	Metagenome	Rhizosphere
562	3300049588	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03	Metagenome	Rhizosphere
563	3300049590	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02	Metagenome	Rhizosphere
564	3300049591	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03	Metagenome	Rhizosphere
565	3300049592	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01	Metagenome	Rhizosphere
566	3300049593	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02	Metagenome	Rhizosphere
567	3300049741	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01	Metagenome	Rhizosphere
568	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
569	3300049743	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03	Metagenome	Rhizosphere
570	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
571	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
572	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
573	3300049824	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03	Metagenome	Rhizosphere
574	3300049853	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought	Metagenome	Rhizosphere
575	3300050490	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation	Metagenome	Endosphere
576	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
577	3300050493	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation	Metagenome	Endosphere
578	3300050494	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation	Metagenome	Endosphere
579	3300050496	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation	Metagenome	Endosphere
580	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
581	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
582	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
583	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
584	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
585	3300053126	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere	Metagenome	Endosphere
586	3300053140	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere	Metagenome	Endosphere
587	3300053153	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere	Metagenome	Endosphere
588	3300053178	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere	Metagenome	Endosphere
589	3300054114	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03	Metagenome	Rhizosphere
590	3300059507	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
591	3300059627	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
592	3300059639	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
593	3300060346	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
594	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere
595	3300061734	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2)	Metagenome	Rhizosphere
596	8004592986	Serratia sp. S119	Isolate	Unclassified
597	8015394850	Serratia sp. PGPR-27	Isolate	Rhizosphere
598	8016733728	Pantoea sp. SORGH_AS 659	Isolate	Unclassified
599	8018221730	Enterobacter sp. CM29	Isolate	Unclassified
600	8018405270	Enterobacter sp. 198	Isolate	Rhizosphere
601	8019499862	Kluyvera sp. 1366	Isolate	Rhizosphere
602	8019504834	Atlantibacter hermannii 1903	Isolate	Rhizosphere
603	8054844752	Dryocola boscaweniae H18W14	Isolate	Rhizosphere
604	8054849141	Dryocola clanedunensis H11S18	Isolate	Rhizosphere
605	8055087960	Silvania hatchlandensis H19S6	Isolate	Rhizosphere
606	8055092621	Silvania confinis H4N4	Isolate	Rhizosphere
607	8055097453	Leclercia tamurae H6W5	Isolate	Rhizosphere
608	8055693939	Hafnia alvei A23BA	Isolate	Rhizosphere
609	8057304971	Scandinavium manionii H17S15	Isolate	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	73.45
Metatranscriptomes	12.21
Isolates	14.34

Biome Distribution

Category	Percentage (%)
Aerial Root	0.35
Bulb	0.09
Endosphere	3.45
Nodule	0.44
Rhizoplane	6.9
Rhizosphere	75.75
Stem	0.09
Stem Tuber	0.44
Unclassified	12.48

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	RicEn_FSXC76377_b1	2010549000	Bacteria	834
2	JGI24736J21556_1013279	3300001904	Bacteria	1330
3	JGI24735J21928_10080595	3300002067	Bacteria	932
4	JGI24744J21845_10002487	3300002077	Bacteria	3757
5	JGI25162J39368_1004425	3300002737	Bacteria	3270
6	JGI25163J39215_1000088	3300002771	Bacteria	38934
7	JGI25164J39214_1000264	3300002772	Bacteria	38934
8	JGI25152J39213_1001191	3300002773	Bacteria	11965
9	rootH2_10073821	3300003320	Bacteria	6400
10	Ga0006562J51391_1011677	3300003578	Bacteria	5160
11	Ga0032354_1069816	3300003693	Bacteria	518
12	Ga0055538_1000183	3300003751	Bacteria	38934
13	Ga0055539_1000232	3300003752	Bacteria	38934
14	Ga0055533_1000224	3300003756	Bacteria	38934
15	Ga0055525_1000316	3300003759	Bacteria	38934
16	Ga0055541_1000139	3300003841	Bacteria	38934
17	Ga0058692_1029092	3300003856	Bacteria	1060
18	Ga0058858_1206800	3300004785	Bacteria	1042
19	Ga0058858_1426995	3300004785	Bacteria	652
20	Ga0058859_11834326	3300004798	Bacteria	1560
21	Ga0058863_11606235	3300004799	Bacteria	662
22	Ga0058860_10132144	3300004801	Bacteria	722
23	Ga0058860_10214236	3300004801	Bacteria	716
24	Ga0058860_11973223	3300004801	Bacteria	639
25	Ga0065703_1021099	3300005272	Bacteria	1399
26	Ga0065714_10441502	3300005288	Bacteria	542
27	Ga0065704_10000076	3300005289	Bacteria	33688
28	Ga0065704_10159976	3300005289	Bacteria	1346
29	Ga0065707_10001618	3300005295	Bacteria	6793
30	Ga0070658_10062030	3300005327	Bacteria	3046
31	Ga0070658_10140178	3300005327	Bacteria	2019
32	Ga0070676_10608786	3300005328	Bacteria	789
33	Ga0070683_100005998	3300005329	Bacteria	10179
34	Ga0070690_100225567	3300005330	Bacteria	1315
35	Ga0070690_100881951	3300005330	Bacteria	699
36	Ga0070670_100447774	3300005331	Bacteria	1144
37	Ga0070670_100633350	3300005331	Bacteria	958
38	Ga0068869_100216046	3300005334	Bacteria	1518
39	Ga0068869_100387136	3300005334	Bacteria	1147
40	Ga0068869_101721040	3300005334	Bacteria	560
41	Ga0068869_102089727	3300005334	Bacteria	509
42	Ga0070666_10004036	3300005335	Bacteria	8909
43	Ga0070666_10028752	3300005335	Bacteria	3650
44	Ga0070666_10054968	3300005335	Bacteria	2686
45	Ga0070666_10215539	3300005335	Bacteria	1353
46	Ga0070666_10219784	3300005335	Bacteria	1340
47	Ga0070680_100482078	3300005336	Bacteria	1060
48	Ga0070680_100523779	3300005336	Bacteria	1015
49	Ga0070682_100424956	3300005337	Bacteria	1011
50	Ga0068868_100221046	3300005338	Bacteria	1586
51	Ga0068868_101034666	3300005338	Bacteria	753
52	Ga0070660_100071219	3300005339	Bacteria	2714
53	Ga0070660_100679592	3300005339	Bacteria	863
54	Ga0070689_100124186	3300005340	Bacteria	2064
55	Ga0070689_102008535	3300005340	Bacteria	529
56	Ga0070691_10283935	3300005341	Bacteria	899
57	Ga0070687_100351133	3300005343	Bacteria	952
58	Ga0070687_101258041	3300005343	Bacteria	548
59	Ga0070661_100248315	3300005344	Bacteria	1372
60	Ga0070661_100790911	3300005344	Bacteria	778
61	Ga0070668_100015678	3300005347	Bacteria	5667
62	Ga0070668_100019041	3300005347	Bacteria	5160
63	Ga0070668_100803518	3300005347	Bacteria	836
64	Ga0070669_100000040	3300005353	Bacteria	130277
65	Ga0070669_100006246	3300005353	Bacteria	8599
66	Ga0070669_100102406	3300005353	Bacteria	2162
67	Ga0070671_100253289	3300005355	Bacteria	1496
68	Ga0070674_101545792	3300005356	Bacteria	597
69	Ga0070673_100013502	3300005364	Bacteria	5655
70	Ga0070673_100490636	3300005364	Bacteria	1110
71	Ga0070688_100041186	3300005365	Bacteria	2834
72	Ga0070688_101051846	3300005365	Bacteria	649
73	Ga0070659_100060890	3300005366	Bacteria	2982
74	Ga0070659_100320272	3300005366	Bacteria	1296
75	Ga0070667_100025865	3300005367	Bacteria	4882
76	Ga0070667_100602362	3300005367	Bacteria	1012
77	Ga0070667_100839977	3300005367	Bacteria	854
78	Ga0070667_101599125	3300005367	Bacteria	613
79	Ga0070709_10000076	3300005434	Bacteria	74077
80	Ga0070713_100651040	3300005436	Bacteria	1003
81	Ga0070713_101971198	3300005436	Bacteria	566
82	Ga0070710_10290713	3300005437	Bacteria	1064
83	Ga0070711_100105641	3300005439	Bacteria	2057
84	Ga0070663_100205709	3300005455	Bacteria	1539
85	Ga0070678_100007039	3300005456	Bacteria	6648
86	Ga0070662_100001640	3300005457	Bacteria	13783
87	Ga0070662_100328011	3300005457	Bacteria	1250
88	Ga0070681_10092928	3300005458	Bacteria	2965
89	Ga0068867_100408840	3300005459	Bacteria	1147
90	Ga0070685_10013827	3300005466	Bacteria	4267
91	Ga0070685_10850593	3300005466	Bacteria	676
92	Ga0070706_100017475	3300005467	Bacteria	6620
93	Ga0070707_100416571	3300005468	Bacteria	1304
94	Ga0070699_102130682	3300005518	Bacteria	512
95	Ga0070679_100257090	3300005530	Bacteria	1702
96	Ga0070684_100609347	3300005535	Bacteria	1015
97	Ga0070697_100976132	3300005536	Bacteria	753
98	Ga0070686_101274972	3300005544	Bacteria	613
99	Ga0070665_100001128	3300005548	Bacteria	32835
100	Ga0070665_100003465	3300005548	Bacteria	16812
101	Ga0070664_100043262	3300005564	Bacteria	3800
102	Ga0070664_100111227	3300005564	Bacteria	2391
103	Ga0068857_100000609	3300005577	Bacteria	26325
104	Ga0068857_100003667	3300005577	Bacteria	12865
105	Ga0068854_100469468	3300005578	Bacteria	1054
106	Ga0068856_101349675	3300005614	Bacteria	728
107	Ga0070702_100876521	3300005615	Bacteria	701
108	Ga0068852_100098418	3300005616	Bacteria	2634
109	Ga0068852_100101942	3300005616	Bacteria	2593
110	Ga0068859_101633064	3300005617	Bacteria	712
111	Ga0068859_102087475	3300005617	Bacteria	626
112	Ga0068859_102559614	3300005617	Bacteria	561
113	Ga0068864_101034226	3300005618	Bacteria	815
114	Ga0068861_100380132	3300005719	Bacteria	1247
115	Ga0068861_100695485	3300005719	Bacteria	944
116	Ga0068861_101259589	3300005719	Bacteria	717
117	Ga0068861_102133709	3300005719	Bacteria	561
118	Ga0068851_10003477	3300005834	Bacteria	7014
119	Ga0068851_10044122	3300005834	Bacteria	2249
120	Ga0068870_10001674	3300005840	Bacteria	9068
121	Ga0068863_101044764	3300005841	Bacteria	820
122	Ga0068858_100141511	3300005842	Bacteria	2258
123	Ga0068858_101240197	3300005842	Bacteria	733
124	Ga0068860_100022771	3300005843	Bacteria	6058
125	Ga0068860_100270761	3300005843	Bacteria	1657
126	Ga0068860_100336649	3300005843	Bacteria	1483
127	Ga0068862_101903311	3300005844	Bacteria	605
128	Ga0081455_10004632	3300005937	Bacteria	15327
129	Ga0075364_10080235	3300006051	Bacteria	2157
130	Ga0075364_10465924	3300006051	Bacteria	863
131	Ga0075364_10616445	3300006051	Bacteria	741
132	Ga0075432_10032545	3300006058	Bacteria	1807
133	Ga0070716_100035497	3300006173	Bacteria	2742
134	Ga0070716_100543900	3300006173	Bacteria	864
135	Ga0075367_10194594	3300006178	Bacteria	1266
136	Ga0075366_10002820	3300006195	Bacteria	8996
137	Ga0097621_101072095	3300006237	Bacteria	755
138	Ga0097621_101713061	3300006237	Bacteria	598
139	Ga0075370_10773223	3300006353	Bacteria	585
140	Ga0068871_100669707	3300006358	Bacteria	949
141	Ga0075428_102707480	3300006844	Bacteria	505
142	Ga0075431_100063671	3300006847	Bacteria	3806
143	Ga0075433_10222451	3300006852	Bacteria	1677
144	Ga0075434_100059026	3300006871	Bacteria	3814
145	Ga0075434_100317535	3300006871	Bacteria	1578
146	Ga0075434_101047527	3300006871	Bacteria	829
147	Ga0075429_100436803	3300006880	Bacteria	1147
148	Ga0075429_101144313	3300006880	Bacteria	680
149	Ga0068865_100087792	3300006881	Bacteria	2248
150	Ga0075436_100003766	3300006914	Bacteria	10400
151	Ga0097620_101633577	3300006931	Bacteria	712
152	Ga0097620_102087112	3300006931	Bacteria	626
153	Ga0097620_102559638	3300006931	Bacteria	561
154	Ga0079104_1073696	3300006946	Bacteria	712
155	Ga0075435_100101448	3300007076	Bacteria	2385
156	Ga0099794_10488435	3300007265	Bacteria	647
157	Ga0099795_10456711	3300007788	Bacteria	589
158	Ga0105251_10649032	3300009011	Bacteria	504
159	Ga0105240_10014453	3300009093	Bacteria	10778
160	Ga0105240_10403727	3300009093	Bacteria	1538
161	Ga0111539_11243213	3300009094	Bacteria	865
162	Ga0105245_11154486	3300009098	Bacteria	822
163	Ga0105245_11233908	3300009098	Bacteria	796
164	Ga0105247_10014018	3300009101	Bacteria	4807
165	Ga0105247_11594329	3300009101	Bacteria	536
166	Ga0114129_11439915	3300009147	Bacteria	849
167	Ga0114129_12142072	3300009147	Bacteria	674
168	Ga0105243_11174093	3300009148	Bacteria	779
169	Ga0105243_12487366	3300009148	Bacteria	557
170	Ga0105241_10000672	3300009174	Bacteria	25784
171	Ga0105241_10062629	3300009174	Bacteria	2868
172	Ga0105241_10254534	3300009174	Bacteria	1490
173	Ga0105242_10312432	3300009176	Bacteria	1438
174	Ga0105242_10716442	3300009176	Bacteria	981
175	Ga0105242_11609325	3300009176	Bacteria	683
176	Ga0105242_13321896	3300009176	Bacteria	500
177	Ga0105248_10490209	3300009177	Bacteria	1385
178	Ga0105248_11996545	3300009177	Bacteria	659
179	Ga0105238_10090877	3300009551	Bacteria	3041
180	Ga0105238_10761653	3300009551	Bacteria	982
181	Ga0105249_10108165	3300009553	Bacteria	2625
182	Ga0105249_10220317	3300009553	Bacteria	1867
183	Ga0105249_10250785	3300009553	Bacteria	1755
184	Ga0105249_11217757	3300009553	Bacteria	824
185	Ga0130087_1072414	3300009828	Bacteria	1240
186	Ga0105239_10323351	3300010375	Bacteria	1739
187	Ga0105239_11072159	3300010375	Bacteria	927
188	Ga0105246_10057896	3300011119	Bacteria	2683
189	Ga0105246_10524045	3300011119	Bacteria	1011
190	Ga0105246_11224795	3300011119	Bacteria	692
191	Ga0105246_11341327	3300011119	Bacteria	665
192	Ga0157373_10186286	3300013100	Bacteria	1462
193	Ga0157373_10818815	3300013100	Unclassified	687
194	Ga0157371_11001630	3300013102	Bacteria	637
195	Ga0157371_11637357	3300013102	Bacteria	504
196	Ga0157370_10119403	3300013104	Bacteria	2462
197	Ga0157370_10450014	3300013104	Bacteria	1184
198	Ga0157370_10892104	3300013104	Bacteria	807
199	Ga0157369_10039077	3300013105	Bacteria	5187
200	Ga0157369_10576701	3300013105	Bacteria	1162
201	Ga0157369_10676373	3300013105	Bacteria	1064
202	Ga0157378_10089660	3300013297	Bacteria	2794
203	Ga0157378_10273033	3300013297	Bacteria	1627
204	Ga0163162_10375501	3300013306	Bacteria	1555
205	Ga0163162_11343129	3300013306	Bacteria	813
206	Ga0163162_11795954	3300013306	Bacteria	701
207	Ga0157372_10411826	3300013307	Bacteria	1575
208	Ga0157372_10884304	3300013307	Bacteria	1037
209	Ga0157372_11975931	3300013307	Bacteria	670
210	Ga0157375_10199187	3300013308	Bacteria	2158
211	Ga0157375_10316770	3300013308	Bacteria	1724
212	Ga0163163_10060747	3300014325	Bacteria	3743
213	Ga0163163_10788311	3300014325	Bacteria	1014
214	Ga0163163_12729138	3300014325	Bacteria	551
215	Ga0157380_11549947	3300014326	Bacteria	717
216	Ga0157380_11554327	3300014326	Bacteria	716
217	Ga0157380_11978565	3300014326	Bacteria	644
218	Ga0182008_10200526	3300014497	Bacteria	1015
219	Ga0157377_10194120	3300014745	Bacteria	1285
220	Ga0157376_10256859	3300014969	Bacteria	1635
221	Ga0157376_11230547	3300014969	Bacteria	777
222	Ga0182006_1175458	3300015261	Bacteria	716
223	Ga0182006_1200771	3300015261	Bacteria	661
224	Ga0182007_10003639	3300015262	Bacteria	7223
225	Ga0183366_1011	3300015679	Bacteria	26434
226	Ga0183370_1011	3300015680	Bacteria	26434
227	Ga0183369_1026	3300015685	Bacteria	26434
228	Ga0183368_1014	3300015687	Bacteria	26434
229	Ga0163161_10190458	3300017792	Bacteria	1577
230	Ga0163161_10805469	3300017792	Bacteria	790
231	Ga0206356_10926534	3300020070	Bacteria	553
232	Ga0206356_11200246	3300020070	Bacteria	1452
233	Ga0206351_10280140	3300020077	Bacteria	13796
234	Ga0206352_10023630	3300020078	Bacteria	5147
235	Ga0206354_10257381	3300020081	Bacteria	2099
236	Ga0206353_11644736	3300020082	Bacteria	750
237	Ga0154015_1090949	3300020610	Bacteria	803
238	Ga0213876_10000608	3300021384	Bacteria	26445
239	Ga0224712_10012065	3300022467	Bacteria	2704
240	Ga0256714_102603	3300023304	Bacteria	1901
241	Ga0256744_102491	3300023309	Bacteria	3541
242	Ga0256744_150807	3300023309	Bacteria	3994
243	Ga0256720_111476	3300023438	Bacteria	1652
244	Ga0209760_100166	3300025207	Bacteria	39087
245	Ga0209784_100218	3300025224	Bacteria	39215
246	Ga0209566_100353	3300025225	Bacteria	39215
247	Ga0209674_100273	3300025226	Bacteria	39215
248	Ga0209563_100182	3300025230	Bacteria	39215
249	Ga0207427_100270	3300025231	Bacteria	39215
250	Ga0207425_1015406	3300025245	Bacteria	1717
251	Ga0209677_100234	3300025253	Bacteria	39215
252	Ga0209129_1000540	3300025258	Bacteria	26365
253	Ga0209233_1000968	3300025261	Bacteria	12387
254	Ga0209257_1134274	3300025304	Bacteria	563
255	Ga0207697_10287731	3300025315	Bacteria	728
256	Ga0207656_10005114	3300025321	Bacteria	4613
257	Ga0207656_10070808	3300025321	Bacteria	1549
258	Ga0207696_1000198	3300025711	Bacteria	92750
259	Ga0207696_1000334	3300025711	Bacteria	49107
260	Ga0207696_1001023	3300025711	Bacteria	16688
261	Ga0207696_1002288	3300025711	Bacteria	9512
262	Ga0207696_1010712	3300025711	Bacteria	3345
263	Ga0207696_1011698	3300025711	Bacteria	3145
264	Ga0207696_1023655	3300025711	Bacteria	1934
265	Ga0207655_1001098	3300025728	Bacteria	26525
266	Ga0207655_1001305	3300025728	Bacteria	23562
267	Ga0207655_1043092	3300025728	Bacteria	1914
268	Ga0207713_1002459	3300025735	Bacteria	13464
269	Ga0207713_1013654	3300025735	Bacteria	4269
270	Ga0207710_10000468	3300025900	Bacteria	25913
271	Ga0207680_10008302	3300025903	Bacteria	5089
272	Ga0207680_10032342	3300025903	Bacteria	2973
273	Ga0207680_10232353	3300025903	Bacteria	1268
274	Ga0207680_10262560	3300025903	Bacteria	1195
275	Ga0207680_10295141	3300025903	Bacteria	1129
276	Ga0207680_11236207	3300025903	Bacteria	532
277	Ga0207647_10013393	3300025904	Bacteria	5686
278	Ga0207699_10000182	3300025906	Bacteria	38240
279	Ga0207699_10785429	3300025906	Bacteria	700
280	Ga0207645_10042905	3300025907	Bacteria	2894
281	Ga0207645_10090221	3300025907	Bacteria	1971
282	Ga0207645_11016838	3300025907	Bacteria	561
283	Ga0207643_10002762	3300025908	Bacteria	9490
284	Ga0207705_10049846	3300025909	Bacteria	3014
285	Ga0207705_10241468	3300025909	Bacteria	1376
286	Ga0207705_10710148	3300025909	Bacteria	781
287	Ga0207684_10034726	3300025910	Bacteria	4283
288	Ga0207654_10000379	3300025911	Bacteria	25944
289	Ga0207654_10001703	3300025911	Bacteria	11472
290	Ga0207654_10376448	3300025911	Bacteria	983
291	Ga0207654_11353844	3300025911	Bacteria	519
292	Ga0207707_10000723	3300025912	Bacteria	32671
293	Ga0207707_10342789	3300025912	Bacteria	1288
294	Ga0207707_10479088	3300025912	Bacteria	1063
295	Ga0207695_10000818	3300025913	Bacteria	57675
296	Ga0207695_10020876	3300025913	Bacteria	7485
297	Ga0207671_10047226	3300025914	Bacteria	3187
298	Ga0207671_10397739	3300025914	Bacteria	1096
299	Ga0207671_11045168	3300025914	Bacteria	643
300	Ga0207663_10033208	3300025916	Bacteria	3071
301	Ga0207660_10250281	3300025917	Bacteria	1398
302	Ga0207660_10295709	3300025917	Bacteria	1288
303	Ga0207660_11003814	3300025917	Bacteria	681
304	Ga0207662_10073007	3300025918	Bacteria	2081
305	Ga0207662_10113337	3300025918	Bacteria	1693
306	Ga0207657_10355646	3300025919	Bacteria	1155
307	Ga0207657_10419823	3300025919	Bacteria	1051
308	Ga0207649_10015259	3300025920	Bacteria	4316
309	Ga0207649_11034764	3300025920	Unclassified	647
310	Ga0207652_10033389	3300025921	Bacteria	4333
311	Ga0207646_10353321	3300025922	Bacteria	1328
312	Ga0207681_10000015	3300025923	Bacteria	352892
313	Ga0207681_10095933	3300025923	Bacteria	2128
314	Ga0207681_10670758	3300025923	Bacteria	860
315	Ga0207694_10051440	3300025924	Bacteria	3193
316	Ga0207650_10235149	3300025925	Bacteria	1479
317	Ga0207659_10078290	3300025926	Bacteria	2436
318	Ga0207687_10180424	3300025927	Bacteria	1635
319	Ga0207687_10265398	3300025927	Bacteria	1370
320	Ga0207687_10473139	3300025927	Bacteria	1042
321	Ga0207687_10947899	3300025927	Bacteria	737
322	Ga0207664_10021065	3300025929	Bacteria	4840
323	Ga0207690_10043028	3300025932	Bacteria	2970
324	Ga0207690_10044560	3300025932	Bacteria	2925
325	Ga0207690_10131079	3300025932	Bacteria	1835
326	Ga0207706_10005266	3300025933	Bacteria	12063
327	Ga0207706_10318489	3300025933	Bacteria	1354
328	Ga0207686_10251333	3300025934	Bacteria	1292
329	Ga0207686_11023064	3300025934	Bacteria	671
330	Ga0207709_10157311	3300025935	Bacteria	1581
331	Ga0207670_10060508	3300025936	Bacteria	2580
332	Ga0207670_10110850	3300025936	Bacteria	1978
333	Ga0207669_11347670	3300025937	Bacteria	607
334	Ga0207704_10026972	3300025938	Bacteria	3160
335	Ga0207704_10161378	3300025938	Bacteria	1595
336	Ga0207665_10030899	3300025939	Bacteria	3542
337	Ga0207665_10143471	3300025939	Bacteria	1705
338	Ga0207665_10881789	3300025939	Bacteria	709
339	Ga0207689_10021962	3300025942	Bacteria	5367
340	Ga0207689_10122305	3300025942	Bacteria	2140
341	Ga0207689_10315576	3300025942	Bacteria	1297
342	Ga0207661_10067045	3300025944	Bacteria	2917
343	Ga0207679_10131921	3300025945	Bacteria	2006
344	Ga0207679_10311001	3300025945	Bacteria	1361
345	Ga0207679_11423559	3300025945	Bacteria	636
346	Ga0207667_10258924	3300025949	Bacteria	1779
347	Ga0207651_10079565	3300025960	Bacteria	2355
348	Ga0207712_10247927	3300025961	Bacteria	1438
349	Ga0207712_10808850	3300025961	Bacteria	824
350	Ga0207668_10001695	3300025972	Bacteria	12890
351	Ga0207668_10008346	3300025972	Bacteria	6168
352	Ga0207668_10401217	3300025972	Bacteria	1159
353	Ga0207640_10075216	3300025981	Bacteria	2288
354	Ga0207658_10028034	3300025986	Bacteria	3963
355	Ga0207658_10550244	3300025986	Bacteria	1032
356	Ga0207658_11366232	3300025986	Bacteria	648
357	Ga0207658_11542678	3300025986	Bacteria	607
358	Ga0207677_10093411	3300026023	Bacteria	2193
359	Ga0207677_10218339	3300026023	Bacteria	1527
360	Ga0207677_11883586	3300026023	Bacteria	556
361	Ga0207703_10154862	3300026035	Bacteria	2002
362	Ga0207639_10066089	3300026041	Bacteria	2809
363	Ga0207678_10251871	3300026067	Bacteria	1512
364	Ga0207708_11480104	3300026075	Bacteria	596
365	Ga0207702_10108230	3300026078	Bacteria	2466
366	Ga0207648_10396306	3300026089	Bacteria	1250
367	Ga0207676_10693746	3300026095	Bacteria	986
368	Ga0207674_10001554	3300026116	Bacteria	29587
369	Ga0207674_10001940	3300026116	Bacteria	26275
370	Ga0207675_100554332	3300026118	Bacteria	1149
371	Ga0207675_100605291	3300026118	Bacteria	1099
372	Ga0207683_10023634	3300026121	Bacteria	5287
373	Ga0207698_10071585	3300026142	Bacteria	2752
374	Ga0207698_10106407	3300026142	Bacteria	2339
375	Ga0207698_10137171	3300026142	Bacteria	2101
376	Ga0209281_1000327	3300027111	Bacteria	82960
377	Ga0209281_1000874	3300027111	Bacteria	26131
378	Ga0209281_1007912	3300027111	Bacteria	2628
379	Ga0209371_1001410	3300027312	Bacteria	16496
380	Ga0209371_1017289	3300027312	Bacteria	1872
381	Ga0209371_1050676	3300027312	Bacteria	798
382	Ga0207428_10881602	3300027907	Bacteria	633
383	Ga0268266_10000745	3300028379	Bacteria	43623
384	Ga0268266_10001891	3300028379	Bacteria	23621
385	Ga0268266_10019459	3300028379	Bacteria	5783
386	Ga0268266_10023861	3300028379	Bacteria	5205
387	Ga0268266_10043580	3300028379	Bacteria	3835
388	Ga0268265_10019115	3300028380	Bacteria	4755
389	Ga0268264_10036794	3300028381	Bacteria	4033
390	Ga0268264_10089020	3300028381	Bacteria	2657
391	Ga0268264_10267969	3300028381	Bacteria	1594
392	Ga0265326_10024519	3300028558	Bacteria	1721
393	Ga0265334_10000005	3300028573	Bacteria	242590
394	Ga0265334_10010603	3300028573	Bacteria	3890
395	Ga0265318_10271401	3300028577	Bacteria	619
396	Ga0265338_10006324	3300028800	Bacteria	15135
397	Ga0311004_142155	3300029276	Bacteria	734
398	Ga0311001_1080693	3300029277	Bacteria	5101
399	Ga0268256_1000383	3300030500	Bacteria	41230
400	Ga0268256_1000654	3300030500	Bacteria	26403
401	Ga0268256_1019274	3300030500	Bacteria	1872
402	Ga0268256_1066324	3300030500	Bacteria	708
403	Ga0314311_1124004	3300030733	Bacteria	518
404	Ga0316183_1215055	3300030742	Bacteria	1341
405	Ga0265325_10066725	3300031241	Bacteria	1814
406	Ga0265325_10121442	3300031241	Bacteria	1259
407	Ga0265339_10337823	3300031249	Bacteria	712
408	Ga0265316_10191095	3300031344	Bacteria	1521
409	Ga0307408_102071869	3300031548	Bacteria	548
410	Ga0265313_10000014	3300031595	Bacteria	156295
411	Ga0265313_10004626	3300031595	Bacteria	10430
412	Ga0316575_10001471	3300031665	Bacteria	7589
413	Ga0316575_10011754	3300031665	Bacteria	3244
414	Ga0316575_10021694	3300031665	Bacteria	2474
415	Ga0316575_10031703	3300031665	Bacteria	2069
416	Ga0316575_10201900	3300031665	Bacteria	828
417	Ga0316575_10247276	3300031665	Bacteria	748
418	Ga0316575_10284483	3300031665	Bacteria	697
419	Ga0316579_10005295	3300031691	Bacteria	5195
420	Ga0316579_10029948	3300031691	Bacteria	2485
421	Ga0316579_10045411	3300031691	Bacteria	2048
422	Ga0316579_10076875	3300031691	Unclassified	1587
423	Ga0316579_10077344	3300031691	Bacteria	1582
424	Ga0316579_10130860	3300031691	Bacteria	1209
425	Ga0316579_10226842	3300031691	Bacteria	903
426	Ga0316576_10000051	3300031727	Bacteria	36940
427	Ga0316576_10005535	3300031727	Bacteria	7732
428	Ga0316576_10005914	3300031727	Bacteria	7552
429	Ga0316576_10005961	3300031727	Bacteria	7527
430	Ga0316576_10008020	3300031727	Bacteria	6696
431	Ga0316576_10016497	3300031727	Bacteria	4991
432	Ga0316576_10048175	3300031727	Bacteria	3090
433	Ga0316576_10077457	3300031727	Bacteria	2462
434	Ga0316576_10102525	3300031727	Bacteria	2140
435	Ga0316576_10118623	3300031727	Bacteria	1986
436	Ga0316576_10126683	3300031727	Bacteria	1919
437	Ga0316576_10232629	3300031727	Bacteria	1385
438	Ga0316576_10262708	3300031727	Bacteria	1295
439	Ga0316576_10721896	3300031727	Bacteria	721
440	Ga0316578_10007960	3300031728	Bacteria	5356
441	Ga0316578_10016497	3300031728	Bacteria	3999
442	Ga0316578_10043727	3300031728	Bacteria	2603
443	Ga0316578_10046392	3300031728	Bacteria	2532
444	Ga0316578_10079270	3300031728	Bacteria	1952
445	Ga0316578_10086682	3300031728	Bacteria	1867
446	Ga0316578_10194426	3300031728	Bacteria	1222
447	Ga0316578_10274835	3300031728	Bacteria	1009
448	Ga0316578_10463303	3300031728	Bacteria	748
449	Ga0316578_10517901	3300031728	Bacteria	702
450	Ga0316578_10556637	3300031728	Bacteria	673
451	Ga0316578_10802455	3300031728	Bacteria	545
452	Ga0307516_10007119	3300031730	Bacteria	12924
453	Ga0307405_11418830	3300031731	Bacteria	608
454	Ga0316577_10008903	3300031733	Bacteria	5390
455	Ga0316577_10009015	3300031733	Bacteria	5354
456	Ga0316577_10017014	3300031733	Bacteria	4012
457	Ga0316577_10034525	3300031733	Bacteria	2826
458	Ga0316577_10139717	3300031733	Bacteria	1364
459	Ga0316577_10163890	3300031733	Bacteria	1254
460	Ga0316577_10171129	3300031733	Unclassified	1226
461	Ga0316577_10194982	3300031733	Bacteria	1145
462	Ga0316577_10372212	3300031733	Bacteria	811
463	Ga0316577_10402591	3300031733	Bacteria	777
464	Ga0316577_10817246	3300031733	Bacteria	529
465	Ga0307407_10603052	3300031903	Bacteria	818
466	Ga0307409_100008471	3300031995	Bacteria	6245
467	Ga0307411_12339475	3300032005	Bacteria	502
468	Ga0316583_10033302	3300032133	Bacteria	1831
469	Ga0316583_10054816	3300032133	Bacteria	1402
470	Ga0316583_10149326	3300032133	Bacteria	814
471	Ga0316585_10131502	3300032137	Bacteria	825
472	Ga0316580_10003686	3300032139	Bacteria	4384
473	Ga0316580_10005312	3300032139	Bacteria	3754
474	Ga0316593_10000042	3300032168	Bacteria	13946
475	Ga0316593_10000043	3300032168	Bacteria	13880
476	Ga0316593_10000149	3300032168	Bacteria	9970
477	Ga0316593_10000198	3300032168	Bacteria	9333
478	Ga0316593_10000538	3300032168	Bacteria	7065
479	Ga0316593_10000968	3300032168	Bacteria	5933
480	Ga0316593_10001768	3300032168	Bacteria	4909
481	Ga0316593_10002038	3300032168	Bacteria	4666
482	Ga0316593_10003175	3300032168	Bacteria	4037
483	Ga0316593_10004139	3300032168	Bacteria	3687
484	Ga0316593_10005892	3300032168	Bacteria	3272
485	Ga0316593_10006885	3300032168	Bacteria	3094
486	Ga0316593_10010252	3300032168	Bacteria	2680
487	Ga0316593_10012318	3300032168	Bacteria	2508
488	Ga0316593_10015702	3300032168	Bacteria	2283
489	Ga0316593_10016347	3300032168	Bacteria	2248
490	Ga0316593_10017572	3300032168	Bacteria	2184
491	Ga0316593_10019872	3300032168	Bacteria	2080
492	Ga0316593_10020811	3300032168	Bacteria	2045
493	Ga0316593_10023739	3300032168	Bacteria	1939
494	Ga0316593_10029863	3300032168	Bacteria	1766
495	Ga0316593_10088070	3300032168	Bacteria	1091
496	Ga0316593_10095067	3300032168	Bacteria	1052
497	Ga0316593_10102187	3300032168	Bacteria	1018
498	Ga0316593_10107573	3300032168	Bacteria	994
499	Ga0316593_10134376	3300032168	Bacteria	894
500	Ga0316593_10249876	3300032168	Bacteria	664
501	Ga0316593_10373765	3300032168	Unclassified	548
502	Ga0316592_1000008	3300033524	Bacteria	14268
503	Ga0316592_1000366	3300033524	Bacteria	5983
504	Ga0316592_1000411	3300033524	Bacteria	5776
505	Ga0316592_1001885	3300033524	Bacteria	3511
506	Ga0316592_1001949	3300033524	Bacteria	3479
507	Ga0316592_1005866	3300033524	Bacteria	2347
508	Ga0316592_1006141	3300033524	Bacteria	2303
509	Ga0316592_1021335	3300033524	Bacteria	1379
510	Ga0316592_1021977	3300033524	Bacteria	1361
511	Ga0316592_1025209	3300033524	Bacteria	1282
512	Ga0316592_1035835	3300033524	Bacteria	1089
513	Ga0316592_1064745	3300033524	Bacteria	823
514	Ga0316586_1000060	3300033527	Bacteria	7978
515	Ga0316586_1000370	3300033527	Bacteria	4227
516	Ga0316586_1003434	3300033527	Bacteria	2080
517	Ga0316586_1003843	3300033527	Bacteria	2005
518	Ga0316586_1043099	3300033527	Bacteria	797
519	Ga0316586_1055990	3300033527	Bacteria	711
520	Ga0316586_1094397	3300033527	Bacteria	567
521	Ga0316588_1000495	3300033528	Bacteria	5384
522	Ga0316588_1020839	3300033528	Bacteria	1487
523	Ga0316588_1022194	3300033528	Bacteria	1449
524	Ga0316588_1026017	3300033528	Bacteria	1354
525	Ga0316588_1040188	3300033528	Bacteria	1116
526	Ga0316588_1042489	3300033528	Bacteria	1089
527	Ga0316588_1133431	3300033528	Bacteria	632
528	Ga0316588_1173271	3300033528	Bacteria	558
529	Ga0316588_1215440	3300033528	Bacteria	504
530	Ga0316587_1000022	3300033529	Bacteria	9239
531	Ga0316587_1000319	3300033529	Bacteria	4512
532	Ga0316587_1005477	3300033529	Bacteria	1907
533	Ga0316587_1005715	3300033529	Bacteria	1876
534	Ga0316587_1009257	3300033529	Bacteria	1560
535	Ga0316587_1011919	3300033529	Bacteria	1409
536	Ga0316587_1024988	3300033529	Bacteria	1036
537	Ga0316587_1035822	3300033529	Bacteria	888
538	Ga0316587_1041854	3300033529	Bacteria	829
539	Ga0316587_1092151	3300033529	Bacteria	579
540	Ga0316587_1113419	3300033529	Bacteria	527
541	Ga0316587_1113541	3300033529	Bacteria	527
542	Ga0316596_1000026	3300033541	Bacteria	14495
543	Ga0316596_1000116	3300033541	Bacteria	10404
544	Ga0316596_1000208	3300033541	Bacteria	8714
545	Ga0316596_1000296	3300033541	Bacteria	7867
546	Ga0316596_1000644	3300033541	Bacteria	6242
547	Ga0316596_1000766	3300033541	Bacteria	5881
548	Ga0316596_1001141	3300033541	Bacteria	5193
549	Ga0316596_1001478	3300033541	Bacteria	4757
550	Ga0316596_1001556	3300033541	Bacteria	4675
551	Ga0316596_1001917	3300033541	Bacteria	4358
552	Ga0316596_1002958	3300033541	Bacteria	3687
553	Ga0316596_1003895	3300033541	Bacteria	3306
554	Ga0316596_1006605	3300033541	Bacteria	2704
555	Ga0316596_1008803	3300033541	Bacteria	2413
556	Ga0316596_1011352	3300033541	Bacteria	2175
557	Ga0316596_1012101	3300033541	Bacteria	2118
558	Ga0316596_1016754	3300033541	Bacteria	1837
559	Ga0316596_1021125	3300033541	Bacteria	1658
560	Ga0316596_1021887	3300033541	Bacteria	1631
561	Ga0316596_1032765	3300033541	Bacteria	1353
562	Ga0316596_1033638	3300033541	Bacteria	1336
563	Ga0316596_1043360	3300033541	Bacteria	1184
564	Ga0316596_1051816	3300033541	Bacteria	1087
565	Ga0316596_1052466	3300033541	Bacteria	1081
566	Ga0316596_1054419	3300033541	Bacteria	1062
567	Ga0316596_1095623	3300033541	Bacteria	802
568	Ga0316596_1099683	3300033541	Bacteria	785
569	Ga0316596_1118242	3300033541	Bacteria	721
570	Ga0316596_1160920	3300033541	Bacteria	618
571	Ga0316596_1185863	3300033541	Bacteria	576
572	Ga0316596_1195084	3300033541	Bacteria	562
573	Ga0316596_1202811	3300033541	Bacteria	552
574	Ga0373929_0027611	3300035085	Bacteria	1194
575	Ga0373949_0296483	3300035090	Bacteria	512
576	Ga0373941_0315318	3300035115	Bacteria	628
577	Ga0373943_0069735	3300035170	Bacteria	1777
578	Ga0316574_0000085	3300035398	Bacteria	26529
579	Ga0316574_0000624	3300035398	Bacteria	14789
580	Ga0316574_0008614	3300035398	Bacteria	5671
581	Ga0316574_0018659	3300035398	Bacteria	4081
582	Ga0316574_0061024	3300035398	Bacteria	2367
583	Ga0316574_0080084	3300035398	Bacteria	2073
584	Ga0316574_0080967	3300035398	Bacteria	2062
585	Ga0316574_0116002	3300035398	Bacteria	1718
586	Ga0316574_0120475	3300035398	Bacteria	1685
587	Ga0316574_0140559	3300035398	Bacteria	1555
588	Ga0316574_0278314	3300035398	Bacteria	1066
589	Ga0316574_0386021	3300035398	Bacteria	883
590	Ga0316574_0400096	3300035398	Bacteria	865
591	Ga0316574_0476349	3300035398	Bacteria	780
592	Ga0316574_0486307	3300035398	Bacteria	771
593	Ga0316574_0910202	3300035398	Bacteria	532
594	Ga0373935_0093998	3300035692	Bacteria	1967
595	Ga0373947_0052297	3300035725	Bacteria	2460
596	Ga0316582_0011702	3300036647	Bacteria	4863
597	Ga0316582_0012852	3300036647	Bacteria	4690
598	Ga0316582_0052038	3300036647	Bacteria	2602
599	Ga0316582_0052920	3300036647	Bacteria	2582
600	Ga0316582_0106141	3300036647	Bacteria	1865
601	Ga0316582_0220624	3300036647	Bacteria	1296
602	Ga0316582_0449476	3300036647	Bacteria	888
603	Ga0316582_0468862	3300036647	Bacteria	868
604	Ga0316582_0539029	3300036647	Bacteria	804
605	Ga0316582_0541249	3300036647	Bacteria	802
606	Ga0316582_0572329	3300036647	Bacteria	778
607	Ga0316582_0825520	3300036647	Bacteria	635
608	Ga0316582_0984035	3300036647	Bacteria	576
609	Ga0316582_1096655	3300036647	Bacteria	543
610	Ga0316584_0004587	3300036712	Bacteria	9157
611	Ga0316584_0007521	3300036712	Bacteria	7461
612	Ga0316584_0024905	3300036712	Bacteria	4384
613	Ga0316584_0026734	3300036712	Bacteria	4244
614	Ga0316584_0051325	3300036712	Bacteria	3084
615	Ga0316584_0147127	3300036712	Bacteria	1755
616	Ga0316584_0209042	3300036712	Bacteria	1437
617	Ga0316584_0273989	3300036712	Bacteria	1228
618	Ga0316584_0300436	3300036712	Bacteria	1162
619	Ga0316584_0371889	3300036712	Bacteria	1023
620	Ga0316584_0400825	3300036712	Bacteria	977
621	Ga0316584_0447448	3300036712	Bacteria	914
622	Ga0316584_0989576	3300036712	Bacteria	562
623	Ga0373925_1053175	3300037068	Bacteria	670
624	Ga0395899_0003536	3300037312	Bacteria	12380
625	Ga0395898_0427409	3300037466	Bacteria	1262
626	Ga0316581_0001826	3300037588	Bacteria	4942
627	Ga0400484_27667	3300038725	Bacteria	4271
628	Ga0400484_30405	3300038725	Bacteria	18960
629	Ga0400484_37672	3300038725	Bacteria	9379
630	Ga0400490_03371	3300038726	Bacteria	14955
631	Ga0400490_05180	3300038726	Bacteria	2956
632	Ga0400490_07415	3300038726	Bacteria	1357
633	Ga0400490_18978	3300038726	Bacteria	41932
634	Ga0400490_34548	3300038726	Bacteria	3133
635	Ga0400491_04613	3300038727	Bacteria	1009
636	Ga0400491_13944	3300038727	Bacteria	2738
637	Ga0400485_06724	3300038735	Bacteria	9642
638	Ga0400485_08047	3300038735	Bacteria	20055
639	Ga0400485_16370	3300038735	Bacteria	1306
640	Ga0400488_00038	3300038741	Bacteria	1719
641	Ga0400488_03335	3300038741	Bacteria	7283
642	Ga0400488_14030	3300038741	Bacteria	1533
643	Ga0400488_57235	3300038741	Bacteria	4135
644	Ga0400486_17114	3300038742	Bacteria	18189
645	Ga0400486_17728	3300038742	Bacteria	12468
646	Ga0400486_21368	3300038742	Bacteria	5998
647	Ga0400486_32047	3300038742	Bacteria	23991
648	Ga0400483_079217	3300039062	Bacteria	83041
649	Ga0400483_081993	3300039062	Bacteria	8486
650	Ga0400483_092352	3300039062	Bacteria	246443
651	Ga0400483_109431	3300039062	Bacteria	1797
652	Ga0400483_112336	3300039062	Bacteria	1604
653	Ga0400483_120099	3300039062	Bacteria	48943
654	Ga0400483_166753	3300039062	Bacteria	21909
655	Ga0400483_170099	3300039062	Bacteria	3889
656	Ga0400483_198250	3300039062	Bacteria	18872
657	Ga0400483_222800	3300039062	Bacteria	244239
658	Ga0400483_228134	3300039062	Bacteria	119181
659	Ga0400483_272346	3300039062	Bacteria	1117
660	Ga0400489_23715	3300039093	Bacteria	15377
661	Ga0400489_59643	3300039093	Bacteria	25982
662	Ga0400489_66216	3300039093	Bacteria	19270
663	Ga0400489_76217	3300039093	Bacteria	1176
664	Ga0400489_85539	3300039093	Bacteria	4968
665	Ga0400489_86209	3300039093	Bacteria	8537
666	Ga0400487_25190	3300039110	Bacteria	4609
667	Ga0400487_33846	3300039110	Bacteria	3869
668	Ga0400487_50276	3300039110	Bacteria	9871
669	Ga0400487_55496	3300039110	Bacteria	6673
670	Ga0400487_65029	3300039110	Bacteria	1986
671	Ga0400487_66163	3300039110	Bacteria	6500
672	Ga0436365_0390798	3300039437	Bacteria	26679
673	Ga0439436_0014231	3300041404	Bacteria	2403
674	Ga0439438_000016	3300041405	Bacteria	128189
675	Ga0439438_000406	3300041405	Bacteria	19354
676	Ga0439438_002298	3300041405	Bacteria	8188
677	Ga0439438_005137	3300041405	Bacteria	4872
678	Ga0439447_004147	3300041407	Bacteria	5035
679	Ga0439447_005027	3300041407	Bacteria	4451
680	Ga0439447_005606	3300041407	Bacteria	4154
681	Ga0439447_024590	3300041407	Bacteria	1558
682	Ga0439453_0120200	3300041408	Bacteria	602
683	Ga0439466_0000011	3300041411	Bacteria	221134
684	Ga0439466_0063394	3300041411	Bacteria	1186
685	Ga0451789_1258268	3300041443	Bacteria	758
686	Ga0451790_34400	3300041444	Bacteria	546
687	Ga0451797_1446479	3300041453	Bacteria	741
688	Ga0451802_1655263	3300041460	Bacteria	625
689	Ga0451805_041168	3300041461	Bacteria	516
690	Ga0451805_082450	3300041461	Bacteria	896
691	Ga0451807_1110780	3300041486	Bacteria	885
692	Ga0451833_0861978	3300041491	Bacteria	1120
693	Ga0451835_1129155	3300041492	Bacteria	1159
694	Ga0451837_0214257	3300041494	Bacteria	574
695	Ga0451841_1411344	3300041498	Bacteria	686
696	Ga0451845_0255181	3300041501	Bacteria	531
697	Ga0451849_0245757	3300041505	Bacteria	819
698	Ga0451849_0689430	3300041505	Bacteria	3332
699	Ga0451843_1539340	3300041509	Bacteria	1327
700	Ga0451854_01357	3300041510	Bacteria	682
701	Ga0451853_1390713	3300041512	Bacteria	663
702	Ga0451853_1407400	3300041512	Bacteria	515
703	Ga0452271_09894	3300041916	Bacteria	773
704	Ga0452271_14401	3300041916	Bacteria	782
705	Ga0439431_0235453	3300041997	Bacteria	540
706	Ga0439437_000645	3300042000	Bacteria	3498
707	Ga0439432_003421	3300042006	Bacteria	5889
708	Ga0439432_007959	3300042006	Bacteria	3736
709	Ga0439432_041273	3300042006	Bacteria	1461
710	Ga0439432_090260	3300042006	Bacteria	922
711	Ga0439450_192402	3300042008	Bacteria	544
712	Ga0439452_000010	3300042010	Bacteria	459139
713	Ga0439452_000384	3300042010	Bacteria	26380
714	Ga0439452_000388	3300042010	Bacteria	26215
715	Ga0439452_001845	3300042010	Bacteria	8199
716	Ga0439463_000973	3300042016	Bacteria	7814
717	Ga0450911_002488	3300042115	Bacteria	3597
718	Ga0450919_025930	3300042121	Bacteria	666
719	Ga0450923_020397	3300042125	Bacteria	1284
720	Ga0450900_002382	3300042136	Bacteria	1986
721	Ga0450902_000565	3300042137	Bacteria	4683
722	Ga0450904_001663	3300042139	Bacteria	2982
723	Ga0450905_005808	3300042142	Bacteria	1657
724	Ga0450907_000073	3300042146	Bacteria	38529
725	Ga0439446_0083813	3300042156	Bacteria	990
726	Ga0439434_0090582	3300042435	Bacteria	977
727	Ga0439459_0001548	3300042438	Bacteria	3415
728	Ga0439464_0002761	3300042439	Bacteria	4357
729	Ga0439464_0022415	3300042439	Bacteria	1739
730	Ga0450918_062804	3300042531	Bacteria	688
731	Ga0451577_0000139	3300042876	Bacteria	161883
732	Ga0451577_0097387	3300042876	Bacteria	2627
733	Ga0451577_0150700	3300042876	Bacteria	2092
734	Ga0451577_0990910	3300042876	Bacteria	755
735	Ga0451577_1223130	3300042876	Bacteria	670
736	Ga0466986_0510418	3300044650	Bacteria	669
737	Ga0466981_0000041	3300044669	Bacteria	41355
738	Ga0453683_0000392	3300044673	Bacteria	52154
739	Ga0453684_0009530	3300044712	Bacteria	16970
740	Ga0453684_0051165	3300044712	Bacteria	5420
741	Ga0453684_0126829	3300044712	Bacteria	3069
742	Ga0453684_0196274	3300044712	Bacteria	2357
743	Ga0453684_0211699	3300044712	Bacteria	2252
744	Ga0466968_0427917	3300044735	Bacteria	652
745	Ga0466970_0129556	3300044765	Bacteria	1385
746	Ga0466957_1180952	3300044842	Bacteria	553
747	Ga0451576_0002988	3300045051	Bacteria	23949
748	Ga0451576_1544623	3300045051	Bacteria	689
749	Ga0495627_000696	3300046453	Bacteria	25746
750	Ga0495627_119300	3300046453	Bacteria	745
751	Ga0495591_000658	3300046458	Bacteria	25518
752	Ga0495591_001736	3300046458	Bacteria	12983
753	Ga0495638_0001912	3300046460	Bacteria	17955
754	Ga0495650_0000787	3300046471	Bacteria	38830
755	Ga0495650_0001108	3300046471	Bacteria	29502
756	Ga0495650_0008267	3300046471	Bacteria	6101
757	Ga0495605_0003552	3300046474	Bacteria	9242
758	Ga0495584_0002357	3300046491	Bacteria	10763
759	Ga0495585_0016401	3300046492	Bacteria	4291
760	Ga0495596_0009116	3300046500	Bacteria	4381
761	Ga0495607_0005107	3300046501	Bacteria	9495
762	Ga0495606_0004907	3300046507	Bacteria	13094
763	Ga0495608_0614347	3300046511	Bacteria	652
764	Ga0495616_0041811	3300046513	Bacteria	2336
765	Ga0495620_0027513	3300046515	Bacteria	2659
766	Ga0495630_0006403	3300046517	Bacteria	8376
767	Ga0495631_0015328	3300046518	Bacteria	3675
768	Ga0495632_0056123	3300046519	Bacteria	1926
769	Ga0495643_0014746	3300046522	Bacteria	4641
770	Ga0495643_0017256	3300046522	Bacteria	4223
771	Ga0495643_0063859	3300046522	Bacteria	1946
772	Ga0495644_0000420	3300046523	Bacteria	18895
773	Ga0495648_0013359	3300046524	Bacteria	6078
774	Ga0495666_0225901	3300046526	Bacteria	857
775	Ga0495654_0000178	3300046530	Bacteria	62611
776	Ga0495654_0000730	3300046530	Bacteria	25592
777	Ga0495654_0015484	3300046530	Bacteria	4047
778	Ga0495654_0029546	3300046530	Bacteria	2794
779	Ga0495609_0166211	3300046538	Bacteria	933
780	Ga0495621_0113025	3300046539	Bacteria	1043
781	Ga0495597_0002054	3300046542	Bacteria	13432
782	Ga0495668_0122736	3300046616	Bacteria	1421
783	Ga0495625_0004220	3300046660	Bacteria	13697
784	Ga0495588_0006351	3300046674	Bacteria	5319
785	Ga0495623_0330569	3300046679	Bacteria	835
786	Ga0495671_0000488	3300046692	Bacteria	30667
787	Ga0495649_0033297	3300046694	Bacteria	2836
788	Ga0495589_0000538	3300046794	Bacteria	26421
789	Ga0495589_0009440	3300046794	Bacteria	5074
790	Ga0495660_0000286	3300046810	Bacteria	46967
791	Ga0495660_0000352	3300046810	Bacteria	40624
792	Ga0495660_0005861	3300046810	Bacteria	7329
793	Ga0495636_0258292	3300047318	Bacteria	807
794	Ga0495672_0000011	3300047320	Bacteria	535362
795	Ga0495672_0000040	3300047320	Bacteria	268573
796	Ga0495672_0000057	3300047320	Bacteria	221635
797	Ga0495683_0027974	3300047323	Bacteria	2882
798	Ga0495679_007993	3300047446	Bacteria	4347
799	Ga0495673_0000948	3300047469	Bacteria	26258
800	Ga0495673_0002408	3300047469	Bacteria	13186
801	Ga0495681_0009501	3300047470	Bacteria	5983
802	Ga0495681_0098751	3300047470	Bacteria	1279
803	Ga0496100_0006417	3300048903	Bacteria	6409
804	Ga0496101_1110914	3300048904	Bacteria	620
805	Ga0496102_0008032	3300048905	Bacteria	9021
806	Ga0496103_0024190	3300048906	Bacteria	3664
807	Ga0496103_0074206	3300048906	Bacteria	2132
808	Ga0496104_0002752	3300048907	Bacteria	15143
809	Ga0496105_0014958	3300048908	Bacteria	6176
810	Ga0496105_0122629	3300048908	Bacteria	2143
811	Ga0496106_0145412	3300048909	Bacteria	1867
812	Ga0496109_0520803	3300048912	Bacteria	1122
813	Ga0496109_1587018	3300048912	Bacteria	589
814	Ga0496110_0078363	3300048913	Bacteria	2942
815	Ga0496111_0228780	3300048914	Bacteria	1381
816	Ga0496111_0344977	3300048914	Bacteria	1102
817	Ga0496112_0633054	3300048915	Bacteria	1000
818	Ga0496113_0142152	3300048916	Bacteria	1889
819	Ga0496116_0001902	3300048919	Bacteria	22502
820	Ga0496116_0004226	3300048919	Bacteria	13802
821	Ga0496116_0179081	3300048919	Bacteria	1137
822	Ga0496117_0055475	3300048920	Bacteria	2768
823	Ga0496117_0345459	3300048920	Bacteria	770
824	Ga0496118_0004575	3300048921	Bacteria	16282
825	Ga0496118_0061768	3300048921	Bacteria	2771
826	Ga0496119_0011070	3300048922	Bacteria	7514
827	Ga0496119_0026821	3300048922	Bacteria	3982
828	Ga0496119_0027860	3300048922	Bacteria	3870
829	Ga0496119_0063774	3300048922	Bacteria	2190
830	Ga0496120_0001572	3300048923	Bacteria	26689
831	Ga0496120_0003750	3300048923	Bacteria	13457
832	Ga0496120_0027570	3300048923	Bacteria	3490
833	Ga0496121_0007671	3300048924	Bacteria	12960
834	Ga0496122_0001405	3300048925	Bacteria	39030
835	Ga0496122_0038644	3300048925	Bacteria	3819
836	Ga0496122_0113885	3300048925	Bacteria	1765
837	Ga0496123_0001162	3300048926	Bacteria	39028
838	Ga0496123_0097706	3300048926	Bacteria	1719
839	Ga0496124_0001250	3300048927	Bacteria	38944
840	Ga0496124_0362008	3300048927	Bacteria	1021
841	Ga0496125_0000100	3300048928	Bacteria	202713
842	Ga0496125_0018559	3300048928	Bacteria	6604
843	Ga0496125_0049430	3300048928	Bacteria	3494
844	Ga0496126_0021055	3300048929	Bacteria	6379
845	Ga0496126_0053009	3300048929	Bacteria	3682
846	Ga0496126_0090602	3300048929	Bacteria	2690
847	Ga0496126_0113896	3300048929	Bacteria	2353
848	Ga0501306_062566	3300049127	Bacteria	615
849	Ga0501307_094277	3300049162	Bacteria	503
850	Ga0495678_000882	3300049459	Bacteria	26697
851	Ga0495678_019016	3300049459	Bacteria	3075
852	Ga0495682_0000520	3300049460	Bacteria	26623
853	Ga0501296_010368	3300049519	Bacteria	1104
854	Ga0501334_14951	3300049550	Bacteria	591
855	Ga0501032_0711301	3300049569	Bacteria	636
856	Ga0501032_0750901	3300049569	Bacteria	617
857	Ga0501033_0043558	3300049570	Bacteria	3342
858	Ga0501034_1201048	3300049571	Bacteria	637
859	Ga0501034_1567864	3300049571	Bacteria	532
860	Ga0501036_0501729	3300049572	Bacteria	1010
861	Ga0501036_0620091	3300049572	Bacteria	896
862	Ga0501037_0001035	3300049573	Bacteria	20561
863	Ga0501037_1092052	3300049573	Bacteria	517
864	Ga0501038_0090413	3300049574	Bacteria	2566
865	Ga0501038_0113988	3300049574	Bacteria	2236
866	Ga0501038_0310526	3300049574	Bacteria	1236
867	Ga0501039_0015373	3300049575	Bacteria	5859
868	Ga0501039_0097397	3300049575	Bacteria	2294
869	Ga0501039_0330346	3300049575	Bacteria	1198
870	Ga0501040_0021344	3300049576	Bacteria	4324
871	Ga0501040_0039400	3300049576	Bacteria	3213
872	Ga0501040_1258574	3300049576	Bacteria	537
873	Ga0501041_0019155	3300049577	Bacteria	4082
874	Ga0501041_0055179	3300049577	Bacteria	2425
875	Ga0501042_0052378	3300049578	Bacteria	2911
876	Ga0501042_0126198	3300049578	Bacteria	1843
877	Ga0501042_0579993	3300049578	Bacteria	815
878	Ga0501042_1072061	3300049578	Bacteria	587
879	Ga0501046_0044244	3300049580	Bacteria	3541
880	Ga0501046_0077348	3300049580	Bacteria	2576
881	Ga0501046_0897924	3300049580	Bacteria	618
882	Ga0501047_0027520	3300049581	Bacteria	5477
883	Ga0501047_0428298	3300049581	Bacteria	1154
884	Ga0501047_0665228	3300049581	Bacteria	860
885	Ga0501048_0029263	3300049582	Bacteria	3996
886	Ga0501068_0015132	3300049584	Bacteria	4426
887	Ga0501068_0814996	3300049584	Unclassified	612
888	Ga0501069_0094739	3300049585	Bacteria	1690
889	Ga0501069_0778446	3300049585	Bacteria	579
890	Ga0501070_0022172	3300049586	Bacteria	5319
891	Ga0501070_0051615	3300049586	Bacteria	3413
892	Ga0501070_0174990	3300049586	Bacteria	1767
893	Ga0501071_0020287	3300049587	Bacteria	4617
894	Ga0501071_0391954	3300049587	Bacteria	1060
895	Ga0501071_0392491	3300049587	Bacteria	1059
896	Ga0501071_1262868	3300049587	Bacteria	570
897	Ga0501072_0076994	3300049588	Bacteria	2640
898	Ga0501072_0093644	3300049588	Bacteria	2386
899	Ga0501072_0104845	3300049588	Bacteria	2248
900	Ga0501074_0000179	3300049590	Bacteria	34289
901	Ga0501074_0210750	3300049590	Bacteria	1384
902	Ga0501074_0255333	3300049590	Bacteria	1247
903	Ga0501074_0420149	3300049590	Bacteria	948
904	Ga0501075_0029856	3300049591	Bacteria	4033
905	Ga0501075_0051380	3300049591	Bacteria	3099
906	Ga0501075_1492684	3300049591	Bacteria	512
907	Ga0501076_0033905	3300049592	Bacteria	3987
908	Ga0501076_0335683	3300049592	Bacteria	1240
909	Ga0501076_0867344	3300049592	Bacteria	744
910	Ga0501077_0012488	3300049593	Bacteria	5317
911	Ga0501077_0071743	3300049593	Bacteria	2195
912	Ga0501077_0488718	3300049593	Bacteria	789
913	Ga0501079_0033472	3300049741	Bacteria	3953
914	Ga0501079_0068669	3300049741	Bacteria	2736
915	Ga0501079_0580104	3300049741	Unclassified	882
916	Ga0501080_0001184	3300049742	Bacteria	21614
917	Ga0501080_0011395	3300049742	Bacteria	8144
918	Ga0501080_0133578	3300049742	Bacteria	2297
919	Ga0501081_0045960	3300049743	Bacteria	2999
920	Ga0501081_0058721	3300049743	Bacteria	2662
921	Ga0501083_0002042	3300049744	Bacteria	13908
922	Ga0501083_0081151	3300049744	Bacteria	2150
923	Ga0501083_0562928	3300049744	Bacteria	742
924	Ga0501035_0033983	3300049822	Bacteria	4635
925	Ga0501035_0503824	3300049822	Bacteria	996
926	Ga0501044_0000086	3300049823	Bacteria	114287
927	Ga0501045_0023485	3300049824	Bacteria	4421
928	Ga0501226_001020	3300049853	Bacteria	3647
929	nmdc:mga03n38_7412_c1	3300050490	Bacteria	3881
930	nmdc:mga00v17_221950_c1	3300050491	Bacteria	1224
931	nmdc:mga00v17_423158_c1	3300050491	Bacteria	865
932	nmdc:mga00v17_505008_c1	3300050491	Bacteria	784
933	nmdc:mga0k408_12227_c1	3300050493	Bacteria	4141
934	nmdc:mga06z11_145155_c1	3300050494	Bacteria	1344
935	nmdc:mga06z11_423983_c1	3300050494	Bacteria	802
936	nmdc:mga07m45_817001_c1	3300050496	Bacteria	534
937	nmdc:mga09592_709487_c1	3300050508	Bacteria	856
938	nmdc:mga09592_74996_c1	3300050508	Bacteria	2875
939	nmdc:mga0qj67_461522_c1	3300050509	Bacteria	1022
940	nmdc:mga0qj67_6556_c1	3300050509	Bacteria	8550
941	nmdc:mga06r32_141709_c1	3300050510	Bacteria	2380
942	nmdc:mga06r32_24034_c1	3300050510	Bacteria	5650
943	nmdc:mga06r32_54274_c1	3300050510	Bacteria	3842
944	nmdc:mga0n895_118290_c1	3300050512	Bacteria	2670
945	nmdc:mga0n895_21250_c1	3300050512	Bacteria	6065
946	nmdc:mga0n895_483483_c1	3300050512	Bacteria	1248
947	nmdc:mga0n895_741720_c1	3300050512	Bacteria	976
948	nmdc:mga0rr50_132074_c1	3300050513	Bacteria	2000
949	nmdc:mga0rr50_629966_c1	3300050513	Bacteria	915
950	nmdc:mga0rr50_73319_c1	3300050513	Bacteria	2617
951	Ga0500621_000035	3300053126	Bacteria	26463
952	Ga0500573_0424449	3300053140	Bacteria	622
953	Ga0500616_0012293	3300053153	Bacteria	5012
954	Ga0500637_0382953	3300053178	Bacteria	737
955	Ga0501084_0005747	3300054114	Bacteria	10202
956	Ga0501084_0008704	3300054114	Bacteria	8394
957	Ga0501084_0790117	3300054114	Bacteria	799
958	Ga0501084_0883135	3300054114	Bacteria	752
959	Ga0587086_106274	3300059507	Unclassified	523
960	Ga0587117_113644	3300059627	Bacteria	529
961	Ga0587062_074351	3300059639	Bacteria	620
962	Ga0587111_0042066	3300060346	Bacteria	978
963	Ga0587111_0042631	3300060346	Bacteria	973
964	Ga0501082_0026777	3300060353	Bacteria	4969
965	Ga0530510_0020862	3300061734	Bacteria	4660
966	Ga0530510_0185751	3300061734	Bacteria	1542
967	Ga0530510_0810729	3300061734	Bacteria	714
968	Ga0530510_1337267	3300061734	Bacteria	550

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300007265	Ga0099794_10488435	Ga0099794_104884351	80
2	3300005328	Ga0070676_10608786	Ga0070676_106087862	82
3	3300014325	Ga0163163_12729138	Ga0163163_127291381	82
4	3300049573	Ga0501037_1092052	Ga0501037_1092052_146_415	86
5	3300049592	Ga0501076_0867344	Ga0501076_0867344_362_631	86
6	3300054114	Ga0501084_0790117	Ga0501084_0790117_520_789	86
7	3300009101	Ga0105247_11594329	Ga0105247_115943292	87
8	3300009176	Ga0105242_13321896	Ga0105242_133218961	87
9	3300009177	Ga0105248_10490209	Ga0105248_104902093	87
10	3300009553	Ga0105249_10108165	Ga0105249_101081653	87
11	3300009553	Ga0105249_10220317	Ga0105249_102203171	87
12	3300013306	Ga0163162_11343129	Ga0163162_113431292	87
13	3300014325	Ga0163163_10788311	Ga0163163_107883112	87
14	3300014326	Ga0157380_11554327	Ga0157380_115543272	87
15	3300026075	Ga0207708_11480104	Ga0207708_114801042	87
16	3300031691	Ga0316579_10076875	Ga0316579_100768753	87
17	3300042125	Ga0450923_020397	Ga0450923_020397_954_1223	87
18	3300049569	Ga0501032_0750901	Ga0501032_0750901_260_532	87
19	3300049570	Ga0501033_0043558	Ga0501033_0043558_2992_3264	87
20	3300049571	Ga0501034_1567864	Ga0501034_1567864_87_359	87
21	3300049572	Ga0501036_0620091	Ga0501036_0620091_450_722	87
22	3300049574	Ga0501038_0113988	Ga0501038_0113988_225_497	87
23	3300049575	Ga0501039_0015373	Ga0501039_0015373_3016_3288	87
24	3300049576	Ga0501040_0039400	Ga0501040_0039400_2863_3135	87
25	3300049577	Ga0501041_0019155	Ga0501041_0019155_778_1050	87
26	3300049578	Ga0501042_0052378	Ga0501042_0052378_1876_2148	87
27	3300049580	Ga0501046_0044244	Ga0501046_0044244_3159_3431	87
28	3300049581	Ga0501047_0665228	Ga0501047_0665228_80_352	87
29	3300049582	Ga0501048_0029263	Ga0501048_0029263_3175_3447	87
30	3300049584	Ga0501068_0015132	Ga0501068_0015132_1594_1866	87
31	3300049585	Ga0501069_0778446	Ga0501069_0778446_239_511	87
32	3300049587	Ga0501071_0020287	Ga0501071_0020287_1127_1399	87
33	3300049588	Ga0501072_0093644	Ga0501072_0093644_351_623	87
34	3300049590	Ga0501074_0210750	Ga0501074_0210750_320_592	87
35	3300049591	Ga0501075_0051380	Ga0501075_0051380_79_351	87
36	3300049593	Ga0501077_0012488	Ga0501077_0012488_5026_5298	87
37	3300049741	Ga0501079_0033472	Ga0501079_0033472_3218_3490	87
38	3300049742	Ga0501080_0011395	Ga0501080_0011395_4682_4954	87
39	3300049743	Ga0501081_0045960	Ga0501081_0045960_1039_1311	87
40	3300049744	Ga0501083_0081151	Ga0501083_0081151_132_404	87
41	3300049822	Ga0501035_0033983	Ga0501035_0033983_3280_3552	87
42	3300049824	Ga0501045_0023485	Ga0501045_0023485_3927_4199	87
43	3300050508	nmdc:mga09592_709487_c1	nmdc:mga09592_709487_c1_577_846	87
44	3300050509	nmdc:mga0qj67_6556_c1	nmdc:mga0qj67_6556_c1_6699_6968	87
45	3300050510	nmdc:mga06r32_24034_c1	nmdc:mga06r32_24034_c1_529_798	87
46	3300054114	Ga0501084_0008704	Ga0501084_0008704_5082_5354	87
47	3300059507	Ga0587086_106274	Ga0587086_106274_84_350	87
48	3300060353	Ga0501082_0026777	Ga0501082_0026777_3169_3441	87
49	3300061734	Ga0530510_0020862	Ga0530510_0020862_1170_1442	87
50	3300007788	Ga0099795_10456711	Ga0099795_104567112	88
51	3300032168	Ga0316593_10134376	Ga0316593_101343762	88
52	3300032168	Ga0316593_10373765	Ga0316593_103737651	88
53	3300033541	Ga0316596_1011352	Ga0316596_10113524	88
54	3300042008	Ga0439450_192402	Ga0439450_192402_184_456	88
55	3300042876	Ga0451577_0150700	Ga0451577_0150700_985_1251	88
56	3300049587	Ga0501071_0391954	Ga0501071_0391954_422_766	88
57	3300049592	Ga0501076_0335683	Ga0501076_0335683_209_481	88
58	3300050513	nmdc:mga0rr50_73319_c1	nmdc:mga0rr50_73319_c1_2249_2560	88
59	3300061734	Ga0530510_1337267	Ga0530510_1337267_128_496	88
60	iso_pu_bacteria	2506520007	2506580744	88
61	iso_pu_bacteria	2506520008	2506585883	88
62	iso_pu_bacteria	2508501071	2508854547	88
63	iso_pu_bacteria	2511231025	2511379848	88
64	iso_pu_bacteria	2511231035	2511436638	88
65	iso_pu_bacteria	2523533628	2524002986	88
66	iso_pu_bacteria	2537561728	2538425690	88
67	iso_pu_bacteria	2547132181	2547698878	88
68	iso_pu_bacteria	2547132416	2548653080	88
69	iso_pu_bacteria	2554235234	2555262673	88
70	iso_pu_bacteria	2561511199	2562464740	88
71	iso_pu_bacteria	2565956521	2566037278	88
72	iso_pu_bacteria	2585427591	2585830091	88
73	iso_pu_bacteria	2585427592	2585835151	88
74	iso_pu_bacteria	2599185169	2599413698	88
75	iso_pu_bacteria	2599185299	2599925231	88
76	iso_pu_bacteria	2600255254	2601526363	88
77	iso_pu_bacteria	2600255255	2601531386	88
78	iso_pu_bacteria	2600255256	2601536779	88
79	iso_pu_bacteria	2600255257	2601542101	88
80	iso_pu_bacteria	2600255280	2601618247	88
81	iso_pu_bacteria	2600255281	2601623253	88
82	iso_pu_bacteria	2600255287	2601646623	88
83	iso_pu_bacteria	2600255288	2601651636	88
84	iso_pu_bacteria	2600255289	2601656668	88
85	iso_pu_bacteria	2600255290	2601661673	88
86	iso_pu_bacteria	2600255291	2601666582	88
87	iso_pu_bacteria	2600255298	2601699542	88
88	iso_pu_bacteria	2600255299	2601704453	88
89	iso_pu_bacteria	2600255300	2601709476	88
90	iso_pu_bacteria	2600255301	2601714492	88
91	iso_pu_bacteria	2600255302	2601719523	88
92	iso_pu_bacteria	2600255303	2601724425	88
93	iso_pu_bacteria	2600255304	2601729446	88
94	iso_pu_bacteria	2600255305	2601734496	88
95	iso_pu_bacteria	2600255306	2601739486	88
96	iso_pu_bacteria	2600255307	2601744618	88
97	iso_pu_bacteria	2600255309	2601755111	88
98	iso_pu_bacteria	2600255310	2601760460	88
99	iso_pu_bacteria	2600255311	2601765830	88
100	iso_pu_bacteria	2600255392	2602022378	88
101	iso_pu_bacteria	2602042046	2603636536	88
102	iso_pu_bacteria	2602042047	2603641951	88
103	iso_pu_bacteria	2602042052	2603659270	88
104	iso_pu_bacteria	2602042053	2603664163	88
105	iso_pu_bacteria	2602042066	2603697994	88
106	iso_pu_bacteria	2602042067	2603702344	88
107	iso_pu_bacteria	2602042103	2603836819	88
108	iso_pu_bacteria	2602042104	2603841928	88
109	iso_pu_bacteria	2602042105	2603846971	88
110	iso_pu_bacteria	2602042106	2603852041	88
111	iso_pu_bacteria	2602042109	2603865015	88
112	iso_pu_bacteria	2602042110	2603869613	88
113	iso_pu_bacteria	2602042111	2603874819	88
114	iso_pu_bacteria	2603880178	2606046829	88
115	iso_pu_bacteria	2603880184	2606068593	88
116	iso_pu_bacteria	2603880202	2606144501	88
117	iso_pu_bacteria	2603880211	2606174688	88
118	iso_pu_bacteria	2608642108	2608672223	88
119	iso_pu_bacteria	2609459761	2609914602	88
120	iso_pu_bacteria	2636415599	2637223023	88
121	iso_pu_bacteria	2648501241	2649122829	88
122	iso_pu_bacteria	2648501693	2650899326	88
123	iso_pu_bacteria	2651869818	2652975771	88
124	iso_pu_bacteria	2654587920	2656276172	88
125	iso_pu_bacteria	2667528172	2671105910	88
126	iso_pu_bacteria	2667528173	2671110992	88
127	iso_pu_bacteria	2671180115	2671589078	88
128	iso_pu_bacteria	2675903046	2676410370	88
129	iso_pu_bacteria	2681812866	2681995314	88
130	iso_pu_bacteria	2681812869	2682010088	88
131	iso_pu_bacteria	2684622997	2686356863	88
132	iso_pu_bacteria	2687453601	2689447303	88
133	iso_pu_bacteria	2690315857	2691333067	88
134	iso_pu_bacteria	2706794495	2707102079	88
135	iso_pu_bacteria	2711768156	2712472237	88
136	iso_pu_bacteria	2740891818	2740990510	88
137	iso_pu_bacteria	2751185917	2753857858	88
138	iso_pu_bacteria	2765235842	2765590979	88
139	iso_pu_bacteria	2772190666	2772441107	88
140	iso_pu_bacteria	2775506706	2775542701	88
141	iso_pu_bacteria	2775507074	2777024592	88
142	iso_pu_bacteria	2791354903	2791923315	88
143	iso_pu_bacteria	2791355010	2792311286	88
144	iso_pu_bacteria	2791355275	2793403748	88
145	iso_pu_bacteria	2806310673	2807179205	88
146	iso_pu_bacteria	2808606414	2809128018	88
147	iso_pu_bacteria	2811995292	2813726660	88
148	iso_pu_bacteria	2814123068	2814694033	88
149	iso_pu_bacteria	2821118458	2821122533	88
150	iso_pu_bacteria	2823373977	2823378656	88
151	iso_pu_bacteria	2844425489	2844429351	88
152	iso_pu_bacteria	2844528606	2844533104	88
153	iso_pu_bacteria	2846540461	2846543405	88
154	iso_pu_bacteria	2847085930	2847090206	88
155	iso_pu_bacteria	2847797336	2847797776	88
156	iso_pu_bacteria	2852103415	2852106468	88
157	iso_pu_bacteria	2854601825	2854605328	88
158	iso_pu_bacteria	2855195626	2855200113	88
159	iso_pu_bacteria	2858466076	2858466993	88
160	iso_pu_bacteria	2865014394	2865018849	88
161	iso_pu_bacteria	2869551831	2869556720	88
162	iso_pu_bacteria	2871272651	2871275296	88
163	iso_pu_bacteria	2871282230	2871284918	88
164	iso_pu_bacteria	2876601092	2876601481	88
165	iso_pu_bacteria	2881609920	2881613181	88
166	iso_pu_bacteria	2884086401	2884086902	88
167	iso_pu_bacteria	2887630918	2887633806	88
168	iso_pu_bacteria	2888366609	2888371233	88
169	iso_pu_bacteria	2888373701	2888376094	88
170	iso_pu_bacteria	2891670763	2891674027	88
171	iso_pu_bacteria	2904474040	2904479216	88
172	iso_pu_bacteria	2904504865	2904509636	88
173	iso_pu_bacteria	2904513164	2904518024	88
174	iso_pu_bacteria	2908669403	2908674756	88
175	iso_pu_bacteria	2919108558	2919113059	88
176	iso_pu_bacteria	2919150387	2919155531	88
177	iso_pu_bacteria	2919493220	2919496411	88
178	iso_pu_bacteria	2919497567	2919501562	88
179	iso_pu_bacteria	2919534386	2919538559	88
180	iso_pu_bacteria	2919543075	2919546998	88
181	iso_pu_bacteria	2923525760	2923526643	88
182	iso_pu_bacteria	2923634449	2923636875	88
183	iso_pu_bacteria	2927143783	2927148983	88
184	iso_pu_bacteria	2927833300	2927836673	88
185	iso_pu_bacteria	2932406140	2932409464	88
186	iso_pu_bacteria	2935625433	2935630330	88
187	iso_pu_bacteria	2937539931	2937542046	88
188	iso_pu_bacteria	2937967321	2937970494	88
189	iso_pu_bacteria	2939568625	2939573039	88
190	iso_pu_bacteria	2939573065	2939577762	88
191	iso_pu_bacteria	2939577877	2939582562	88
192	iso_pu_bacteria	2939602548	2939606236	88
193	iso_pu_bacteria	2939607340	2939611918	88
194	iso_pu_bacteria	2939617950	2939622566	88
195	iso_pu_bacteria	2939642701	2939646987	88
196	iso_pu_bacteria	2945874760	2945875711	88
197	iso_pu_bacteria	2945951305	2945955360	88
198	iso_pu_bacteria	2969079654	2969080051	88
199	iso_pu_bacteria	2971820967	2971821401	88
200	iso_pu_bacteria	2974310843	2974314790	88
201	iso_pu_bacteria	2974435778	2974440419	88
202	iso_pu_bacteria	2978975091	2978977835	88
203	iso_pu_bacteria	2984494565	2984499206	88
204	iso_pu_bacteria	2984559226	2984562505	88
205	iso_pu_bacteria	2984595703	2984600566	88
206	iso_pu_bacteria	2990261002	2990263909	88
207	iso_pu_bacteria	3000376612	3000377369	88
208	iso_pu_bacteria	8004592986	8004594461	88
209	iso_pu_bacteria	8015394850	8015398757	88
210	iso_pu_bacteria	8016733728	8016734140	88
211	iso_pu_bacteria	8018221730	8018225092	88
212	iso_pu_bacteria	8018405270	8018406452	88
213	iso_pu_bacteria	8019499862	8019504039	88
214	iso_pu_bacteria	8019504834	8019509427	88
215	iso_pu_bacteria	8054844752	8054847669	88
216	iso_pu_bacteria	8054849141	8054849616	88
217	iso_pu_bacteria	8055087960	8055092252	88
218	iso_pu_bacteria	8055092621	8055092973	88
219	iso_pu_bacteria	8055097453	8055097826	88
220	iso_pu_bacteria	8055693939	8055697977	88
221	iso_pu_bacteria	8057304971	8057308111	88
222	3300005295	Ga0065707_10001618	Ga0065707_100016182	89
223	3300006051	Ga0075364_10080235	Ga0075364_100802354	89
224	3300006178	Ga0075367_10194594	Ga0075367_101945942	89
225	3300025711	Ga0207696_1000198	Ga0207696_100019887	89
226	3300025911	Ga0207654_11353844	Ga0207654_113538442	89
227	3300031727	Ga0316576_10005961	Ga0316576_100059619	89
228	3300031903	Ga0307407_10603052	Ga0307407_106030522	89
229	3300031995	Ga0307409_100008471	Ga0307409_1000084715	89
230	3300032005	Ga0307411_12339475	Ga0307411_123394752	89
231	3300035398	Ga0316574_0000624	Ga0316574_0000624_12343_12612	89
232	3300035398	Ga0316574_0486307	Ga0316574_0486307_214_483	89
233	3300036647	Ga0316582_0572329	Ga0316582_0572329_223_492	89
234	3300041491	Ga0451833_0861978	Ga0451833_0861978_134_403	89
235	3300041916	Ga0452271_14401	Ga0452271_14401_453_722	89
236	3300046679	Ga0495623_0330569	Ga0495623_0330569_218_511	89
237	3300047318	Ga0495636_0258292	Ga0495636_0258292_293_562	89
238	3300050490	nmdc:mga03n38_7412_c1	nmdc:mga03n38_7412_c1_1426_1704	89
239	3300050491	nmdc:mga00v17_423158_c1	nmdc:mga00v17_423158_c1_222_500	89
240	3300050494	nmdc:mga06z11_145155_c1	nmdc:mga06z11_145155_c1_852_1130	89
241	3300053140	Ga0500573_0424449	Ga0500573_0424449_71_340	89
242	3300053153	Ga0500616_0012293	Ga0500616_0012293_3203_3472	89
243	3300005340	Ga0070689_100124186	Ga0070689_1001241863	90
244	3300005365	Ga0070688_100041186	Ga0070688_1000411862	90
245	3300005437	Ga0070710_10290713	Ga0070710_102907132	90
246	3300005439	Ga0070711_100105641	Ga0070711_1001056412	90
247	3300005843	Ga0068860_100336649	Ga0068860_1003366493	90
248	3300009551	Ga0105238_10090877	Ga0105238_100908772	90
249	3300009551	Ga0105238_10761653	Ga0105238_107616533	90
250	3300025916	Ga0207663_10033208	Ga0207663_100332084	90
251	3300028381	Ga0268264_10267969	Ga0268264_102679692	90
252	3300031344	Ga0265316_10191095	Ga0265316_101910952	90
253	3300031665	Ga0316575_10011754	Ga0316575_100117544	90
254	3300031665	Ga0316575_10021694	Ga0316575_100216944	90
255	3300031665	Ga0316575_10031703	Ga0316575_100317033	90
256	3300031665	Ga0316575_10201900	Ga0316575_102019002	90
257	3300031665	Ga0316575_10247276	Ga0316575_102472762	90
258	3300031665	Ga0316575_10284483	Ga0316575_102844832	90
259	3300031691	Ga0316579_10005295	Ga0316579_100052952	90
260	3300031691	Ga0316579_10029948	Ga0316579_100299482	90
261	3300031691	Ga0316579_10077344	Ga0316579_100773441	90
262	3300031727	Ga0316576_10005535	Ga0316576_100055353	90
263	3300031727	Ga0316576_10005914	Ga0316576_1000591411	90
264	3300031727	Ga0316576_10016497	Ga0316576_100164973	90
265	3300031727	Ga0316576_10048175	Ga0316576_100481755	90
266	3300031727	Ga0316576_10102525	Ga0316576_101025251	90
267	3300031727	Ga0316576_10126683	Ga0316576_101266832	90
268	3300031727	Ga0316576_10262708	Ga0316576_102627082	90
269	3300031728	Ga0316578_10043727	Ga0316578_100437274	90
270	3300031728	Ga0316578_10046392	Ga0316578_100463922	90
271	3300031728	Ga0316578_10079270	Ga0316578_100792704	90
272	3300031728	Ga0316578_10194426	Ga0316578_101944261	90
273	3300031728	Ga0316578_10463303	Ga0316578_104633032	90
274	3300031728	Ga0316578_10556637	Ga0316578_105566372	90
275	3300031728	Ga0316578_10802455	Ga0316578_108024552	90
276	3300031733	Ga0316577_10017014	Ga0316577_100170145	90
277	3300032133	Ga0316583_10033302	Ga0316583_100333024	90
278	3300032133	Ga0316583_10054816	Ga0316583_100548162	90
279	3300032133	Ga0316583_10149326	Ga0316583_101493262	90
280	3300032137	Ga0316585_10131502	Ga0316585_101315022	90
281	3300032139	Ga0316580_10003686	Ga0316580_100036864	90
282	3300032168	Ga0316593_10000042	Ga0316593_1000004223	90
283	3300032168	Ga0316593_10000968	Ga0316593_100009681	90
284	3300032168	Ga0316593_10002038	Ga0316593_100020387	90
285	3300032168	Ga0316593_10003175	Ga0316593_100031753	90
286	3300032168	Ga0316593_10004139	Ga0316593_100041393	90
287	3300032168	Ga0316593_10010252	Ga0316593_100102525	90
288	3300032168	Ga0316593_10017572	Ga0316593_100175724	90
289	3300032168	Ga0316593_10020811	Ga0316593_100208114	90
290	3300032168	Ga0316593_10023739	Ga0316593_100237392	90
291	3300032168	Ga0316593_10029863	Ga0316593_100298633	90
292	3300032168	Ga0316593_10088070	Ga0316593_100880703	90
293	3300032168	Ga0316593_10249876	Ga0316593_102498762	90
294	3300033524	Ga0316592_1000008	Ga0316592_10000087	90
295	3300033524	Ga0316592_1000366	Ga0316592_10003665	90
296	3300033524	Ga0316592_1000411	Ga0316592_10004117	90
297	3300033524	Ga0316592_1001885	Ga0316592_10018855	90
298	3300033524	Ga0316592_1005866	Ga0316592_10058664	90
299	3300033524	Ga0316592_1021977	Ga0316592_10219773	90
300	3300033527	Ga0316586_1000060	Ga0316586_10000606	90
301	3300033527	Ga0316586_1000370	Ga0316586_10003708	90
302	3300033527	Ga0316586_1003434	Ga0316586_10034342	90
303	3300033527	Ga0316586_1043099	Ga0316586_10430992	90
304	3300033527	Ga0316586_1055990	Ga0316586_10559901	90
305	3300033528	Ga0316588_1000495	Ga0316588_10004957	90
306	3300033528	Ga0316588_1042489	Ga0316588_10424892	90
307	3300033528	Ga0316588_1173271	Ga0316588_11732711	90
308	3300033529	Ga0316587_1000022	Ga0316587_100002216	90
309	3300033529	Ga0316587_1000319	Ga0316587_10003196	90
310	3300033529	Ga0316587_1005715	Ga0316587_10057152	90
311	3300033529	Ga0316587_1009257	Ga0316587_10092572	90
312	3300033529	Ga0316587_1011919	Ga0316587_10119193	90
313	3300033529	Ga0316587_1035822	Ga0316587_10358222	90
314	3300033529	Ga0316587_1041854	Ga0316587_10418542	90
315	3300033529	Ga0316587_1113541	Ga0316587_11135411	90
316	3300033541	Ga0316596_1000026	Ga0316596_10000268	90
317	3300033541	Ga0316596_1000296	Ga0316596_100029614	90
318	3300033541	Ga0316596_1000644	Ga0316596_10006449	90
319	3300033541	Ga0316596_1001141	Ga0316596_10011416	90
320	3300033541	Ga0316596_1001556	Ga0316596_10015566	90
321	3300033541	Ga0316596_1002958	Ga0316596_10029583	90
322	3300033541	Ga0316596_1033638	Ga0316596_10336382	90
323	3300033541	Ga0316596_1043360	Ga0316596_10433602	90
324	3300033541	Ga0316596_1054419	Ga0316596_10544192	90
325	3300033541	Ga0316596_1118242	Ga0316596_11182422	90
326	3300033541	Ga0316596_1185863	Ga0316596_11858632	90
327	3300035398	Ga0316574_0000085	Ga0316574_0000085_14978_15250	90
328	3300035398	Ga0316574_0008614	Ga0316574_0008614_1265_1537	90
329	3300035398	Ga0316574_0061024	Ga0316574_0061024_2001_2273	90
330	3300035398	Ga0316574_0116002	Ga0316574_0116002_1314_1586	90
331	3300035398	Ga0316574_0140559	Ga0316574_0140559_222_494	90
332	3300035398	Ga0316574_0278314	Ga0316574_0278314_665_937	90
333	3300035398	Ga0316574_0386021	Ga0316574_0386021_220_492	90
334	3300035398	Ga0316574_0476349	Ga0316574_0476349_50_322	90
335	3300036647	Ga0316582_0012852	Ga0316582_0012852_1396_1668	90
336	3300036647	Ga0316582_0052920	Ga0316582_0052920_911_1183	90
337	3300036647	Ga0316582_0106141	Ga0316582_0106141_610_882	90
338	3300036647	Ga0316582_0220624	Ga0316582_0220624_206_478	90
339	3300036647	Ga0316582_0468862	Ga0316582_0468862_104_376	90
340	3300036647	Ga0316582_0539029	Ga0316582_0539029_465_737	90
341	3300036647	Ga0316582_0541249	Ga0316582_0541249_168_440	90
342	3300036647	Ga0316582_1096655	Ga0316582_1096655_161_433	90
343	3300036712	Ga0316584_0007521	Ga0316584_0007521_1694_1966	90
344	3300036712	Ga0316584_0024905	Ga0316584_0024905_3433_3705	90
345	3300036712	Ga0316584_0051325	Ga0316584_0051325_2252_2524	90
346	3300036712	Ga0316584_0147127	Ga0316584_0147127_89_361	90
347	3300036712	Ga0316584_0209042	Ga0316584_0209042_1035_1307	90
348	3300036712	Ga0316584_0300436	Ga0316584_0300436_621_893	90
349	3300036712	Ga0316584_0371889	Ga0316584_0371889_69_341	90
350	3300036712	Ga0316584_0989576	Ga0316584_0989576_165_437	90
351	3300037588	Ga0316581_0001826	Ga0316581_0001826_2218_2490	90
352	3300038725	Ga0400484_30405	Ga0400484_30405_11429_11701	90
353	3300038727	Ga0400491_04613	Ga0400491_04613_629_901	90
354	3300039062	Ga0400483_112336	Ga0400483_112336_546_818	90
355	3300039062	Ga0400483_272346	Ga0400483_272346_174_446	90
356	3300039110	Ga0400487_25190	Ga0400487_25190_2800_3072	90
357	3300039110	Ga0400487_65029	Ga0400487_65029_476_748	90
358	3300039110	Ga0400487_66163	Ga0400487_66163_3861_4133	90
359	3300042531	Ga0450918_062804	Ga0450918_062804_406_678	90
360	3300042876	Ga0451577_1223130	Ga0451577_1223130_285_557	90
361	3300045051	Ga0451576_1544623	Ga0451576_1544623_97_381	90
362	3300049569	Ga0501032_0711301	Ga0501032_0711301_219_491	90
363	3300049573	Ga0501037_0001035	Ga0501037_0001035_11442_11714	90
364	3300049575	Ga0501039_0330346	Ga0501039_0330346_86_358	90
365	3300049578	Ga0501042_0579993	Ga0501042_0579993_330_602	90
366	3300049581	Ga0501047_0428298	Ga0501047_0428298_586_858	90
367	3300049586	Ga0501070_0051615	Ga0501070_0051615_2625_2897	90
368	3300049586	Ga0501070_0174990	Ga0501070_0174990_663_935	90
369	3300049587	Ga0501071_0392491	Ga0501071_0392491_703_975	90
370	3300049588	Ga0501072_0076994	Ga0501072_0076994_341_613	90
371	3300049590	Ga0501074_0000179	Ga0501074_0000179_14923_15195	90
372	3300049590	Ga0501074_0420149	Ga0501074_0420149_558_830	90
373	3300049742	Ga0501080_0001184	Ga0501080_0001184_4009_4281	90
374	3300003693	Ga0032354_1069816	Ga0032354_10698161	91
375	3300004785	Ga0058858_1426995	Ga0058858_14269952	91
376	3300004798	Ga0058859_11834326	Ga0058859_118343263	91
377	3300004801	Ga0058860_11973223	Ga0058860_119732232	91
378	3300005288	Ga0065714_10441502	Ga0065714_104415021	91
379	3300005327	Ga0070658_10062030	Ga0070658_100620301	91
380	3300005330	Ga0070690_100225567	Ga0070690_1002255673	91
381	3300005330	Ga0070690_100881951	Ga0070690_1008819512	91
382	3300005334	Ga0068869_100387136	Ga0068869_1003871362	91
383	3300005334	Ga0068869_102089727	Ga0068869_1020897272	91
384	3300005335	Ga0070666_10004036	Ga0070666_100040365	91
385	3300005335	Ga0070666_10215539	Ga0070666_102155393	91
386	3300005335	Ga0070666_10219784	Ga0070666_102197843	91
387	3300005336	Ga0070680_100482078	Ga0070680_1004820781	91
388	3300005341	Ga0070691_10283935	Ga0070691_102839352	91
389	3300005343	Ga0070687_100351133	Ga0070687_1003511332	91
390	3300005343	Ga0070687_101258041	Ga0070687_1012580412	91
391	3300005347	Ga0070668_100803518	Ga0070668_1008035182	91
392	3300005353	Ga0070669_100000040	Ga0070669_1000000406	91
393	3300005364	Ga0070673_100490636	Ga0070673_1004906362	91
394	3300005365	Ga0070688_101051846	Ga0070688_1010518462	91
395	3300005366	Ga0070659_100320272	Ga0070659_1003202723	91
396	3300005434	Ga0070709_10000076	Ga0070709_1000007630	91
397	3300005436	Ga0070713_101971198	Ga0070713_1019711981	91
398	3300005466	Ga0070685_10013827	Ga0070685_100138273	91
399	3300005466	Ga0070685_10850593	Ga0070685_108505932	91
400	3300005518	Ga0070699_102130682	Ga0070699_1021306822	91
401	3300005536	Ga0070697_100976132	Ga0070697_1009761322	91
402	3300005548	Ga0070665_100001128	Ga0070665_1000011287	91
403	3300005614	Ga0068856_101349675	Ga0068856_1013496752	91
404	3300005615	Ga0070702_100876521	Ga0070702_1008765211	91
405	3300005616	Ga0068852_100098418	Ga0068852_1000984183	91
406	3300005617	Ga0068859_101633064	Ga0068859_1016330642	91
407	3300005617	Ga0068859_102087475	Ga0068859_1020874752	91
408	3300005719	Ga0068861_100380132	Ga0068861_1003801322	91
409	3300005719	Ga0068861_101259589	Ga0068861_1012595891	91
410	3300005719	Ga0068861_102133709	Ga0068861_1021337092	91
411	3300005842	Ga0068858_101240197	Ga0068858_1012401972	91
412	3300005843	Ga0068860_100022771	Ga0068860_1000227718	91
413	3300005844	Ga0068862_101903311	Ga0068862_1019033111	91
414	3300006173	Ga0070716_100035497	Ga0070716_1000354974	91
415	3300006173	Ga0070716_100543900	Ga0070716_1005439002	91
416	3300006847	Ga0075431_100063671	Ga0075431_1000636715	91
417	3300006852	Ga0075433_10222451	Ga0075433_102224512	91
418	3300006871	Ga0075434_100059026	Ga0075434_1000590268	91
419	3300006871	Ga0075434_100317535	Ga0075434_1003175353	91
420	3300006871	Ga0075434_101047527	Ga0075434_1010475272	91
421	3300006880	Ga0075429_100436803	Ga0075429_1004368032	91
422	3300006914	Ga0075436_100003766	Ga0075436_1000037662	91
423	3300006931	Ga0097620_101633577	Ga0097620_1016335772	91
424	3300006931	Ga0097620_102087112	Ga0097620_1020871122	91
425	3300007076	Ga0075435_100101448	Ga0075435_1001014482	91
426	3300009147	Ga0114129_11439915	Ga0114129_114399152	91
427	3300009147	Ga0114129_12142072	Ga0114129_121420722	91
428	3300009553	Ga0105249_10250785	Ga0105249_102507852	91
429	3300009553	Ga0105249_11217757	Ga0105249_112177572	91
430	3300013308	Ga0157375_10316770	Ga0157375_103167701	91
431	3300014326	Ga0157380_11549947	Ga0157380_115499472	91
432	3300014326	Ga0157380_11978565	Ga0157380_119785652	91
433	3300017792	Ga0163161_10805469	Ga0163161_108054692	91
434	3300023309	Ga0256744_150807	Ga0256744_1508072	91
435	3300025304	Ga0209257_1134274	Ga0209257_11342742	91
436	3300025903	Ga0207680_10032342	Ga0207680_100323422	91
437	3300025903	Ga0207680_10232353	Ga0207680_102323532	91
438	3300025903	Ga0207680_11236207	Ga0207680_112362071	91
439	3300025906	Ga0207699_10000182	Ga0207699_100001825	91
440	3300025907	Ga0207645_10042905	Ga0207645_100429057	91
441	3300025909	Ga0207705_10049846	Ga0207705_100498463	91
442	3300025917	Ga0207660_11003814	Ga0207660_110038142	91
443	3300025918	Ga0207662_10073007	Ga0207662_100730072	91
444	3300025918	Ga0207662_10113337	Ga0207662_101133372	91
445	3300025923	Ga0207681_10000015	Ga0207681_10000015294	91
446	3300025927	Ga0207687_10180424	Ga0207687_101804242	91
447	3300025929	Ga0207664_10021065	Ga0207664_100210657	91
448	3300025932	Ga0207690_10131079	Ga0207690_101310792	91
449	3300025936	Ga0207670_10060508	Ga0207670_100605084	91
450	3300025939	Ga0207665_10030899	Ga0207665_100308992	91
451	3300025939	Ga0207665_10143471	Ga0207665_101434712	91
452	3300025942	Ga0207689_10315576	Ga0207689_103155763	91
453	3300025945	Ga0207679_11423559	Ga0207679_114235592	91
454	3300025961	Ga0207712_10247927	Ga0207712_102479273	91
455	3300025961	Ga0207712_10808850	Ga0207712_108088502	91
456	3300025972	Ga0207668_10401217	Ga0207668_104012172	91
457	3300026023	Ga0207677_11883586	Ga0207677_118835862	91
458	3300026118	Ga0207675_100554332	Ga0207675_1005543322	91
459	3300026142	Ga0207698_10137171	Ga0207698_101371713	91
460	3300028379	Ga0268266_10000745	Ga0268266_100007457	91
461	3300028380	Ga0268265_10019115	Ga0268265_100191157	91
462	3300028381	Ga0268264_10089020	Ga0268264_100890204	91
463	3300028558	Ga0265326_10024519	Ga0265326_100245193	91
464	3300028573	Ga0265334_10000005	Ga0265334_10000005213	91
465	3300028573	Ga0265334_10010603	Ga0265334_100106039	91
466	3300028577	Ga0265318_10271401	Ga0265318_102714012	91
467	3300028800	Ga0265338_10006324	Ga0265338_1000632422	91
468	3300029276	Ga0311004_142155	Ga0311004_1421552	91
469	3300031241	Ga0265325_10066725	Ga0265325_100667252	91
470	3300031249	Ga0265339_10337823	Ga0265339_103378232	91
471	3300031548	Ga0307408_102071869	Ga0307408_1020718692	91
472	3300031595	Ga0265313_10000014	Ga0265313_10000014147	91
473	3300031595	Ga0265313_10004626	Ga0265313_1000462617	91
474	3300031665	Ga0316575_10001471	Ga0316575_100014711	91
475	3300031691	Ga0316579_10130860	Ga0316579_101308602	91
476	3300031691	Ga0316579_10226842	Ga0316579_102268423	91
477	3300031727	Ga0316576_10077457	Ga0316576_100774572	91
478	3300031727	Ga0316576_10118623	Ga0316576_101186232	91
479	3300031727	Ga0316576_10232629	Ga0316576_102326292	91
480	3300031727	Ga0316576_10721896	Ga0316576_107218961	91
481	3300031728	Ga0316578_10016497	Ga0316578_100164973	91
482	3300031728	Ga0316578_10086682	Ga0316578_100866823	91
483	3300031728	Ga0316578_10517901	Ga0316578_105179011	91
484	3300031731	Ga0307405_11418830	Ga0307405_114188302	91
485	3300031733	Ga0316577_10009015	Ga0316577_100090157	91
486	3300031733	Ga0316577_10034525	Ga0316577_100345254	91
487	3300031733	Ga0316577_10139717	Ga0316577_101397172	91
488	3300031733	Ga0316577_10163890	Ga0316577_101638902	91
489	3300031733	Ga0316577_10194982	Ga0316577_101949823	91
490	3300031733	Ga0316577_10372212	Ga0316577_103722123	91
491	3300031733	Ga0316577_10402591	Ga0316577_104025913	91
492	3300031733	Ga0316577_10817246	Ga0316577_108172462	91
493	3300032139	Ga0316580_10005312	Ga0316580_100053124	91
494	3300032168	Ga0316593_10000149	Ga0316593_100001497	91
495	3300032168	Ga0316593_10000198	Ga0316593_1000019816	91
496	3300032168	Ga0316593_10005892	Ga0316593_100058926	91
497	3300032168	Ga0316593_10006885	Ga0316593_100068851	91
498	3300032168	Ga0316593_10012318	Ga0316593_100123186	91
499	3300032168	Ga0316593_10015702	Ga0316593_100157023	91
500	3300032168	Ga0316593_10019872	Ga0316593_100198722	91
501	3300032168	Ga0316593_10095067	Ga0316593_100950671	91
502	3300033524	Ga0316592_1001949	Ga0316592_10019497	91
503	3300033524	Ga0316592_1025209	Ga0316592_10252092	91
504	3300033524	Ga0316592_1035835	Ga0316592_10358353	91
505	3300033527	Ga0316586_1094397	Ga0316586_10943971	91
506	3300033528	Ga0316588_1020839	Ga0316588_10208393	91
507	3300033528	Ga0316588_1040188	Ga0316588_10401883	91
508	3300033529	Ga0316587_1005477	Ga0316587_10054771	91
509	3300033529	Ga0316587_1024988	Ga0316587_10249882	91
510	3300033529	Ga0316587_1092151	Ga0316587_10921512	91
511	3300033541	Ga0316596_1000116	Ga0316596_10001167	91
512	3300033541	Ga0316596_1000208	Ga0316596_10002087	91
513	3300033541	Ga0316596_1003895	Ga0316596_10038956	91
514	3300033541	Ga0316596_1006605	Ga0316596_10066053	91
515	3300033541	Ga0316596_1008803	Ga0316596_10088032	91
516	3300033541	Ga0316596_1016754	Ga0316596_10167543	91
517	3300033541	Ga0316596_1021125	Ga0316596_10211253	91
518	3300033541	Ga0316596_1021887	Ga0316596_10218873	91
519	3300033541	Ga0316596_1051816	Ga0316596_10518162	91
520	3300033541	Ga0316596_1052466	Ga0316596_10524662	91
521	3300035085	Ga0373929_0027611	Ga0373929_0027611_94_381	91
522	3300035090	Ga0373949_0296483	Ga0373949_0296483_32_319	91
523	3300035115	Ga0373941_0315318	Ga0373941_0315318_97_384	91
524	3300035398	Ga0316574_0018659	Ga0316574_0018659_2861_3136	91
525	3300035398	Ga0316574_0080084	Ga0316574_0080084_606_893	91
526	3300035398	Ga0316574_0910202	Ga0316574_0910202_95_370	91
527	3300036647	Ga0316582_0449476	Ga0316582_0449476_526_801	91
528	3300036647	Ga0316582_0825520	Ga0316582_0825520_131_409	91
529	3300036647	Ga0316582_0984035	Ga0316582_0984035_184_474	91
530	3300036712	Ga0316584_0026734	Ga0316584_0026734_1910_2188	91
531	3300036712	Ga0316584_0447448	Ga0316584_0447448_556_831	91
532	3300037312	Ga0395899_0003536	Ga0395899_0003536_5327_5602	91
533	3300037466	Ga0395898_0427409	Ga0395898_0427409_914_1189	91
534	3300038725	Ga0400484_37672	Ga0400484_37672_2983_3261	91
535	3300038726	Ga0400490_03371	Ga0400490_03371_3085_3360	91
536	3300038726	Ga0400490_07415	Ga0400490_07415_909_1187	91
537	3300038726	Ga0400490_18978	Ga0400490_18978_18075_18353	91
538	3300038726	Ga0400490_34548	Ga0400490_34548_1588_1866	91
539	3300038727	Ga0400491_13944	Ga0400491_13944_1473_1751	91
540	3300038735	Ga0400485_06724	Ga0400485_06724_6906_7184	91
541	3300038735	Ga0400485_16370	Ga0400485_16370_744_1022	91
542	3300038741	Ga0400488_14030	Ga0400488_14030_183_461	91
543	3300038741	Ga0400488_57235	Ga0400488_57235_2271_2549	91
544	3300038742	Ga0400486_21368	Ga0400486_21368_2750_3028	91
545	3300038742	Ga0400486_32047	Ga0400486_32047_15007_15285	91
546	3300039062	Ga0400483_079217	Ga0400483_079217_21071_21346	91
547	3300039062	Ga0400483_092352	Ga0400483_092352_83768_84043	91
548	3300039062	Ga0400483_109431	Ga0400483_109431_1409_1684	91
549	3300039062	Ga0400483_120099	Ga0400483_120099_30590_30868	91
550	3300039062	Ga0400483_166753	Ga0400483_166753_5890_6165	91
551	3300039062	Ga0400483_198250	Ga0400483_198250_815_1093	91
552	3300039062	Ga0400483_222800	Ga0400483_222800_160769_161044	91
553	3300039062	Ga0400483_228134	Ga0400483_228134_2989_3267	91
554	3300039093	Ga0400489_23715	Ga0400489_23715_2161_2439	91
555	3300039093	Ga0400489_66216	Ga0400489_66216_15978_16256	91
556	3300039093	Ga0400489_85539	Ga0400489_85539_3971_4261	91
557	3300039110	Ga0400487_33846	Ga0400487_33846_2612_2890	91
558	3300039110	Ga0400487_50276	Ga0400487_50276_3044_3322	91
559	3300041404	Ga0439436_0014231	Ga0439436_0014231_311_586	91
560	3300041405	Ga0439438_002298	Ga0439438_002298_7810_8085	91
561	3300041407	Ga0439447_024590	Ga0439447_024590_98_373	91
562	3300041408	Ga0439453_0120200	Ga0439453_0120200_187_462	91
563	3300041411	Ga0439466_0063394	Ga0439466_0063394_811_1086	91
564	3300041443	Ga0451789_1258268	Ga0451789_1258268_197_484	91
565	3300041444	Ga0451790_34400	Ga0451790_34400_155_442	91
566	3300041460	Ga0451802_1655263	Ga0451802_1655263_82_369	91
567	3300041461	Ga0451805_041168	Ga0451805_041168_57_344	91
568	3300041486	Ga0451807_1110780	Ga0451807_1110780_91_378	91
569	3300041501	Ga0451845_0255181	Ga0451845_0255181_126_413	91
570	3300041505	Ga0451849_0689430	Ga0451849_0689430_44_331	91
571	3300041509	Ga0451843_1539340	Ga0451843_1539340_871_1158	91
572	3300041512	Ga0451853_1390713	Ga0451853_1390713_48_335	91
573	3300041997	Ga0439431_0235453	Ga0439431_0235453_141_416	91
574	3300042000	Ga0439437_000645	Ga0439437_000645_133_408	91
575	3300042006	Ga0439432_090260	Ga0439432_090260_544_819	91
576	3300042010	Ga0439452_001845	Ga0439452_001845_612_887	91
577	3300042115	Ga0450911_002488	Ga0450911_002488_142_417	91
578	3300042121	Ga0450919_025930	Ga0450919_025930_142_417	91
579	3300042139	Ga0450904_001663	Ga0450904_001663_2551_2826	91
580	3300042156	Ga0439446_0083813	Ga0439446_0083813_142_417	91
581	3300042435	Ga0439434_0090582	Ga0439434_0090582_227_502	91
582	3300042438	Ga0439459_0001548	Ga0439459_0001548_3096_3371	91
583	3300042876	Ga0451577_0000139	Ga0451577_0000139_145953_146240	91
584	3300042876	Ga0451577_0097387	Ga0451577_0097387_1516_1797	91
585	3300042876	Ga0451577_0990910	Ga0451577_0990910_173_451	91
586	3300044673	Ga0453683_0000392	Ga0453683_0000392_46606_46893	91
587	3300044712	Ga0453684_0009530	Ga0453684_0009530_5011_5292	91
588	3300044712	Ga0453684_0051165	Ga0453684_0051165_3252_3539	91
589	3300044712	Ga0453684_0126829	Ga0453684_0126829_2478_2765	91
590	3300044712	Ga0453684_0196274	Ga0453684_0196274_1624_1902	91
591	3300044712	Ga0453684_0211699	Ga0453684_0211699_787_1074	91
592	3300044842	Ga0466957_1180952	Ga0466957_1180952_175_462	91
593	3300045051	Ga0451576_0002988	Ga0451576_0002988_7956_8243	91
594	3300046511	Ga0495608_0614347	Ga0495608_0614347_31_318	91
595	3300048908	Ga0496105_0122629	Ga0496105_0122629_1632_1919	91
596	3300048912	Ga0496109_0520803	Ga0496109_0520803_612_899	91
597	3300048912	Ga0496109_1587018	Ga0496109_1587018_278_565	91
598	3300048914	Ga0496111_0228780	Ga0496111_0228780_658_945	91
599	3300048916	Ga0496113_0142152	Ga0496113_0142152_1363_1683	91
600	3300049162	Ga0501307_094277	Ga0501307_094277_108_383	91
601	3300049571	Ga0501034_1201048	Ga0501034_1201048_157_432	91
602	3300049576	Ga0501040_0021344	Ga0501040_0021344_2411_2686	91
603	3300049580	Ga0501046_0897924	Ga0501046_0897924_136_423	91
604	3300049585	Ga0501069_0094739	Ga0501069_0094739_819_1094	91
605	3300049586	Ga0501070_0022172	Ga0501070_0022172_2649_2924	91
606	3300049590	Ga0501074_0255333	Ga0501074_0255333_17_304	91
607	3300049591	Ga0501075_1492684	Ga0501075_1492684_69_359	91
608	3300049593	Ga0501077_0488718	Ga0501077_0488718_205_495	91
609	3300049741	Ga0501079_0580104	Ga0501079_0580104_166_456	91
610	3300049744	Ga0501083_0002042	Ga0501083_0002042_3772_4059	91
611	3300049853	Ga0501226_001020	Ga0501226_001020_3098_3373	91
612	3300050508	nmdc:mga09592_74996_c1	nmdc:mga09592_74996_c1_417_710	91
613	3300050509	nmdc:mga0qj67_461522_c1	nmdc:mga0qj67_461522_c1_503_820	91
614	3300050510	nmdc:mga06r32_141709_c1	nmdc:mga06r32_141709_c1_1417_1707	91
615	3300050510	nmdc:mga06r32_54274_c1	nmdc:mga06r32_54274_c1_1750_2043	91
616	3300050512	nmdc:mga0n895_118290_c1	nmdc:mga0n895_118290_c1_824_1111	91
617	3300050512	nmdc:mga0n895_21250_c1	nmdc:mga0n895_21250_c1_3442_3729	91
618	3300050512	nmdc:mga0n895_483483_c1	nmdc:mga0n895_483483_c1_297_623	91
619	3300050512	nmdc:mga0n895_741720_c1	nmdc:mga0n895_741720_c1_386_673	91
620	3300050513	nmdc:mga0rr50_132074_c1	nmdc:mga0rr50_132074_c1_1523_1843	91
621	3300050513	nmdc:mga0rr50_629966_c1	nmdc:mga0rr50_629966_c1_31_318	91
622	3300053178	Ga0500637_0382953	Ga0500637_0382953_232_519	91
623	3300054114	Ga0501084_0883135	Ga0501084_0883135_84_380	91
624	3300059639	Ga0587062_074351	Ga0587062_074351_258_539	91
625	3300060346	Ga0587111_0042066	Ga0587111_0042066_132_413	91
626	3300060346	Ga0587111_0042631	Ga0587111_0042631_619_906	91
627	3300061734	Ga0530510_0810729	Ga0530510_0810729_68_355	91
628	2010549000	RicEn_FSXC76377_b1	RicEn_557660	92
629	3300001904	JGI24736J21556_1013279	JGI24736J21556_10132793	92
630	3300002067	JGI24735J21928_10080595	JGI24735J21928_100805952	92
631	3300002077	JGI24744J21845_10002487	JGI24744J21845_100024875	92
632	3300002737	JGI25162J39368_1004425	JGI25162J39368_10044251	92
633	3300002771	JGI25163J39215_1000088	JGI25163J39215_100008823	92
634	3300002772	JGI25164J39214_1000264	JGI25164J39214_100026436	92
635	3300002773	JGI25152J39213_1001191	JGI25152J39213_100119110	92
636	3300003320	rootH2_10073821	rootH2_1007382110	92
637	3300003578	Ga0006562J51391_1011677	Ga0006562J51391_10116776	92
638	3300003751	Ga0055538_1000183	Ga0055538_100018323	92
639	3300003752	Ga0055539_1000232	Ga0055539_100023236	92
640	3300003756	Ga0055533_1000224	Ga0055533_100022436	92
641	3300003759	Ga0055525_1000316	Ga0055525_100031636	92
642	3300003841	Ga0055541_1000139	Ga0055541_100013923	92
643	3300003856	Ga0058692_1029092	Ga0058692_10290922	92
644	3300004785	Ga0058858_1206800	Ga0058858_12068003	92
645	3300004799	Ga0058863_11606235	Ga0058863_116062352	92
646	3300004801	Ga0058860_10132144	Ga0058860_101321441	92
647	3300004801	Ga0058860_10214236	Ga0058860_102142362	92
648	3300005272	Ga0065703_1021099	Ga0065703_10210992	92
649	3300005289	Ga0065704_10000076	Ga0065704_1000007636	92
650	3300005289	Ga0065704_10159976	Ga0065704_101599762	92
651	3300005327	Ga0070658_10140178	Ga0070658_101401782	92
652	3300005329	Ga0070683_100005998	Ga0070683_10000599821	92
653	3300005331	Ga0070670_100447774	Ga0070670_1004477741	92
654	3300005331	Ga0070670_100633350	Ga0070670_1006333502	92
655	3300005334	Ga0068869_100216046	Ga0068869_1002160463	92
656	3300005334	Ga0068869_101721040	Ga0068869_1017210402	92
657	3300005335	Ga0070666_10028752	Ga0070666_100287525	92
658	3300005335	Ga0070666_10054968	Ga0070666_100549686	92
659	3300005336	Ga0070680_100523779	Ga0070680_1005237792	92
660	3300005337	Ga0070682_100424956	Ga0070682_1004249562	92
661	3300005338	Ga0068868_100221046	Ga0068868_1002210462	92
662	3300005338	Ga0068868_101034666	Ga0068868_1010346661	92
663	3300005339	Ga0070660_100071219	Ga0070660_1000712192	92
664	3300005339	Ga0070660_100679592	Ga0070660_1006795922	92
665	3300005340	Ga0070689_102008535	Ga0070689_1020085351	92
666	3300005344	Ga0070661_100248315	Ga0070661_1002483151	92
667	3300005344	Ga0070661_100790911	Ga0070661_1007909112	92
668	3300005347	Ga0070668_100015678	Ga0070668_1000156782	92
669	3300005347	Ga0070668_100019041	Ga0070668_1000190417	92
670	3300005353	Ga0070669_100006246	Ga0070669_1000062468	92
671	3300005353	Ga0070669_100102406	Ga0070669_1001024062	92
672	3300005355	Ga0070671_100253289	Ga0070671_1002532892	92
673	3300005356	Ga0070674_101545792	Ga0070674_1015457921	92
674	3300005364	Ga0070673_100013502	Ga0070673_1000135025	92
675	3300005366	Ga0070659_100060890	Ga0070659_1000608902	92
676	3300005367	Ga0070667_100025865	Ga0070667_1000258658	92
677	3300005367	Ga0070667_100602362	Ga0070667_1006023623	92
678	3300005367	Ga0070667_100839977	Ga0070667_1008399773	92
679	3300005367	Ga0070667_101599125	Ga0070667_1015991251	92
680	3300005436	Ga0070713_100651040	Ga0070713_1006510403	92
681	3300005455	Ga0070663_100205709	Ga0070663_1002057093	92
682	3300005456	Ga0070678_100007039	Ga0070678_1000070396	92
683	3300005457	Ga0070662_100001640	Ga0070662_1000016406	92
684	3300005457	Ga0070662_100328011	Ga0070662_1003280113	92
685	3300005458	Ga0070681_10092928	Ga0070681_100929286	92
686	3300005459	Ga0068867_100408840	Ga0068867_1004088402	92
687	3300005467	Ga0070706_100017475	Ga0070706_1000174759	92
688	3300005468	Ga0070707_100416571	Ga0070707_1004165712	92
689	3300005530	Ga0070679_100257090	Ga0070679_1002570902	92
690	3300005535	Ga0070684_100609347	Ga0070684_1006093473	92
691	3300005544	Ga0070686_101274972	Ga0070686_1012749722	92
692	3300005548	Ga0070665_100003465	Ga0070665_10000346521	92
693	3300005564	Ga0070664_100043262	Ga0070664_1000432624	92
694	3300005564	Ga0070664_100111227	Ga0070664_1001112274	92
695	3300005577	Ga0068857_100000609	Ga0068857_10000060910	92
696	3300005577	Ga0068857_100003667	Ga0068857_1000036677	92
697	3300005578	Ga0068854_100469468	Ga0068854_1004694682	92
698	3300005616	Ga0068852_100101942	Ga0068852_1001019425	92
699	3300005617	Ga0068859_102559614	Ga0068859_1025596141	92
700	3300005618	Ga0068864_101034226	Ga0068864_1010342262	92
701	3300005719	Ga0068861_100695485	Ga0068861_1006954853	92
702	3300005834	Ga0068851_10003477	Ga0068851_100034775	92
703	3300005834	Ga0068851_10044122	Ga0068851_100441223	92
704	3300005840	Ga0068870_10001674	Ga0068870_100016745	92
705	3300005841	Ga0068863_101044764	Ga0068863_1010447641	92
706	3300005842	Ga0068858_100141511	Ga0068858_1001415112	92
707	3300005843	Ga0068860_100270761	Ga0068860_1002707612	92
708	3300005937	Ga0081455_10004632	Ga0081455_1000463210	92
709	3300006051	Ga0075364_10465924	Ga0075364_104659242	92
710	3300006051	Ga0075364_10616445	Ga0075364_106164452	92
711	3300006058	Ga0075432_10032545	Ga0075432_100325452	92
712	3300006195	Ga0075366_10002820	Ga0075366_1000282010	92
713	3300006237	Ga0097621_101072095	Ga0097621_1010720952	92
714	3300006237	Ga0097621_101713061	Ga0097621_1017130612	92
715	3300006353	Ga0075370_10773223	Ga0075370_107732232	92
716	3300006358	Ga0068871_100669707	Ga0068871_1006697072	92
717	3300006844	Ga0075428_102707480	Ga0075428_1027074802	92
718	3300006880	Ga0075429_101144313	Ga0075429_1011443132	92
719	3300006881	Ga0068865_100087792	Ga0068865_1000877923	92
720	3300006931	Ga0097620_102559638	Ga0097620_1025596382	92
721	3300006946	Ga0079104_1073696	Ga0079104_10736962	92
722	3300009011	Ga0105251_10649032	Ga0105251_106490321	92
723	3300009093	Ga0105240_10014453	Ga0105240_1001445317	92
724	3300009093	Ga0105240_10403727	Ga0105240_104037272	92
725	3300009094	Ga0111539_11243213	Ga0111539_112432132	92
726	3300009098	Ga0105245_11154486	Ga0105245_111544862	92
727	3300009098	Ga0105245_11233908	Ga0105245_112339081	92
728	3300009101	Ga0105247_10014018	Ga0105247_100140189	92
729	3300009148	Ga0105243_11174093	Ga0105243_111740932	92
730	3300009148	Ga0105243_12487366	Ga0105243_124873662	92
731	3300009174	Ga0105241_10000672	Ga0105241_100006729	92
732	3300009174	Ga0105241_10062629	Ga0105241_100626294	92
733	3300009174	Ga0105241_10254534	Ga0105241_102545342	92
734	3300009176	Ga0105242_10312432	Ga0105242_103124323	92
735	3300009176	Ga0105242_10716442	Ga0105242_107164421	92
736	3300009176	Ga0105242_11609325	Ga0105242_116093252	92
737	3300009177	Ga0105248_11996545	Ga0105248_119965451	92
738	3300009828	Ga0130087_1072414	Ga0130087_10724143	92
739	3300010375	Ga0105239_10323351	Ga0105239_103233511	92
740	3300010375	Ga0105239_11072159	Ga0105239_110721592	92
741	3300011119	Ga0105246_10057896	Ga0105246_100578965	92
742	3300011119	Ga0105246_10524045	Ga0105246_105240451	92
743	3300011119	Ga0105246_11224795	Ga0105246_112247951	92
744	3300011119	Ga0105246_11341327	Ga0105246_113413272	92
745	3300013100	Ga0157373_10186286	Ga0157373_101862862	92
746	3300013100	Ga0157373_10818815	Ga0157373_108188151	92
747	3300013102	Ga0157371_11001630	Ga0157371_110016302	92
748	3300013102	Ga0157371_11637357	Ga0157371_116373571	92
749	3300013104	Ga0157370_10119403	Ga0157370_101194034	92
750	3300013104	Ga0157370_10450014	Ga0157370_104500142	92
751	3300013104	Ga0157370_10892104	Ga0157370_108921042	92
752	3300013105	Ga0157369_10039077	Ga0157369_100390772	92
753	3300013105	Ga0157369_10576701	Ga0157369_105767012	92
754	3300013105	Ga0157369_10676373	Ga0157369_106763732	92
755	3300013297	Ga0157378_10089660	Ga0157378_100896603	92
756	3300013297	Ga0157378_10273033	Ga0157378_102730332	92
757	3300013306	Ga0163162_10375501	Ga0163162_103755011	92
758	3300013306	Ga0163162_11795954	Ga0163162_117959542	92
759	3300013307	Ga0157372_10411826	Ga0157372_104118262	92
760	3300013307	Ga0157372_10884304	Ga0157372_108843042	92
761	3300013307	Ga0157372_11975931	Ga0157372_119759311	92
762	3300013308	Ga0157375_10199187	Ga0157375_101991873	92
763	3300014325	Ga0163163_10060747	Ga0163163_100607478	92
764	3300014497	Ga0182008_10200526	Ga0182008_102005262	92
765	3300014745	Ga0157377_10194120	Ga0157377_101941202	92
766	3300014969	Ga0157376_10256859	Ga0157376_102568594	92
767	3300014969	Ga0157376_11230547	Ga0157376_112305472	92
768	3300015261	Ga0182006_1175458	Ga0182006_11754581	92
769	3300015261	Ga0182006_1200771	Ga0182006_12007711	92
770	3300015262	Ga0182007_10003639	Ga0182007_100036394	92
771	3300015679	Ga0183366_1011	Ga0183366_101110	92
772	3300015680	Ga0183370_1011	Ga0183370_101110	92
773	3300015685	Ga0183369_1026	Ga0183369_102610	92
774	3300015687	Ga0183368_1014	Ga0183368_101410	92
775	3300017792	Ga0163161_10190458	Ga0163161_101904582	92
776	3300020070	Ga0206356_10926534	Ga0206356_109265341	92
777	3300020070	Ga0206356_11200246	Ga0206356_112002463	92
778	3300020077	Ga0206351_10280140	Ga0206351_102801406	92
779	3300020078	Ga0206352_10023630	Ga0206352_100236306	92
780	3300020081	Ga0206354_10257381	Ga0206354_102573814	92
781	3300020082	Ga0206353_11644736	Ga0206353_116447362	92
782	3300020610	Ga0154015_1090949	Ga0154015_10909491	92
783	3300021384	Ga0213876_10000608	Ga0213876_1000060810	92
784	3300022467	Ga0224712_10012065	Ga0224712_100120652	92
785	3300023304	Ga0256714_102603	Ga0256714_1026032	92
786	3300023309	Ga0256744_102491	Ga0256744_1024912	92
787	3300023438	Ga0256720_111476	Ga0256720_1114762	92
788	3300025207	Ga0209760_100166	Ga0209760_10016622	92
789	3300025224	Ga0209784_100218	Ga0209784_10021822	92
790	3300025225	Ga0209566_100353	Ga0209566_10035322	92
791	3300025226	Ga0209674_100273	Ga0209674_10027322	92
792	3300025230	Ga0209563_100182	Ga0209563_10018222	92
793	3300025231	Ga0207427_100270	Ga0207427_10027022	92
794	3300025245	Ga0207425_1015406	Ga0207425_10154062	92
795	3300025253	Ga0209677_100234	Ga0209677_10023422	92
796	3300025258	Ga0209129_1000540	Ga0209129_100054038	92
797	3300025261	Ga0209233_1000968	Ga0209233_10009684	92
798	3300025315	Ga0207697_10287731	Ga0207697_102877312	92
799	3300025321	Ga0207656_10005114	Ga0207656_1000511411	92
800	3300025321	Ga0207656_10070808	Ga0207656_100708082	92
801	3300025711	Ga0207696_1000334	Ga0207696_100033439	92
802	3300025711	Ga0207696_1001023	Ga0207696_100102327	92
803	3300025711	Ga0207696_1002288	Ga0207696_100228814	92
804	3300025711	Ga0207696_1010712	Ga0207696_10107129	92
805	3300025711	Ga0207696_1011698	Ga0207696_10116984	92
806	3300025711	Ga0207696_1023655	Ga0207696_10236554	92
807	3300025728	Ga0207655_1001098	Ga0207655_100109810	92
808	3300025728	Ga0207655_1001305	Ga0207655_100130539	92
809	3300025728	Ga0207655_1043092	Ga0207655_10430923	92
810	3300025735	Ga0207713_1002459	Ga0207713_10024595	92
811	3300025735	Ga0207713_1013654	Ga0207713_10136547	92
812	3300025900	Ga0207710_10000468	Ga0207710_1000046837	92
813	3300025903	Ga0207680_10008302	Ga0207680_100083023	92
814	3300025903	Ga0207680_10262560	Ga0207680_102625603	92
815	3300025903	Ga0207680_10295141	Ga0207680_102951413	92
816	3300025904	Ga0207647_10013393	Ga0207647_100133937	92
817	3300025906	Ga0207699_10785429	Ga0207699_107854292	92
818	3300025907	Ga0207645_10090221	Ga0207645_100902214	92
819	3300025907	Ga0207645_11016838	Ga0207645_110168381	92
820	3300025908	Ga0207643_10002762	Ga0207643_100027625	92
821	3300025909	Ga0207705_10241468	Ga0207705_102414682	92
822	3300025909	Ga0207705_10710148	Ga0207705_107101482	92
823	3300025910	Ga0207684_10034726	Ga0207684_100347263	92
824	3300025911	Ga0207654_10000379	Ga0207654_100003799	92
825	3300025911	Ga0207654_10001703	Ga0207654_1000170319	92
826	3300025911	Ga0207654_10376448	Ga0207654_103764482	92
827	3300025912	Ga0207707_10000723	Ga0207707_1000072334	92
828	3300025912	Ga0207707_10342789	Ga0207707_103427892	92
829	3300025912	Ga0207707_10479088	Ga0207707_104790882	92
830	3300025913	Ga0207695_10000818	Ga0207695_1000081843	92
831	3300025913	Ga0207695_10020876	Ga0207695_1002087612	92
832	3300025914	Ga0207671_10047226	Ga0207671_100472265	92
833	3300025914	Ga0207671_10397739	Ga0207671_103977393	92
834	3300025914	Ga0207671_11045168	Ga0207671_110451682	92
835	3300025917	Ga0207660_10250281	Ga0207660_102502812	92
836	3300025917	Ga0207660_10295709	Ga0207660_102957093	92
837	3300025919	Ga0207657_10355646	Ga0207657_103556462	92
838	3300025919	Ga0207657_10419823	Ga0207657_104198232	92
839	3300025920	Ga0207649_10015259	Ga0207649_100152597	92
840	3300025920	Ga0207649_11034764	Ga0207649_110347641	92
841	3300025921	Ga0207652_10033389	Ga0207652_1003338910	92
842	3300025922	Ga0207646_10353321	Ga0207646_103533212	92
843	3300025923	Ga0207681_10095933	Ga0207681_100959332	92
844	3300025923	Ga0207681_10670758	Ga0207681_106707582	92
845	3300025924	Ga0207694_10051440	Ga0207694_100514404	92
846	3300025925	Ga0207650_10235149	Ga0207650_102351492	92
847	3300025926	Ga0207659_10078290	Ga0207659_100782905	92
848	3300025927	Ga0207687_10265398	Ga0207687_102653982	92
849	3300025927	Ga0207687_10473139	Ga0207687_104731392	92
850	3300025927	Ga0207687_10947899	Ga0207687_109478992	92
851	3300025932	Ga0207690_10043028	Ga0207690_100430284	92
852	3300025932	Ga0207690_10044560	Ga0207690_100445606	92
853	3300025933	Ga0207706_10005266	Ga0207706_100052666	92
854	3300025933	Ga0207706_10318489	Ga0207706_103184892	92
855	3300025934	Ga0207686_10251333	Ga0207686_102513332	92
856	3300025934	Ga0207686_11023064	Ga0207686_110230642	92
857	3300025935	Ga0207709_10157311	Ga0207709_101573112	92
858	3300025936	Ga0207670_10110850	Ga0207670_101108504	92
859	3300025937	Ga0207669_11347670	Ga0207669_113476702	92
860	3300025938	Ga0207704_10026972	Ga0207704_100269724	92
861	3300025938	Ga0207704_10161378	Ga0207704_101613783	92
862	3300025939	Ga0207665_10881789	Ga0207665_108817892	92
863	3300025942	Ga0207689_10021962	Ga0207689_100219626	92
864	3300025942	Ga0207689_10122305	Ga0207689_101223052	92
865	3300025944	Ga0207661_10067045	Ga0207661_100670456	92
866	3300025945	Ga0207679_10131921	Ga0207679_101319213	92
867	3300025945	Ga0207679_10311001	Ga0207679_103110012	92
868	3300025949	Ga0207667_10258924	Ga0207667_102589243	92
869	3300025960	Ga0207651_10079565	Ga0207651_100795652	92
870	3300025972	Ga0207668_10001695	Ga0207668_100016957	92
871	3300025972	Ga0207668_10008346	Ga0207668_100083462	92
872	3300025981	Ga0207640_10075216	Ga0207640_100752164	92
873	3300025986	Ga0207658_10028034	Ga0207658_100280343	92
874	3300025986	Ga0207658_10550244	Ga0207658_105502442	92
875	3300025986	Ga0207658_11366232	Ga0207658_113662322	92
876	3300025986	Ga0207658_11542678	Ga0207658_115426782	92
877	3300026023	Ga0207677_10093411	Ga0207677_100934113	92
878	3300026023	Ga0207677_10218339	Ga0207677_102183392	92
879	3300026035	Ga0207703_10154862	Ga0207703_101548623	92
880	3300026041	Ga0207639_10066089	Ga0207639_100660897	92
881	3300026067	Ga0207678_10251871	Ga0207678_102518712	92
882	3300026078	Ga0207702_10108230	Ga0207702_101082302	92
883	3300026089	Ga0207648_10396306	Ga0207648_103963063	92
884	3300026095	Ga0207676_10693746	Ga0207676_106937461	92
885	3300026116	Ga0207674_10001554	Ga0207674_100015546	92
886	3300026116	Ga0207674_10001940	Ga0207674_1000194039	92
887	3300026118	Ga0207675_100605291	Ga0207675_1006052912	92
888	3300026121	Ga0207683_10023634	Ga0207683_100236346	92
889	3300026142	Ga0207698_10071585	Ga0207698_100715852	92
890	3300026142	Ga0207698_10106407	Ga0207698_101064072	92
891	3300027111	Ga0209281_1000327	Ga0209281_10003273	92
892	3300027111	Ga0209281_1000874	Ga0209281_100087438	92
893	3300027111	Ga0209281_1007912	Ga0209281_10079125	92
894	3300027312	Ga0209371_1001410	Ga0209371_10014109	92
895	3300027312	Ga0209371_1017289	Ga0209371_10172893	92
896	3300027312	Ga0209371_1050676	Ga0209371_10506763	92
897	3300027907	Ga0207428_10881602	Ga0207428_108816022	92
898	3300028379	Ga0268266_10001891	Ga0268266_1000189139	92
899	3300028379	Ga0268266_10019459	Ga0268266_100194592	92
900	3300028379	Ga0268266_10023861	Ga0268266_100238615	92
901	3300028379	Ga0268266_10043580	Ga0268266_100435805	92
902	3300028381	Ga0268264_10036794	Ga0268264_100367942	92
903	3300029277	Ga0311001_1080693	Ga0311001_10806936	92
904	3300030500	Ga0268256_1000383	Ga0268256_100038322	92
905	3300030500	Ga0268256_1000654	Ga0268256_100065438	92
906	3300030500	Ga0268256_1019274	Ga0268256_10192743	92
907	3300030500	Ga0268256_1066324	Ga0268256_10663241	92
908	3300030733	Ga0314311_1124004	Ga0314311_11240041	92
909	3300030742	Ga0316183_1215055	Ga0316183_12150552	92
910	3300031241	Ga0265325_10121442	Ga0265325_101214423	92
911	3300031691	Ga0316579_10045411	Ga0316579_100454113	92
912	3300031727	Ga0316576_10000051	Ga0316576_1000005137	92
913	3300031727	Ga0316576_10008020	Ga0316576_100080209	92
914	3300031728	Ga0316578_10007960	Ga0316578_100079602	92
915	3300031728	Ga0316578_10274835	Ga0316578_102748353	92
916	3300031730	Ga0307516_10007119	Ga0307516_100071196	92
917	3300031733	Ga0316577_10008903	Ga0316577_100089035	92
918	3300031733	Ga0316577_10171129	Ga0316577_101711292	92
919	3300032168	Ga0316593_10000043	Ga0316593_1000004323	92
920	3300032168	Ga0316593_10000538	Ga0316593_1000053810	92
921	3300032168	Ga0316593_10001768	Ga0316593_100017684	92
922	3300032168	Ga0316593_10016347	Ga0316593_100163473	92
923	3300032168	Ga0316593_10102187	Ga0316593_101021873	92
924	3300032168	Ga0316593_10107573	Ga0316593_101075731	92
925	3300033524	Ga0316592_1006141	Ga0316592_10061414	92
926	3300033524	Ga0316592_1021335	Ga0316592_10213353	92
927	3300033524	Ga0316592_1064745	Ga0316592_10647451	92
928	3300033527	Ga0316586_1003843	Ga0316586_10038433	92
929	3300033528	Ga0316588_1022194	Ga0316588_10221943	92
930	3300033528	Ga0316588_1026017	Ga0316588_10260173	92
931	3300033528	Ga0316588_1133431	Ga0316588_11334312	92
932	3300033528	Ga0316588_1215440	Ga0316588_12154402	92
933	3300033529	Ga0316587_1113419	Ga0316587_11134191	92
934	3300033541	Ga0316596_1000766	Ga0316596_10007666	92
935	3300033541	Ga0316596_1001478	Ga0316596_10014784	92
936	3300033541	Ga0316596_1001917	Ga0316596_10019174	92
937	3300033541	Ga0316596_1012101	Ga0316596_10121015	92
938	3300033541	Ga0316596_1032765	Ga0316596_10327651	92
939	3300033541	Ga0316596_1095623	Ga0316596_10956232	92
940	3300033541	Ga0316596_1099683	Ga0316596_10996832	92
941	3300033541	Ga0316596_1160920	Ga0316596_11609201	92
942	3300033541	Ga0316596_1195084	Ga0316596_11950842	92
943	3300033541	Ga0316596_1202811	Ga0316596_12028111	92
944	3300035170	Ga0373943_0069735	Ga0373943_0069735_392_700	92
945	3300035398	Ga0316574_0080967	Ga0316574_0080967_1650_1931	92
946	3300035398	Ga0316574_0120475	Ga0316574_0120475_1250_1528	92
947	3300035398	Ga0316574_0400096	Ga0316574_0400096_216_494	92
948	3300035692	Ga0373935_0093998	Ga0373935_0093998_644_952	92
949	3300035725	Ga0373947_0052297	Ga0373947_0052297_1096_1404	92
950	3300036647	Ga0316582_0011702	Ga0316582_0011702_3402_3683	92
951	3300036647	Ga0316582_0052038	Ga0316582_0052038_351_632	92
952	3300036712	Ga0316584_0004587	Ga0316584_0004587_4872_5153	92
953	3300036712	Ga0316584_0273989	Ga0316584_0273989_819_1100	92
954	3300036712	Ga0316584_0400825	Ga0316584_0400825_139_426	92
955	3300037068	Ga0373925_1053175	Ga0373925_1053175_365_655	92
956	3300038725	Ga0400484_27667	Ga0400484_27667_3113_3394	92
957	3300038726	Ga0400490_05180	Ga0400490_05180_1316_1597	92
958	3300038735	Ga0400485_08047	Ga0400485_08047_16658_16939	92
959	3300038741	Ga0400488_00038	Ga0400488_00038_520_837	92
960	3300038741	Ga0400488_03335	Ga0400488_03335_1894_2175	92
961	3300038742	Ga0400486_17114	Ga0400486_17114_3065_3382	92
962	3300038742	Ga0400486_17728	Ga0400486_17728_9071_9352	92
963	3300039062	Ga0400483_081993	Ga0400483_081993_7035_7313	92
964	3300039062	Ga0400483_170099	Ga0400483_170099_3536_3814	92
965	3300039093	Ga0400489_59643	Ga0400489_59643_18657_18974	92
966	3300039093	Ga0400489_76217	Ga0400489_76217_132_413	92
967	3300039093	Ga0400489_86209	Ga0400489_86209_6341_6622	92
968	3300039110	Ga0400487_55496	Ga0400487_55496_3065_3382	92
969	3300039437	Ga0436365_0390798	Ga0436365_0390798_21732_22010	92
970	3300041405	Ga0439438_000016	Ga0439438_000016_106473_106751	92
971	3300041405	Ga0439438_000406	Ga0439438_000406_15187_15465	92
972	3300041405	Ga0439438_005137	Ga0439438_005137_4188_4466	92
973	3300041407	Ga0439447_004147	Ga0439447_004147_1382_1660	92
974	3300041407	Ga0439447_005027	Ga0439447_005027_1757_2035	92
975	3300041407	Ga0439447_005606	Ga0439447_005606_1011_1289	92
976	3300041411	Ga0439466_0000011	Ga0439466_0000011_197749_198027	92
977	3300041453	Ga0451797_1446479	Ga0451797_1446479_54_332	92
978	3300041461	Ga0451805_082450	Ga0451805_082450_251_529	92
979	3300041492	Ga0451835_1129155	Ga0451835_1129155_235_513	92
980	3300041494	Ga0451837_0214257	Ga0451837_0214257_136_414	92
981	3300041498	Ga0451841_1411344	Ga0451841_1411344_85_363	92
982	3300041505	Ga0451849_0245757	Ga0451849_0245757_116_394	92
983	3300041510	Ga0451854_01357	Ga0451854_01357_154_432	92
984	3300041512	Ga0451853_1407400	Ga0451853_1407400_67_345	92
985	3300041916	Ga0452271_09894	Ga0452271_09894_390_668	92
986	3300042006	Ga0439432_003421	Ga0439432_003421_3025_3303	92
987	3300042006	Ga0439432_007959	Ga0439432_007959_3193_3471	92
988	3300042006	Ga0439432_041273	Ga0439432_041273_828_1106	92
989	3300042010	Ga0439452_000010	Ga0439452_000010_21021_21299	92
990	3300042010	Ga0439452_000384	Ga0439452_000384_21389_21667	92
991	3300042010	Ga0439452_000388	Ga0439452_000388_20870_21148	92
992	3300042016	Ga0439463_000973	Ga0439463_000973_2418_2696	92
993	3300042136	Ga0450900_002382	Ga0450900_002382_1024_1302	92
994	3300042137	Ga0450902_000565	Ga0450902_000565_4336_4614	92
995	3300042142	Ga0450905_005808	Ga0450905_005808_1365_1643	92
996	3300042146	Ga0450907_000073	Ga0450907_000073_26789_27067	92
997	3300042439	Ga0439464_0002761	Ga0439464_0002761_3592_3870	92
998	3300042439	Ga0439464_0022415	Ga0439464_0022415_1075_1353	92
999	3300044650	Ga0466986_0510418	Ga0466986_0510418_52_330	92
1000	3300044669	Ga0466981_0000041	Ga0466981_0000041_21563_21841	92
1001	3300044735	Ga0466968_0427917	Ga0466968_0427917_335_613	92
1002	3300044765	Ga0466970_0129556	Ga0466970_0129556_1085_1363	92
1003	3300046453	Ga0495627_000696	Ga0495627_000696_21347_21625	92
1004	3300046453	Ga0495627_119300	Ga0495627_119300_134_412	92
1005	3300046458	Ga0495591_000658	Ga0495591_000658_4146_4424	92
1006	3300046458	Ga0495591_001736	Ga0495591_001736_2831_3109	92
1007	3300046460	Ga0495638_0001912	Ga0495638_0001912_3728_4006	92
1008	3300046471	Ga0495650_0000787	Ga0495650_0000787_21315_21593	92
1009	3300046471	Ga0495650_0001108	Ga0495650_0001108_11872_12150	92
1010	3300046471	Ga0495650_0008267	Ga0495650_0008267_1147_1425	92
1011	3300046474	Ga0495605_0003552	Ga0495605_0003552_6211_6489	92
1012	3300046491	Ga0495584_0002357	Ga0495584_0002357_5568_5846	92
1013	3300046492	Ga0495585_0016401	Ga0495585_0016401_2913_3191	92
1014	3300046500	Ga0495596_0009116	Ga0495596_0009116_1004_1282	92
1015	3300046501	Ga0495607_0005107	Ga0495607_0005107_2628_2906	92
1016	3300046507	Ga0495606_0004907	Ga0495606_0004907_8612_8890	92
1017	3300046513	Ga0495616_0041811	Ga0495616_0041811_1021_1299	92
1018	3300046515	Ga0495620_0027513	Ga0495620_0027513_1908_2186	92
1019	3300046517	Ga0495630_0006403	Ga0495630_0006403_4964_5254	92
1020	3300046518	Ga0495631_0015328	Ga0495631_0015328_1108_1386	92
1021	3300046519	Ga0495632_0056123	Ga0495632_0056123_679_957	92
1022	3300046522	Ga0495643_0014746	Ga0495643_0014746_1012_1290	92
1023	3300046522	Ga0495643_0017256	Ga0495643_0017256_3907_4185	92
1024	3300046522	Ga0495643_0063859	Ga0495643_0063859_434_712	92
1025	3300046523	Ga0495644_0000420	Ga0495644_0000420_4782_5060	92
1026	3300046524	Ga0495648_0013359	Ga0495648_0013359_1022_1300	92
1027	3300046526	Ga0495666_0225901	Ga0495666_0225901_292_582	92
1028	3300046530	Ga0495654_0000178	Ga0495654_0000178_21276_21554	92
1029	3300046530	Ga0495654_0000730	Ga0495654_0000730_21169_21447	92
1030	3300046530	Ga0495654_0015484	Ga0495654_0015484_2690_2968	92
1031	3300046530	Ga0495654_0029546	Ga0495654_0029546_381_659	92
1032	3300046538	Ga0495609_0166211	Ga0495609_0166211_104_382	92
1033	3300046539	Ga0495621_0113025	Ga0495621_0113025_285_581	92
1034	3300046542	Ga0495597_0002054	Ga0495597_0002054_12402_12680	92
1035	3300046616	Ga0495668_0122736	Ga0495668_0122736_966_1244	92
1036	3300046660	Ga0495625_0004220	Ga0495625_0004220_7727_8005	92
1037	3300046674	Ga0495588_0006351	Ga0495588_0006351_3251_3529	92
1038	3300046692	Ga0495671_0000488	Ga0495671_0000488_17431_17709	92
1039	3300046694	Ga0495649_0033297	Ga0495649_0033297_730_1008	92
1040	3300046794	Ga0495589_0000538	Ga0495589_0000538_5037_5315	92
1041	3300046794	Ga0495589_0009440	Ga0495589_0009440_4693_4971	92
1042	3300046810	Ga0495660_0000286	Ga0495660_0000286_21356_21634	92
1043	3300046810	Ga0495660_0000352	Ga0495660_0000352_18824_19102	92
1044	3300046810	Ga0495660_0005861	Ga0495660_0005861_3762_4040	92
1045	3300047320	Ga0495672_0000011	Ga0495672_0000011_9303_9581	92
1046	3300047320	Ga0495672_0000040	Ga0495672_0000040_23128_23406	92
1047	3300047320	Ga0495672_0000057	Ga0495672_0000057_200291_200569	92
1048	3300047323	Ga0495683_0027974	Ga0495683_0027974_1106_1384	92
1049	3300047446	Ga0495679_007993	Ga0495679_007993_3882_4160	92
1050	3300047469	Ga0495673_0000948	Ga0495673_0000948_4647_4925	92
1051	3300047469	Ga0495673_0002408	Ga0495673_0002408_6714_6992	92
1052	3300047470	Ga0495681_0009501	Ga0495681_0009501_2609_2887	92
1053	3300047470	Ga0495681_0098751	Ga0495681_0098751_149_427	92
1054	3300048903	Ga0496100_0006417	Ga0496100_0006417_1213_1491	92
1055	3300048904	Ga0496101_1110914	Ga0496101_1110914_320_598	92
1056	3300048905	Ga0496102_0008032	Ga0496102_0008032_4991_5269	92
1057	3300048906	Ga0496103_0024190	Ga0496103_0024190_503_781	92
1058	3300048906	Ga0496103_0074206	Ga0496103_0074206_1493_1771	92
1059	3300048907	Ga0496104_0002752	Ga0496104_0002752_2544_2822	92
1060	3300048908	Ga0496105_0014958	Ga0496105_0014958_708_986	92
1061	3300048909	Ga0496106_0145412	Ga0496106_0145412_468_746	92
1062	3300048913	Ga0496110_0078363	Ga0496110_0078363_1220_1498	92
1063	3300048914	Ga0496111_0344977	Ga0496111_0344977_591_869	92
1064	3300048915	Ga0496112_0633054	Ga0496112_0633054_551_829	92
1065	3300048919	Ga0496116_0001902	Ga0496116_0001902_17543_17821	92
1066	3300048919	Ga0496116_0004226	Ga0496116_0004226_10658_10936	92
1067	3300048919	Ga0496116_0179081	Ga0496116_0179081_714_992	92
1068	3300048920	Ga0496117_0055475	Ga0496117_0055475_2002_2280	92
1069	3300048920	Ga0496117_0345459	Ga0496117_0345459_345_623	92
1070	3300048921	Ga0496118_0004575	Ga0496118_0004575_8935_9213	92
1071	3300048921	Ga0496118_0061768	Ga0496118_0061768_1138_1416	92
1072	3300048922	Ga0496119_0011070	Ga0496119_0011070_4705_4983	92
1073	3300048922	Ga0496119_0026821	Ga0496119_0026821_1784_2062	92
1074	3300048922	Ga0496119_0027860	Ga0496119_0027860_2858_3136	92
1075	3300048922	Ga0496119_0063774	Ga0496119_0063774_1542_1820	92
1076	3300048923	Ga0496120_0001572	Ga0496120_0001572_18306_18584	92
1077	3300048923	Ga0496120_0003750	Ga0496120_0003750_10313_10591	92
1078	3300048923	Ga0496120_0027570	Ga0496120_0027570_355_633	92
1079	3300048924	Ga0496121_0007671	Ga0496121_0007671_10681_10959	92
1080	3300048925	Ga0496122_0001405	Ga0496122_0001405_21440_21718	92
1081	3300048925	Ga0496122_0038644	Ga0496122_0038644_1759_2037	92
1082	3300048925	Ga0496122_0113885	Ga0496122_0113885_1030_1308	92
1083	3300048926	Ga0496123_0001162	Ga0496123_0001162_21438_21716	92
1084	3300048926	Ga0496123_0097706	Ga0496123_0097706_409_687	92
1085	3300048927	Ga0496124_0001250	Ga0496124_0001250_21354_21632	92
1086	3300048927	Ga0496124_0362008	Ga0496124_0362008_335_613	92
1087	3300048928	Ga0496125_0000100	Ga0496125_0000100_181080_181358	92
1088	3300048928	Ga0496125_0018559	Ga0496125_0018559_2354_2632	92
1089	3300048928	Ga0496125_0049430	Ga0496125_0049430_2244_2522	92
1090	3300048929	Ga0496126_0021055	Ga0496126_0021055_3099_3377	92
1091	3300048929	Ga0496126_0053009	Ga0496126_0053009_1783_2061	92
1092	3300048929	Ga0496126_0090602	Ga0496126_0090602_165_443	92
1093	3300048929	Ga0496126_0113896	Ga0496126_0113896_74_352	92
1094	3300049127	Ga0501306_062566	Ga0501306_062566_72_350	92
1095	3300049459	Ga0495678_000882	Ga0495678_000882_21514_21792	92
1096	3300049459	Ga0495678_019016	Ga0495678_019016_1987_2265	92
1097	3300049460	Ga0495682_0000520	Ga0495682_0000520_21443_21721	92
1098	3300049519	Ga0501296_010368	Ga0501296_010368_188_496	92
1099	3300049550	Ga0501334_14951	Ga0501334_14951_124_402	92
1100	3300049572	Ga0501036_0501729	Ga0501036_0501729_262_555	92
1101	3300049574	Ga0501038_0090413	Ga0501038_0090413_353_640	92
1102	3300049574	Ga0501038_0310526	Ga0501038_0310526_659_952	92
1103	3300049575	Ga0501039_0097397	Ga0501039_0097397_128_421	92
1104	3300049576	Ga0501040_1258574	Ga0501040_1258574_186_479	92
1105	3300049577	Ga0501041_0055179	Ga0501041_0055179_265_558	92
1106	3300049578	Ga0501042_0126198	Ga0501042_0126198_493_786	92
1107	3300049578	Ga0501042_1072061	Ga0501042_1072061_21_395	92
1108	3300049580	Ga0501046_0077348	Ga0501046_0077348_1455_1748	92
1109	3300049581	Ga0501047_0027520	Ga0501047_0027520_3864_4151	92
1110	3300049584	Ga0501068_0814996	Ga0501068_0814996_276_569	92
1111	3300049587	Ga0501071_1262868	Ga0501071_1262868_219_512	92
1112	3300049588	Ga0501072_0104845	Ga0501072_0104845_886_1179	92
1113	3300049591	Ga0501075_0029856	Ga0501075_0029856_1801_2094	92
1114	3300049592	Ga0501076_0033905	Ga0501076_0033905_3635_3928	92
1115	3300049593	Ga0501077_0071743	Ga0501077_0071743_1601_1894	92
1116	3300049741	Ga0501079_0068669	Ga0501079_0068669_1458_1751	92
1117	3300049742	Ga0501080_0133578	Ga0501080_0133578_224_517	92
1118	3300049743	Ga0501081_0058721	Ga0501081_0058721_2350_2643	92
1119	3300049744	Ga0501083_0562928	Ga0501083_0562928_430_723	92
1120	3300049822	Ga0501035_0503824	Ga0501035_0503824_640_927	92
1121	3300049823	Ga0501044_0000086	Ga0501044_0000086_69119_69406	92
1122	3300050491	nmdc:mga00v17_221950_c1	nmdc:mga00v17_221950_c1_539_817	92
1123	3300050491	nmdc:mga00v17_505008_c1	nmdc:mga00v17_505008_c1_409_687	92
1124	3300050493	nmdc:mga0k408_12227_c1	nmdc:mga0k408_12227_c1_2837_3115	92
1125	3300050494	nmdc:mga06z11_423983_c1	nmdc:mga06z11_423983_c1_376_696	92
1126	3300050496	nmdc:mga07m45_817001_c1	nmdc:mga07m45_817001_c1_194_472	92
1127	3300053126	Ga0500621_000035	Ga0500621_000035_4763_5041	92
1128	3300054114	Ga0501084_0005747	Ga0501084_0005747_8914_9207	92
1129	3300059627	Ga0587117_113644	Ga0587117_113644_161_451	92
1130	3300061734	Ga0530510_0185751	Ga0530510_0185751_186_479	92

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00203

Ribosomal_S19

Ribosomal protein S19

3

83

0.98 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
4v48-assembly1.cif.gz_BS	real space refined coordinates of the 30s and 50s subunits fitted into the low resolution cryo-em map of the initiation-like state of e. coli 70s ribosome	0.9553	12	76
6ywy-assembly1.cif.gz_SS	the structure of the mitoribosome from neurospora crassa with bound trna at the p-site	0.9548	27	79
4v48-assembly1.cif.gz_BS	real space refined coordinates of the 30s and 50s subunits fitted into the low resolution cryo-em map of the initiation-like state of e. coli 70s ribosome	0.9414	12	76
4v5z-assembly1.cif.gz_As	structure of a mammalian 80s ribosome obtained by docking homology models of the rna and proteins into an 8.7 a cryo-em map	0.9281	13	79
7qv3-assembly1.cif.gz_s	bacillus subtilis muts2-collided disome complex (muts2 conf.2; leading 70s)	0.9131	4	80

ID	Description	Score	Start	End	Superfamily
4kj2S00	Alpha Beta;2-Layer Sandwich;30s Ribosomal Protein S19; Chain A;Ribosomal protein S19/S15	0.899	3	81	3.30.860.10
4kj2S00	Alpha Beta;2-Layer Sandwich;30s Ribosomal Protein S19; Chain A;Ribosomal protein S19/S15	0.8882	3	81	3.30.860.10
4tpaS00	Alpha Beta;2-Layer Sandwich;30s Ribosomal Protein S19; Chain A;Ribosomal protein S19/S15	0.8847	3	81	3.30.860.10
af_A0A1D8PTL2_10_91_3.30.860.10	Alpha Beta;2-Layer Sandwich;30s Ribosomal Protein S19; Chain A;Ribosomal protein S19/S15	0.8825	3	79	3.30.860.10
2qbbS00	Alpha Beta;2-Layer Sandwich;30s Ribosomal Protein S19; Chain A;Ribosomal protein S19/S15	0.8782	2	81	3.30.860.10

ID	Description	Score	Start	End	GO Terms
AF-A0A650CYW8-F1-model_v4	Small ribosomal subunit protein uS19c	0.9119	1	79	GO:0000028 GO:0003735 GO:0005763 GO:0006412 GO:0009507 GO:0019843
AF-A0A1V5L2N2-F1-model_v4	Small ribosomal subunit protein uS19	0.9007	3	83	GO:0000028 GO:0003735 GO:0005737 GO:0006412 GO:0015935 GO:0019843
AF-A0A7C7KZT8-F1-model_v4	Small ribosomal subunit protein uS19 (30S ribosomal protein S19)	0.9002	1	81	GO:0000028 GO:0003735 GO:0005737 GO:0006412 GO:0015935 GO:0019843
AF-A0A6H1YGR5-F1-model_v4	Small ribosomal subunit protein uS19c	0.8999	1	80	GO:0000028 GO:0003735 GO:0005763 GO:0006412 GO:0009507 GO:0019843
AF-Q36807-F1-model_v4	Small ribosomal subunit protein uS19c	0.8991	1	80	GO:0003735 GO:0006412 GO:0009507 GO:0015935 GO:0019843

Feature Viewer

pLDDT	pTM	Quality
84.57	0.66	Medium

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F490532

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF00203

Ribosomal_S19

Ribosomal protein S19

3

83

0.98

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map