F490295

General Info

Members Datasets Scaffolds Average Seq Length
1115 475 1096 322

Family's Representative Sequence

Representative Sequence 3300037853|Ga0436364_0684151|Ga0436364_0684151_1040_2089
Length 349
Sequence LQLITGSAAIVFLFRADQSSILQSIEQSMKILVTGAAGMIGRKFCDALVKRGKIGSRPVVRLTMADTIKPTAPTGAPFEACTDSADISDPGVAESLVADRPEIIYHLAAVVSGEAEADFDKGYRVNLTGTQRLFEAVRRAGHQPRVVFASSIAVFGTPFPEKIPEDYALTPLTSYGTQKAIGEFLLADFSRRGFFNGIGIRFPTICVRPGKPNKAASGFFSNIIREPLKGKPAVLPVGEEVRHWFASPRAAVEFLFHAGALDLGQIGSGRTLNMPGLSATVREMIVSLRNVAGAECAKLIRREPDPAIQKIVDGWPGRLDASRAEALGFRAETSFEEIVRQHIEDESAG

Samples

Sample ID Description Type Environment
1 2508501050 Microvirga lupini Lut6 Isolate Nodule
2 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
3 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
4 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
5 2643221688 Rhizobium sp. Root482 Isolate Unclassified
6 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
7 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
8 2835312727 Microvirga calopogonii CCBAU 65841 Isolate Nodule
9 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
10 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
11 2904564687 Burkholderia sp. 571 Isolate Unclassified
12 2904571731 Burkholderia cenocepacia 574 Isolate Unclassified
13 2928536128 Burkholderia sola 565 Isolate Unclassified
14 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
15 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
16 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
17 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
18 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
19 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
20 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
21 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
22 3300000045 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere Metagenome Rhizosphere
23 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
24 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
25 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
26 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
27 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
28 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
29 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
30 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
31 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
32 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
33 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
34 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
35 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
36 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
37 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
38 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
39 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
40 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
41 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
42 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
43 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
44 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
45 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
46 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
47 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
48 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
49 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
50 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
51 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
52 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
53 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
54 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
55 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
56 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
57 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
58 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
59 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
60 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
61 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
62 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
63 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
64 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
65 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
66 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
67 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
68 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
69 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
70 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
71 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
72 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
73 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
74 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
75 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
76 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
77 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
78 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
79 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
80 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
81 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
82 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
83 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
84 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
85 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
86 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
87 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
88 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
89 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
90 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
91 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
92 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
93 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
94 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
95 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
96 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
97 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
98 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
99 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
100 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
101 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
102 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
103 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
104 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
105 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
106 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
107 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
108 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
109 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
110 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
111 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
112 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
113 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
114 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
115 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
116 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
117 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
118 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
119 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
120 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
121 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
122 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
123 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
124 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
125 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
126 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
127 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
128 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
129 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
130 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
131 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
132 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
133 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
134 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
135 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
136 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
137 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
138 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
139 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
140 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
141 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
142 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
143 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
144 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
145 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
146 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
147 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
148 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
149 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
150 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
151 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
152 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
153 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
154 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
155 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
156 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
157 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
158 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
159 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
160 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
161 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
162 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
163 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
164 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
165 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
166 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
167 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
168 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
169 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
170 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
171 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
172 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
173 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
174 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
175 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
176 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
177 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
179 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
180 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
181 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
182 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
183 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
184 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
185 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
186 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
239 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
240 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
241 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
244 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
245 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
246 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
247 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
248 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
249 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
250 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
251 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
252 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
253 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
254 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
255 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
256 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
257 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
258 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
259 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
260 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
261 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
262 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
263 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
264 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
265 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
266 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
267 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
268 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
269 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
270 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
271 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
272 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
273 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
274 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
275 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
276 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
277 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
278 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
279 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
280 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
281 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
282 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
283 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
284 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
285 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
286 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
287 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
288 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
289 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
290 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
291 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
292 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
293 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
294 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
295 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
296 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
297 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
298 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
299 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
300 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
301 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
302 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
303 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
304 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
305 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
306 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
307 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
308 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
309 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
310 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
311 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
312 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
313 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
314 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
315 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
316 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
317 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
318 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
319 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
320 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
321 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
322 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
323 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
324 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
325 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
326 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
327 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
328 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
329 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
330 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
331 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
332 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
333 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
334 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
335 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
336 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
337 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
338 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
339 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
340 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
341 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
342 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
343 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
344 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
345 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
346 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
347 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
348 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
349 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
350 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
351 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
352 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
353 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
354 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
355 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
356 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
357 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
358 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
359 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
360 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
361 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
362 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
363 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
364 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
365 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
366 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
367 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
368 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
369 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
370 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
371 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
372 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
373 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
374 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
375 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
376 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
377 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
378 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
379 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
380 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
381 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
382 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
383 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
384 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
385 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
386 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
387 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
388 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
389 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
390 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
391 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
392 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
393 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
394 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
395 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
396 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
397 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
398 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
399 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
400 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
401 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
402 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
403 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
404 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
405 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
406 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
407 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
408 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
409 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
410 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
411 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
412 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
413 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
414 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
415 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
416 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
417 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
418 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
419 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
420 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
421 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
422 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
423 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
424 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
425 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
426 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
427 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
428 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
429 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
430 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
431 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
432 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
433 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
434 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
435 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
436 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
437 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
438 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
439 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
440 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
441 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
442 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
443 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
444 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
445 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
446 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
447 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
448 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
449 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
450 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
451 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
452 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
453 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
454 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
455 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
456 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
457 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
458 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
459 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
460 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
461 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
462 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
463 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
464 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
465 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
466 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
467 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
468 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
469 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
470 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
471 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
472 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
473 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
474 8020938398 Burkholderia sp. BE12 Isolate Rhizosphere
475 8020953355 Burkholderia sp. BE24 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.3
Metatranscriptomes 0
Isolates 1.7

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.57
Nodule 0.81
Rhizoplane 6.64
Rhizosphere 85.11
Stem 0
Stem Tuber 0
Unclassified 2.87

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 ARcpr5oldR_c000046 3300000041 Bacteria 22854
2 ARSoilYngRDRAFT_c00078 3300000042 Bacteria 16119
3 ARcpr5yngRDRAFT_c000072 3300000043 Bacteria 16816
4 ARSoilOldRDRAFT_c000019 3300000044 Bacteria 37577
5 ARCol0oldRDRAFT_c00019 3300000045 Bacteria 12070
6 ARCol0yngRDRAFT_1000004 3300000652 Bacteria 52222
7 JGI24739J22299_10001890 3300001989 Bacteria 8001
8 JGI24737J22298_10000207 3300001990 Bacteria 19137
9 JGI24737J22298_10001119 3300001990 Bacteria 9430
10 JGI24750J21931_1001369 3300002070 Bacteria 3064
11 JGI24745J21846_1001822 3300002073 Bacteria 2110
12 JGI24748J21848_1000218 3300002074 Bacteria 7022
13 JGI24738J21930_10000029 3300002075 Bacteria 26851
14 JGI24749J21850_1001190 3300002076 Bacteria 3694
15 JGI24744J21845_10001741 3300002077 Bacteria 4367
16 JGI24742J22300_10002072 3300002244 Bacteria 3190
17 JGI25406J46586_10000093 3300003203 Bacteria 41100
18 JGI25153J46596_10002951 3300003215 Bacteria 9630
19 JGI25153J46596_10003480 3300003215 Bacteria 8805
20 JGI25153J46596_10013314 3300003215 Bacteria 3483
21 Ga0055526_1000427 3300003771 Bacteria 33902
22 Ga0055524_1001121 3300003775 Bacteria 16157
23 Ga0055530_10003423 3300003791 Bacteria 9029
24 Ga0055531_10028919 3300003794 Bacteria 1899
25 JGI25405J52794_10006708 3300003911 Bacteria 2107
26 Ga0065165_1010588 3300005262 Bacteria 3960
27 Ga0065712_10001614 3300005290 Bacteria 6094
28 Ga0065712_10081440 3300005290 Bacteria 3006
29 Ga0065715_10001152 3300005293 Bacteria 6938
30 Ga0065715_10104947 3300005293 Bacteria 2925
31 Ga0065707_10101857 3300005295 Bacteria 2842
32 Ga0070676_10001460 3300005328 Bacteria 11953
33 Ga0070676_10026353 3300005328 Bacteria 3291
34 Ga0070683_100087289 3300005329 Bacteria 2925
35 Ga0070683_100100186 3300005329 Bacteria 2727
36 Ga0070690_100004467 3300005330 Bacteria 7770
37 Ga0070690_100021035 3300005330 Bacteria 3980
38 Ga0070670_100054629 3300005331 Bacteria 3429
39 Ga0070670_100063259 3300005331 Bacteria 3176
40 Ga0070670_100132432 3300005331 Bacteria 2153
41 Ga0070677_10000429 3300005333 Bacteria 14486
42 Ga0068869_100000687 3300005334 Bacteria 19110
43 Ga0068869_100085936 3300005334 Bacteria 2357
44 Ga0068869_100268560 3300005334 Bacteria 1368
45 Ga0068869_100381291 3300005334 Bacteria 1155
46 Ga0070666_10060082 3300005335 Bacteria 2572
47 Ga0070680_100027252 3300005336 Bacteria 4575
48 Ga0070680_100077923 3300005336 Bacteria 2730
49 Ga0070680_100246084 3300005336 Bacteria 1512
50 Ga0070682_100000995 3300005337 Bacteria 16400
51 Ga0070682_100003787 3300005337 Bacteria 8408
52 Ga0070682_100065437 3300005337 Bacteria 2310
53 Ga0070682_100136920 3300005337 Bacteria 1664
54 Ga0068868_100058156 3300005338 Bacteria 3055
55 Ga0068868_100254238 3300005338 Bacteria 1479
56 Ga0070660_100006096 3300005339 Bacteria 8336
57 Ga0070660_100083714 3300005339 Bacteria 2506
58 Ga0070660_100091470 3300005339 Bacteria 2400
59 Ga0070689_100016831 3300005340 Bacteria 5359
60 Ga0070689_100065316 3300005340 Bacteria 2833
61 Ga0070691_10001450 3300005341 Bacteria 10155
62 Ga0070687_100010183 3300005343 Bacteria 4054
63 Ga0070687_100025480 3300005343 Bacteria 2838
64 Ga0070661_100075460 3300005344 Bacteria 2484
65 Ga0070692_10001330 3300005345 Bacteria 8896
66 Ga0070692_10032664 3300005345 Bacteria 2618
67 Ga0070668_100052491 3300005347 Bacteria 3142
68 Ga0070668_100214941 3300005347 Bacteria 1583
69 Ga0070669_100032918 3300005353 Bacteria 3746
70 Ga0070669_100062781 3300005353 Bacteria 2733
71 Ga0070675_100000240 3300005354 Bacteria 35499
72 Ga0070675_100070918 3300005354 Bacteria 2889
73 Ga0070671_100027986 3300005355 Bacteria 4641
74 Ga0070671_100196451 3300005355 Bacteria 1710
75 Ga0070671_100278529 3300005355 Bacteria 1422
76 Ga0070674_100002264 3300005356 Bacteria 10625
77 Ga0070673_100019462 3300005364 Bacteria 4872
78 Ga0070673_100134704 3300005364 Bacteria 2078
79 Ga0070688_100016686 3300005365 Bacteria 4202
80 Ga0070688_100041792 3300005365 Bacteria 2816
81 Ga0070659_100009275 3300005366 Bacteria 7224
82 Ga0070659_100033735 3300005366 Bacteria 3978
83 Ga0070659_100064249 3300005366 Bacteria 2905
84 Ga0070667_100015593 3300005367 Bacteria 6283
85 Ga0070667_100066927 3300005367 Bacteria 3053
86 Ga0070667_100088578 3300005367 Bacteria 2658
87 Ga0070709_10237690 3300005434 Bacteria 1307
88 Ga0070714_100093931 3300005435 Bacteria 2632
89 Ga0070713_100008105 3300005436 Bacteria 7430
90 Ga0070713_100017182 3300005436 Bacteria 5464
91 Ga0070713_100034300 3300005436 Bacteria 4076
92 Ga0070713_100041015 3300005436 Bacteria 3768
93 Ga0070713_100142923 3300005436 Bacteria 2121
94 Ga0070710_10006165 3300005437 Bacteria 5737
95 Ga0070710_10016385 3300005437 Bacteria 3770
96 Ga0070701_10000039 3300005438 Bacteria 32727
97 Ga0070711_100016158 3300005439 Bacteria 4736
98 Ga0070711_100022759 3300005439 Bacteria 4066
99 Ga0070705_100000768 3300005440 Bacteria 18121
100 Ga0070705_100102717 3300005440 Bacteria 1808
101 Ga0070700_100000735 3300005441 Bacteria 16194
102 Ga0070694_100005074 3300005444 Bacteria 7938
103 Ga0070694_100023281 3300005444 Bacteria 3981
104 Ga0070708_100011083 3300005445 Bacteria 7325
105 Ga0070708_100327900 3300005445 Bacteria 1442
106 Ga0070663_100057916 3300005455 Bacteria 2781
107 Ga0070663_100065616 3300005455 Bacteria 2628
108 Ga0070678_100000998 3300005456 Bacteria 14672
109 Ga0070678_100013593 3300005456 Bacteria 5111
110 Ga0070678_100031955 3300005456 Bacteria 3637
111 Ga0070662_100060345 3300005457 Bacteria 2765
112 Ga0070662_100061564 3300005457 Bacteria 2740
113 Ga0070681_10002988 3300005458 Bacteria 15683
114 Ga0070681_10009201 3300005458 Bacteria 9709
115 Ga0070681_10019515 3300005458 Bacteria 6787
116 Ga0070681_10019918 3300005458 Bacteria 6722
117 Ga0070681_10064905 3300005458 Bacteria 3621
118 Ga0070681_10143822 3300005458 Bacteria 2314
119 Ga0070681_10280825 3300005458 Bacteria 1576
120 Ga0068867_100008309 3300005459 Bacteria 7328
121 Ga0070685_10016125 3300005466 Bacteria 3975
122 Ga0070685_10040878 3300005466 Bacteria 2640
123 Ga0070707_100004536 3300005468 Bacteria 12999
124 Ga0070698_100079951 3300005471 Bacteria 3265
125 Ga0070679_100001814 3300005530 Bacteria 19260
126 Ga0070679_100010765 3300005530 Bacteria 8684
127 Ga0070679_100011317 3300005530 Bacteria 8506
128 Ga0070679_100016730 3300005530 Bacteria 7086
129 Ga0070679_100049458 3300005530 Unclassified 4187
130 Ga0070679_100086604 3300005530 Bacteria 3119
131 Ga0070679_100441582 3300005530 Bacteria 1246
132 Ga0070684_100006735 3300005535 Bacteria 8912
133 Ga0070684_100178396 3300005535 Bacteria 1931
134 Ga0070697_100030782 3300005536 Bacteria 4313
135 Ga0070697_100038587 3300005536 Bacteria 3860
136 Ga0070697_100047284 3300005536 Bacteria 3489
137 Ga0070697_100204273 3300005536 Bacteria 1680
138 Ga0068853_100000437 3300005539 Bacteria 28499
139 Ga0068853_100031350 3300005539 Bacteria 4496
140 Ga0070672_100001847 3300005543 Bacteria 13222
141 Ga0070686_100003301 3300005544 Bacteria 8832
142 Ga0070686_100019694 3300005544 Bacteria 3980
143 Ga0070695_100003423 3300005545 Bacteria 9272
144 Ga0070695_100021124 3300005545 Bacteria 3980
145 Ga0070696_100019038 3300005546 Bacteria 4647
146 Ga0070696_100072002 3300005546 Bacteria 2433
147 Ga0070696_100341126 3300005546 Bacteria 1158
148 Ga0070693_100003347 3300005547 Bacteria 7453
149 Ga0070693_100078512 3300005547 Bacteria 1962
150 Ga0070693_100096188 3300005547 Bacteria 1795
151 Ga0070665_100400073 3300005548 Bacteria 1381
152 Ga0070704_100013544 3300005549 Bacteria 5063
153 Ga0070704_100073537 3300005549 Bacteria 2490
154 Ga0070704_100201039 3300005549 Bacteria 1608
155 Ga0068855_100002138 3300005563 Bacteria 24449
156 Ga0068855_100023725 3300005563 Bacteria 7348
157 Ga0068855_100046002 3300005563 Bacteria 5159
158 Ga0070664_100001002 3300005564 Bacteria 22163
159 Ga0068857_100008801 3300005577 Bacteria 8743
160 Ga0068857_100255119 3300005577 Bacteria 1608
161 Ga0068854_100001976 3300005578 Bacteria 12534
162 Ga0068854_100089710 3300005578 Bacteria 2285
163 Ga0068856_100005280 3300005614 Bacteria 12741
164 Ga0068856_100143713 3300005614 Bacteria 2394
165 Ga0070702_100002858 3300005615 Bacteria 7581
166 Ga0068859_100018024 3300005617 Bacteria 7096
167 Ga0068859_100119803 3300005617 Bacteria 2698
168 Ga0068864_100006180 3300005618 Bacteria 9820
169 Ga0068866_10011870 3300005718 Bacteria 3784
170 Ga0068861_100000248 3300005719 Bacteria 29792
171 Ga0068870_10000157 3300005840 Bacteria 23872
172 Ga0068863_100000674 3300005841 Bacteria 34508
173 Ga0068863_100323821 3300005841 Bacteria 1497
174 Ga0068863_100390688 3300005841 Bacteria 1359
175 Ga0068858_100054434 3300005842 Bacteria 3700
176 Ga0068858_100072251 3300005842 Bacteria 3201
177 Ga0068860_100011546 3300005843 Bacteria 8707
178 Ga0068860_100050047 3300005843 Bacteria 3979
179 Ga0068860_100072707 3300005843 Bacteria 3269
180 Ga0068862_100040120 3300005844 Bacteria 3979
181 Ga0081455_10000059 3300005937 Bacteria 119148
182 Ga0081455_10002427 3300005937 Bacteria 22238
183 Ga0081455_10242350 3300005937 Bacteria 1324
184 Ga0081538_10049508 3300005981 Bacteria 2548
185 Ga0081540_1008452 3300005983 Bacteria 7190
186 Ga0081539_10000140 3300005985 Bacteria 166746
187 Ga0081539_10046544 3300005985 Bacteria 2485
188 Ga0070717_10000161 3300006028 Bacteria 50633
189 Ga0070717_10012075 3300006028 Bacteria 6581
190 Ga0070717_10045154 3300006028 Bacteria 3601
191 Ga0075365_10003405 3300006038 Bacteria 8181
192 Ga0075368_10001688 3300006042 Bacteria 7091
193 Ga0075363_100013917 3300006048 Bacteria 3917
194 Ga0075364_10009796 3300006051 Bacteria 5763
195 Ga0075432_10010678 3300006058 Bacteria 3121
196 Ga0070715_10002352 3300006163 Bacteria 5786
197 Ga0070716_100026605 3300006173 Bacteria 3099
198 Ga0070716_100259043 3300006173 Bacteria 1189
199 Ga0070712_100006221 3300006175 Bacteria 7388
200 Ga0070712_100123444 3300006175 Bacteria 1952
201 Ga0075367_10074959 3300006178 Bacteria 2040
202 Ga0075369_10041306 3300006186 Bacteria 1974
203 Ga0075427_10000100 3300006194 Bacteria 7234
204 Ga0075366_10087695 3300006195 Bacteria 1863
205 Ga0097621_100001613 3300006237 Bacteria 15457
206 Ga0068871_100001066 3300006358 Bacteria 18401
207 Ga0075430_100000070 3300006846 Bacteria 55805
208 Ga0075431_100001221 3300006847 Bacteria 23276
209 Ga0075433_10006220 3300006852 Bacteria 9418
210 Ga0075433_10110695 3300006852 Bacteria 2437
211 Ga0075433_10124808 3300006852 Bacteria 2287
212 Ga0075434_100000212 3300006871 Bacteria 39628
213 Ga0075434_100027125 3300006871 Bacteria 5621
214 Ga0075434_100157948 3300006871 Bacteria 2287
215 Ga0075434_100216040 3300006871 Bacteria 1937
216 Ga0075429_100003999 3300006880 Bacteria 12622
217 Ga0068865_100000131 3300006881 Bacteria 38862
218 Ga0075436_100001731 3300006914 Bacteria 14950
219 Ga0075436_100034998 3300006914 Bacteria 3464
220 Ga0075436_100070908 3300006914 Bacteria 2409
221 Ga0097620_100018022 3300006931 Bacteria 7096
222 Ga0097620_100119802 3300006931 Bacteria 2698
223 Ga0075435_100015735 3300007076 Bacteria 5690
224 Ga0075435_100049577 3300007076 Bacteria 3377
225 Ga0075435_100109551 3300007076 Bacteria 2296
226 Ga0075435_100268392 3300007076 Bacteria 1455
227 Ga0099794_10006018 3300007265 Bacteria 4896
228 Ga0105244_10017643 3300009036 Bacteria 4029
229 Ga0105240_10000411 3300009093 Bacteria 79786
230 Ga0105240_10003526 3300009093 Bacteria 24279
231 Ga0105240_10011914 3300009093 Bacteria 12061
232 Ga0105240_10191619 3300009093 Bacteria 2404
233 Ga0111539_10000138 3300009094 Bacteria 82968
234 Ga0111539_10000684 3300009094 Bacteria 43895
235 Ga0111539_10005247 3300009094 Bacteria 16787
236 Ga0111539_10028103 3300009094 Bacteria 6867
237 Ga0111539_10232912 3300009094 Bacteria 2144
238 Ga0105245_10003161 3300009098 Bacteria 14721
239 Ga0105245_10005778 3300009098 Bacteria 10853
240 Ga0105245_10167920 3300009098 Bacteria 2087
241 Ga0105245_10297231 3300009098 Bacteria 1583
242 Ga0105247_10005112 3300009101 Bacteria 8310
243 Ga0105247_10034021 3300009101 Bacteria 3103
244 Ga0105247_10056044 3300009101 Bacteria 2433
245 Ga0105247_10111516 3300009101 Bacteria 1761
246 Ga0105247_10159395 3300009101 Bacteria 1493
247 Ga0114129_10002312 3300009147 Bacteria 26434
248 Ga0114129_10058044 3300009147 Bacteria 5414
249 Ga0114129_10482426 3300009147 Bacteria 1622
250 Ga0105243_10071183 3300009148 Bacteria 2811
251 Ga0105243_10073860 3300009148 Bacteria 2764
252 Ga0105241_10069318 3300009174 Bacteria 2734
253 Ga0105241_10075502 3300009174 Bacteria 2627
254 Ga0105241_10405603 3300009174 Bacteria 1196
255 Ga0105242_10021762 3300009176 Bacteria 5038
256 Ga0105242_10215419 3300009176 Bacteria 1713
257 Ga0105248_10051300 3300009177 Bacteria 4629
258 Ga0105248_10103407 3300009177 Bacteria 3211
259 Ga0105248_10117464 3300009177 Bacteria 3000
260 Ga0105237_10016490 3300009545 Bacteria 7674
261 Ga0105237_10079338 3300009545 Bacteria 3273
262 Ga0105237_10087884 3300009545 Bacteria 3097
263 Ga0105238_10002477 3300009551 Bacteria 18476
264 Ga0105238_10058977 3300009551 Bacteria 3846
265 Ga0105238_10257445 3300009551 Bacteria 1724
266 Ga0105249_10000711 3300009553 Bacteria 30203
267 Ga0105249_10005299 3300009553 Bacteria 11137
268 Ga0105249_10021879 3300009553 Bacteria 5726
269 Ga0105249_10073357 3300009553 Bacteria 3166
270 Ga0105239_10021637 3300010375 Bacteria 7090
271 Ga0105239_10173107 3300010375 Bacteria 2414
272 Ga0105239_10417110 3300010375 Bacteria 1520
273 Ga0105246_10002665 3300011119 Bacteria 10812
274 Ga0105246_10117875 3300011119 Bacteria 1962
275 Ga0105246_10209764 3300011119 Bacteria 1520
276 Ga0105246_10273185 3300011119 Bacteria 1352
277 Ga0157373_10011307 3300013100 Bacteria 6563
278 Ga0157373_10020584 3300013100 Bacteria 4792
279 Ga0157371_10057880 3300013102 Bacteria 2749
280 Ga0157370_10003496 3300013104 Bacteria 18415
281 Ga0157370_10065204 3300013104 Bacteria 3446
282 Ga0157370_10589985 3300013104 Bacteria 1018
283 Ga0157369_10004403 3300013105 Bacteria 16624
284 Ga0157369_10018324 3300013105 Bacteria 7851
285 Ga0157374_10000671 3300013296 Bacteria 30150
286 Ga0157374_10032272 3300013296 Bacteria 4766
287 Ga0157374_10084810 3300013296 Unclassified 3011
288 Ga0157374_10205183 3300013296 Bacteria 1931
289 Ga0157378_10126975 3300013297 Bacteria 2357
290 Ga0157378_10175656 3300013297 Bacteria 2012
291 Ga0157378_10348032 3300013297 Bacteria 1447
292 Ga0163162_10003419 3300013306 Bacteria 15152
293 Ga0163162_10137663 3300013306 Bacteria 2553
294 Ga0163162_10197380 3300013306 Bacteria 2141
295 Ga0157372_10105543 3300013307 Bacteria 3222
296 Ga0157375_10009189 3300013308 Bacteria 8664
297 Ga0157375_10017721 3300013308 Bacteria 6437
298 Ga0157375_10138520 3300013308 Bacteria 2559
299 Ga0163163_10004312 3300014325 Bacteria 12118
300 Ga0163163_10029813 3300014325 Bacteria 5250
301 Ga0157380_10000678 3300014326 Bacteria 21096
302 Ga0157380_10532272 3300014326 Bacteria 1149
303 Ga0157377_10000570 3300014745 Bacteria 15436
304 Ga0157377_10056043 3300014745 Bacteria 2237
305 Ga0157377_10191287 3300014745 Bacteria 1293
306 Ga0157379_10000345 3300014968 Bacteria 37352
307 Ga0157379_10042501 3300014968 Bacteria 4058
308 Ga0157379_10061412 3300014968 Bacteria 3360
309 Ga0157379_10311399 3300014968 Bacteria 1436
310 Ga0157379_10414874 3300014968 Bacteria 1239
311 Ga0157376_10003644 3300014969 Bacteria 10633
312 Ga0163161_10004669 3300017792 Bacteria 9525
313 Ga0213872_10015714 3300021361 Unclassified 3518
314 Ga0213872_10100322 3300021361 Bacteria 1291
315 Ga0213874_10004551 3300021377 Unclassified 3180
316 Ga0213876_10001266 3300021384 Bacteria 15963
317 Ga0209677_106740 3300025253 Bacteria 2636
318 Ga0209148_1011843 3300025254 Bacteria 1610
319 Ga0207666_1000069 3300025271 Bacteria 17953
320 Ga0207666_1001537 3300025271 Bacteria 2724
321 Ga0207673_1000145 3300025290 Bacteria 6892
322 Ga0209675_1000307 3300025291 Bacteria 44268
323 Ga0209025_1024894 3300025294 Bacteria 3072
324 Ga0209564_1000015 3300025295 Bacteria 615324
325 Ga0209564_1000031 3300025295 Bacteria 494703
326 Ga0209564_1025935 3300025295 Bacteria 1953
327 Ga0209758_1000140 3300025297 Bacteria 174267
328 Ga0209758_1000232 3300025297 Bacteria 117382
329 Ga0209758_1000925 3300025297 Bacteria 39673
330 Ga0209758_1002072 3300025297 Bacteria 21375
331 Ga0209758_1007360 3300025297 Bacteria 7527
332 Ga0209256_1000205 3300025299 Bacteria 111530
333 Ga0209256_1004348 3300025299 Bacteria 8979
334 Ga0209256_1007690 3300025299 Bacteria 5231
335 Ga0207426_1000434 3300025302 Bacteria 68127
336 Ga0207426_1058688 3300025302 Bacteria 1115
337 Ga0209257_1001932 3300025304 Bacteria 22369
338 Ga0207697_10019122 3300025315 Bacteria 2806
339 Ga0207653_10016912 3300025885 Bacteria 2294
340 Ga0207682_10000048 3300025893 Bacteria 50998
341 Ga0207692_10008259 3300025898 Bacteria 4305
342 Ga0207642_10000783 3300025899 Bacteria 9847
343 Ga0207710_10037372 3300025900 Bacteria 2144
344 Ga0207688_10001496 3300025901 Bacteria 12264
345 Ga0207688_10040016 3300025901 Bacteria 2604
346 Ga0207680_10021980 3300025903 Bacteria 3462
347 Ga0207647_10007263 3300025904 Bacteria 8019
348 Ga0207647_10008534 3300025904 Bacteria 7336
349 Ga0207647_10012181 3300025904 Bacteria 5999
350 Ga0207699_10000944 3300025906 Bacteria 13851
351 Ga0207699_10067828 3300025906 Bacteria 2170
352 Ga0207699_10169314 3300025906 Bacteria 1460
353 Ga0207645_10003506 3300025907 Bacteria 11875
354 Ga0207645_10063042 3300025907 Bacteria 2368
355 Ga0207645_10156185 3300025907 Bacteria 1490
356 Ga0207643_10001399 3300025908 Bacteria 13828
357 Ga0207684_10064509 3300025910 Bacteria 3109
358 Ga0207654_10003198 3300025911 Bacteria 8280
359 Ga0207654_10215549 3300025911 Bacteria 1271
360 Ga0207707_10000119 3300025912 Bacteria 80273
361 Ga0207707_10001610 3300025912 Bacteria 20791
362 Ga0207707_10018809 3300025912 Bacteria 6026
363 Ga0207707_10020384 3300025912 Bacteria 5789
364 Ga0207707_10023721 3300025912 Bacteria 5365
365 Ga0207707_10023741 3300025912 Bacteria 5363
366 Ga0207707_10036943 3300025912 Bacteria 4269
367 Ga0207707_10037232 3300025912 Bacteria 4250
368 Ga0207707_10226637 3300025912 Bacteria 1626
369 Ga0207695_10004562 3300025913 Bacteria 18831
370 Ga0207695_10064793 3300025913 Bacteria 3760
371 Ga0207695_10144499 3300025913 Bacteria 2324
372 Ga0207695_10152593 3300025913 Bacteria 2248
373 Ga0207695_10280138 3300025913 Bacteria 1561
374 Ga0207671_10115222 3300025914 Bacteria 2049
375 Ga0207671_10206742 3300025914 Bacteria 1534
376 Ga0207693_10002467 3300025915 Bacteria 16076
377 Ga0207663_10011512 3300025916 Bacteria 4751
378 Ga0207663_10063336 3300025916 Bacteria 2354
379 Ga0207663_10119530 3300025916 Bacteria 1802
380 Ga0207660_10000104 3300025917 Bacteria 47254
381 Ga0207660_10004090 3300025917 Bacteria 9500
382 Ga0207660_10103776 3300025917 Bacteria 2127
383 Ga0207660_10107364 3300025917 Bacteria 2095
384 Ga0207660_10201056 3300025917 Bacteria 1556
385 Ga0207660_10229653 3300025917 Bacteria 1459
386 Ga0207660_10389475 3300025917 Bacteria 1121
387 Ga0207662_10003087 3300025918 Bacteria 8502
388 Ga0207662_10004464 3300025918 Bacteria 7364
389 Ga0207657_10003518 3300025919 Bacteria 16733
390 Ga0207657_10088833 3300025919 Bacteria 2582
391 Ga0207657_10094095 3300025919 Bacteria 2495
392 Ga0207649_10000141 3300025920 Bacteria 60047
393 Ga0207649_10123937 3300025920 Bacteria 1746
394 Ga0207652_10000515 3300025921 Bacteria 39187
395 Ga0207652_10001526 3300025921 Bacteria 20428
396 Ga0207652_10142877 3300025921 Bacteria 2141
397 Ga0207652_10210755 3300025921 Bacteria 1749
398 Ga0207646_10011053 3300025922 Bacteria 8767
399 Ga0207681_10000359 3300025923 Bacteria 32485
400 Ga0207681_10166082 3300025923 Bacteria 1669
401 Ga0207694_10122911 3300025924 Bacteria 2074
402 Ga0207694_10201258 3300025924 Bacteria 1620
403 Ga0207650_10032317 3300025925 Bacteria 3785
404 Ga0207659_10000052 3300025926 Bacteria 79692
405 Ga0207659_10243311 3300025926 Bacteria 1456
406 Ga0207687_10000097 3300025927 Bacteria 64441
407 Ga0207687_10010954 3300025927 Bacteria 5925
408 Ga0207687_10188765 3300025927 Bacteria 1602
409 Ga0207700_10000673 3300025928 Bacteria 19951
410 Ga0207700_10008693 3300025928 Bacteria 6308
411 Ga0207700_10057884 3300025928 Bacteria 2925
412 Ga0207700_10250010 3300025928 Bacteria 1514
413 Ga0207664_10010534 3300025929 Bacteria 6530
414 Ga0207664_10107677 3300025929 Bacteria 2313
415 Ga0207644_10002956 3300025931 Bacteria 10949
416 Ga0207690_10000278 3300025932 Bacteria 36244
417 Ga0207690_10018178 3300025932 Bacteria 4309
418 Ga0207706_10078650 3300025933 Bacteria 2900
419 Ga0207706_10083323 3300025933 Bacteria 2811
420 Ga0207706_10088290 3300025933 Bacteria 2726
421 Ga0207686_10000850 3300025934 Bacteria 18532
422 Ga0207686_10045453 3300025934 Bacteria 2702
423 Ga0207709_10000349 3300025935 Bacteria 47453
424 Ga0207709_10041427 3300025935 Bacteria 2763
425 Ga0207670_10000781 3300025936 Bacteria 16732
426 Ga0207670_10061577 3300025936 Bacteria 2561
427 Ga0207669_10000168 3300025937 Bacteria 30867
428 Ga0207704_10000704 3300025938 Bacteria 14739
429 Ga0207665_10000248 3300025939 Bacteria 37228
430 Ga0207665_10074153 3300025939 Bacteria 2329
431 Ga0207691_10003348 3300025940 Bacteria 15596
432 Ga0207691_10142573 3300025940 Bacteria 2110
433 Ga0207711_10003359 3300025941 Bacteria 13863
434 Ga0207689_10005416 3300025942 Bacteria 11423
435 Ga0207689_10045015 3300025942 Bacteria 3650
436 Ga0207661_10000143 3300025944 Bacteria 45329
437 Ga0207661_10186597 3300025944 Bacteria 1815
438 Ga0207679_10000035 3300025945 Bacteria 144173
439 Ga0207679_10011268 3300025945 Bacteria 5781
440 Ga0207667_10001570 3300025949 Bacteria 28787
441 Ga0207667_10046224 3300025949 Bacteria 4609
442 Ga0207667_10049164 3300025949 Bacteria 4456
443 Ga0207651_10000080 3300025960 Bacteria 42826
444 Ga0207712_10001127 3300025961 Bacteria 18629
445 Ga0207712_10092379 3300025961 Bacteria 2231
446 Ga0207712_10330591 3300025961 Bacteria 1261
447 Ga0207668_10005342 3300025972 Bacteria 7557
448 Ga0207668_10071444 3300025972 Bacteria 2479
449 Ga0207668_10085490 3300025972 Bacteria 2302
450 Ga0207640_10001402 3300025981 Bacteria 13012
451 Ga0207640_10098875 3300025981 Bacteria 2041
452 Ga0207640_10257024 3300025981 Bacteria 1359
453 Ga0207658_10032065 3300025986 Bacteria 3736
454 Ga0207658_10217197 3300025986 Bacteria 1606
455 Ga0207677_10000614 3300026023 Bacteria 21876
456 Ga0207677_10335320 3300026023 Bacteria 1262
457 Ga0207703_10030485 3300026035 Bacteria 4263
458 Ga0207703_10125493 3300026035 Bacteria 2209
459 Ga0207703_10151412 3300026035 Bacteria 2023
460 Ga0207639_10021338 3300026041 Bacteria 4651
461 Ga0207678_10038552 3300026067 Bacteria 4152
462 Ga0207678_10079023 3300026067 Bacteria 2817
463 Ga0207678_10082729 3300026067 Bacteria 2746
464 Ga0207678_10082730 3300026067 Bacteria 2746
465 Ga0207708_10001353 3300026075 Bacteria 18401
466 Ga0207708_10007477 3300026075 Bacteria 8073
467 Ga0207702_10001956 3300026078 Bacteria 20052
468 Ga0207702_10060712 3300026078 Bacteria 3223
469 Ga0207702_10116988 3300026078 Bacteria 2380
470 Ga0207702_10218473 3300026078 Bacteria 1775
471 Ga0207641_10084479 3300026088 Bacteria 2763
472 Ga0207641_10102400 3300026088 Bacteria 2525
473 Ga0207648_10013365 3300026089 Bacteria 7641
474 Ga0207648_10143291 3300026089 Bacteria 2107
475 Ga0207676_10001840 3300026095 Bacteria 15541
476 Ga0207674_10008438 3300026116 Bacteria 11902
477 Ga0207674_10043305 3300026116 Bacteria 4642
478 Ga0207674_10149204 3300026116 Bacteria 2295
479 Ga0207674_10193479 3300026116 Bacteria 1984
480 Ga0207674_10247416 3300026116 Bacteria 1730
481 Ga0207674_10328044 3300026116 Bacteria 1480
482 Ga0207675_100002948 3300026118 Bacteria 16733
483 Ga0207675_100012197 3300026118 Bacteria 8027
484 Ga0207675_100028974 3300026118 Bacteria 5159
485 Ga0207683_10002096 3300026121 Bacteria 17563
486 Ga0207683_10003030 3300026121 Bacteria 14680
487 Ga0207683_10100175 3300026121 Bacteria 2586
488 Ga0207698_10008006 3300026142 Bacteria 6661
489 Ga0209971_1004128 3300027682 Bacteria 3441
490 Ga0209966_1001601 3300027695 Bacteria 3876
491 Ga0209998_10005225 3300027717 Bacteria 2722
492 Ga0209998_10006493 3300027717 Bacteria 2430
493 Ga0209998_10031253 3300027717 Bacteria 1180
494 Ga0209974_10008734 3300027876 Bacteria 3452
495 Ga0209974_10068970 3300027876 Bacteria 1204
496 Ga0207428_10000075 3300027907 Bacteria 137887
497 Ga0207428_10000428 3300027907 Bacteria 51964
498 Ga0207428_10001396 3300027907 Bacteria 25497
499 Ga0207428_10156604 3300027907 Bacteria 1732
500 Ga0268266_10027620 3300028379 Bacteria 4824
501 Ga0268266_10111657 3300028379 Bacteria 2422
502 Ga0268265_10003048 3300028380 Bacteria 12223
503 Ga0268265_10011699 3300028380 Bacteria 5934
504 Ga0268264_10001145 3300028381 Bacteria 25934
505 Ga0268264_10079277 3300028381 Bacteria 2801
506 Ga0268264_10195287 3300028381 Bacteria 1847
507 Ga0265337_1000182 3300028556 Bacteria 33103
508 Ga0307515_10000600 3300028794 Bacteria 83981
509 Ga0265332_10125828 3300031238 Bacteria 1076
510 Ga0265340_10001673 3300031247 Bacteria 12747
511 Ga0265339_10001531 3300031249 Bacteria 17069
512 Ga0265339_10141850 3300031249 Bacteria 1221
513 Ga0265316_10317838 3300031344 Bacteria 1131
514 Ga0307513_10008298 3300031456 Bacteria 13309
515 Ga0265313_10000181 3300031595 Bacteria 67263
516 Ga0307406_10027838 3300031901 Bacteria 3410
517 Ga0316583_10040564 3300032133 Bacteria 1648
518 Ga0307510_10094692 3300033180 Bacteria 2810
519 Ga0373930_0000464 3300034816 Bacteria 5460
520 Ga0373930_0003826 3300034816 Bacteria 2413
521 Ga0373930_0015819 3300034816 Bacteria 1420
522 Ga0373948_0000488 3300034817 Bacteria 4950
523 Ga0373948_0001405 3300034817 Bacteria 3324
524 Ga0373950_0000351 3300034818 Bacteria 5715
525 Ga0373950_0002315 3300034818 Bacteria 2611
526 Ga0373950_0011583 3300034818 Bacteria 1442
527 Ga0373958_0000402 3300034819 Bacteria 5242
528 Ga0373958_0001293 3300034819 Bacteria 3348
529 Ga0373958_0002203 3300034819 Bacteria 2707
530 Ga0373959_0000494 3300034820 Bacteria 7127
531 Ga0373959_0001509 3300034820 Bacteria 3724
532 Ga0373938_0000413 3300034957 Bacteria 6890
533 Ga0373926_0002008 3300035083 Bacteria 6390
534 Ga0373926_0010300 3300035083 Bacteria 3131
535 Ga0373928_0000172 3300035084 Bacteria 12512
536 Ga0373928_0002041 3300035084 Bacteria 3934
537 Ga0373929_0000302 3300035085 Bacteria 9176
538 Ga0373929_0003253 3300035085 Bacteria 2939
539 Ga0373934_0015240 3300035086 Bacteria 2915
540 Ga0373934_0046778 3300035086 Bacteria 1712
541 Ga0373940_0003536 3300035088 Bacteria 3199
542 Ga0373940_0008001 3300035088 Bacteria 2409
543 Ga0373944_0000062 3300035089 Bacteria 17879
544 Ga0373944_0005563 3300035089 Bacteria 3321
545 Ga0373949_0002398 3300035090 Bacteria 4832
546 Ga0373949_0003324 3300035090 Bacteria 3861
547 Ga0373949_0003453 3300035090 Bacteria 3758
548 Ga0373951_0001192 3300035091 Bacteria 6872
549 Ga0373951_0006845 3300035091 Bacteria 2604
550 Ga0373952_0000447 3300035092 Bacteria 7176
551 Ga0373952_0000884 3300035092 Bacteria 5461
552 Ga0373952_0001020 3300035092 Bacteria 5115
553 Ga0373923_0000387 3300035111 Bacteria 10139
554 Ga0373932_0000029 3300035112 Bacteria 39605
555 Ga0373932_0003160 3300035112 Bacteria 4007
556 Ga0373932_0003822 3300035112 Bacteria 3599
557 Ga0373936_0000484 3300035113 Bacteria 13457
558 Ga0373936_0019710 3300035113 Bacteria 2615
559 Ga0373936_0108417 3300035113 Bacteria 1177
560 Ga0373939_0000356 3300035114 Bacteria 11594
561 Ga0373939_0001362 3300035114 Bacteria 5918
562 Ga0373941_0000106 3300035115 Bacteria 14078
563 Ga0373941_0000424 3300035115 Bacteria 8379
564 Ga0373941_0026859 3300035115 Bacteria 1675
565 Ga0373945_0004180 3300035116 Bacteria 4582
566 Ga0373945_0023152 3300035116 Bacteria 2144
567 Ga0373953_0001395 3300035117 Bacteria 6962
568 Ga0373953_0063163 3300035117 Bacteria 1517
569 Ga0373954_0037654 3300035118 Bacteria 2248
570 Ga0373956_0027092 3300035119 Bacteria 2486
571 Ga0373957_0000713 3300035120 Bacteria 8612
572 Ga0373957_0011670 3300035120 Bacteria 2940
573 Ga0373960_0000009 3300035121 Bacteria 26216
574 Ga0373960_0009990 3300035121 Bacteria 2310
575 Ga0373943_0012718 3300035170 Bacteria 3794
576 Ga0373943_0020592 3300035170 Bacteria 3042
577 Ga0373943_0028976 3300035170 Bacteria 2613
578 Ga0373943_0047591 3300035170 Bacteria 2097
579 Ga0373946_0002687 3300035171 Bacteria 6285
580 Ga0373946_0012381 3300035171 Bacteria 3192
581 Ga0373946_0018899 3300035171 Bacteria 2649
582 Ga0373946_0047960 3300035171 Bacteria 1776
583 Ga0373955_0000366 3300035172 Bacteria 19051
584 Ga0373955_0002392 3300035172 Bacteria 8177
585 Ga0373955_0043353 3300035172 Bacteria 2420
586 Ga0373942_0000542 3300035207 Bacteria 10621
587 Ga0373961_0001281 3300035241 Bacteria 7655
588 Ga0373961_0002601 3300035241 Bacteria 4646
589 Ga0373962_0000376 3300035242 Bacteria 9743
590 Ga0373962_0008200 3300035242 Bacteria 2568
591 Ga0373924_0019001 3300035410 Bacteria 2657
592 Ga0373924_0037312 3300035410 Bacteria 1978
593 Ga0373931_0000409 3300035691 Bacteria 17588
594 Ga0373931_0004931 3300035691 Bacteria 6136
595 Ga0373931_0013494 3300035691 Bacteria 3979
596 Ga0373935_0000382 3300035692 Bacteria 22745
597 Ga0373935_0010618 3300035692 Bacteria 5527
598 Ga0373935_0024746 3300035692 Bacteria 3697
599 Ga0373927_0000956 3300035695 Bacteria 22017
600 Ga0373927_0002885 3300035695 Bacteria 12521
601 Ga0373927_0045009 3300035695 Bacteria 2855
602 Ga0373933_0000110 3300035724 Bacteria 52519
603 Ga0373933_0002646 3300035724 Bacteria 10029
604 Ga0373933_0061272 3300035724 Bacteria 2270
605 Ga0373933_0066231 3300035724 Bacteria 2189
606 Ga0373947_0000731 3300035725 Bacteria 19641
607 Ga0373947_0001850 3300035725 Bacteria 12909
608 Ga0373947_0003531 3300035725 Bacteria 9232
609 Ga0373937_0002001 3300036401 Bacteria 17037
610 Ga0373937_0007098 3300036401 Bacteria 9677
611 Ga0373937_0009476 3300036401 Bacteria 8464
612 Ga0373937_0109590 3300036401 Bacteria 2567
613 Ga0373925_0002634 3300037068 Bacteria 14243
614 Ga0373925_0003685 3300037068 Bacteria 11776
615 Ga0373925_0010358 3300037068 Bacteria 6765
616 Ga0373925_0103628 3300037068 Bacteria 2190
617 Ga0373925_0349406 3300037068 Bacteria 1200
618 Ga0395900_0137353 3300037418 Bacteria 2505
619 Ga0395905_0002565 3300037471 Bacteria 20011
620 Ga0436364_0684151 3300037853 Unclassified 2101
621 Ga0395901_0136667 3300038443 Bacteria 2576
622 Ga0395901_0166786 3300038443 Bacteria 2312
623 Ga0436365_0513279 3300039437 Bacteria 19541
624 Ga0436365_1104947 3300039437 Bacteria 3437
625 Ga0436360_1211363 3300039438 Bacteria 4122
626 Ga0436361_0027198 3300039447 Bacteria 15108
627 Ga0436361_0147176 3300039447 Bacteria 4122
628 Ga0436361_1157127 3300039447 Bacteria 2805
629 Ga0436363_0096027 3300039450 Bacteria 1621
630 Ga0436363_0540018 3300039450 Bacteria 12334
631 Ga0439453_0003687 3300041408 Bacteria 2224
632 Ga0439448_0041230 3300042005 Bacteria 1493
633 Ga0439435_0006396 3300042436 Bacteria 2646
634 Ga0466969_0080482 3300044656 Bacteria 1556
635 Ga0466966_0006283 3300044684 Bacteria 7861
636 Ga0466961_0000154 3300044693 Bacteria 46518
637 Ga0466963_0004891 3300044694 Bacteria 7811
638 Ga0466963_0259264 3300044694 Bacteria 1220
639 Ga0453684_0253798 3300044712 Bacteria 2018
640 Ga0466959_0012963 3300045049 Bacteria 6035
641 Ga0451576_0016775 3300045051 Bacteria 8074
642 Ga0495592_0029190 3300046454 Bacteria 4175
643 Ga0495592_0036453 3300046454 Bacteria 3704
644 Ga0495592_0051160 3300046454 Bacteria 3069
645 Ga0495592_0157393 3300046454 Bacteria 1566
646 Ga0495592_0208641 3300046454 Bacteria 1313
647 Ga0495603_0002008 3300046455 Bacteria 11977
648 Ga0495603_0009274 3300046455 Bacteria 5952
649 Ga0495603_0056028 3300046455 Bacteria 2335
650 Ga0495629_0000500 3300046459 Bacteria 32861
651 Ga0495629_0002524 3300046459 Bacteria 14035
652 Ga0495629_0014754 3300046459 Bacteria 5620
653 Ga0495629_0021353 3300046459 Bacteria 4620
654 Ga0495629_0072107 3300046459 Bacteria 2410
655 Ga0495638_0029760 3300046460 Bacteria 3521
656 Ga0495641_0001436 3300046461 Bacteria 20225
657 Ga0495641_0025868 3300046461 Bacteria 2874
658 Ga0495651_0001150 3300046462 Bacteria 20444
659 Ga0495651_0003637 3300046462 Bacteria 11807
660 Ga0495651_0013744 3300046462 Bacteria 6259
661 Ga0495651_0024828 3300046462 Bacteria 4663
662 Ga0495653_0001957 3300046463 Bacteria 16221
663 Ga0495653_0009176 3300046463 Bacteria 8089
664 Ga0495653_0192942 3300046463 Bacteria 1388
665 Ga0495650_0030504 3300046471 Bacteria 2442
666 Ga0495650_0042756 3300046471 Bacteria 1927
667 Ga0495580_0001416 3300046472 Bacteria 21075
668 Ga0495580_0004694 3300046472 Bacteria 11461
669 Ga0495580_0026223 3300046472 Bacteria 4251
670 Ga0495582_0000251 3300046473 Bacteria 29816
671 Ga0495582_0044786 3300046473 Bacteria 2436
672 Ga0495582_0077010 3300046473 Bacteria 1849
673 Ga0495639_0000077 3300046475 Bacteria 46394
674 Ga0495639_0009153 3300046475 Bacteria 4244
675 Ga0495639_0025780 3300046475 Bacteria 2594
676 Ga0495662_0002039 3300046476 Bacteria 10119
677 Ga0495662_0005023 3300046476 Bacteria 6628
678 Ga0495664_0000178 3300046477 Bacteria 31382
679 Ga0495594_0000648 3300046499 Bacteria 17955
680 Ga0495594_0018573 3300046499 Bacteria 3685
681 Ga0495594_0043982 3300046499 Bacteria 2449
682 Ga0495594_0067104 3300046499 Bacteria 1990
683 Ga0495607_0010007 3300046501 Bacteria 6390
684 Ga0495583_0053134 3300046506 Bacteria 1840
685 Ga0495606_0008377 3300046507 Bacteria 8999
686 Ga0495608_0001671 3300046511 Bacteria 15955
687 Ga0495608_0012960 3300046511 Bacteria 5784
688 Ga0495608_0087254 3300046511 Bacteria 2021
689 Ga0495618_0043141 3300046514 Bacteria 2845
690 Ga0495618_0045614 3300046514 Bacteria 2765
691 Ga0495618_0079346 3300046514 Bacteria 2094
692 Ga0495618_0122232 3300046514 Bacteria 1668
693 Ga0495618_0156045 3300046514 Bacteria 1456
694 Ga0495628_0001448 3300046516 Bacteria 21780
695 Ga0495628_0007599 3300046516 Bacteria 9369
696 Ga0495628_0058528 3300046516 Bacteria 3027
697 Ga0495628_0067617 3300046516 Bacteria 2789
698 Ga0495628_0385534 3300046516 Bacteria 1026
699 Ga0495630_0001279 3300046517 Bacteria 17334
700 Ga0495630_0015634 3300046517 Bacteria 5545
701 Ga0495630_0118561 3300046517 Bacteria 2007
702 Ga0495644_0013279 3300046523 Bacteria 3162
703 Ga0495666_0000187 3300046526 Bacteria 26576
704 Ga0495666_0006830 3300046526 Bacteria 5730
705 Ga0495666_0025210 3300046526 Bacteria 2937
706 Ga0495652_0016995 3300046529 Bacteria 6500
707 Ga0495652_0020641 3300046529 Bacteria 5855
708 Ga0495652_0022353 3300046529 Bacteria 5611
709 Ga0495652_0057912 3300046529 Bacteria 3284
710 Ga0495652_0058863 3300046529 Bacteria 3252
711 Ga0495652_0154913 3300046529 Bacteria 1785
712 Ga0495652_0371961 3300046529 Bacteria 1018
713 Ga0495665_0008864 3300046531 Bacteria 5456
714 Ga0495665_0010034 3300046531 Bacteria 5132
715 Ga0495665_0010232 3300046531 Bacteria 5079
716 Ga0495640_0036563 3300046533 Bacteria 3469
717 Ga0495640_0086181 3300046533 Bacteria 2080
718 Ga0495640_0156752 3300046533 Bacteria 1461
719 Ga0495586_0004369 3300046535 Bacteria 7558
720 Ga0495586_0114764 3300046535 Bacteria 1501
721 Ga0495587_0002681 3300046536 Bacteria 11893
722 Ga0495587_0015083 3300046536 Bacteria 4829
723 Ga0495587_0026467 3300046536 Bacteria 3538
724 Ga0495587_0081897 3300046536 Bacteria 1870
725 Ga0495598_0002702 3300046537 Bacteria 3678
726 Ga0495645_0005154 3300046543 Bacteria 8949
727 Ga0495645_0113517 3300046543 Bacteria 1915
728 Ga0495622_0006500 3300046557 Bacteria 5422
729 Ga0495622_0013770 3300046557 Bacteria 3750
730 Ga0495633_0012498 3300046558 Bacteria 4512
731 Ga0495667_0000821 3300046559 Bacteria 20039
732 Ga0495667_0032794 3300046559 Bacteria 3477
733 Ga0495667_0047814 3300046559 Bacteria 2825
734 Ga0495656_0000534 3300046615 Bacteria 12388
735 Ga0495668_0020492 3300046616 Bacteria 3804
736 Ga0495634_0001976 3300046642 Bacteria 17475
737 Ga0495634_0015427 3300046642 Bacteria 5490
738 Ga0495634_0023646 3300046642 Bacteria 4317
739 Ga0495634_0063318 3300046642 Bacteria 2455
740 Ga0495634_0174029 3300046642 Bacteria 1352
741 Ga0495611_0016881 3300046648 Bacteria 3121
742 Ga0495635_0002471 3300046663 Bacteria 12619
743 Ga0495635_0010978 3300046663 Bacteria 6347
744 Ga0495635_0041465 3300046663 Bacteria 3179
745 Ga0495635_0057830 3300046663 Bacteria 2668
746 Ga0495659_0013500 3300046664 Bacteria 2661
747 Ga0495661_0066763 3300046665 Bacteria 2116
748 Ga0495588_0001695 3300046674 Bacteria 9374
749 Ga0495588_0040655 3300046674 Bacteria 2373
750 Ga0495588_0126037 3300046674 Bacteria 1350
751 Ga0495657_0003184 3300046675 Bacteria 13516
752 Ga0495657_0034766 3300046675 Bacteria 3498
753 Ga0495599_0000806 3300046678 Bacteria 17617
754 Ga0495599_0009828 3300046678 Bacteria 5855
755 Ga0495599_0038287 3300046678 Bacteria 3013
756 Ga0495623_0008437 3300046679 Bacteria 6694
757 Ga0495647_0000638 3300046681 Bacteria 10362
758 Ga0495647_0006505 3300046681 Bacteria 3874
759 Ga0495647_0007166 3300046681 Bacteria 3726
760 Ga0495658_0001615 3300046683 Bacteria 11744
761 Ga0495658_0002133 3300046683 Bacteria 10012
762 Ga0495658_0044890 3300046683 Bacteria 2477
763 Ga0495658_0107390 3300046683 Bacteria 1674
764 Ga0495669_0027321 3300046684 Bacteria 2497
765 Ga0495613_0013924 3300046689 Bacteria 5968
766 Ga0495613_0051009 3300046689 Bacteria 3050
767 Ga0495613_0064833 3300046689 Bacteria 2670
768 Ga0495613_0396753 3300046689 Bacteria 941
769 Ga0495624_0001411 3300046690 Bacteria 18734
770 Ga0495624_0002021 3300046690 Bacteria 15445
771 Ga0495624_0031367 3300046690 Bacteria 3456
772 Ga0495624_0117183 3300046690 Bacteria 1636
773 Ga0495670_0004377 3300046691 Bacteria 6924
774 Ga0495649_0035904 3300046694 Bacteria 2725
775 Ga0495600_0000208 3300046809 Bacteria 33755
776 Ga0495600_0009879 3300046809 Bacteria 5907
777 Ga0495600_0066443 3300046809 Bacteria 2357
778 Ga0495600_0089176 3300046809 Bacteria 2012
779 Ga0495581_0000503 3300047315 Bacteria 19983
780 Ga0495581_0005790 3300047315 Bacteria 7163
781 Ga0495604_0001423 3300047317 Bacteria 19641
782 Ga0495674_0009848 3300047319 Bacteria 9072
783 Ga0495674_0016553 3300047319 Bacteria 6882
784 Ga0495674_0053424 3300047319 Bacteria 3551
785 Ga0495676_0011575 3300047321 Bacteria 7958
786 Ga0495676_0024072 3300047321 Bacteria 5276
787 Ga0495676_0036100 3300047321 Bacteria 4130
788 Ga0495676_0080628 3300047321 Bacteria 2470
789 Ga0495680_0001491 3300047322 Bacteria 25179
790 Ga0495680_0002844 3300047322 Bacteria 17397
791 Ga0495680_0029147 3300047322 Bacteria 4522
792 Ga0495675_0020212 3300047444 Bacteria 4233
793 Ga0495675_0176444 3300047444 Bacteria 1310
794 Ga0495684_0009241 3300047471 Bacteria 7612
795 Ga0495684_0064370 3300047471 Bacteria 2786
796 Ga0495684_0149264 3300047471 Bacteria 1748
797 Ga0495593_0000372 3300047673 Bacteria 24728
798 Ga0495593_0010385 3300047673 Bacteria 5383
799 Ga0495593_0054779 3300047673 Bacteria 2101
800 Ga0495593_0055548 3300047673 Bacteria 2083
801 Ga0495593_0064268 3300047673 Bacteria 1916
802 Ga0495602_0010688 3300048088 Bacteria 9521
803 Ga0495602_0083964 3300048088 Bacteria 2665
804 Ga0495614_0007981 3300048089 Bacteria 4705
805 Ga0495614_0037583 3300048089 Bacteria 2077
806 Ga0496100_0000203 3300048903 Bacteria 32744
807 Ga0496100_0005697 3300048903 Bacteria 6737
808 Ga0496101_0002812 3300048904 Bacteria 10691
809 Ga0496101_0228873 3300048904 Bacteria 1444
810 Ga0496101_0228883 3300048904 Bacteria 1444
811 Ga0496102_0107498 3300048905 Bacteria 2597
812 Ga0496102_0131082 3300048905 Bacteria 2346
813 Ga0496102_0684154 3300048905 Bacteria 949
814 Ga0496103_0001529 3300048906 Bacteria 15450
815 Ga0496103_0011847 3300048906 Bacteria 5174
816 Ga0496103_0044221 3300048906 Bacteria 2743
817 Ga0496103_0073333 3300048906 Bacteria 2144
818 Ga0496103_0147742 3300048906 Bacteria 1505
819 Ga0496104_0001608 3300048907 Bacteria 19461
820 Ga0496104_0016648 3300048907 Bacteria 6682
821 Ga0496104_0451451 3300048907 Bacteria 1197
822 Ga0496105_0006281 3300048908 Bacteria 9125
823 Ga0496105_0103975 3300048908 Bacteria 2345
824 Ga0496105_0128391 3300048908 Bacteria 2090
825 Ga0496105_0184888 3300048908 Bacteria 1705
826 Ga0496105_0321252 3300048908 Bacteria 1241
827 Ga0496106_0006066 3300048909 Bacteria 8944
828 Ga0496106_0042498 3300048909 Bacteria 3409
829 Ga0496106_0053524 3300048909 Bacteria 3048
830 Ga0496106_0080438 3300048909 Bacteria 2502
831 Ga0496107_0003174 3300048910 Bacteria 10928
832 Ga0496107_0031467 3300048910 Bacteria 3787
833 Ga0496107_0053179 3300048910 Bacteria 2921
834 Ga0496107_0193468 3300048910 Bacteria 1511
835 Ga0496107_0221521 3300048910 Bacteria 1407
836 Ga0496107_0337107 3300048910 Bacteria 1122
837 Ga0496108_0006052 3300048911 Bacteria 9791
838 Ga0496108_0038993 3300048911 Bacteria 3960
839 Ga0496108_0043035 3300048911 Bacteria 3771
840 Ga0496108_0103805 3300048911 Bacteria 2425
841 Ga0496108_0113621 3300048911 Bacteria 2317
842 Ga0496108_0212236 3300048911 Bacteria 1681
843 Ga0496109_0006654 3300048912 Bacteria 9730
844 Ga0496109_0008201 3300048912 Bacteria 8863
845 Ga0496109_0013562 3300048912 Bacteria 7076
846 Ga0496109_0030701 3300048912 Bacteria 4817
847 Ga0496109_0076567 3300048912 Bacteria 3077
848 Ga0496109_0179219 3300048912 Bacteria 1990
849 Ga0496110_0025973 3300048913 Bacteria 5007
850 Ga0496110_0026118 3300048913 Bacteria 4994
851 Ga0496110_0046934 3300048913 Bacteria 3780
852 Ga0496110_0114351 3300048913 Bacteria 2428
853 Ga0496110_0269457 3300048913 Bacteria 1550
854 Ga0496111_0005390 3300048914 Bacteria 8187
855 Ga0496111_0033297 3300048914 Bacteria 3675
856 Ga0496111_0040973 3300048914 Bacteria 3322
857 Ga0496111_0041513 3300048914 Bacteria 3301
858 Ga0496111_0080316 3300048914 Bacteria 2379
859 Ga0496112_0000004 3300048915 Bacteria 553294
860 Ga0496112_0023658 3300048915 Bacteria 5874
861 Ga0496112_0028755 3300048915 Bacteria 5369
862 Ga0496112_0043941 3300048915 Bacteria 4375
863 Ga0496112_0098122 3300048915 Bacteria 2899
864 Ga0496112_0127710 3300048915 Bacteria 2513
865 Ga0496112_0148010 3300048915 Bacteria 2316
866 Ga0496112_0172581 3300048915 Bacteria 2127
867 Ga0496112_0220185 3300048915 Bacteria 1854
868 Ga0496113_0002762 3300048916 Bacteria 10321
869 Ga0496113_0006342 3300048916 Bacteria 7482
870 Ga0496113_0100320 3300048916 Bacteria 2243
871 Ga0496113_0188936 3300048916 Bacteria 1635
872 Ga0496113_0284106 3300048916 Bacteria 1323
873 Ga0496114_0005021 3300048917 Bacteria 10319
874 Ga0496114_0112639 3300048917 Bacteria 2332
875 Ga0496115_0027336 3300048918 Bacteria 4460
876 Ga0496115_0035893 3300048918 Bacteria 3924
877 Ga0496115_0082053 3300048918 Bacteria 2626
878 Ga0496115_0117908 3300048918 Bacteria 2183
879 Ga0496115_0393293 3300048918 Bacteria 1125
880 Ga0496117_0032569 3300048920 Bacteria 3958
881 Ga0496118_0097639 3300048921 Bacteria 1998
882 Ga0496119_0003438 3300048922 Bacteria 16444
883 Ga0496119_0026329 3300048922 Bacteria 4035
884 Ga0496121_0000458 3300048924 Bacteria 80207
885 Ga0496122_0148270 3300048925 Bacteria 1454
886 Ga0496124_0143143 3300048927 Bacteria 1884
887 Ga0496125_0073574 3300048928 Bacteria 2656
888 Ga0496125_0155943 3300048928 Bacteria 1560
889 Ga0496125_0171824 3300048928 Bacteria 1456
890 Ga0496126_0015313 3300048929 Bacteria 7717
891 Ga0496126_0021658 3300048929 Bacteria 6274
892 Ga0496126_0127629 3300048929 Bacteria 2200
893 Ga0496126_0204102 3300048929 Bacteria 1667
894 Ga0496126_0332205 3300048929 Bacteria 1247
895 Ga0501031_0009952 3300049568 Bacteria 6191
896 Ga0501031_0040419 3300049568 Bacteria 3045
897 Ga0501031_0068246 3300049568 Bacteria 2316
898 Ga0501031_0128196 3300049568 Bacteria 1657
899 Ga0501032_0004443 3300049569 Bacteria 10572
900 Ga0501032_0010442 3300049569 Bacteria 6697
901 Ga0501032_0020767 3300049569 Bacteria 4571
902 Ga0501032_0079846 3300049569 Bacteria 2177
903 Ga0501033_0001387 3300049570 Bacteria 21551
904 Ga0501033_0003747 3300049570 Bacteria 12358
905 Ga0501033_0009064 3300049570 Bacteria 7677
906 Ga0501033_0012028 3300049570 Bacteria 6608
907 Ga0501033_0019522 3300049570 Bacteria 5125
908 Ga0501033_0057808 3300049570 Bacteria 2865
909 Ga0501034_0013177 3300049571 Bacteria 8516
910 Ga0501034_0022766 3300049571 Bacteria 6382
911 Ga0501034_0065325 3300049571 Bacteria 3650
912 Ga0501034_0092593 3300049571 Bacteria 3019
913 Ga0501036_0001303 3300049572 Bacteria 19110
914 Ga0501036_0013017 3300049572 Bacteria 6906
915 Ga0501036_0030450 3300049572 Bacteria 4558
916 Ga0501036_0043307 3300049572 Bacteria 3811
917 Ga0501036_0090229 3300049572 Bacteria 2589
918 Ga0501036_0130597 3300049572 Bacteria 2121
919 Ga0501037_0000328 3300049573 Bacteria 40237
920 Ga0501037_0003605 3300049573 Bacteria 11225
921 Ga0501037_0016589 3300049573 Bacteria 5420
922 Ga0501037_0024107 3300049573 Bacteria 4499
923 Ga0501037_0024368 3300049573 Bacteria 4475
924 Ga0501038_0009112 3300049574 Bacteria 9107
925 Ga0501038_0026430 3300049574 Bacteria 5170
926 Ga0501038_0033611 3300049574 Bacteria 4517
927 Ga0501038_0041501 3300049574 Bacteria 4012
928 Ga0501038_0051184 3300049574 Bacteria 3566
929 Ga0501038_0116784 3300049574 Bacteria 2204
930 Ga0501038_0125102 3300049574 Bacteria 2117
931 Ga0501038_0274756 3300049574 Bacteria 1328
932 Ga0501039_0164667 3300049575 Bacteria 1743
933 Ga0501041_0067417 3300049577 Bacteria 2194
934 Ga0501042_0026243 3300049578 Bacteria 4095
935 Ga0501042_0201419 3300049578 Bacteria 1435
936 Ga0501042_0316559 3300049578 Bacteria 1127
937 Ga0501043_0000377 3300049579 Bacteria 40484
938 Ga0501043_0014338 3300049579 Bacteria 6203
939 Ga0501043_0019625 3300049579 Bacteria 5306
940 Ga0501043_0031985 3300049579 Bacteria 4135
941 Ga0501043_0296519 3300049579 Bacteria 1237
942 Ga0501046_0003241 3300049580 Bacteria 14957
943 Ga0501046_0016244 3300049580 Bacteria 6241
944 Ga0501046_0026473 3300049580 Bacteria 4738
945 Ga0501046_0058330 3300049580 Bacteria 3026
946 Ga0501047_0030661 3300049581 Bacteria 5183
947 Ga0501047_0040563 3300049581 Bacteria 4502
948 Ga0501047_0044503 3300049581 Bacteria 4289
949 Ga0501047_0064418 3300049581 Bacteria 3535
950 Ga0501047_0068132 3300049581 Bacteria 3428
951 Ga0501047_0145285 3300049581 Bacteria 2249
952 Ga0501047_0185442 3300049581 Bacteria 1946
953 Ga0501048_0004184 3300049582 Bacteria 11002
954 Ga0501048_0017935 3300049582 Bacteria 5208
955 Ga0501048_0268106 3300049582 Bacteria 1213
956 Ga0501067_0010554 3300049583 Bacteria 5114
957 Ga0501067_0017640 3300049583 Bacteria 3951
958 Ga0501067_0031337 3300049583 Bacteria 2950
959 Ga0501068_0002507 3300049584 Bacteria 9752
960 Ga0501068_0042908 3300049584 Bacteria 2720
961 Ga0501068_0164250 3300049584 Bacteria 1400
962 Ga0501068_0211376 3300049584 Bacteria 1232
963 Ga0501069_0000100 3300049585 Bacteria 40506
964 Ga0501069_0003145 3300049585 Bacteria 8461
965 Ga0501069_0016117 3300049585 Bacteria 4009
966 Ga0501069_0018526 3300049585 Bacteria 3758
967 Ga0501070_0000229 3300049586 Bacteria 52795
968 Ga0501070_0000714 3300049586 Bacteria 30358
969 Ga0501070_0001806 3300049586 Bacteria 18882
970 Ga0501070_0003195 3300049586 Bacteria 14252
971 Ga0501070_0006026 3300049586 Bacteria 10326
972 Ga0501070_0170533 3300049586 Bacteria 1792
973 Ga0501070_0172101 3300049586 Bacteria 1783
974 Ga0501071_0013118 3300049587 Bacteria 5640
975 Ga0501071_0017405 3300049587 Bacteria 4955
976 Ga0501071_0032588 3300049587 Bacteria 3701
977 Ga0501072_0075492 3300049588 Bacteria 2666
978 Ga0501073_0006658 3300049589 Bacteria 8605
979 Ga0501073_0009289 3300049589 Bacteria 7253
980 Ga0501073_0015968 3300049589 Bacteria 5442
981 Ga0501073_0017729 3300049589 Bacteria 5154
982 Ga0501073_0027212 3300049589 Bacteria 4092
983 Ga0501073_0027631 3300049589 Bacteria 4057
984 Ga0501073_0068983 3300049589 Bacteria 2464
985 Ga0501074_0000113 3300049590 Bacteria 40297
986 Ga0501074_0004959 3300049590 Bacteria 9538
987 Ga0501074_0020303 3300049590 Bacteria 4828
988 Ga0501074_0023766 3300049590 Bacteria 4455
989 Ga0501074_0208311 3300049590 Bacteria 1393
990 Ga0501076_0053637 3300049592 Bacteria 3195
991 Ga0501076_0264551 3300049592 Bacteria 1408
992 Ga0501079_0018785 3300049741 Bacteria 5281
993 Ga0501079_0074734 3300049741 Bacteria 2620
994 Ga0501079_0137031 3300049741 Bacteria 1906
995 Ga0501079_0211695 3300049741 Bacteria 1514
996 Ga0501080_0007250 3300049742 Bacteria 10004
997 Ga0501080_0014802 3300049742 Bacteria 7183
998 Ga0501080_0021648 3300049742 Bacteria 5953
999 Ga0501080_0033198 3300049742 Bacteria 4817
1000 Ga0501080_0047654 3300049742 Bacteria 3990
1001 Ga0501080_0065528 3300049742 Bacteria 3378
1002 Ga0501080_0190205 3300049742 Bacteria 1886
1003 Ga0501080_0292969 3300049742 Bacteria 1477
1004 Ga0501080_0361578 3300049742 Bacteria 1309
1005 Ga0501081_0162792 3300049743 Bacteria 1608
1006 Ga0501081_0244361 3300049743 Bacteria 1309
1007 Ga0501081_0380641 3300049743 Bacteria 1043
1008 Ga0501083_0000529 3300049744 Bacteria 24371
1009 Ga0501083_0036835 3300049744 Bacteria 3334
1010 Ga0501083_0066225 3300049744 Bacteria 2406
1011 Ga0501083_0091983 3300049744 Bacteria 2002
1012 Ga0501035_0000373 3300049822 Bacteria 51518
1013 Ga0501035_0000580 3300049822 Bacteria 40294
1014 Ga0501035_0003027 3300049822 Bacteria 16113
1015 Ga0501035_0010765 3300049822 Bacteria 8469
1016 Ga0501035_0034886 3300049822 Bacteria 4569
1017 Ga0501035_0307857 3300049822 Bacteria 1333
1018 Ga0501044_0000494 3300049823 Bacteria 47857
1019 Ga0501044_0012523 3300049823 Bacteria 9186
1020 Ga0501044_0013031 3300049823 Bacteria 8998
1021 Ga0501044_0024835 3300049823 Bacteria 6357
1022 Ga0501044_0031713 3300049823 Bacteria 5559
1023 Ga0501044_0032277 3300049823 Bacteria 5506
1024 Ga0501044_0034815 3300049823 Bacteria 5279
1025 Ga0501044_0125363 3300049823 Bacteria 2566
1026 nmdc:mga00v17_8336_c1 3300050491 Bacteria 5576
1027 nmdc:mga0yw44_28739_c1 3300050492 Bacteria 3203
1028 nmdc:mga0yw44_40792_c1 3300050492 Bacteria 2760
1029 nmdc:mga0k408_71829_c1 3300050493 Bacteria 2020
1030 nmdc:mga05p37_30291_c1 3300050507 Bacteria 6602
1031 nmdc:mga05p37_32_c1 3300050507 Bacteria 112982
1032 nmdc:mga09592_6535_c1 3300050508 Bacteria 9497
1033 nmdc:mga0qj67_355_c1 3300050509 Bacteria 31660
1034 nmdc:mga06r32_5297_c1 3300050510 Bacteria 11609
1035 nmdc:mga08y16_175108_c1 3300050511 Bacteria 2228
1036 nmdc:mga08y16_2238_c1 3300050511 Bacteria 19836
1037 nmdc:mga08y16_6098_c1 3300050511 Bacteria 12643
1038 nmdc:mga0n895_101316_c1 3300050512 Bacteria 2890
1039 nmdc:mga0n895_40463_c1 3300050512 Bacteria 4527
1040 nmdc:mga0n895_442378_c1 3300050512 Bacteria 1313
1041 nmdc:mga0n895_452920_c1 3300050512 Bacteria 1295
1042 nmdc:mga0n895_547_c1 3300050512 Bacteria 25755
1043 nmdc:mga0n895_67573_c1 3300050512 Bacteria 3540
1044 nmdc:mga0n895_8451_c1 3300050512 Bacteria 8914
1045 nmdc:mga0rr50_2161_c1 3300050513 Bacteria 10994
1046 nmdc:mga0rr50_237205_c1 3300050513 Bacteria 1511
1047 nmdc:mga0rr50_24109_c1 3300050513 Bacteria 4209
1048 nmdc:mga0rr50_51016_c1 3300050513 Bacteria 3068
1049 nmdc:mga08x19_143264_c1 3300050514 Bacteria 1615
1050 nmdc:mga08x19_6_c1 3300050514 Bacteria 405679
1051 nmdc:mga08x19_91285_c1 3300050514 Bacteria 2010
1052 nmdc:mga0a205_19845_c1 3300050515 Bacteria 6342
1053 nmdc:mga0a205_278960_c1 3300050515 Bacteria 1547
1054 nmdc:mga0a205_629_c1 3300050515 Bacteria 28029
1055 Ga0495601_0004297 3300053077 Bacteria 8228
1056 Ga0495601_0004847 3300053077 Bacteria 7804
1057 Ga0495601_0005893 3300053077 Bacteria 7146
1058 Ga0495601_0007409 3300053077 Bacteria 6430
1059 Ga0495601_0008232 3300053077 Bacteria 6151
1060 Ga0495612_0005828 3300053078 Bacteria 5088
1061 Ga0500635_0000553 3300053080 Bacteria 9959
1062 Ga0495595_0002810 3300053084 Bacteria 6850
1063 Ga0495595_0003138 3300053084 Bacteria 6551
1064 Ga0495595_0003361 3300053084 Bacteria 6352
1065 Ga0495595_0004354 3300053084 Bacteria 5697
1066 Ga0495595_0046712 3300053084 Bacteria 1996
1067 Ga0495619_0000016 3300053085 Bacteria 231442
1068 Ga0495619_0002830 3300053085 Bacteria 11300
1069 Ga0495619_0006052 3300053085 Bacteria 7664
1070 Ga0495619_0010377 3300053085 Bacteria 5863
1071 Ga0495619_0030196 3300053085 Bacteria 3507
1072 Ga0495619_0045414 3300053085 Bacteria 2886
1073 Ga0495619_0138516 3300053085 Bacteria 1674
1074 Ga0495619_0149951 3300053085 Bacteria 1608
1075 Ga0500566_0131967 3300053094 Bacteria 1335
1076 Ga0500640_024696 3300053095 Bacteria 2612
1077 Ga0500595_023055 3300053119 Bacteria 2192
1078 Ga0500607_067427 3300053121 Bacteria 1854
1079 Ga0500652_096804 3300053131 Bacteria 1233
1080 Ga0500568_0000682 3300053139 Bacteria 24448
1081 Ga0500568_0008676 3300053139 Bacteria 4878
1082 Ga0500568_0073721 3300053139 Bacteria 1303
1083 Ga0500603_001483 3300053150 Bacteria 5353
1084 Ga0500604_0019357 3300053151 Bacteria 1906
1085 Ga0500637_0099587 3300053178 Bacteria 1685
1086 Ga0500609_000759 3300053731 Bacteria 4841
1087 Ga0500609_013616 3300053731 Bacteria 1101
1088 Ga0501084_0013177 3300054114 Bacteria 6840
1089 Ga0501082_0005362 3300060353 Bacteria 11126
1090 Ga0501082_0009755 3300060353 Bacteria 8272
1091 Ga0501082_0023892 3300060353 Bacteria 5270
1092 Ga0501082_0094555 3300060353 Bacteria 2583
1093 Ga0501082_0229824 3300060353 Bacteria 1614
1094 Ga0501082_0302275 3300060353 Bacteria 1393
1095 Ga0466962_0015456 3300061719 Bacteria 3679
1096 Ga0530510_0297590 3300061734 Bacteria 1207

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005985 Ga0081539_10046544 Ga0081539_100465443 277
2 3300005530 Ga0070679_100010765 Ga0070679_1000107654 280
3 3300013104 Ga0157370_10589985 Ga0157370_105899851 282
4 3300025912 Ga0207707_10001610 Ga0207707_100016105 282
5 3300046471 Ga0495650_0042756 Ga0495650_0042756_1047_1913 285
6 3300035410 Ga0373924_0037312 Ga0373924_0037312_1102_1962 286
7 3300046529 Ga0495652_0371961 Ga0495652_0371961_86_973 287
8 3300049575 Ga0501039_0164667 Ga0501039_0164667_20_883 287
9 3300060353 Ga0501082_0302275 Ga0501082_0302275_18_881 287
10 3300048905 Ga0496102_0684154 Ga0496102_0684154_17_931 289
11 3300046689 Ga0495613_0396753 Ga0495613_0396753_47_928 290
12 3300009147 Ga0114129_10482426 Ga0114129_104824262 294
13 3300009545 Ga0105237_10087884 Ga0105237_100878842 299
14 3300048929 Ga0496126_0332205 Ga0496126_0332205_23_931 300
15 3300005535 Ga0070684_100178396 Ga0070684_1001783962 303
16 3300009093 Ga0105240_10003526 Ga0105240_1000352615 303
17 3300025917 Ga0207660_10389475 Ga0207660_103894751 303
18 3300005336 Ga0070680_100027252 Ga0070680_1000272525 305
19 3300025913 Ga0207695_10152593 Ga0207695_101525931 305
20 3300025917 Ga0207660_10103776 Ga0207660_101037762 305
21 3300046516 Ga0495628_0385534 Ga0495628_0385534_84_1010 305
22 3300061719 Ga0466962_0015456 Ga0466962_0015456_2732_3658 305
23 3300005337 Ga0070682_100065437 Ga0070682_1000654371 306
24 3300005339 Ga0070660_100091470 Ga0070660_1000914702 306
25 3300005458 Ga0070681_10002988 Ga0070681_100029886 306
26 3300005468 Ga0070707_100004536 Ga0070707_10000453614 306
27 3300005530 Ga0070679_100001814 Ga0070679_10000181416 306
28 3300005563 Ga0068855_100002138 Ga0068855_10000213821 306
29 3300005578 Ga0068854_100089710 Ga0068854_1000897102 306
30 3300009093 Ga0105240_10000411 Ga0105240_1000041113 306
31 3300009551 Ga0105238_10002477 Ga0105238_1000247713 306
32 3300013104 Ga0157370_10003496 Ga0157370_1000349614 306
33 3300013105 Ga0157369_10004403 Ga0157369_1000440312 306
34 3300025910 Ga0207684_10064509 Ga0207684_100645093 306
35 3300025912 Ga0207707_10000119 Ga0207707_1000011913 306
36 3300025913 Ga0207695_10004562 Ga0207695_1000456215 306
37 3300025917 Ga0207660_10004090 Ga0207660_100040907 306
38 3300025919 Ga0207657_10094095 Ga0207657_100940952 306
39 3300025921 Ga0207652_10000515 Ga0207652_100005156 306
40 3300025922 Ga0207646_10011053 Ga0207646_100110539 306
41 3300025949 Ga0207667_10001570 Ga0207667_1000157021 306
42 3300026078 Ga0207702_10060712 Ga0207702_100607123 306
43 3300037068 Ga0373925_0010358 Ga0373925_0010358_1013_1987 307
44 3300005937 Ga0081455_10000059 Ga0081455_1000005934 308
45 3300001989 JGI24739J22299_10001890 JGI24739J22299_100018903 309
46 3300001990 JGI24737J22298_10000207 JGI24737J22298_1000020716 309
47 3300002070 JGI24750J21931_1001369 JGI24750J21931_10013693 309
48 3300002073 JGI24745J21846_1001822 JGI24745J21846_10018223 309
49 3300002074 JGI24748J21848_1000218 JGI24748J21848_10002185 309
50 3300002075 JGI24738J21930_10000029 JGI24738J21930_100000295 309
51 3300002076 JGI24749J21850_1001190 JGI24749J21850_10011904 309
52 3300002077 JGI24744J21845_10001741 JGI24744J21845_100017412 309
53 3300002244 JGI24742J22300_10002072 JGI24742J22300_100020723 309
54 3300005293 Ga0065715_10104947 Ga0065715_101049473 309
55 3300005328 Ga0070676_10001460 Ga0070676_100014607 309
56 3300005329 Ga0070683_100100186 Ga0070683_1001001863 309
57 3300005330 Ga0070690_100021035 Ga0070690_1000210353 309
58 3300005331 Ga0070670_100054629 Ga0070670_1000546292 309
59 3300005333 Ga0070677_10000429 Ga0070677_100004297 309
60 3300005334 Ga0068869_100000687 Ga0068869_1000006873 309
61 3300005336 Ga0070680_100077923 Ga0070680_1000779233 309
62 3300005337 Ga0070682_100000995 Ga0070682_1000009953 309
63 3300005338 Ga0068868_100058156 Ga0068868_1000581562 309
64 3300005339 Ga0070660_100006096 Ga0070660_1000060968 309
65 3300005340 Ga0070689_100016831 Ga0070689_1000168313 309
66 3300005341 Ga0070691_10001450 Ga0070691_100014508 309
67 3300005343 Ga0070687_100025480 Ga0070687_1000254803 309
68 3300005344 Ga0070661_100075460 Ga0070661_1000754603 309
69 3300005345 Ga0070692_10001330 Ga0070692_100013303 309
70 3300005347 Ga0070668_100052491 Ga0070668_1000524912 309
71 3300005353 Ga0070669_100032918 Ga0070669_1000329183 309
72 3300005354 Ga0070675_100000240 Ga0070675_10000024022 309
73 3300005355 Ga0070671_100027986 Ga0070671_1000279866 309
74 3300005356 Ga0070674_100002264 Ga0070674_1000022649 309
75 3300005364 Ga0070673_100019462 Ga0070673_1000194621 309
76 3300005365 Ga0070688_100041792 Ga0070688_1000417922 309
77 3300005366 Ga0070659_100009275 Ga0070659_1000092754 309
78 3300005367 Ga0070667_100015593 Ga0070667_1000155933 309
79 3300005438 Ga0070701_10000039 Ga0070701_100000393 309
80 3300005440 Ga0070705_100000768 Ga0070705_10000076814 309
81 3300005441 Ga0070700_100000735 Ga0070700_1000007352 309
82 3300005444 Ga0070694_100005074 Ga0070694_1000050743 309
83 3300005445 Ga0070708_100011083 Ga0070708_1000110838 309
84 3300005455 Ga0070663_100065616 Ga0070663_1000656162 309
85 3300005456 Ga0070678_100000998 Ga0070678_1000009988 309
86 3300005458 Ga0070681_10143822 Ga0070681_101438222 309
87 3300005459 Ga0068867_100008309 Ga0068867_1000083097 309
88 3300005466 Ga0070685_10016125 Ga0070685_100161253 309
89 3300005530 Ga0070679_100016730 Ga0070679_1000167304 309
90 3300005535 Ga0070684_100006735 Ga0070684_1000067353 309
91 3300005536 Ga0070697_100038587 Ga0070697_1000385872 309
92 3300005539 Ga0068853_100000437 Ga0068853_10000043726 309
93 3300005543 Ga0070672_100001847 Ga0070672_1000018472 309
94 3300005544 Ga0070686_100019694 Ga0070686_1000196943 309
95 3300005545 Ga0070695_100003423 Ga0070695_1000034233 309
96 3300005546 Ga0070696_100072002 Ga0070696_1000720021 309
97 3300005547 Ga0070693_100003347 Ga0070693_1000033472 309
98 3300005549 Ga0070704_100201039 Ga0070704_1002010392 309
99 3300005563 Ga0068855_100023725 Ga0068855_1000237257 309
100 3300005563 Ga0068855_100046002 Ga0068855_1000460022 309
101 3300005564 Ga0070664_100001002 Ga0070664_10000100216 309
102 3300005577 Ga0068857_100008801 Ga0068857_1000088017 309
103 3300005578 Ga0068854_100001976 Ga0068854_10000197611 309
104 3300005614 Ga0068856_100005280 Ga0068856_10000528011 309
105 3300005615 Ga0070702_100002858 Ga0070702_1000028583 309
106 3300005617 Ga0068859_100018024 Ga0068859_1000180246 309
107 3300005618 Ga0068864_100006180 Ga0068864_1000061809 309
108 3300005718 Ga0068866_10011870 Ga0068866_100118704 309
109 3300005719 Ga0068861_100000248 Ga0068861_1000002483 309
110 3300005840 Ga0068870_10000157 Ga0068870_1000015713 309
111 3300005841 Ga0068863_100000674 Ga0068863_1000006748 309
112 3300005842 Ga0068858_100072251 Ga0068858_1000722512 309
113 3300005843 Ga0068860_100011546 Ga0068860_1000115463 309
114 3300006237 Ga0097621_100001613 Ga0097621_1000016139 309
115 3300006358 Ga0068871_100001066 Ga0068871_10000106612 309
116 3300006852 Ga0075433_10006220 Ga0075433_100062207 309
117 3300006871 Ga0075434_100027125 Ga0075434_1000271253 309
118 3300006881 Ga0068865_100000131 Ga0068865_10000013114 309
119 3300006931 Ga0097620_100018022 Ga0097620_1000180223 309
120 3300009036 Ga0105244_10017643 Ga0105244_100176434 309
121 3300009093 Ga0105240_10011914 Ga0105240_100119143 309
122 3300009093 Ga0105240_10191619 Ga0105240_101916193 309
123 3300009094 Ga0111539_10005247 Ga0111539_100052473 309
124 3300009098 Ga0105245_10003161 Ga0105245_1000316111 309
125 3300009101 Ga0105247_10005112 Ga0105247_100051127 309
126 3300009148 Ga0105243_10073860 Ga0105243_100738602 309
127 3300009174 Ga0105241_10069318 Ga0105241_100693183 309
128 3300009176 Ga0105242_10021762 Ga0105242_100217622 309
129 3300009177 Ga0105248_10103407 Ga0105248_101034072 309
130 3300009545 Ga0105237_10016490 Ga0105237_100164902 309
131 3300009551 Ga0105238_10058977 Ga0105238_100589772 309
132 3300009551 Ga0105238_10257445 Ga0105238_102574451 309
133 3300009553 Ga0105249_10005299 Ga0105249_100052993 309
134 3300011119 Ga0105246_10002665 Ga0105246_100026653 309
135 3300013102 Ga0157371_10057880 Ga0157371_100578803 309
136 3300013104 Ga0157370_10065204 Ga0157370_100652042 309
137 3300013296 Ga0157374_10000671 Ga0157374_1000067115 309
138 3300013297 Ga0157378_10126975 Ga0157378_101269752 309
139 3300013306 Ga0163162_10003419 Ga0163162_1000341913 309
140 3300013307 Ga0157372_10105543 Ga0157372_101055433 309
141 3300013308 Ga0157375_10009189 Ga0157375_100091893 309
142 3300014325 Ga0163163_10004312 Ga0163163_100043122 309
143 3300014326 Ga0157380_10000678 Ga0157380_100006786 309
144 3300014745 Ga0157377_10000570 Ga0157377_100005706 309
145 3300014968 Ga0157379_10000345 Ga0157379_1000034523 309
146 3300014969 Ga0157376_10003644 Ga0157376_100036449 309
147 3300017792 Ga0163161_10004669 Ga0163161_1000466910 309
148 3300025271 Ga0207666_1000069 Ga0207666_10000698 309
149 3300025290 Ga0207673_1000145 Ga0207673_10001457 309
150 3300025315 Ga0207697_10019122 Ga0207697_100191223 309
151 3300025893 Ga0207682_10000048 Ga0207682_1000004814 309
152 3300025899 Ga0207642_10000783 Ga0207642_1000078310 309
153 3300025901 Ga0207688_10001496 Ga0207688_1000149614 309
154 3300025904 Ga0207647_10008534 Ga0207647_100085348 309
155 3300025907 Ga0207645_10003506 Ga0207645_100035067 309
156 3300025908 Ga0207643_10001399 Ga0207643_100013993 309
157 3300025911 Ga0207654_10003198 Ga0207654_100031987 309
158 3300025912 Ga0207707_10018809 Ga0207707_100188094 309
159 3300025912 Ga0207707_10020384 Ga0207707_100203842 309
160 3300025913 Ga0207695_10064793 Ga0207695_100647932 309
161 3300025913 Ga0207695_10144499 Ga0207695_101444992 309
162 3300025914 Ga0207671_10115222 Ga0207671_101152222 309
163 3300025917 Ga0207660_10000104 Ga0207660_100001041 309
164 3300025918 Ga0207662_10003087 Ga0207662_100030877 309
165 3300025919 Ga0207657_10003518 Ga0207657_100035183 309
166 3300025920 Ga0207649_10000141 Ga0207649_1000014122 309
167 3300025921 Ga0207652_10001526 Ga0207652_1000152616 309
168 3300025923 Ga0207681_10000359 Ga0207681_100003598 309
169 3300025924 Ga0207694_10201258 Ga0207694_102012581 309
170 3300025925 Ga0207650_10032317 Ga0207650_100323172 309
171 3300025926 Ga0207659_10000052 Ga0207659_1000005240 309
172 3300025927 Ga0207687_10000097 Ga0207687_1000009735 309
173 3300025931 Ga0207644_10002956 Ga0207644_100029562 309
174 3300025932 Ga0207690_10000278 Ga0207690_1000027827 309
175 3300025933 Ga0207706_10083323 Ga0207706_100833232 309
176 3300025934 Ga0207686_10000850 Ga0207686_100008507 309
177 3300025935 Ga0207709_10000349 Ga0207709_1000034910 309
178 3300025936 Ga0207670_10000781 Ga0207670_100007812 309
179 3300025937 Ga0207669_10000168 Ga0207669_1000016818 309
180 3300025938 Ga0207704_10000704 Ga0207704_1000070414 309
181 3300025940 Ga0207691_10003348 Ga0207691_100033486 309
182 3300025941 Ga0207711_10003359 Ga0207711_100033592 309
183 3300025942 Ga0207689_10005416 Ga0207689_1000541610 309
184 3300025944 Ga0207661_10000143 Ga0207661_1000014322 309
185 3300025945 Ga0207679_10000035 Ga0207679_1000003516 309
186 3300025949 Ga0207667_10046224 Ga0207667_100462243 309
187 3300025949 Ga0207667_10049164 Ga0207667_100491642 309
188 3300025960 Ga0207651_10000080 Ga0207651_1000008041 309
189 3300025961 Ga0207712_10001127 Ga0207712_1000112717 309
190 3300025972 Ga0207668_10005342 Ga0207668_100053422 309
191 3300025981 Ga0207640_10001402 Ga0207640_100014028 309
192 3300025986 Ga0207658_10032065 Ga0207658_100320651 309
193 3300026023 Ga0207677_10000614 Ga0207677_1000061415 309
194 3300026035 Ga0207703_10151412 Ga0207703_101514122 309
195 3300026041 Ga0207639_10021338 Ga0207639_100213385 309
196 3300026067 Ga0207678_10082730 Ga0207678_100827303 309
197 3300026075 Ga0207708_10001353 Ga0207708_100013533 309
198 3300026078 Ga0207702_10001956 Ga0207702_1000195611 309
199 3300026088 Ga0207641_10084479 Ga0207641_100844792 309
200 3300026089 Ga0207648_10013365 Ga0207648_100133652 309
201 3300026095 Ga0207676_10001840 Ga0207676_100018409 309
202 3300026116 Ga0207674_10008438 Ga0207674_100084383 309
203 3300026118 Ga0207675_100002948 Ga0207675_1000029483 309
204 3300026121 Ga0207683_10002096 Ga0207683_1000209614 309
205 3300026142 Ga0207698_10008006 Ga0207698_100080064 309
206 3300027717 Ga0209998_10031253 Ga0209998_100312532 309
207 3300027876 Ga0209974_10008734 Ga0209974_100087342 309
208 3300027907 Ga0207428_10000428 Ga0207428_1000042835 309
209 3300028379 Ga0268266_10111657 Ga0268266_101116572 309
210 3300028380 Ga0268265_10003048 Ga0268265_1000304810 309
211 3300028381 Ga0268264_10001145 Ga0268264_1000114514 309
212 3300034816 Ga0373930_0015819 Ga0373930_0015819_84_1061 309
213 3300034818 Ga0373950_0011583 Ga0373950_0011583_271_1248 309
214 3300034819 Ga0373958_0002203 Ga0373958_0002203_346_1323 309
215 3300034820 Ga0373959_0001509 Ga0373959_0001509_2457_3434 309
216 3300035084 Ga0373928_0002041 Ga0373928_0002041_2763_3740 309
217 3300035085 Ga0373929_0003253 Ga0373929_0003253_343_1320 309
218 3300035090 Ga0373949_0003453 Ga0373949_0003453_1526_2503 309
219 3300035092 Ga0373952_0000884 Ga0373952_0000884_2915_3892 309
220 3300035112 Ga0373932_0003822 Ga0373932_0003822_1030_2007 309
221 3300035114 Ga0373939_0000356 Ga0373939_0000356_9711_10688 309
222 3300035115 Ga0373941_0000424 Ga0373941_0000424_5965_6942 309
223 3300035242 Ga0373962_0000376 Ga0373962_0000376_1690_2667 309
224 3300035691 Ga0373931_0000409 Ga0373931_0000409_1191_2168 309
225 3300048903 Ga0496100_0000203 Ga0496100_0000203_470_1447 309
226 3300048904 Ga0496101_0002812 Ga0496101_0002812_9073_10050 309
227 3300048906 Ga0496103_0001529 Ga0496103_0001529_1407_2384 309
228 3300048910 Ga0496107_0053179 Ga0496107_0053179_1603_2580 309
229 3300048912 Ga0496109_0006654 Ga0496109_0006654_1407_2384 309
230 3300048915 Ga0496112_0148010 Ga0496112_0148010_706_1683 309
231 3300048916 Ga0496113_0002762 Ga0496113_0002762_6040_7017 309
232 3300048917 Ga0496114_0112639 Ga0496114_0112639_930_1907 309
233 3300048918 Ga0496115_0035893 Ga0496115_0035893_1096_2073 309
234 3300049743 Ga0501081_0244361 Ga0501081_0244361_47_1024 309
235 3300050511 nmdc:mga08y16_6098_c1 nmdc:mga08y16_6098_c1_9321_10298 309
236 3300050512 nmdc:mga0n895_8451_c1 nmdc:mga0n895_8451_c1_6969_7946 309
237 3300050513 nmdc:mga0rr50_24109_c1 nmdc:mga0rr50_24109_c1_2764_3741 309
238 3300050515 nmdc:mga0a205_19845_c1 nmdc:mga0a205_19845_c1_569_1546 309
239 iso_pu_bacteria 2508501050 2508729138 309
240 iso_pu_bacteria 2904564687 2904570923 311
241 iso_pu_bacteria 2904571731 2904578123 311
242 iso_pu_bacteria 2928536128 2928543017 311
243 iso_pu_bacteria 8020938398 8020943355 311
244 iso_pu_bacteria 8020953355 8020954546 311
245 3300039438 Ga0436360_1211363 Ga0436360_1211363_2825_3763 312
246 3300048908 Ga0496105_0184888 Ga0496105_0184888_152_1096 313
247 3300048910 Ga0496107_0031467 Ga0496107_0031467_1063_2007 313
248 3300048911 Ga0496108_0212236 Ga0496108_0212236_51_995 313
249 3300048912 Ga0496109_0013562 Ga0496109_0013562_3401_4345 313
250 3300048913 Ga0496110_0026118 Ga0496110_0026118_2564_3508 313
251 3300048914 Ga0496111_0041513 Ga0496111_0041513_1953_2897 313
252 3300048915 Ga0496112_0127710 Ga0496112_0127710_57_1001 313
253 3300049568 Ga0501031_0009952 Ga0501031_0009952_1422_2387 313
254 3300049568 Ga0501031_0128196 Ga0501031_0128196_64_1029 313
255 3300049569 Ga0501032_0004443 Ga0501032_0004443_4278_5243 313
256 3300049569 Ga0501032_0010442 Ga0501032_0010442_982_1947 313
257 3300049569 Ga0501032_0079846 Ga0501032_0079846_655_1620 313
258 3300049570 Ga0501033_0001387 Ga0501033_0001387_17630_18595 313
259 3300049570 Ga0501033_0012028 Ga0501033_0012028_1453_2418 313
260 3300049571 Ga0501034_0065325 Ga0501034_0065325_1361_2326 313
261 3300049572 Ga0501036_0001303 Ga0501036_0001303_16674_17639 313
262 3300049572 Ga0501036_0013017 Ga0501036_0013017_2857_3822 313
263 3300049572 Ga0501036_0043307 Ga0501036_0043307_1766_2731 313
264 3300049573 Ga0501037_0003605 Ga0501037_0003605_4830_5795 313
265 3300049573 Ga0501037_0024368 Ga0501037_0024368_280_1245 313
266 3300049574 Ga0501038_0009112 Ga0501038_0009112_384_1349 313
267 3300049574 Ga0501038_0041501 Ga0501038_0041501_1582_2547 313
268 3300049574 Ga0501038_0051184 Ga0501038_0051184_2097_3062 313
269 3300049578 Ga0501042_0026243 Ga0501042_0026243_1371_2336 313
270 3300049578 Ga0501042_0316559 Ga0501042_0316559_29_994 313
271 3300049579 Ga0501043_0019625 Ga0501043_0019625_2913_3878 313
272 3300049579 Ga0501043_0031985 Ga0501043_0031985_2126_3091 313
273 3300049580 Ga0501046_0003241 Ga0501046_0003241_9793_10758 313
274 3300049580 Ga0501046_0016244 Ga0501046_0016244_3350_4315 313
275 3300049580 Ga0501046_0058330 Ga0501046_0058330_1325_2290 313
276 3300049581 Ga0501047_0044503 Ga0501047_0044503_1823_2788 313
277 3300049581 Ga0501047_0068132 Ga0501047_0068132_2309_3274 313
278 3300049582 Ga0501048_0004184 Ga0501048_0004184_7231_8196 313
279 3300049582 Ga0501048_0017935 Ga0501048_0017935_2518_3483 313
280 3300049583 Ga0501067_0010554 Ga0501067_0010554_1234_2199 313
281 3300049583 Ga0501067_0017640 Ga0501067_0017640_2961_3926 313
282 3300049583 Ga0501067_0031337 Ga0501067_0031337_357_1322 313
283 3300049584 Ga0501068_0002507 Ga0501068_0002507_3705_4670 313
284 3300049585 Ga0501069_0003145 Ga0501069_0003145_2476_3441 313
285 3300049585 Ga0501069_0016117 Ga0501069_0016117_133_1098 313
286 3300049586 Ga0501070_0003195 Ga0501070_0003195_3028_3993 313
287 3300049586 Ga0501070_0170533 Ga0501070_0170533_533_1498 313
288 3300049587 Ga0501071_0032588 Ga0501071_0032588_2394_3359 313
289 3300049589 Ga0501073_0006658 Ga0501073_0006658_3631_4596 313
290 3300049589 Ga0501073_0015968 Ga0501073_0015968_3305_4270 313
291 3300049589 Ga0501073_0027212 Ga0501073_0027212_1361_2326 313
292 3300049590 Ga0501074_0004959 Ga0501074_0004959_6795_7760 313
293 3300049590 Ga0501074_0023766 Ga0501074_0023766_1989_2954 313
294 3300049592 Ga0501076_0053637 Ga0501076_0053637_1452_2417 313
295 3300049741 Ga0501079_0018785 Ga0501079_0018785_2447_3412 313
296 3300049742 Ga0501080_0014802 Ga0501080_0014802_1501_2466 313
297 3300049742 Ga0501080_0065528 Ga0501080_0065528_2009_2974 313
298 3300049742 Ga0501080_0361578 Ga0501080_0361578_285_1250 313
299 3300049744 Ga0501083_0036835 Ga0501083_0036835_590_1555 313
300 3300049744 Ga0501083_0066225 Ga0501083_0066225_1142_2107 313
301 3300049744 Ga0501083_0091983 Ga0501083_0091983_526_1491 313
302 3300049822 Ga0501035_0010765 Ga0501035_0010765_2089_3054 313
303 3300049822 Ga0501035_0034886 Ga0501035_0034886_3303_4268 313
304 3300049823 Ga0501044_0031713 Ga0501044_0031713_2956_3921 313
305 3300054114 Ga0501084_0013177 Ga0501084_0013177_1872_2837 313
306 3300060353 Ga0501082_0005362 Ga0501082_0005362_661_1626 313
307 3300060353 Ga0501082_0023892 Ga0501082_0023892_1325_2290 313
308 3300005981 Ga0081538_10049508 Ga0081538_100495082 314
309 3300006038 Ga0075365_10003405 Ga0075365_100034057 314
310 3300006051 Ga0075364_10009796 Ga0075364_100097964 314
311 3300014326 Ga0157380_10532272 Ga0157380_105322722 314
312 3300035170 Ga0373943_0028976 Ga0373943_0028976_336_1319 314
313 3300035115 Ga0373941_0026859 Ga0373941_0026859_22_975 315
314 3300035724 Ga0373933_0000110 Ga0373933_0000110_13705_14661 315
315 3300039450 Ga0436363_0096027 Ga0436363_0096027_607_1563 315
316 3300048929 Ga0496126_0021658 Ga0496126_0021658_1050_2006 315
317 3300049579 Ga0501043_0296519 Ga0501043_0296519_13_963 315
318 3300049581 Ga0501047_0185442 Ga0501047_0185442_763_1713 315
319 3300049584 Ga0501068_0211376 Ga0501068_0211376_15_965 315
320 3300049586 Ga0501070_0006026 Ga0501070_0006026_8504_9454 315
321 3300049742 Ga0501080_0292969 Ga0501080_0292969_14_964 315
322 3300049823 Ga0501044_0125363 Ga0501044_0125363_700_1650 315
323 3300053085 Ga0495619_0149951 Ga0495619_0149951_11_973 315
324 3300049578 Ga0501042_0201419 Ga0501042_0201419_212_1285 316
325 3300053731 Ga0500609_013616 Ga0500609_013616_102_1064 316
326 3300021377 Ga0213874_10004551 Ga0213874_100045512 317
327 3300028794 Ga0307515_10000600 Ga0307515_1000060049 317
328 3300031456 Ga0307513_10008298 Ga0307513_100082986 317
329 3300048915 Ga0496112_0220185 Ga0496112_0220185_684_1697 317
330 3300049741 Ga0501079_0074734 Ga0501079_0074734_733_1716 317
331 3300003215 JGI25153J46596_10002951 JGI25153J46596_100029513 318
332 3300003771 Ga0055526_1000427 Ga0055526_100042732 318
333 3300003775 Ga0055524_1001121 Ga0055524_100112115 318
334 3300025291 Ga0209675_1000307 Ga0209675_100030729 318
335 3300025295 Ga0209564_1000015 Ga0209564_1000015126 318
336 3300025297 Ga0209758_1000232 Ga0209758_100023239 318
337 3300025299 Ga0209256_1000205 Ga0209256_10002054 318
338 3300003791 Ga0055530_10003423 Ga0055530_100034236 319
339 3300005440 Ga0070705_100102717 Ga0070705_1001027172 319
340 3300013308 Ga0157375_10138520 Ga0157375_101385203 319
341 3300035113 Ga0373936_0019710 Ga0373936_0019710_1572_2555 319
342 3300035116 Ga0373945_0023152 Ga0373945_0023152_214_1197 319
343 3300035171 Ga0373946_0012381 Ga0373946_0012381_1083_2066 319
344 3300035692 Ga0373935_0000382 Ga0373935_0000382_13858_14841 319
345 3300035695 Ga0373927_0002885 Ga0373927_0002885_5828_6811 319
346 3300035725 Ga0373947_0001850 Ga0373947_0001850_6646_7629 319
347 3300037068 Ga0373925_0002634 Ga0373925_0002634_1487_2470 319
348 3300046454 Ga0495592_0036453 Ga0495592_0036453_180_1163 319
349 3300046459 Ga0495629_0000500 Ga0495629_0000500_1331_2314 319
350 3300046461 Ga0495641_0001436 Ga0495641_0001436_18395_19378 319
351 3300046463 Ga0495653_0192942 Ga0495653_0192942_55_1038 319
352 3300046472 Ga0495580_0004694 Ga0495580_0004694_8401_9384 319
353 3300046473 Ga0495582_0000251 Ga0495582_0000251_2280_3263 319
354 3300046475 Ga0495639_0000077 Ga0495639_0000077_31497_32480 319
355 3300046476 Ga0495662_0005023 Ga0495662_0005023_1580_2563 319
356 3300046499 Ga0495594_0000648 Ga0495594_0000648_1012_1995 319
357 3300046514 Ga0495618_0122232 Ga0495618_0122232_55_1038 319
358 3300046516 Ga0495628_0058528 Ga0495628_0058528_1348_2331 319
359 3300046517 Ga0495630_0001279 Ga0495630_0001279_11036_12019 319
360 3300046526 Ga0495666_0006830 Ga0495666_0006830_3175_4158 319
361 3300046529 Ga0495652_0057912 Ga0495652_0057912_367_1350 319
362 3300046531 Ga0495665_0010232 Ga0495665_0010232_2269_3252 319
363 3300046533 Ga0495640_0036563 Ga0495640_0036563_1372_2355 319
364 3300046642 Ga0495634_0001976 Ga0495634_0001976_7922_8905 319
365 3300046663 Ga0495635_0041465 Ga0495635_0041465_1312_2295 319
366 3300046681 Ga0495647_0006505 Ga0495647_0006505_1827_2810 319
367 3300046683 Ga0495658_0001615 Ga0495658_0001615_4519_5502 319
368 3300046689 Ga0495613_0013924 Ga0495613_0013924_3280_4263 319
369 3300046690 Ga0495624_0002021 Ga0495624_0002021_7888_8871 319
370 3300047315 Ga0495581_0000503 Ga0495581_0000503_11098_12081 319
371 3300047319 Ga0495674_0009848 Ga0495674_0009848_6451_7434 319
372 3300047321 Ga0495676_0024072 Ga0495676_0024072_3044_4027 319
373 3300047471 Ga0495684_0009241 Ga0495684_0009241_1826_2809 319
374 3300048089 Ga0495614_0037583 Ga0495614_0037583_731_1714 319
375 iso_pu_bacteria 2508501114 2509078049 319
376 iso_pu_bacteria 2835312727 2835312799 319
377 3300021361 Ga0213872_10100322 Ga0213872_101003221 320
378 3300039447 Ga0436361_0147176 Ga0436361_0147176_224_1198 320
379 iso_pu_bacteria 2643221688 2644494869 320
380 iso_pu_bacteria 2643221689 2644498255 320
381 3300037853 Ga0436364_0684151 Ga0436364_0684151_1040_2089 321
382 3300039450 Ga0436363_0540018 Ga0436363_0540018_204_1253 321
383 iso_pu_bacteria 2511231028 2511394988 321
384 iso_pu_bacteria 2528768022 2528848582 321
385 iso_pu_bacteria 2824773399 2824775347 321
386 iso_pu_bacteria 2879099564 2879104573 321
387 iso_pu_bacteria 2885366525 2885369174 321
388 iso_pu_bacteria 2932809354 2932817385 321
389 iso_pu_bacteria 2932818245 2932826154 321
390 iso_pu_bacteria 2935760218 2935765185 321
391 iso_pu_bacteria 2935959822 2935960691 321
392 3300021361 Ga0213872_10015714 Ga0213872_100157142 322
393 3300021384 Ga0213876_10001266 Ga0213876_1000126612 322
394 3300037418 Ga0395900_0137353 Ga0395900_0137353_1515_2489 322
395 3300038443 Ga0395901_0166786 Ga0395901_0166786_1192_2166 322
396 3300039437 Ga0436365_0513279 Ga0436365_0513279_10968_11936 322
397 3300039447 Ga0436361_0027198 Ga0436361_0027198_5530_6498 322
398 3300039447 Ga0436361_1157127 Ga0436361_1157127_73_1041 322
399 3300044694 Ga0466963_0259264 Ga0466963_0259264_129_1106 322
400 3300048929 Ga0496126_0127629 Ga0496126_0127629_622_1599 322
401 3300009098 Ga0105245_10005778 Ga0105245_1000577810 323
402 3300025927 Ga0207687_10010954 Ga0207687_100109544 323
403 3300031247 Ga0265340_10001673 Ga0265340_100016738 323
404 3300031249 Ga0265339_10001531 Ga0265339_1000153114 323
405 3300031344 Ga0265316_10317838 Ga0265316_103178381 323
406 3300031595 Ga0265313_10000181 Ga0265313_1000018130 323
407 3300046454 Ga0495592_0208641 Ga0495592_0208641_287_1282 323
408 3300046642 Ga0495634_0174029 Ga0495634_0174029_147_1142 323
409 3300049572 Ga0501036_0130597 Ga0501036_0130597_1060_2040 323
410 3300049577 Ga0501041_0067417 Ga0501041_0067417_1023_2003 323
411 3300049743 Ga0501081_0380641 Ga0501081_0380641_31_1011 323
412 3300005337 Ga0070682_100003787 Ga0070682_1000037875 324
413 3300005347 Ga0070668_100214941 Ga0070668_1002149412 324
414 3300005366 Ga0070659_100064249 Ga0070659_1000642492 324
415 3300005458 Ga0070681_10019918 Ga0070681_100199186 324
416 3300005458 Ga0070681_10064905 Ga0070681_100649052 324
417 3300005530 Ga0070679_100011317 Ga0070679_1000113176 324
418 3300005530 Ga0070679_100049458 Ga0070679_1000494582 324
419 3300005530 Ga0070679_100441582 Ga0070679_1004415822 324
420 3300005536 Ga0070697_100030782 Ga0070697_1000307822 324
421 3300005539 Ga0068853_100031350 Ga0068853_1000313503 324
422 3300005549 Ga0070704_100013544 Ga0070704_1000135445 324
423 3300006173 Ga0070716_100259043 Ga0070716_1002590431 324
424 3300006914 Ga0075436_100001731 Ga0075436_1000017315 324
425 3300007076 Ga0075435_100268392 Ga0075435_1002683922 324
426 3300009098 Ga0105245_10167920 Ga0105245_101679202 324
427 3300009553 Ga0105249_10000711 Ga0105249_1000071131 324
428 3300013100 Ga0157373_10011307 Ga0157373_100113076 324
429 3300013296 Ga0157374_10084810 Ga0157374_100848102 324
430 3300025294 Ga0209025_1024894 Ga0209025_10248943 324
431 3300025295 Ga0209564_1000031 Ga0209564_1000031169 324
432 3300025297 Ga0209758_1002072 Ga0209758_100207210 324
433 3300025299 Ga0209256_1007690 Ga0209256_10076904 324
434 3300025912 Ga0207707_10023721 Ga0207707_100237214 324
435 3300025912 Ga0207707_10023741 Ga0207707_100237414 324
436 3300025917 Ga0207660_10107364 Ga0207660_101073642 324
437 3300025927 Ga0207687_10188765 Ga0207687_101887651 324
438 3300025961 Ga0207712_10092379 Ga0207712_100923792 324
439 3300025972 Ga0207668_10085490 Ga0207668_100854902 324
440 3300026116 Ga0207674_10043305 Ga0207674_100433053 324
441 3300028556 Ga0265337_1000182 Ga0265337_100018212 324
442 3300031901 Ga0307406_10027838 Ga0307406_100278382 324
443 3300035086 Ga0373934_0046778 Ga0373934_0046778_597_1571 324
444 3300035117 Ga0373953_0063163 Ga0373953_0063163_379_1353 324
445 3300035172 Ga0373955_0002392 Ga0373955_0002392_460_1434 324
446 3300036401 Ga0373937_0009476 Ga0373937_0009476_4502_5476 324
447 3300037471 Ga0395905_0002565 Ga0395905_0002565_14426_15418 324
448 3300039437 Ga0436365_1104947 Ga0436365_1104947_929_1915 324
449 3300042005 Ga0439448_0041230 Ga0439448_0041230_337_1314 324
450 3300046460 Ga0495638_0029760 Ga0495638_0029760_2427_3419 324
451 3300046462 Ga0495651_0013744 Ga0495651_0013744_4126_5100 324
452 3300046516 Ga0495628_0007599 Ga0495628_0007599_670_1644 324
453 3300046529 Ga0495652_0022353 Ga0495652_0022353_3456_4430 324
454 3300046536 Ga0495587_0081897 Ga0495587_0081897_632_1606 324
455 3300046559 Ga0495667_0047814 Ga0495667_0047814_1178_2152 324
456 3300046678 Ga0495599_0038287 Ga0495599_0038287_1903_2877 324
457 3300046809 Ga0495600_0009879 Ga0495600_0009879_4422_5396 324
458 3300048088 Ga0495602_0010688 Ga0495602_0010688_2116_3090 324
459 3300048908 Ga0496105_0321252 Ga0496105_0321252_81_1079 324
460 3300049568 Ga0501031_0068246 Ga0501031_0068246_631_1608 324
461 3300049570 Ga0501033_0019522 Ga0501033_0019522_1444_2421 324
462 3300049571 Ga0501034_0013177 Ga0501034_0013177_7154_8140 324
463 3300049571 Ga0501034_0022766 Ga0501034_0022766_4806_5783 324
464 3300049571 Ga0501034_0092593 Ga0501034_0092593_873_1856 324
465 3300049572 Ga0501036_0030450 Ga0501036_0030450_2686_3663 324
466 3300049573 Ga0501037_0016589 Ga0501037_0016589_896_1873 324
467 3300049574 Ga0501038_0026430 Ga0501038_0026430_636_1613 324
468 3300049574 Ga0501038_0033611 Ga0501038_0033611_1817_2800 324
469 3300049579 Ga0501043_0014338 Ga0501043_0014338_525_1502 324
470 3300049581 Ga0501047_0030661 Ga0501047_0030661_444_1421 324
471 3300049584 Ga0501068_0164250 Ga0501068_0164250_350_1327 324
472 3300049589 Ga0501073_0009289 Ga0501073_0009289_1595_2572 324
473 3300049590 Ga0501074_0208311 Ga0501074_0208311_249_1226 324
474 3300049592 Ga0501076_0264551 Ga0501076_0264551_79_1098 324
475 3300049741 Ga0501079_0211695 Ga0501079_0211695_19_1038 324
476 3300049742 Ga0501080_0033198 Ga0501080_0033198_3491_4468 324
477 3300049742 Ga0501080_0190205 Ga0501080_0190205_546_1529 324
478 3300049823 Ga0501044_0013031 Ga0501044_0013031_3818_4795 324
479 3300050491 nmdc:mga00v17_8336_c1 nmdc:mga00v17_8336_c1_1643_2626 324
480 3300050492 nmdc:mga0yw44_40792_c1 nmdc:mga0yw44_40792_c1_1130_2113 324
481 3300050513 nmdc:mga0rr50_237205_c1 nmdc:mga0rr50_237205_c1_103_1080 324
482 3300050514 nmdc:mga08x19_6_c1 nmdc:mga08x19_6_c1_325365_326342 324
483 3300053077 Ga0495601_0008232 Ga0495601_0008232_4233_5207 324
484 3300053084 Ga0495595_0003138 Ga0495595_0003138_2923_3897 324
485 3300053085 Ga0495619_0006052 Ga0495619_0006052_4879_5853 324
486 3300053119 Ga0500595_023055 Ga0500595_023055_122_1108 324
487 3300053139 Ga0500568_0000682 Ga0500568_0000682_10762_11748 324
488 3300060353 Ga0501082_0094555 Ga0501082_0094555_76_1062 324
489 3300060353 Ga0501082_0229824 Ga0501082_0229824_117_1136 324
490 3300061734 Ga0530510_0297590 Ga0530510_0297590_142_1161 324
491 3300000041 ARcpr5oldR_c000046 ARcpr5oldR_00004613 325
492 3300000042 ARSoilYngRDRAFT_c00078 ARSoilYngRDRAFT_000789 325
493 3300000043 ARcpr5yngRDRAFT_c000072 ARcpr5yngRDRAFT_00007214 325
494 3300000044 ARSoilOldRDRAFT_c000019 ARSoilOldRDRAFT_00001911 325
495 3300000045 ARCol0oldRDRAFT_c00019 ARCol0oldRDRAFT_000196 325
496 3300000652 ARCol0yngRDRAFT_1000004 ARCol0yngRDRAFT_100000434 325
497 3300001990 JGI24737J22298_10001119 JGI24737J22298_100011197 325
498 3300003203 JGI25406J46586_10000093 JGI25406J46586_100000938 325
499 3300003215 JGI25153J46596_10003480 JGI25153J46596_100034807 325
500 3300003215 JGI25153J46596_10013314 JGI25153J46596_100133144 325
501 3300003794 Ga0055531_10028919 Ga0055531_100289192 325
502 3300003911 JGI25405J52794_10006708 JGI25405J52794_100067082 325
503 3300005262 Ga0065165_1010588 Ga0065165_10105884 325
504 3300005290 Ga0065712_10001614 Ga0065712_100016145 325
505 3300005290 Ga0065712_10081440 Ga0065712_100814402 325
506 3300005293 Ga0065715_10001152 Ga0065715_100011526 325
507 3300005295 Ga0065707_10101857 Ga0065707_101018573 325
508 3300005328 Ga0070676_10026353 Ga0070676_100263532 325
509 3300005329 Ga0070683_100087289 Ga0070683_1000872892 325
510 3300005330 Ga0070690_100004467 Ga0070690_1000044673 325
511 3300005331 Ga0070670_100063259 Ga0070670_1000632592 325
512 3300005331 Ga0070670_100132432 Ga0070670_1001324322 325
513 3300005334 Ga0068869_100085936 Ga0068869_1000859362 325
514 3300005334 Ga0068869_100268560 Ga0068869_1002685601 325
515 3300005334 Ga0068869_100381291 Ga0068869_1003812911 325
516 3300005335 Ga0070666_10060082 Ga0070666_100600821 325
517 3300005336 Ga0070680_100246084 Ga0070680_1002460842 325
518 3300005337 Ga0070682_100136920 Ga0070682_1001369202 325
519 3300005338 Ga0068868_100254238 Ga0068868_1002542382 325
520 3300005339 Ga0070660_100083714 Ga0070660_1000837143 325
521 3300005340 Ga0070689_100065316 Ga0070689_1000653162 325
522 3300005343 Ga0070687_100010183 Ga0070687_1000101833 325
523 3300005345 Ga0070692_10032664 Ga0070692_100326642 325
524 3300005353 Ga0070669_100062781 Ga0070669_1000627813 325
525 3300005354 Ga0070675_100070918 Ga0070675_1000709183 325
526 3300005355 Ga0070671_100196451 Ga0070671_1001964512 325
527 3300005355 Ga0070671_100278529 Ga0070671_1002785292 325
528 3300005364 Ga0070673_100134704 Ga0070673_1001347041 325
529 3300005365 Ga0070688_100016686 Ga0070688_1000166864 325
530 3300005366 Ga0070659_100033735 Ga0070659_1000337353 325
531 3300005367 Ga0070667_100066927 Ga0070667_1000669271 325
532 3300005367 Ga0070667_100088578 Ga0070667_1000885782 325
533 3300005434 Ga0070709_10237690 Ga0070709_102376901 325
534 3300005435 Ga0070714_100093931 Ga0070714_1000939312 325
535 3300005436 Ga0070713_100008105 Ga0070713_1000081052 325
536 3300005436 Ga0070713_100017182 Ga0070713_1000171822 325
537 3300005436 Ga0070713_100034300 Ga0070713_1000343004 325
538 3300005436 Ga0070713_100041015 Ga0070713_1000410153 325
539 3300005436 Ga0070713_100142923 Ga0070713_1001429232 325
540 3300005437 Ga0070710_10006165 Ga0070710_100061652 325
541 3300005437 Ga0070710_10016385 Ga0070710_100163851 325
542 3300005439 Ga0070711_100016158 Ga0070711_1000161584 325
543 3300005439 Ga0070711_100022759 Ga0070711_1000227592 325
544 3300005444 Ga0070694_100023281 Ga0070694_1000232813 325
545 3300005445 Ga0070708_100327900 Ga0070708_1003279002 325
546 3300005455 Ga0070663_100057916 Ga0070663_1000579162 325
547 3300005456 Ga0070678_100013593 Ga0070678_1000135934 325
548 3300005456 Ga0070678_100031955 Ga0070678_1000319555 325
549 3300005457 Ga0070662_100060345 Ga0070662_1000603453 325
550 3300005457 Ga0070662_100061564 Ga0070662_1000615643 325
551 3300005458 Ga0070681_10009201 Ga0070681_100092015 325
552 3300005458 Ga0070681_10019515 Ga0070681_100195153 325
553 3300005458 Ga0070681_10280825 Ga0070681_102808252 325
554 3300005466 Ga0070685_10040878 Ga0070685_100408782 325
555 3300005471 Ga0070698_100079951 Ga0070698_1000799513 325
556 3300005530 Ga0070679_100086604 Ga0070679_1000866042 325
557 3300005536 Ga0070697_100047284 Ga0070697_1000472844 325
558 3300005536 Ga0070697_100204273 Ga0070697_1002042731 325
559 3300005544 Ga0070686_100003301 Ga0070686_1000033018 325
560 3300005545 Ga0070695_100021124 Ga0070695_1000211243 325
561 3300005546 Ga0070696_100019038 Ga0070696_1000190383 325
562 3300005546 Ga0070696_100341126 Ga0070696_1003411261 325
563 3300005547 Ga0070693_100078512 Ga0070693_1000785122 325
564 3300005547 Ga0070693_100096188 Ga0070693_1000961882 325
565 3300005548 Ga0070665_100400073 Ga0070665_1004000732 325
566 3300005549 Ga0070704_100073537 Ga0070704_1000735371 325
567 3300005577 Ga0068857_100255119 Ga0068857_1002551192 325
568 3300005614 Ga0068856_100143713 Ga0068856_1001437133 325
569 3300005617 Ga0068859_100119803 Ga0068859_1001198033 325
570 3300005841 Ga0068863_100323821 Ga0068863_1003238212 325
571 3300005841 Ga0068863_100390688 Ga0068863_1003906881 325
572 3300005842 Ga0068858_100054434 Ga0068858_1000544343 325
573 3300005843 Ga0068860_100050047 Ga0068860_1000500473 325
574 3300005843 Ga0068860_100072707 Ga0068860_1000727073 325
575 3300005844 Ga0068862_100040120 Ga0068862_1000401203 325
576 3300005937 Ga0081455_10002427 Ga0081455_1000242712 325
577 3300005937 Ga0081455_10242350 Ga0081455_102423502 325
578 3300005983 Ga0081540_1008452 Ga0081540_10084527 325
579 3300005985 Ga0081539_10000140 Ga0081539_1000014026 325
580 3300006028 Ga0070717_10000161 Ga0070717_100001619 325
581 3300006028 Ga0070717_10012075 Ga0070717_100120754 325
582 3300006028 Ga0070717_10045154 Ga0070717_100451544 325
583 3300006042 Ga0075368_10001688 Ga0075368_100016885 325
584 3300006048 Ga0075363_100013917 Ga0075363_1000139172 325
585 3300006058 Ga0075432_10010678 Ga0075432_100106782 325
586 3300006163 Ga0070715_10002352 Ga0070715_100023522 325
587 3300006173 Ga0070716_100026605 Ga0070716_1000266052 325
588 3300006175 Ga0070712_100006221 Ga0070712_1000062212 325
589 3300006175 Ga0070712_100123444 Ga0070712_1001234442 325
590 3300006178 Ga0075367_10074959 Ga0075367_100749592 325
591 3300006186 Ga0075369_10041306 Ga0075369_100413062 325
592 3300006194 Ga0075427_10000100 Ga0075427_100001005 325
593 3300006195 Ga0075366_10087695 Ga0075366_100876952 325
594 3300006846 Ga0075430_100000070 Ga0075430_10000007037 325
595 3300006847 Ga0075431_100001221 Ga0075431_10000122118 325
596 3300006852 Ga0075433_10110695 Ga0075433_101106952 325
597 3300006852 Ga0075433_10124808 Ga0075433_101248082 325
598 3300006871 Ga0075434_100000212 Ga0075434_10000021230 325
599 3300006871 Ga0075434_100157948 Ga0075434_1001579482 325
600 3300006871 Ga0075434_100216040 Ga0075434_1002160402 325
601 3300006880 Ga0075429_100003999 Ga0075429_1000039997 325
602 3300006914 Ga0075436_100034998 Ga0075436_1000349983 325
603 3300006914 Ga0075436_100070908 Ga0075436_1000709082 325
604 3300006931 Ga0097620_100119802 Ga0097620_1001198022 325
605 3300007076 Ga0075435_100015735 Ga0075435_1000157355 325
606 3300007076 Ga0075435_100049577 Ga0075435_1000495772 325
607 3300007076 Ga0075435_100109551 Ga0075435_1001095512 325
608 3300007265 Ga0099794_10006018 Ga0099794_100060182 325
609 3300009094 Ga0111539_10000138 Ga0111539_1000013830 325
610 3300009094 Ga0111539_10000684 Ga0111539_1000068425 325
611 3300009094 Ga0111539_10028103 Ga0111539_100281037 325
612 3300009094 Ga0111539_10232912 Ga0111539_102329122 325
613 3300009098 Ga0105245_10297231 Ga0105245_102972312 325
614 3300009101 Ga0105247_10034021 Ga0105247_100340211 325
615 3300009101 Ga0105247_10056044 Ga0105247_100560442 325
616 3300009101 Ga0105247_10111516 Ga0105247_101115162 325
617 3300009101 Ga0105247_10159395 Ga0105247_101593952 325
618 3300009147 Ga0114129_10002312 Ga0114129_100023124 325
619 3300009147 Ga0114129_10058044 Ga0114129_100580442 325
620 3300009148 Ga0105243_10071183 Ga0105243_100711833 325
621 3300009174 Ga0105241_10075502 Ga0105241_100755022 325
622 3300009174 Ga0105241_10405603 Ga0105241_104056031 325
623 3300009176 Ga0105242_10215419 Ga0105242_102154192 325
624 3300009177 Ga0105248_10051300 Ga0105248_100513004 325
625 3300009177 Ga0105248_10117464 Ga0105248_101174642 325
626 3300009545 Ga0105237_10079338 Ga0105237_100793383 325
627 3300009553 Ga0105249_10021879 Ga0105249_100218793 325
628 3300009553 Ga0105249_10073357 Ga0105249_100733572 325
629 3300010375 Ga0105239_10021637 Ga0105239_100216373 325
630 3300010375 Ga0105239_10173107 Ga0105239_101731073 325
631 3300010375 Ga0105239_10417110 Ga0105239_104171101 325
632 3300011119 Ga0105246_10117875 Ga0105246_101178752 325
633 3300011119 Ga0105246_10209764 Ga0105246_102097642 325
634 3300011119 Ga0105246_10273185 Ga0105246_102731851 325
635 3300013100 Ga0157373_10020584 Ga0157373_100205843 325
636 3300013105 Ga0157369_10018324 Ga0157369_100183247 325
637 3300013296 Ga0157374_10032272 Ga0157374_100322726 325
638 3300013296 Ga0157374_10205183 Ga0157374_102051832 325
639 3300013297 Ga0157378_10175656 Ga0157378_101756561 325
640 3300013297 Ga0157378_10348032 Ga0157378_103480322 325
641 3300013306 Ga0163162_10137663 Ga0163162_101376632 325
642 3300013306 Ga0163162_10197380 Ga0163162_101973801 325
643 3300013308 Ga0157375_10017721 Ga0157375_100177213 325
644 3300014325 Ga0163163_10029813 Ga0163163_100298132 325
645 3300014745 Ga0157377_10056043 Ga0157377_100560432 325
646 3300014745 Ga0157377_10191287 Ga0157377_101912872 325
647 3300014968 Ga0157379_10042501 Ga0157379_100425013 325
648 3300014968 Ga0157379_10061412 Ga0157379_100614124 325
649 3300014968 Ga0157379_10311399 Ga0157379_103113992 325
650 3300014968 Ga0157379_10414874 Ga0157379_104148741 325
651 3300025253 Ga0209677_106740 Ga0209677_1067402 325
652 3300025254 Ga0209148_1011843 Ga0209148_10118431 325
653 3300025271 Ga0207666_1001537 Ga0207666_10015372 325
654 3300025295 Ga0209564_1025935 Ga0209564_10259352 325
655 3300025297 Ga0209758_1000140 Ga0209758_10001405 325
656 3300025297 Ga0209758_1000925 Ga0209758_100092510 325
657 3300025297 Ga0209758_1007360 Ga0209758_10073604 325
658 3300025299 Ga0209256_1004348 Ga0209256_10043483 325
659 3300025302 Ga0207426_1000434 Ga0207426_100043455 325
660 3300025302 Ga0207426_1058688 Ga0207426_10586881 325
661 3300025304 Ga0209257_1001932 Ga0209257_100193218 325
662 3300025885 Ga0207653_10016912 Ga0207653_100169122 325
663 3300025898 Ga0207692_10008259 Ga0207692_100082592 325
664 3300025900 Ga0207710_10037372 Ga0207710_100373722 325
665 3300025901 Ga0207688_10040016 Ga0207688_100400162 325
666 3300025903 Ga0207680_10021980 Ga0207680_100219802 325
667 3300025904 Ga0207647_10007263 Ga0207647_100072637 325
668 3300025904 Ga0207647_10012181 Ga0207647_100121813 325
669 3300025906 Ga0207699_10000944 Ga0207699_100009446 325
670 3300025906 Ga0207699_10067828 Ga0207699_100678281 325
671 3300025906 Ga0207699_10169314 Ga0207699_101693142 325
672 3300025907 Ga0207645_10063042 Ga0207645_100630423 325
673 3300025907 Ga0207645_10156185 Ga0207645_101561852 325
674 3300025911 Ga0207654_10215549 Ga0207654_102155492 325
675 3300025912 Ga0207707_10036943 Ga0207707_100369431 325
676 3300025912 Ga0207707_10037232 Ga0207707_100372323 325
677 3300025912 Ga0207707_10226637 Ga0207707_102266372 325
678 3300025913 Ga0207695_10280138 Ga0207695_102801381 325
679 3300025914 Ga0207671_10206742 Ga0207671_102067422 325
680 3300025915 Ga0207693_10002467 Ga0207693_100024677 325
681 3300025916 Ga0207663_10011512 Ga0207663_100115123 325
682 3300025916 Ga0207663_10063336 Ga0207663_100633362 325
683 3300025916 Ga0207663_10119530 Ga0207663_101195302 325
684 3300025917 Ga0207660_10201056 Ga0207660_102010562 325
685 3300025917 Ga0207660_10229653 Ga0207660_102296532 325
686 3300025918 Ga0207662_10004464 Ga0207662_100044643 325
687 3300025919 Ga0207657_10088833 Ga0207657_100888333 325
688 3300025920 Ga0207649_10123937 Ga0207649_101239371 325
689 3300025921 Ga0207652_10142877 Ga0207652_101428772 325
690 3300025921 Ga0207652_10210755 Ga0207652_102107552 325
691 3300025923 Ga0207681_10166082 Ga0207681_101660822 325
692 3300025924 Ga0207694_10122911 Ga0207694_101229112 325
693 3300025926 Ga0207659_10243311 Ga0207659_102433112 325
694 3300025928 Ga0207700_10000673 Ga0207700_1000067313 325
695 3300025928 Ga0207700_10008693 Ga0207700_100086933 325
696 3300025928 Ga0207700_10057884 Ga0207700_100578841 325
697 3300025928 Ga0207700_10250010 Ga0207700_102500101 325
698 3300025929 Ga0207664_10010534 Ga0207664_100105342 325
699 3300025929 Ga0207664_10107677 Ga0207664_101076772 325
700 3300025932 Ga0207690_10018178 Ga0207690_100181784 325
701 3300025933 Ga0207706_10078650 Ga0207706_100786503 325
702 3300025933 Ga0207706_10088290 Ga0207706_100882902 325
703 3300025934 Ga0207686_10045453 Ga0207686_100454533 325
704 3300025935 Ga0207709_10041427 Ga0207709_100414272 325
705 3300025936 Ga0207670_10061577 Ga0207670_100615772 325
706 3300025939 Ga0207665_10000248 Ga0207665_1000024821 325
707 3300025939 Ga0207665_10074153 Ga0207665_100741531 325
708 3300025940 Ga0207691_10142573 Ga0207691_101425732 325
709 3300025942 Ga0207689_10045015 Ga0207689_100450153 325
710 3300025944 Ga0207661_10186597 Ga0207661_101865972 325
711 3300025945 Ga0207679_10011268 Ga0207679_100112682 325
712 3300025961 Ga0207712_10330591 Ga0207712_103305912 325
713 3300025972 Ga0207668_10071444 Ga0207668_100714443 325
714 3300025981 Ga0207640_10098875 Ga0207640_100988752 325
715 3300025981 Ga0207640_10257024 Ga0207640_102570241 325
716 3300025986 Ga0207658_10217197 Ga0207658_102171972 325
717 3300026023 Ga0207677_10335320 Ga0207677_103353202 325
718 3300026035 Ga0207703_10030485 Ga0207703_100304853 325
719 3300026035 Ga0207703_10125493 Ga0207703_101254932 325
720 3300026067 Ga0207678_10038552 Ga0207678_100385524 325
721 3300026067 Ga0207678_10079023 Ga0207678_100790233 325
722 3300026067 Ga0207678_10082729 Ga0207678_100827293 325
723 3300026075 Ga0207708_10007477 Ga0207708_100074777 325
724 3300026078 Ga0207702_10116988 Ga0207702_101169883 325
725 3300026078 Ga0207702_10218473 Ga0207702_102184732 325
726 3300026088 Ga0207641_10102400 Ga0207641_101024002 325
727 3300026089 Ga0207648_10143291 Ga0207648_101432911 325
728 3300026116 Ga0207674_10149204 Ga0207674_101492042 325
729 3300026116 Ga0207674_10193479 Ga0207674_101934792 325
730 3300026116 Ga0207674_10247416 Ga0207674_102474162 325
731 3300026116 Ga0207674_10328044 Ga0207674_103280442 325
732 3300026118 Ga0207675_100012197 Ga0207675_1000121977 325
733 3300026118 Ga0207675_100028974 Ga0207675_1000289743 325
734 3300026121 Ga0207683_10003030 Ga0207683_100030301 325
735 3300026121 Ga0207683_10100175 Ga0207683_101001753 325
736 3300027682 Ga0209971_1004128 Ga0209971_10041282 325
737 3300027695 Ga0209966_1001601 Ga0209966_10016014 325
738 3300027717 Ga0209998_10005225 Ga0209998_100052252 325
739 3300027717 Ga0209998_10006493 Ga0209998_100064931 325
740 3300027876 Ga0209974_10068970 Ga0209974_100689702 325
741 3300027907 Ga0207428_10000075 Ga0207428_1000007568 325
742 3300027907 Ga0207428_10001396 Ga0207428_100013966 325
743 3300027907 Ga0207428_10156604 Ga0207428_101566042 325
744 3300028379 Ga0268266_10027620 Ga0268266_100276205 325
745 3300028380 Ga0268265_10011699 Ga0268265_100116995 325
746 3300028381 Ga0268264_10079277 Ga0268264_100792772 325
747 3300028381 Ga0268264_10195287 Ga0268264_101952872 325
748 3300031238 Ga0265332_10125828 Ga0265332_101258281 325
749 3300031249 Ga0265339_10141850 Ga0265339_101418502 325
750 3300032133 Ga0316583_10040564 Ga0316583_100405642 325
751 3300033180 Ga0307510_10094692 Ga0307510_100946923 325
752 3300034816 Ga0373930_0000464 Ga0373930_0000464_2237_3214 325
753 3300034816 Ga0373930_0003826 Ga0373930_0003826_1009_1986 325
754 3300034817 Ga0373948_0000488 Ga0373948_0000488_3193_4170 325
755 3300034817 Ga0373948_0001405 Ga0373948_0001405_1316_2293 325
756 3300034818 Ga0373950_0000351 Ga0373950_0000351_2244_3221 325
757 3300034818 Ga0373950_0002315 Ga0373950_0002315_1004_1981 325
758 3300034819 Ga0373958_0000402 Ga0373958_0000402_2588_3565 325
759 3300034819 Ga0373958_0001293 Ga0373958_0001293_1747_2724 325
760 3300034820 Ga0373959_0000494 Ga0373959_0000494_4359_5336 325
761 3300034957 Ga0373938_0000413 Ga0373938_0000413_4739_5716 325
762 3300035083 Ga0373926_0002008 Ga0373926_0002008_4022_4999 325
763 3300035083 Ga0373926_0010300 Ga0373926_0010300_970_1947 325
764 3300035084 Ga0373928_0000172 Ga0373928_0000172_4592_5569 325
765 3300035085 Ga0373929_0000302 Ga0373929_0000302_6722_7699 325
766 3300035086 Ga0373934_0015240 Ga0373934_0015240_657_1634 325
767 3300035088 Ga0373940_0003536 Ga0373940_0003536_42_1019 325
768 3300035088 Ga0373940_0008001 Ga0373940_0008001_1315_2292 325
769 3300035089 Ga0373944_0000062 Ga0373944_0000062_12297_13274 325
770 3300035089 Ga0373944_0005563 Ga0373944_0005563_1447_2424 325
771 3300035090 Ga0373949_0002398 Ga0373949_0002398_795_1772 325
772 3300035090 Ga0373949_0003324 Ga0373949_0003324_232_1209 325
773 3300035091 Ga0373951_0001192 Ga0373951_0001192_238_1215 325
774 3300035091 Ga0373951_0006845 Ga0373951_0006845_765_1742 325
775 3300035092 Ga0373952_0000447 Ga0373952_0000447_5278_6255 325
776 3300035092 Ga0373952_0001020 Ga0373952_0001020_2171_3148 325
777 3300035111 Ga0373923_0000387 Ga0373923_0000387_7432_8409 325
778 3300035112 Ga0373932_0000029 Ga0373932_0000029_34582_35559 325
779 3300035112 Ga0373932_0003160 Ga0373932_0003160_2756_3733 325
780 3300035113 Ga0373936_0000484 Ga0373936_0000484_10020_10997 325
781 3300035113 Ga0373936_0108417 Ga0373936_0108417_163_1140 325
782 3300035114 Ga0373939_0001362 Ga0373939_0001362_996_1973 325
783 3300035115 Ga0373941_0000106 Ga0373941_0000106_11919_12896 325
784 3300035116 Ga0373945_0004180 Ga0373945_0004180_2477_3454 325
785 3300035117 Ga0373953_0001395 Ga0373953_0001395_5960_6937 325
786 3300035118 Ga0373954_0037654 Ga0373954_0037654_1177_2154 325
787 3300035119 Ga0373956_0027092 Ga0373956_0027092_1155_2132 325
788 3300035120 Ga0373957_0000713 Ga0373957_0000713_2271_3248 325
789 3300035120 Ga0373957_0011670 Ga0373957_0011670_289_1266 325
790 3300035121 Ga0373960_0000009 Ga0373960_0000009_1468_2445 325
791 3300035121 Ga0373960_0009990 Ga0373960_0009990_1276_2253 325
792 3300035170 Ga0373943_0012718 Ga0373943_0012718_819_1796 325
793 3300035170 Ga0373943_0020592 Ga0373943_0020592_1160_2137 325
794 3300035170 Ga0373943_0047591 Ga0373943_0047591_22_999 325
795 3300035171 Ga0373946_0002687 Ga0373946_0002687_1416_2393 325
796 3300035171 Ga0373946_0018899 Ga0373946_0018899_483_1460 325
797 3300035171 Ga0373946_0047960 Ga0373946_0047960_546_1523 325
798 3300035172 Ga0373955_0000366 Ga0373955_0000366_580_1557 325
799 3300035172 Ga0373955_0043353 Ga0373955_0043353_682_1659 325
800 3300035207 Ga0373942_0000542 Ga0373942_0000542_4076_5053 325
801 3300035241 Ga0373961_0001281 Ga0373961_0001281_2180_3157 325
802 3300035241 Ga0373961_0002601 Ga0373961_0002601_2093_3070 325
803 3300035242 Ga0373962_0008200 Ga0373962_0008200_1050_2027 325
804 3300035410 Ga0373924_0019001 Ga0373924_0019001_461_1438 325
805 3300035691 Ga0373931_0004931 Ga0373931_0004931_4164_5141 325
806 3300035691 Ga0373931_0013494 Ga0373931_0013494_1896_2873 325
807 3300035692 Ga0373935_0010618 Ga0373935_0010618_1266_2243 325
808 3300035692 Ga0373935_0024746 Ga0373935_0024746_1974_2951 325
809 3300035695 Ga0373927_0000956 Ga0373927_0000956_2554_3531 325
810 3300035695 Ga0373927_0045009 Ga0373927_0045009_1727_2770 325
811 3300035724 Ga0373933_0002646 Ga0373933_0002646_6260_7237 325
812 3300035724 Ga0373933_0061272 Ga0373933_0061272_637_1614 325
813 3300035724 Ga0373933_0066231 Ga0373933_0066231_1180_2157 325
814 3300035725 Ga0373947_0000731 Ga0373947_0000731_15696_16673 325
815 3300035725 Ga0373947_0003531 Ga0373947_0003531_6677_7654 325
816 3300036401 Ga0373937_0002001 Ga0373937_0002001_9129_10106 325
817 3300036401 Ga0373937_0007098 Ga0373937_0007098_3267_4244 325
818 3300036401 Ga0373937_0109590 Ga0373937_0109590_821_1798 325
819 3300037068 Ga0373925_0003685 Ga0373925_0003685_7515_8492 325
820 3300037068 Ga0373925_0103628 Ga0373925_0103628_552_1529 325
821 3300037068 Ga0373925_0349406 Ga0373925_0349406_147_1124 325
822 3300038443 Ga0395901_0136667 Ga0395901_0136667_919_1905 325
823 3300041408 Ga0439453_0003687 Ga0439453_0003687_716_1699 325
824 3300042436 Ga0439435_0006396 Ga0439435_0006396_340_1323 325
825 3300044656 Ga0466969_0080482 Ga0466969_0080482_165_1151 325
826 3300044684 Ga0466966_0006283 Ga0466966_0006283_6396_7382 325
827 3300044693 Ga0466961_0000154 Ga0466961_0000154_34661_35647 325
828 3300044694 Ga0466963_0004891 Ga0466963_0004891_6293_7279 325
829 3300044712 Ga0453684_0253798 Ga0453684_0253798_751_1728 325
830 3300045049 Ga0466959_0012963 Ga0466959_0012963_356_1342 325
831 3300045051 Ga0451576_0016775 Ga0451576_0016775_4304_5281 325
832 3300046454 Ga0495592_0029190 Ga0495592_0029190_821_1798 325
833 3300046454 Ga0495592_0051160 Ga0495592_0051160_750_1727 325
834 3300046454 Ga0495592_0157393 Ga0495592_0157393_385_1371 325
835 3300046455 Ga0495603_0002008 Ga0495603_0002008_7103_8080 325
836 3300046455 Ga0495603_0009274 Ga0495603_0009274_724_1710 325
837 3300046455 Ga0495603_0056028 Ga0495603_0056028_137_1114 325
838 3300046459 Ga0495629_0002524 Ga0495629_0002524_9158_10135 325
839 3300046459 Ga0495629_0014754 Ga0495629_0014754_3663_4640 325
840 3300046459 Ga0495629_0021353 Ga0495629_0021353_3141_4127 325
841 3300046459 Ga0495629_0072107 Ga0495629_0072107_1388_2365 325
842 3300046461 Ga0495641_0025868 Ga0495641_0025868_937_1914 325
843 3300046462 Ga0495651_0001150 Ga0495651_0001150_19242_20219 325
844 3300046462 Ga0495651_0003637 Ga0495651_0003637_5716_6693 325
845 3300046462 Ga0495651_0024828 Ga0495651_0024828_1437_2423 325
846 3300046463 Ga0495653_0001957 Ga0495653_0001957_4843_5820 325
847 3300046463 Ga0495653_0009176 Ga0495653_0009176_1687_2664 325
848 3300046471 Ga0495650_0030504 Ga0495650_0030504_1318_2304 325
849 3300046472 Ga0495580_0001416 Ga0495580_0001416_7338_8315 325
850 3300046472 Ga0495580_0026223 Ga0495580_0026223_2873_3850 325
851 3300046473 Ga0495582_0044786 Ga0495582_0044786_906_1883 325
852 3300046473 Ga0495582_0077010 Ga0495582_0077010_107_1084 325
853 3300046475 Ga0495639_0009153 Ga0495639_0009153_621_1598 325
854 3300046475 Ga0495639_0025780 Ga0495639_0025780_514_1491 325
855 3300046476 Ga0495662_0002039 Ga0495662_0002039_1092_2069 325
856 3300046477 Ga0495664_0000178 Ga0495664_0000178_15882_16859 325
857 3300046499 Ga0495594_0018573 Ga0495594_0018573_1669_2646 325
858 3300046499 Ga0495594_0043982 Ga0495594_0043982_935_1912 325
859 3300046499 Ga0495594_0067104 Ga0495594_0067104_490_1467 325
860 3300046501 Ga0495607_0010007 Ga0495607_0010007_1388_2365 325
861 3300046506 Ga0495583_0053134 Ga0495583_0053134_836_1813 325
862 3300046507 Ga0495606_0008377 Ga0495606_0008377_6991_7977 325
863 3300046511 Ga0495608_0001671 Ga0495608_0001671_6225_7202 325
864 3300046511 Ga0495608_0012960 Ga0495608_0012960_381_1358 325
865 3300046511 Ga0495608_0087254 Ga0495608_0087254_710_1687 325
866 3300046514 Ga0495618_0043141 Ga0495618_0043141_1394_2371 325
867 3300046514 Ga0495618_0045614 Ga0495618_0045614_781_1758 325
868 3300046514 Ga0495618_0079346 Ga0495618_0079346_634_1620 325
869 3300046514 Ga0495618_0156045 Ga0495618_0156045_407_1384 325
870 3300046516 Ga0495628_0001448 Ga0495628_0001448_16199_17176 325
871 3300046516 Ga0495628_0067617 Ga0495628_0067617_1583_2560 325
872 3300046517 Ga0495630_0015634 Ga0495630_0015634_906_1883 325
873 3300046517 Ga0495630_0118561 Ga0495630_0118561_201_1178 325
874 3300046523 Ga0495644_0013279 Ga0495644_0013279_1390_2367 325
875 3300046526 Ga0495666_0000187 Ga0495666_0000187_17299_18276 325
876 3300046526 Ga0495666_0025210 Ga0495666_0025210_259_1236 325
877 3300046529 Ga0495652_0016995 Ga0495652_0016995_800_1777 325
878 3300046529 Ga0495652_0020641 Ga0495652_0020641_702_1679 325
879 3300046529 Ga0495652_0058863 Ga0495652_0058863_933_1910 325
880 3300046529 Ga0495652_0154913 Ga0495652_0154913_773_1759 325
881 3300046531 Ga0495665_0008864 Ga0495665_0008864_3089_4066 325
882 3300046531 Ga0495665_0010034 Ga0495665_0010034_2006_2983 325
883 3300046533 Ga0495640_0086181 Ga0495640_0086181_623_1609 325
884 3300046533 Ga0495640_0156752 Ga0495640_0156752_30_1007 325
885 3300046535 Ga0495586_0004369 Ga0495586_0004369_4444_5421 325
886 3300046535 Ga0495586_0114764 Ga0495586_0114764_75_1052 325
887 3300046536 Ga0495587_0002681 Ga0495587_0002681_829_1806 325
888 3300046536 Ga0495587_0015083 Ga0495587_0015083_625_1602 325
889 3300046536 Ga0495587_0026467 Ga0495587_0026467_1496_2473 325
890 3300046537 Ga0495598_0002702 Ga0495598_0002702_959_1936 325
891 3300046543 Ga0495645_0005154 Ga0495645_0005154_6610_7587 325
892 3300046543 Ga0495645_0113517 Ga0495645_0113517_536_1513 325
893 3300046557 Ga0495622_0006500 Ga0495622_0006500_1708_2685 325
894 3300046557 Ga0495622_0013770 Ga0495622_0013770_465_1442 325
895 3300046558 Ga0495633_0012498 Ga0495633_0012498_1134_2111 325
896 3300046559 Ga0495667_0000821 Ga0495667_0000821_2076_3053 325
897 3300046559 Ga0495667_0032794 Ga0495667_0032794_1286_2263 325
898 3300046615 Ga0495656_0000534 Ga0495656_0000534_8867_9844 325
899 3300046616 Ga0495668_0020492 Ga0495668_0020492_2708_3694 325
900 3300046642 Ga0495634_0015427 Ga0495634_0015427_1315_2292 325
901 3300046642 Ga0495634_0023646 Ga0495634_0023646_1964_2941 325
902 3300046642 Ga0495634_0063318 Ga0495634_0063318_549_1535 325
903 3300046648 Ga0495611_0016881 Ga0495611_0016881_1195_2172 325
904 3300046663 Ga0495635_0002471 Ga0495635_0002471_3142_4128 325
905 3300046663 Ga0495635_0010978 Ga0495635_0010978_4550_5527 325
906 3300046663 Ga0495635_0057830 Ga0495635_0057830_268_1245 325
907 3300046664 Ga0495659_0013500 Ga0495659_0013500_280_1257 325
908 3300046665 Ga0495661_0066763 Ga0495661_0066763_782_1759 325
909 3300046674 Ga0495588_0001695 Ga0495588_0001695_1153_2130 325
910 3300046674 Ga0495588_0040655 Ga0495588_0040655_1321_2298 325
911 3300046674 Ga0495588_0126037 Ga0495588_0126037_36_1013 325
912 3300046675 Ga0495657_0003184 Ga0495657_0003184_7102_8079 325
913 3300046675 Ga0495657_0034766 Ga0495657_0034766_2319_3305 325
914 3300046678 Ga0495599_0000806 Ga0495599_0000806_9137_10114 325
915 3300046678 Ga0495599_0009828 Ga0495599_0009828_702_1679 325
916 3300046679 Ga0495623_0008437 Ga0495623_0008437_5616_6593 325
917 3300046681 Ga0495647_0000638 Ga0495647_0000638_1271_2248 325
918 3300046681 Ga0495647_0007166 Ga0495647_0007166_1653_2630 325
919 3300046683 Ga0495658_0002133 Ga0495658_0002133_8415_9392 325
920 3300046683 Ga0495658_0044890 Ga0495658_0044890_867_1844 325
921 3300046683 Ga0495658_0107390 Ga0495658_0107390_306_1283 325
922 3300046684 Ga0495669_0027321 Ga0495669_0027321_1503_2480 325
923 3300046689 Ga0495613_0051009 Ga0495613_0051009_1453_2430 325
924 3300046689 Ga0495613_0064833 Ga0495613_0064833_1580_2557 325
925 3300046690 Ga0495624_0001411 Ga0495624_0001411_3213_4190 325
926 3300046690 Ga0495624_0031367 Ga0495624_0031367_1248_2225 325
927 3300046690 Ga0495624_0117183 Ga0495624_0117183_355_1341 325
928 3300046691 Ga0495670_0004377 Ga0495670_0004377_4561_5538 325
929 3300046694 Ga0495649_0035904 Ga0495649_0035904_1611_2597 325
930 3300046809 Ga0495600_0000208 Ga0495600_0000208_29588_30565 325
931 3300046809 Ga0495600_0066443 Ga0495600_0066443_1362_2339 325
932 3300046809 Ga0495600_0089176 Ga0495600_0089176_873_1850 325
933 3300047315 Ga0495581_0005790 Ga0495581_0005790_4844_5821 325
934 3300047317 Ga0495604_0001423 Ga0495604_0001423_8803_9780 325
935 3300047319 Ga0495674_0016553 Ga0495674_0016553_4816_5793 325
936 3300047319 Ga0495674_0053424 Ga0495674_0053424_720_1697 325
937 3300047321 Ga0495676_0011575 Ga0495676_0011575_5890_6867 325
938 3300047321 Ga0495676_0036100 Ga0495676_0036100_290_1267 325
939 3300047321 Ga0495676_0080628 Ga0495676_0080628_671_1648 325
940 3300047322 Ga0495680_0001491 Ga0495680_0001491_73_1050 325
941 3300047322 Ga0495680_0002844 Ga0495680_0002844_11258_12235 325
942 3300047322 Ga0495680_0029147 Ga0495680_0029147_1252_2229 325
943 3300047444 Ga0495675_0020212 Ga0495675_0020212_1156_2133 325
944 3300047444 Ga0495675_0176444 Ga0495675_0176444_232_1218 325
945 3300047471 Ga0495684_0064370 Ga0495684_0064370_73_1050 325
946 3300047471 Ga0495684_0149264 Ga0495684_0149264_269_1246 325
947 3300047673 Ga0495593_0000372 Ga0495593_0000372_3032_4009 325
948 3300047673 Ga0495593_0010385 Ga0495593_0010385_3426_4403 325
949 3300047673 Ga0495593_0054779 Ga0495593_0054779_423_1400 325
950 3300047673 Ga0495593_0055548 Ga0495593_0055548_819_1796 325
951 3300047673 Ga0495593_0064268 Ga0495593_0064268_640_1617 325
952 3300048088 Ga0495602_0083964 Ga0495602_0083964_821_1798 325
953 3300048089 Ga0495614_0007981 Ga0495614_0007981_2419_3396 325
954 3300048903 Ga0496100_0005697 Ga0496100_0005697_4502_5482 325
955 3300048904 Ga0496101_0228873 Ga0496101_0228873_410_1390 325
956 3300048904 Ga0496101_0228883 Ga0496101_0228883_410_1390 325
957 3300048905 Ga0496102_0107498 Ga0496102_0107498_1277_2254 325
958 3300048905 Ga0496102_0131082 Ga0496102_0131082_86_1063 325
959 3300048906 Ga0496103_0011847 Ga0496103_0011847_4140_5120 325
960 3300048906 Ga0496103_0044221 Ga0496103_0044221_1709_2689 325
961 3300048906 Ga0496103_0073333 Ga0496103_0073333_820_1797 325
962 3300048906 Ga0496103_0147742 Ga0496103_0147742_61_1038 325
963 3300048907 Ga0496104_0001608 Ga0496104_0001608_12113_13099 325
964 3300048907 Ga0496104_0016648 Ga0496104_0016648_437_1414 325
965 3300048907 Ga0496104_0451451 Ga0496104_0451451_124_1110 325
966 3300048908 Ga0496105_0006281 Ga0496105_0006281_4839_5825 325
967 3300048908 Ga0496105_0103975 Ga0496105_0103975_638_1615 325
968 3300048908 Ga0496105_0128391 Ga0496105_0128391_755_1735 325
969 3300048909 Ga0496106_0006066 Ga0496106_0006066_6107_7084 325
970 3300048909 Ga0496106_0042498 Ga0496106_0042498_1674_2651 325
971 3300048909 Ga0496106_0053524 Ga0496106_0053524_1700_2677 325
972 3300048909 Ga0496106_0080438 Ga0496106_0080438_410_1390 325
973 3300048910 Ga0496107_0003174 Ga0496107_0003174_1366_2343 325
974 3300048910 Ga0496107_0193468 Ga0496107_0193468_55_1035 325
975 3300048910 Ga0496107_0221521 Ga0496107_0221521_373_1353 325
976 3300048910 Ga0496107_0337107 Ga0496107_0337107_70_1056 325
977 3300048911 Ga0496108_0006052 Ga0496108_0006052_5275_6255 325
978 3300048911 Ga0496108_0038993 Ga0496108_0038993_1937_2914 325
979 3300048911 Ga0496108_0043035 Ga0496108_0043035_40_1020 325
980 3300048911 Ga0496108_0103805 Ga0496108_0103805_683_1660 325
981 3300048911 Ga0496108_0113621 Ga0496108_0113621_864_1841 325
982 3300048912 Ga0496109_0008201 Ga0496109_0008201_1853_2830 325
983 3300048912 Ga0496109_0030701 Ga0496109_0030701_860_1846 325
984 3300048912 Ga0496109_0076567 Ga0496109_0076567_309_1286 325
985 3300048912 Ga0496109_0179219 Ga0496109_0179219_289_1266 325
986 3300048913 Ga0496110_0025973 Ga0496110_0025973_1729_2709 325
987 3300048913 Ga0496110_0046934 Ga0496110_0046934_1995_2972 325
988 3300048913 Ga0496110_0114351 Ga0496110_0114351_29_1006 325
989 3300048913 Ga0496110_0269457 Ga0496110_0269457_337_1323 325
990 3300048914 Ga0496111_0005390 Ga0496111_0005390_2297_3277 325
991 3300048914 Ga0496111_0033297 Ga0496111_0033297_1570_2547 325
992 3300048914 Ga0496111_0040973 Ga0496111_0040973_719_1696 325
993 3300048914 Ga0496111_0080316 Ga0496111_0080316_1374_2351 325
994 3300048915 Ga0496112_0000004 Ga0496112_0000004_314114_315100 325
995 3300048915 Ga0496112_0023658 Ga0496112_0023658_4140_5120 325
996 3300048915 Ga0496112_0028755 Ga0496112_0028755_399_1385 325
997 3300048915 Ga0496112_0043941 Ga0496112_0043941_2641_3621 325
998 3300048915 Ga0496112_0098122 Ga0496112_0098122_683_1660 325
999 3300048915 Ga0496112_0172581 Ga0496112_0172581_130_1107 325
1000 3300048916 Ga0496113_0006342 Ga0496113_0006342_6476_7453 325
1001 3300048916 Ga0496113_0100320 Ga0496113_0100320_1008_1994 325
1002 3300048916 Ga0496113_0188936 Ga0496113_0188936_546_1523 325
1003 3300048916 Ga0496113_0284106 Ga0496113_0284106_185_1171 325
1004 3300048917 Ga0496114_0005021 Ga0496114_0005021_3812_4792 325
1005 3300048918 Ga0496115_0027336 Ga0496115_0027336_2726_3706 325
1006 3300048918 Ga0496115_0082053 Ga0496115_0082053_1159_2136 325
1007 3300048918 Ga0496115_0117908 Ga0496115_0117908_755_1735 325
1008 3300048918 Ga0496115_0393293 Ga0496115_0393293_135_1112 325
1009 3300048920 Ga0496117_0032569 Ga0496117_0032569_1342_2328 325
1010 3300048921 Ga0496118_0097639 Ga0496118_0097639_453_1439 325
1011 3300048922 Ga0496119_0003438 Ga0496119_0003438_7503_8489 325
1012 3300048922 Ga0496119_0026329 Ga0496119_0026329_934_1920 325
1013 3300048924 Ga0496121_0000458 Ga0496121_0000458_73613_74599 325
1014 3300048925 Ga0496122_0148270 Ga0496122_0148270_127_1113 325
1015 3300048927 Ga0496124_0143143 Ga0496124_0143143_284_1270 325
1016 3300048928 Ga0496125_0073574 Ga0496125_0073574_1231_2211 325
1017 3300048928 Ga0496125_0155943 Ga0496125_0155943_332_1318 325
1018 3300048928 Ga0496125_0171824 Ga0496125_0171824_37_1023 325
1019 3300048929 Ga0496126_0015313 Ga0496126_0015313_4404_5390 325
1020 3300048929 Ga0496126_0204102 Ga0496126_0204102_58_1044 325
1021 3300049568 Ga0501031_0040419 Ga0501031_0040419_860_1840 325
1022 3300049569 Ga0501032_0020767 Ga0501032_0020767_1482_2462 325
1023 3300049570 Ga0501033_0003747 Ga0501033_0003747_1511_2491 325
1024 3300049570 Ga0501033_0009064 Ga0501033_0009064_6069_7049 325
1025 3300049570 Ga0501033_0057808 Ga0501033_0057808_1135_2118 325
1026 3300049572 Ga0501036_0090229 Ga0501036_0090229_579_1559 325
1027 3300049573 Ga0501037_0000328 Ga0501037_0000328_9853_10833 325
1028 3300049573 Ga0501037_0024107 Ga0501037_0024107_1669_2649 325
1029 3300049574 Ga0501038_0116784 Ga0501038_0116784_516_1496 325
1030 3300049574 Ga0501038_0125102 Ga0501038_0125102_369_1364 325
1031 3300049574 Ga0501038_0274756 Ga0501038_0274756_26_1006 325
1032 3300049579 Ga0501043_0000377 Ga0501043_0000377_29612_30592 325
1033 3300049580 Ga0501046_0026473 Ga0501046_0026473_3704_4684 325
1034 3300049581 Ga0501047_0040563 Ga0501047_0040563_2915_3895 325
1035 3300049581 Ga0501047_0064418 Ga0501047_0064418_2514_3497 325
1036 3300049581 Ga0501047_0145285 Ga0501047_0145285_387_1382 325
1037 3300049582 Ga0501048_0268106 Ga0501048_0268106_65_1048 325
1038 3300049584 Ga0501068_0042908 Ga0501068_0042908_676_1656 325
1039 3300049585 Ga0501069_0000100 Ga0501069_0000100_29612_30592 325
1040 3300049585 Ga0501069_0018526 Ga0501069_0018526_2405_3385 325
1041 3300049586 Ga0501070_0000229 Ga0501070_0000229_38424_39404 325
1042 3300049586 Ga0501070_0000714 Ga0501070_0000714_19885_20865 325
1043 3300049586 Ga0501070_0001806 Ga0501070_0001806_12260_13240 325
1044 3300049586 Ga0501070_0172101 Ga0501070_0172101_651_1643 325
1045 3300049587 Ga0501071_0013118 Ga0501071_0013118_686_1666 325
1046 3300049587 Ga0501071_0017405 Ga0501071_0017405_2739_3719 325
1047 3300049588 Ga0501072_0075492 Ga0501072_0075492_799_1779 325
1048 3300049589 Ga0501073_0017729 Ga0501073_0017729_2861_3841 325
1049 3300049589 Ga0501073_0027631 Ga0501073_0027631_487_1467 325
1050 3300049589 Ga0501073_0068983 Ga0501073_0068983_452_1432 325
1051 3300049590 Ga0501074_0000113 Ga0501074_0000113_29405_30385 325
1052 3300049590 Ga0501074_0020303 Ga0501074_0020303_445_1425 325
1053 3300049741 Ga0501079_0137031 Ga0501079_0137031_253_1233 325
1054 3300049742 Ga0501080_0007250 Ga0501080_0007250_5331_6311 325
1055 3300049742 Ga0501080_0021648 Ga0501080_0021648_1031_2011 325
1056 3300049742 Ga0501080_0047654 Ga0501080_0047654_1276_2268 325
1057 3300049743 Ga0501081_0162792 Ga0501081_0162792_574_1554 325
1058 3300049744 Ga0501083_0000529 Ga0501083_0000529_9856_10836 325
1059 3300049822 Ga0501035_0000373 Ga0501035_0000373_21004_21984 325
1060 3300049822 Ga0501035_0000580 Ga0501035_0000580_9910_10890 325
1061 3300049822 Ga0501035_0003027 Ga0501035_0003027_1471_2451 325
1062 3300049822 Ga0501035_0307857 Ga0501035_0307857_167_1147 325
1063 3300049823 Ga0501044_0000494 Ga0501044_0000494_9914_10894 325
1064 3300049823 Ga0501044_0012523 Ga0501044_0012523_2184_3164 325
1065 3300049823 Ga0501044_0024835 Ga0501044_0024835_2670_3665 325
1066 3300049823 Ga0501044_0032277 Ga0501044_0032277_3397_4377 325
1067 3300049823 Ga0501044_0034815 Ga0501044_0034815_1332_2324 325
1068 3300050492 nmdc:mga0yw44_28739_c1 nmdc:mga0yw44_28739_c1_1463_2449 325
1069 3300050493 nmdc:mga0k408_71829_c1 nmdc:mga0k408_71829_c1_551_1534 325
1070 3300050507 nmdc:mga05p37_30291_c1 nmdc:mga05p37_30291_c1_3486_4463 325
1071 3300050507 nmdc:mga05p37_32_c1 nmdc:mga05p37_32_c1_51008_51985 325
1072 3300050508 nmdc:mga09592_6535_c1 nmdc:mga09592_6535_c1_2355_3332 325
1073 3300050509 nmdc:mga0qj67_355_c1 nmdc:mga0qj67_355_c1_7891_8868 325
1074 3300050510 nmdc:mga06r32_5297_c1 nmdc:mga06r32_5297_c1_8278_9255 325
1075 3300050511 nmdc:mga08y16_175108_c1 nmdc:mga08y16_175108_c1_949_1926 325
1076 3300050511 nmdc:mga08y16_2238_c1 nmdc:mga08y16_2238_c1_14652_15629 325
1077 3300050512 nmdc:mga0n895_101316_c1 nmdc:mga0n895_101316_c1_937_1914 325
1078 3300050512 nmdc:mga0n895_40463_c1 nmdc:mga0n895_40463_c1_613_1596 325
1079 3300050512 nmdc:mga0n895_442378_c1 nmdc:mga0n895_442378_c1_210_1187 325
1080 3300050512 nmdc:mga0n895_452920_c1 nmdc:mga0n895_452920_c1_19_996 325
1081 3300050512 nmdc:mga0n895_547_c1 nmdc:mga0n895_547_c1_22426_23403 325
1082 3300050512 nmdc:mga0n895_67573_c1 nmdc:mga0n895_67573_c1_2267_3244 325
1083 3300050513 nmdc:mga0rr50_2161_c1 nmdc:mga0rr50_2161_c1_6951_7928 325
1084 3300050513 nmdc:mga0rr50_51016_c1 nmdc:mga0rr50_51016_c1_868_1845 325
1085 3300050514 nmdc:mga08x19_143264_c1 nmdc:mga08x19_143264_c1_292_1269 325
1086 3300050514 nmdc:mga08x19_91285_c1 nmdc:mga08x19_91285_c1_730_1707 325
1087 3300050515 nmdc:mga0a205_278960_c1 nmdc:mga0a205_278960_c1_151_1128 325
1088 3300050515 nmdc:mga0a205_629_c1 nmdc:mga0a205_629_c1_2192_3169 325
1089 3300053077 Ga0495601_0004297 Ga0495601_0004297_2537_3514 325
1090 3300053077 Ga0495601_0004847 Ga0495601_0004847_6126_7103 325
1091 3300053077 Ga0495601_0005893 Ga0495601_0005893_4895_5872 325
1092 3300053077 Ga0495601_0007409 Ga0495601_0007409_4869_5846 325
1093 3300053078 Ga0495612_0005828 Ga0495612_0005828_3299_4276 325
1094 3300053080 Ga0500635_0000553 Ga0500635_0000553_1669_2655 325
1095 3300053084 Ga0495595_0002810 Ga0495595_0002810_4084_5061 325
1096 3300053084 Ga0495595_0003361 Ga0495595_0003361_2707_3684 325
1097 3300053084 Ga0495595_0004354 Ga0495595_0004354_906_1883 325
1098 3300053084 Ga0495595_0046712 Ga0495595_0046712_890_1867 325
1099 3300053085 Ga0495619_0000016 Ga0495619_0000016_93835_94812 325
1100 3300053085 Ga0495619_0002830 Ga0495619_0002830_9943_10920 325
1101 3300053085 Ga0495619_0010377 Ga0495619_0010377_3484_4461 325
1102 3300053085 Ga0495619_0030196 Ga0495619_0030196_208_1185 325
1103 3300053085 Ga0495619_0045414 Ga0495619_0045414_230_1207 325
1104 3300053085 Ga0495619_0138516 Ga0495619_0138516_532_1518 325
1105 3300053094 Ga0500566_0131967 Ga0500566_0131967_191_1177 325
1106 3300053095 Ga0500640_024696 Ga0500640_024696_669_1655 325
1107 3300053121 Ga0500607_067427 Ga0500607_067427_326_1312 325
1108 3300053131 Ga0500652_096804 Ga0500652_096804_22_1005 325
1109 3300053139 Ga0500568_0008676 Ga0500568_0008676_2255_3241 325
1110 3300053139 Ga0500568_0073721 Ga0500568_0073721_139_1125 325
1111 3300053150 Ga0500603_001483 Ga0500603_001483_457_1443 325
1112 3300053151 Ga0500604_0019357 Ga0500604_0019357_204_1190 325
1113 3300053178 Ga0500637_0099587 Ga0500637_0099587_442_1428 325
1114 3300053731 Ga0500609_000759 Ga0500609_000759_750_1736 325
1115 3300060353 Ga0501082_0009755 Ga0501082_0009755_1677_2657 325

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04321

RmlD_sub_bind

RmlD substrate binding domain

29

193

0.88

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

31

255

0.82

PF16363

GDP_Man_Dehyd

GDP-mannose 4,6 dehydratase

32

342

0.78

PF01073

3Beta_HSD

3-beta hydroxysteroid dehydrogenase/isomerase family

32

243

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
2hrz-assembly1.cif.gz_A-2 the crystal structure of the nucleoside-diphosphate-sugar epimerase from agrobacterium tumefaciens 0.9846 1 324
2hrz-assembly1.cif.gz_A-2 the crystal structure of the nucleoside-diphosphate-sugar epimerase from agrobacterium tumefaciens 0.9786 1 324
6jyg-assembly1.cif.gz_E crystal structure of l-threonine dehydrogenase from phytophthora infestans 0.8996 1 316
3wmx-assembly2.cif.gz_B gale-like l-threonine dehydrogenase from cupriavidus necator (holo form) 0.894 1 316
7cgv-assembly1.cif.gz_C-2 full consensus l-threonine 3-dehydrogenase, fctdh-iiym (nad+ bound form) 0.8937 1 317
ID Description Score Start End Superfamily
2hrzA02 Alpha Beta;Alpha-Beta Complex;UDP-galactose 4-epimerase; domain 1;UDP-galactose 4-epimerase, domain 1 0.9674 175 324 3.90.25.10
2hrzA02 Alpha Beta;Alpha-Beta Complex;UDP-galactose 4-epimerase; domain 1;UDP-galactose 4-epimerase, domain 1 0.9578 175 324 3.90.25.10
2hrzA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9411 1 302 3.40.50.720
2hrzA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.937 1 302 3.40.50.720
5k4tA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8857 3 316 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A7X3Z7P9-F1-model_v4 NAD-dependent epimerase 0.9923 155 318
AF-A0A530CEN0-F1-model_v4 NAD-dependent epimerase 0.99 192 325
AF-A0A4Q3HRV7-F1-model_v4 deleted 0.9862 99 324
AF-A0A530CEN0-F1-model_v4 NAD-dependent epimerase 0.9755 192 325
AF-A0A439CLK9-F1-model_v4 NAD-dependent epimerase/dehydratase domain-containing protein 0.9697 125 316

Feature Viewer

pLDDT pTM Quality
94.5 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map