F490020
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1098 | 356 | 1098 | 334 |
Family's Representative Sequence
| Representative Sequence | 3300042876|Ga0451577_0025637|Ga0451577_0025637_989_2104 |
| Length | 371 |
| Sequence | MEKTPSPFDSRHPWACFRYNRVDPFLDLIPPTLLLEIIMTDLTTTYLGLKLKNPIVASASPLSKKLDSAKKVADAGASAIVMYSLFEEQIIHESLELDHYLTRGSESFAEAQTYLPDMGTYSLGPDNYITHLSAIKKAVNIPVIGSLNGVSKGGWVRYAKRIEDAGADALELNLYYLATDPNLTANELEDAYVDLVADVKHNIKIPLAVKLSPFFTSIPNIAKRLVLAGADGLVLFNRFYQPDFDLDELKVAPHLILSNSDEMRLPLRWIAILAGQVKTDYALTSGVHSAEDIVKAMMAGARVTMLASALLQNGISLIPTLLSDLEAWLTAHEYTSIGQMQGSMSQTSVAEPAAYERANYMKELNSFKELP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886006 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 4 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 5 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 6 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 7 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 9 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 10 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 11 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 16 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 18 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 20 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 32 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 46 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 47 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 52 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 54 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 62 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 64 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 65 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 66 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 68 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 69 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 70 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 71 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 72 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 73 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 74 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 75 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 76 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 77 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 79 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 80 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 82 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 83 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 84 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 85 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 86 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 87 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 88 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 89 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 91 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 121 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 122 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 186 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 190 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 191 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 192 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 193 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 194 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 195 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 196 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 197 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 198 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 199 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 200 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 201 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 202 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 203 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 204 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 205 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 206 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 207 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 208 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 209 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 210 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 211 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 212 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 213 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 214 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 215 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 216 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 217 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 218 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 219 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 220 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 221 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 222 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 223 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 224 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 225 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 226 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 227 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 228 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 229 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 230 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 231 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 232 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 233 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 234 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 235 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 236 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 237 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 238 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 239 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 240 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 241 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 242 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 243 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 244 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 245 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 246 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 247 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 248 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 249 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 250 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 251 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 252 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 293 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 294 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 295 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 296 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 297 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 298 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 299 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 300 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 301 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 302 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 303 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 304 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 305 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 306 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 307 | 3300049519 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought | Metagenome | Rhizosphere |
| 308 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 309 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 310 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 311 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 312 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 313 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 314 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 315 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 316 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 317 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 318 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 319 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 320 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 321 | 3300049656 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought | Metagenome | Rhizosphere |
| 322 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 323 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 324 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 325 | 3300049667 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control | Metagenome | Rhizosphere |
| 326 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 327 | 3300049672 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought | Metagenome | Rhizosphere |
| 328 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 329 | 3300049683 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control | Metagenome | Rhizosphere |
| 330 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 331 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 332 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 333 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 334 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 335 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 336 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 337 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 338 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 339 | 3300049767 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought | Metagenome | Rhizosphere |
| 340 | 3300049769 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought | Metagenome | Rhizosphere |
| 341 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 342 | 3300049850 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control | Metagenome | Rhizosphere |
| 343 | 3300049851 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought | Metagenome | Rhizosphere |
| 344 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 345 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 346 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 347 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 348 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 349 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 350 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 351 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 352 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 353 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 355 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 356 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.54 |
| Metatranscriptomes | 0.46 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 1.91 |
| Rhizosphere | 97.45 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.64 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL3b_contig_681025 | 2162886006 | Bacteria | 1459 |
| 2 | SwRhRL2b_contig_2683522 | 2162886007 | Bacteria | 2149 |
| 3 | SwRhRL2b_contig_652773 | 2162886007 | Bacteria | 1461 |
| 4 | MBSR1b_contig_601673 | 2162886012 | Bacteria | 1583 |
| 5 | JGI24740J21852_10049521 | 3300001979 | Bacteria | 1213 |
| 6 | JGI24034J26672_10005904 | 3300002239 | Bacteria | 1762 |
| 7 | rootH1_10224381 | 3300003323 | Bacteria | 3493 |
| 8 | Ga0065704_10000241 | 3300005289 | Bacteria | 55852 |
| 9 | Ga0065704_10008237 | 3300005289 | Bacteria | 2265 |
| 10 | Ga0065712_10046738 | 3300005290 | Unclassified | 1335 |
| 11 | Ga0065712_10071124 | 3300005290 | Bacteria | 5468 |
| 12 | Ga0065715_10003747 | 3300005293 | Bacteria | 6386 |
| 13 | Ga0065715_10091017 | 3300005293 | Bacteria | 6192 |
| 14 | Ga0065707_10000706 | 3300005295 | Bacteria | 13095 |
| 15 | Ga0065707_10138711 | 3300005295 | Bacteria | 1772 |
| 16 | Ga0065707_10149800 | 3300005295 | Bacteria | 1671 |
| 17 | Ga0065707_10196167 | 3300005295 | Bacteria | 1324 |
| 18 | Ga0070658_10023980 | 3300005327 | Bacteria | 4895 |
| 19 | Ga0070658_10034204 | 3300005327 | Bacteria | 4089 |
| 20 | Ga0070658_10363036 | 3300005327 | Bacteria | 1241 |
| 21 | Ga0070683_100004370 | 3300005329 | Bacteria | 11629 |
| 22 | Ga0070683_100005766 | 3300005329 | Bacteria | 10350 |
| 23 | Ga0070683_100007607 | 3300005329 | Bacteria | 9162 |
| 24 | Ga0070683_100056213 | 3300005329 | Bacteria | 3654 |
| 25 | Ga0070683_100094743 | 3300005329 | Bacteria | 2806 |
| 26 | Ga0070683_100237463 | 3300005329 | Bacteria | 1733 |
| 27 | Ga0070683_100262099 | 3300005329 | Unclassified | 1644 |
| 28 | Ga0070683_100286184 | 3300005329 | Unclassified | 1568 |
| 29 | Ga0070690_100023500 | 3300005330 | Bacteria | 3780 |
| 30 | Ga0070690_100204621 | 3300005330 | Bacteria | 1375 |
| 31 | Ga0070670_100105102 | 3300005331 | Bacteria | 2433 |
| 32 | Ga0068869_100017812 | 3300005334 | Bacteria | 4825 |
| 33 | Ga0068869_100042553 | 3300005334 | Bacteria | 3256 |
| 34 | Ga0068869_100057516 | 3300005334 | Bacteria | 2839 |
| 35 | Ga0068869_100083554 | 3300005334 | Bacteria | 2389 |
| 36 | Ga0068869_100144681 | 3300005334 | Bacteria | 1839 |
| 37 | Ga0068869_100169852 | 3300005334 | Bacteria | 1703 |
| 38 | Ga0070666_10093592 | 3300005335 | Bacteria | 2066 |
| 39 | Ga0070680_100014282 | 3300005336 | Bacteria | 6203 |
| 40 | Ga0070682_100034532 | 3300005337 | Bacteria | 3081 |
| 41 | Ga0070682_100053662 | 3300005337 | Bacteria | 2527 |
| 42 | Ga0068868_100015082 | 3300005338 | Bacteria | 5708 |
| 43 | Ga0068868_100021815 | 3300005338 | Bacteria | 4826 |
| 44 | Ga0070660_100032099 | 3300005339 | Bacteria | 3950 |
| 45 | Ga0070660_100301746 | 3300005339 | Unclassified | 1313 |
| 46 | Ga0070689_100000419 | 3300005340 | Bacteria | 25025 |
| 47 | Ga0070689_100300757 | 3300005340 | Bacteria | 1335 |
| 48 | Ga0070687_100113034 | 3300005343 | Bacteria | 1540 |
| 49 | Ga0070661_100027236 | 3300005344 | Bacteria | 4114 |
| 50 | Ga0070661_100104999 | 3300005344 | Bacteria | 2105 |
| 51 | Ga0070661_100194398 | 3300005344 | Bacteria | 1548 |
| 52 | Ga0070692_10117023 | 3300005345 | Bacteria | 1481 |
| 53 | Ga0070668_100036615 | 3300005347 | Bacteria | 3745 |
| 54 | Ga0070668_100078190 | 3300005347 | Bacteria | 2587 |
| 55 | Ga0070668_100167284 | 3300005347 | Bacteria | 1788 |
| 56 | Ga0070668_100229670 | 3300005347 | Bacteria | 1533 |
| 57 | Ga0070669_100072167 | 3300005353 | Bacteria | 2555 |
| 58 | Ga0070669_100090563 | 3300005353 | Bacteria | 2293 |
| 59 | Ga0070669_100106929 | 3300005353 | Bacteria | 2119 |
| 60 | Ga0070675_100139419 | 3300005354 | Bacteria | 2072 |
| 61 | Ga0070671_100011927 | 3300005355 | Bacteria | 6991 |
| 62 | Ga0070671_100017015 | 3300005355 | Bacteria | 5881 |
| 63 | Ga0070674_100001100 | 3300005356 | Bacteria | 14197 |
| 64 | Ga0070673_100014452 | 3300005364 | Bacteria | 5501 |
| 65 | Ga0070673_100031142 | 3300005364 | Bacteria | 4000 |
| 66 | Ga0070673_100057376 | 3300005364 | Bacteria | 3076 |
| 67 | Ga0070688_100017343 | 3300005365 | Bacteria | 4132 |
| 68 | Ga0070688_100125440 | 3300005365 | Bacteria | 1725 |
| 69 | Ga0070659_100043648 | 3300005366 | Bacteria | 3507 |
| 70 | Ga0070659_100118024 | 3300005366 | Bacteria | 2146 |
| 71 | Ga0070659_100169346 | 3300005366 | Unclassified | 1788 |
| 72 | Ga0070667_100153681 | 3300005367 | Bacteria | 2023 |
| 73 | Ga0070703_10002794 | 3300005406 | Bacteria | 4999 |
| 74 | Ga0070714_100335790 | 3300005435 | Bacteria | 1416 |
| 75 | Ga0070713_100000174 | 3300005436 | Bacteria | 42901 |
| 76 | Ga0070713_100047339 | 3300005436 | Bacteria | 3534 |
| 77 | Ga0070713_100114312 | 3300005436 | Bacteria | 2358 |
| 78 | Ga0070713_100162738 | 3300005436 | Bacteria | 1993 |
| 79 | Ga0070713_100173904 | 3300005436 | Bacteria | 1931 |
| 80 | Ga0070713_100235756 | 3300005436 | Bacteria | 1665 |
| 81 | Ga0070701_10046427 | 3300005438 | Bacteria | 2233 |
| 82 | Ga0070701_10050367 | 3300005438 | Bacteria | 2156 |
| 83 | Ga0070701_10073707 | 3300005438 | Bacteria | 1832 |
| 84 | Ga0070711_100000867 | 3300005439 | Bacteria | 15914 |
| 85 | Ga0070711_100051367 | 3300005439 | Bacteria | 2831 |
| 86 | Ga0070705_100003937 | 3300005440 | Bacteria | 7260 |
| 87 | Ga0070705_100014354 | 3300005440 | Bacteria | 4073 |
| 88 | Ga0070705_100157900 | 3300005440 | Unclassified | 1513 |
| 89 | Ga0070705_100206242 | 3300005440 | Unclassified | 1351 |
| 90 | Ga0070700_100000048 | 3300005441 | Bacteria | 89854 |
| 91 | Ga0070700_100013640 | 3300005441 | Bacteria | 4569 |
| 92 | Ga0070700_100032002 | 3300005441 | Bacteria | 3158 |
| 93 | Ga0070700_100225792 | 3300005441 | Bacteria | 1330 |
| 94 | Ga0070694_100013258 | 3300005444 | Bacteria | 5146 |
| 95 | Ga0070694_100148928 | 3300005444 | Bacteria | 1707 |
| 96 | Ga0070663_100144797 | 3300005455 | Unclassified | 1817 |
| 97 | Ga0070678_100012161 | 3300005456 | Bacteria | 5338 |
| 98 | Ga0070662_100161021 | 3300005457 | Bacteria | 1755 |
| 99 | Ga0070662_100192912 | 3300005457 | Bacteria | 1612 |
| 100 | Ga0070662_100195726 | 3300005457 | Bacteria | 1601 |
| 101 | Ga0070681_10001179 | 3300005458 | Bacteria | 22582 |
| 102 | Ga0070681_10001428 | 3300005458 | Bacteria | 21024 |
| 103 | Ga0070681_10032325 | 3300005458 | Bacteria | 5250 |
| 104 | Ga0070681_10097768 | 3300005458 | Bacteria | 2882 |
| 105 | Ga0070681_10262387 | 3300005458 | Bacteria | 1639 |
| 106 | Ga0068867_100021999 | 3300005459 | Bacteria | 4555 |
| 107 | Ga0068867_100138575 | 3300005459 | Bacteria | 1899 |
| 108 | Ga0070685_10032777 | 3300005466 | Bacteria | 2912 |
| 109 | Ga0070706_100071055 | 3300005467 | Bacteria | 3219 |
| 110 | Ga0070706_100238941 | 3300005467 | Bacteria | 1696 |
| 111 | Ga0070698_100046771 | 3300005471 | Bacteria | 4424 |
| 112 | Ga0070699_100190757 | 3300005518 | Bacteria | 1820 |
| 113 | Ga0070679_100000282 | 3300005530 | Bacteria | 42961 |
| 114 | Ga0070679_100004238 | 3300005530 | Bacteria | 13233 |
| 115 | Ga0070679_100103795 | 3300005530 | Bacteria | 2829 |
| 116 | Ga0070679_100182498 | 3300005530 | Bacteria | 2070 |
| 117 | Ga0070684_100001487 | 3300005535 | Bacteria | 16916 |
| 118 | Ga0070684_100019174 | 3300005535 | Bacteria | 5656 |
| 119 | Ga0070684_100019798 | 3300005535 | Bacteria | 5573 |
| 120 | Ga0070684_100045982 | 3300005535 | Bacteria | 3782 |
| 121 | Ga0070684_100089992 | 3300005535 | Bacteria | 2728 |
| 122 | Ga0070684_100243401 | 3300005535 | Unclassified | 1644 |
| 123 | Ga0070684_100258961 | 3300005535 | Bacteria | 1591 |
| 124 | Ga0070684_100278697 | 3300005535 | Bacteria | 1532 |
| 125 | Ga0068853_100000527 | 3300005539 | Bacteria | 25905 |
| 126 | Ga0068853_100009875 | 3300005539 | Bacteria | 7706 |
| 127 | Ga0068853_100015941 | 3300005539 | Bacteria | 6177 |
| 128 | Ga0068853_100118867 | 3300005539 | Bacteria | 2355 |
| 129 | Ga0068853_100192477 | 3300005539 | Bacteria | 1853 |
| 130 | Ga0068853_100324093 | 3300005539 | Unclassified | 1429 |
| 131 | Ga0068853_100411846 | 3300005539 | Bacteria | 1266 |
| 132 | Ga0070672_100066428 | 3300005543 | Bacteria | 2856 |
| 133 | Ga0070672_100087133 | 3300005543 | Bacteria | 2512 |
| 134 | Ga0070672_100245107 | 3300005543 | Bacteria | 1508 |
| 135 | Ga0070686_100032724 | 3300005544 | Bacteria | 3190 |
| 136 | Ga0070695_100075331 | 3300005545 | Bacteria | 2220 |
| 137 | Ga0070695_100173099 | 3300005545 | Unclassified | 1524 |
| 138 | Ga0070696_100007001 | 3300005546 | Bacteria | 7523 |
| 139 | Ga0070696_100203446 | 3300005546 | Bacteria | 1479 |
| 140 | Ga0070696_100289502 | 3300005546 | Unclassified | 1251 |
| 141 | Ga0070693_100000797 | 3300005547 | Bacteria | 13939 |
| 142 | Ga0070693_100021826 | 3300005547 | Bacteria | 3397 |
| 143 | Ga0070665_100005415 | 3300005548 | Bacteria | 13167 |
| 144 | Ga0070665_100039360 | 3300005548 | Bacteria | 4754 |
| 145 | Ga0070665_100121976 | 3300005548 | Bacteria | 2608 |
| 146 | Ga0070665_100180386 | 3300005548 | Bacteria | 2112 |
| 147 | Ga0070704_100005092 | 3300005549 | Bacteria | 7645 |
| 148 | Ga0068855_100008707 | 3300005563 | Bacteria | 12267 |
| 149 | Ga0068855_100015371 | 3300005563 | Bacteria | 9215 |
| 150 | Ga0068855_100029282 | 3300005563 | Bacteria | 6586 |
| 151 | Ga0068855_100043128 | 3300005563 | Bacteria | 5345 |
| 152 | Ga0068855_100053805 | 3300005563 | Bacteria | 4735 |
| 153 | Ga0068855_100110332 | 3300005563 | Bacteria | 3158 |
| 154 | Ga0068855_100216870 | 3300005563 | Bacteria | 2148 |
| 155 | Ga0070664_100000979 | 3300005564 | Bacteria | 22356 |
| 156 | Ga0070664_100115108 | 3300005564 | Bacteria | 2350 |
| 157 | Ga0070664_100187255 | 3300005564 | Bacteria | 1843 |
| 158 | Ga0068857_100000681 | 3300005577 | Bacteria | 25256 |
| 159 | Ga0068857_100000870 | 3300005577 | Bacteria | 22717 |
| 160 | Ga0068857_100001403 | 3300005577 | Bacteria | 19017 |
| 161 | Ga0068857_100014630 | 3300005577 | Bacteria | 6843 |
| 162 | Ga0068857_100034346 | 3300005577 | Bacteria | 4486 |
| 163 | Ga0068857_100035684 | 3300005577 | Bacteria | 4404 |
| 164 | Ga0068857_100052200 | 3300005577 | Bacteria | 3628 |
| 165 | Ga0068857_100125106 | 3300005577 | Unclassified | 2316 |
| 166 | Ga0068857_100323491 | 3300005577 | Bacteria | 1425 |
| 167 | Ga0068857_100345503 | 3300005577 | Bacteria | 1377 |
| 168 | Ga0068857_100372412 | 3300005577 | Bacteria | 1325 |
| 169 | Ga0068854_100016541 | 3300005578 | Bacteria | 4919 |
| 170 | Ga0068854_100052719 | 3300005578 | Bacteria | 2918 |
| 171 | Ga0068856_100010085 | 3300005614 | Bacteria | 9182 |
| 172 | Ga0068856_100010319 | 3300005614 | Bacteria | 9076 |
| 173 | Ga0068856_100025278 | 3300005614 | Bacteria | 5788 |
| 174 | Ga0068856_100043012 | 3300005614 | Bacteria | 4444 |
| 175 | Ga0068856_100166164 | 3300005614 | Bacteria | 2218 |
| 176 | Ga0068856_100179327 | 3300005614 | Bacteria | 2131 |
| 177 | Ga0068856_100223372 | 3300005614 | Bacteria | 1899 |
| 178 | Ga0070702_100197601 | 3300005615 | Bacteria | 1328 |
| 179 | Ga0068852_100000003 | 3300005616 | Bacteria | 246525 |
| 180 | Ga0068852_100000341 | 3300005616 | Bacteria | 31489 |
| 181 | Ga0068852_100017737 | 3300005616 | Bacteria | 5593 |
| 182 | Ga0068852_100043024 | 3300005616 | Bacteria | 3828 |
| 183 | Ga0068852_100124042 | 3300005616 | Bacteria | 2369 |
| 184 | Ga0068852_100213434 | 3300005616 | Bacteria | 1832 |
| 185 | Ga0068852_100229912 | 3300005616 | Bacteria | 1767 |
| 186 | Ga0068852_100264092 | 3300005616 | Bacteria | 1654 |
| 187 | Ga0068852_100276776 | 3300005616 | Unclassified | 1617 |
| 188 | Ga0068852_100505167 | 3300005616 | Bacteria | 1204 |
| 189 | Ga0068859_100002655 | 3300005617 | Bacteria | 18164 |
| 190 | Ga0068859_100004804 | 3300005617 | Bacteria | 13756 |
| 191 | Ga0068859_100037039 | 3300005617 | Bacteria | 4896 |
| 192 | Ga0068859_100044899 | 3300005617 | Bacteria | 4440 |
| 193 | Ga0068859_100073999 | 3300005617 | Bacteria | 3445 |
| 194 | Ga0068859_100081817 | 3300005617 | Bacteria | 3272 |
| 195 | Ga0068859_100090690 | 3300005617 | Bacteria | 3107 |
| 196 | Ga0068859_100105134 | 3300005617 | Bacteria | 2882 |
| 197 | Ga0068859_100163663 | 3300005617 | Bacteria | 2304 |
| 198 | Ga0068859_100225811 | 3300005617 | Bacteria | 1961 |
| 199 | Ga0068859_100316950 | 3300005617 | Bacteria | 1653 |
| 200 | Ga0068859_100477341 | 3300005617 | Bacteria | 1342 |
| 201 | Ga0068864_100009115 | 3300005618 | Bacteria | 8180 |
| 202 | Ga0068864_100057042 | 3300005618 | Bacteria | 3374 |
| 203 | Ga0068864_100067133 | 3300005618 | Bacteria | 3114 |
| 204 | Ga0068864_100070413 | 3300005618 | Bacteria | 3043 |
| 205 | Ga0068864_100120999 | 3300005618 | Bacteria | 2340 |
| 206 | Ga0068864_100175032 | 3300005618 | Bacteria | 1959 |
| 207 | Ga0068864_100276860 | 3300005618 | Bacteria | 1565 |
| 208 | Ga0068864_100391067 | 3300005618 | Bacteria | 1320 |
| 209 | Ga0068864_100396124 | 3300005618 | Bacteria | 1311 |
| 210 | Ga0068861_100049891 | 3300005719 | Bacteria | 3171 |
| 211 | Ga0068861_100071782 | 3300005719 | Bacteria | 2684 |
| 212 | Ga0068861_100108277 | 3300005719 | Bacteria | 2223 |
| 213 | Ga0068861_100113100 | 3300005719 | Bacteria | 2178 |
| 214 | Ga0068861_100160688 | 3300005719 | Bacteria | 1853 |
| 215 | Ga0068851_10000999 | 3300005834 | Bacteria | 12268 |
| 216 | Ga0068851_10006100 | 3300005834 | Bacteria | 5499 |
| 217 | Ga0068851_10006394 | 3300005834 | Bacteria | 5377 |
| 218 | Ga0068851_10030944 | 3300005834 | Bacteria | 2656 |
| 219 | Ga0068851_10072590 | 3300005834 | Bacteria | 1783 |
| 220 | Ga0068870_10053498 | 3300005840 | Bacteria | 2144 |
| 221 | Ga0068870_10128420 | 3300005840 | Bacteria | 1469 |
| 222 | Ga0068870_10205480 | 3300005840 | Bacteria | 1196 |
| 223 | Ga0068863_100001291 | 3300005841 | Bacteria | 24999 |
| 224 | Ga0068863_100039664 | 3300005841 | Bacteria | 4479 |
| 225 | Ga0068863_100048139 | 3300005841 | Bacteria | 4043 |
| 226 | Ga0068863_100163812 | 3300005841 | Bacteria | 2131 |
| 227 | Ga0068863_100445652 | 3300005841 | Bacteria | 1270 |
| 228 | Ga0068858_100092441 | 3300005842 | Bacteria | 2816 |
| 229 | Ga0068858_100124770 | 3300005842 | Bacteria | 2410 |
| 230 | Ga0068858_100136830 | 3300005842 | Bacteria | 2299 |
| 231 | Ga0068858_100148194 | 3300005842 | Bacteria | 2205 |
| 232 | Ga0068858_100156523 | 3300005842 | Unclassified | 2144 |
| 233 | Ga0068858_100230606 | 3300005842 | Bacteria | 1755 |
| 234 | Ga0068858_100238369 | 3300005842 | Bacteria | 1725 |
| 235 | Ga0068858_100360710 | 3300005842 | Bacteria | 1393 |
| 236 | Ga0068860_100020939 | 3300005843 | Bacteria | 6336 |
| 237 | Ga0068860_100086192 | 3300005843 | Bacteria | 2989 |
| 238 | Ga0068860_100246834 | 3300005843 | Unclassified | 1737 |
| 239 | Ga0068860_100370797 | 3300005843 | Unclassified | 1412 |
| 240 | Ga0068862_100111420 | 3300005844 | Bacteria | 2402 |
| 241 | Ga0068862_100205667 | 3300005844 | Bacteria | 1777 |
| 242 | Ga0068862_100205972 | 3300005844 | Bacteria | 1775 |
| 243 | Ga0068862_100232506 | 3300005844 | Bacteria | 1673 |
| 244 | Ga0068862_100240550 | 3300005844 | Bacteria | 1646 |
| 245 | Ga0068862_100260961 | 3300005844 | Bacteria | 1581 |
| 246 | Ga0070717_10011870 | 3300006028 | Bacteria | 6629 |
| 247 | Ga0070717_10086684 | 3300006028 | Bacteria | 2636 |
| 248 | Ga0070716_100023651 | 3300006173 | Bacteria | 3260 |
| 249 | Ga0070716_100142389 | 3300006173 | Unclassified | 1531 |
| 250 | Ga0070712_100001352 | 3300006175 | Bacteria | 14882 |
| 251 | Ga0070712_100095543 | 3300006175 | Bacteria | 2187 |
| 252 | Ga0097621_100001224 | 3300006237 | Bacteria | 17786 |
| 253 | Ga0097621_100004180 | 3300006237 | Bacteria | 10016 |
| 254 | Ga0097621_100005272 | 3300006237 | Bacteria | 9100 |
| 255 | Ga0097621_100017286 | 3300006237 | Bacteria | 5473 |
| 256 | Ga0097621_100040644 | 3300006237 | Bacteria | 3740 |
| 257 | Ga0097621_100272221 | 3300006237 | Unclassified | 1488 |
| 258 | Ga0068871_100003384 | 3300006358 | Bacteria | 10964 |
| 259 | Ga0068871_100006260 | 3300006358 | Bacteria | 8395 |
| 260 | Ga0068871_100021192 | 3300006358 | Bacteria | 4992 |
| 261 | Ga0068871_100030188 | 3300006358 | Bacteria | 4266 |
| 262 | Ga0068871_100231310 | 3300006358 | Bacteria | 1604 |
| 263 | Ga0068871_100232449 | 3300006358 | Bacteria | 1600 |
| 264 | Ga0075428_100073296 | 3300006844 | Bacteria | 3739 |
| 265 | Ga0075428_100082916 | 3300006844 | Bacteria | 3498 |
| 266 | Ga0075428_100120336 | 3300006844 | Bacteria | 2858 |
| 267 | Ga0075428_100202163 | 3300006844 | Bacteria | 2147 |
| 268 | Ga0075430_100004095 | 3300006846 | Bacteria | 12299 |
| 269 | Ga0075430_100029407 | 3300006846 | Bacteria | 4663 |
| 270 | Ga0075430_100114798 | 3300006846 | Bacteria | 2244 |
| 271 | Ga0075431_100104680 | 3300006847 | Unclassified | 2920 |
| 272 | Ga0075431_100327904 | 3300006847 | Bacteria | 1542 |
| 273 | Ga0075433_10016769 | 3300006852 | Bacteria | 6048 |
| 274 | Ga0075433_10225467 | 3300006852 | Unclassified | 1664 |
| 275 | Ga0075434_100105754 | 3300006871 | Bacteria | 2824 |
| 276 | Ga0075429_100000179 | 3300006880 | Bacteria | 41128 |
| 277 | Ga0075429_100171528 | 3300006880 | Bacteria | 1900 |
| 278 | Ga0075429_100192801 | 3300006880 | Bacteria | 1785 |
| 279 | Ga0075429_100244645 | 3300006880 | Unclassified | 1571 |
| 280 | Ga0075436_100006092 | 3300006914 | Bacteria | 8279 |
| 281 | Ga0097620_100002655 | 3300006931 | Bacteria | 18164 |
| 282 | Ga0097620_100004805 | 3300006931 | Bacteria | 13756 |
| 283 | Ga0097620_100036153 | 3300006931 | Bacteria | 4958 |
| 284 | Ga0097620_100037038 | 3300006931 | Bacteria | 4896 |
| 285 | Ga0097620_100044894 | 3300006931 | Bacteria | 4440 |
| 286 | Ga0097620_100071101 | 3300006931 | Bacteria | 3515 |
| 287 | Ga0097620_100074004 | 3300006931 | Bacteria | 3445 |
| 288 | Ga0097620_100081816 | 3300006931 | Bacteria | 3272 |
| 289 | Ga0097620_100090700 | 3300006931 | Bacteria | 3107 |
| 290 | Ga0097620_100105132 | 3300006931 | Bacteria | 2882 |
| 291 | Ga0097620_100163670 | 3300006931 | Bacteria | 2304 |
| 292 | Ga0097620_100225815 | 3300006931 | Bacteria | 1961 |
| 293 | Ga0097620_100316969 | 3300006931 | Bacteria | 1653 |
| 294 | Ga0097620_100477360 | 3300006931 | Bacteria | 1342 |
| 295 | Ga0075435_100008999 | 3300007076 | Bacteria | 7203 |
| 296 | Ga0105240_10000077 | 3300009093 | Bacteria | 197213 |
| 297 | Ga0105240_10000114 | 3300009093 | Bacteria | 166405 |
| 298 | Ga0105240_10001213 | 3300009093 | Bacteria | 44943 |
| 299 | Ga0105240_10010907 | 3300009093 | Bacteria | 12733 |
| 300 | Ga0105240_10014675 | 3300009093 | Bacteria | 10691 |
| 301 | Ga0105240_10016545 | 3300009093 | Bacteria | 9983 |
| 302 | Ga0105240_10030039 | 3300009093 | Bacteria | 7069 |
| 303 | Ga0105240_10060412 | 3300009093 | Bacteria | 4725 |
| 304 | Ga0105240_10091837 | 3300009093 | Bacteria | 3708 |
| 305 | Ga0105240_10094756 | 3300009093 | Bacteria | 3641 |
| 306 | Ga0105240_10095421 | 3300009093 | Bacteria | 3626 |
| 307 | Ga0105240_10425188 | 3300009093 | Bacteria | 1491 |
| 308 | Ga0105240_10504323 | 3300009093 | Unclassified | 1345 |
| 309 | Ga0105240_10593883 | 3300009093 | Bacteria | 1220 |
| 310 | Ga0105240_10650306 | 3300009093 | Bacteria | 1155 |
| 311 | Ga0111539_10101956 | 3300009094 | Bacteria | 3369 |
| 312 | Ga0111539_10152947 | 3300009094 | Bacteria | 2700 |
| 313 | Ga0111539_10198342 | 3300009094 | Bacteria | 2341 |
| 314 | Ga0111539_10222023 | 3300009094 | Bacteria | 2201 |
| 315 | Ga0111539_10512008 | 3300009094 | Bacteria | 1398 |
| 316 | Ga0105245_10003427 | 3300009098 | Bacteria | 14208 |
| 317 | Ga0105245_10003452 | 3300009098 | Bacteria | 14163 |
| 318 | Ga0105245_10067864 | 3300009098 | Bacteria | 3230 |
| 319 | Ga0105245_10157598 | 3300009098 | Bacteria | 2151 |
| 320 | Ga0105245_10212210 | 3300009098 | Bacteria | 1864 |
| 321 | Ga0105247_10001389 | 3300009101 | Bacteria | 17563 |
| 322 | Ga0105247_10020805 | 3300009101 | Bacteria | 3946 |
| 323 | Ga0105247_10039696 | 3300009101 | Bacteria | 2876 |
| 324 | Ga0105247_10135107 | 3300009101 | Bacteria | 1611 |
| 325 | Ga0114129_10001382 | 3300009147 | Bacteria | 32663 |
| 326 | Ga0114129_10012495 | 3300009147 | Bacteria | 12088 |
| 327 | Ga0114129_10146958 | 3300009147 | Bacteria | 3228 |
| 328 | Ga0114129_10309765 | 3300009147 | Bacteria | 2102 |
| 329 | Ga0114129_10446551 | 3300009147 | Bacteria | 1697 |
| 330 | Ga0105243_10352890 | 3300009148 | Unclassified | 1351 |
| 331 | Ga0105241_10000112 | 3300009174 | Bacteria | 58201 |
| 332 | Ga0105241_10001115 | 3300009174 | Bacteria | 20456 |
| 333 | Ga0105241_10023766 | 3300009174 | Bacteria | 4548 |
| 334 | Ga0105241_10040087 | 3300009174 | Bacteria | 3535 |
| 335 | Ga0105241_10059397 | 3300009174 | Bacteria | 2940 |
| 336 | Ga0105241_10101942 | 3300009174 | Bacteria | 2283 |
| 337 | Ga0105241_10137621 | 3300009174 | Bacteria | 1985 |
| 338 | Ga0105241_10168091 | 3300009174 | Bacteria | 1809 |
| 339 | Ga0105241_10230088 | 3300009174 | Bacteria | 1562 |
| 340 | Ga0105242_10006860 | 3300009176 | Bacteria | 8781 |
| 341 | Ga0105242_10101199 | 3300009176 | Unclassified | 2442 |
| 342 | Ga0105248_10000432 | 3300009177 | Bacteria | 47503 |
| 343 | Ga0105248_10001800 | 3300009177 | Bacteria | 23832 |
| 344 | Ga0105248_10033471 | 3300009177 | Bacteria | 5741 |
| 345 | Ga0105248_10033672 | 3300009177 | Bacteria | 5725 |
| 346 | Ga0105248_10036277 | 3300009177 | Bacteria | 5514 |
| 347 | Ga0105248_10086266 | 3300009177 | Bacteria | 3532 |
| 348 | Ga0105248_10137095 | 3300009177 | Bacteria | 2760 |
| 349 | Ga0105248_10308455 | 3300009177 | Bacteria | 1782 |
| 350 | Ga0105248_10437012 | 3300009177 | Unclassified | 1474 |
| 351 | Ga0105248_10450867 | 3300009177 | Unclassified | 1450 |
| 352 | Ga0105248_10607895 | 3300009177 | Bacteria | 1233 |
| 353 | Ga0105237_10002295 | 3300009545 | Bacteria | 23777 |
| 354 | Ga0105237_10003756 | 3300009545 | Bacteria | 17893 |
| 355 | Ga0105237_10042887 | 3300009545 | Bacteria | 4560 |
| 356 | Ga0105237_10086573 | 3300009545 | Bacteria | 3123 |
| 357 | Ga0105237_10139014 | 3300009545 | Bacteria | 2423 |
| 358 | Ga0105237_10140979 | 3300009545 | Bacteria | 2405 |
| 359 | Ga0105237_10143703 | 3300009545 | Bacteria | 2380 |
| 360 | Ga0105237_10382646 | 3300009545 | Bacteria | 1412 |
| 361 | Ga0105238_10000446 | 3300009551 | Bacteria | 43281 |
| 362 | Ga0105238_10001879 | 3300009551 | Bacteria | 21078 |
| 363 | Ga0105238_10002900 | 3300009551 | Bacteria | 17125 |
| 364 | Ga0105238_10003133 | 3300009551 | Bacteria | 16505 |
| 365 | Ga0105238_10027746 | 3300009551 | Bacteria | 5770 |
| 366 | Ga0105238_10064721 | 3300009551 | Bacteria | 3656 |
| 367 | Ga0105238_10071794 | 3300009551 | Bacteria | 3459 |
| 368 | Ga0105238_10116338 | 3300009551 | Bacteria | 2653 |
| 369 | Ga0105238_10186084 | 3300009551 | Bacteria | 2053 |
| 370 | Ga0105249_10001827 | 3300009553 | Bacteria | 18510 |
| 371 | Ga0105249_10003348 | 3300009553 | Bacteria | 13872 |
| 372 | Ga0105249_10121551 | 3300009553 | Unclassified | 2482 |
| 373 | Ga0105249_10189851 | 3300009553 | Bacteria | 2005 |
| 374 | Ga0105249_10470380 | 3300009553 | Bacteria | 1298 |
| 375 | Ga0105239_10005246 | 3300010375 | Bacteria | 15244 |
| 376 | Ga0105239_10012072 | 3300010375 | Bacteria | 9632 |
| 377 | Ga0105239_10016785 | 3300010375 | Bacteria | 8093 |
| 378 | Ga0105239_10067036 | 3300010375 | Bacteria | 3942 |
| 379 | Ga0105239_10109075 | 3300010375 | Bacteria | 3067 |
| 380 | Ga0105239_10208483 | 3300010375 | Bacteria | 2190 |
| 381 | Ga0105239_10217230 | 3300010375 | Bacteria | 2144 |
| 382 | Ga0105239_10388124 | 3300010375 | Bacteria | 1579 |
| 383 | Ga0105246_10002464 | 3300011119 | Bacteria | 11182 |
| 384 | Ga0105246_10013890 | 3300011119 | Bacteria | 5054 |
| 385 | Ga0105246_10159104 | 3300011119 | Bacteria | 1719 |
| 386 | Ga0157373_10023761 | 3300013100 | Bacteria | 4441 |
| 387 | Ga0157373_10033812 | 3300013100 | Bacteria | 3674 |
| 388 | Ga0157373_10136348 | 3300013100 | Bacteria | 1726 |
| 389 | Ga0157371_10005555 | 3300013102 | Bacteria | 10601 |
| 390 | Ga0157371_10016619 | 3300013102 | Bacteria | 5486 |
| 391 | Ga0157370_10000001 | 3300013104 | Bacteria | 529517 |
| 392 | Ga0157370_10003878 | 3300013104 | Bacteria | 17426 |
| 393 | Ga0157370_10150110 | 3300013104 | Bacteria | 2169 |
| 394 | Ga0157370_10402500 | 3300013104 | Unclassified | 1260 |
| 395 | Ga0157369_10000066 | 3300013105 | Bacteria | 144815 |
| 396 | Ga0157369_10004092 | 3300013105 | Bacteria | 17272 |
| 397 | Ga0157369_10006435 | 3300013105 | Bacteria | 13616 |
| 398 | Ga0157369_10007131 | 3300013105 | Bacteria | 12888 |
| 399 | Ga0157369_10007580 | 3300013105 | Bacteria | 12490 |
| 400 | Ga0157369_10014963 | 3300013105 | Bacteria | 8756 |
| 401 | Ga0157369_10065249 | 3300013105 | Bacteria | 3919 |
| 402 | Ga0157369_10101687 | 3300013105 | Bacteria | 3063 |
| 403 | Ga0157369_10108310 | 3300013105 | Bacteria | 2955 |
| 404 | Ga0157369_10186157 | 3300013105 | Bacteria | 2183 |
| 405 | Ga0157369_10201885 | 3300013105 | Bacteria | 2086 |
| 406 | Ga0157369_10202223 | 3300013105 | Bacteria | 2085 |
| 407 | Ga0157369_10229224 | 3300013105 | Bacteria | 1942 |
| 408 | Ga0157369_10241064 | 3300013105 | Bacteria | 1889 |
| 409 | Ga0157374_10019339 | 3300013296 | Bacteria | 6028 |
| 410 | Ga0157374_10022063 | 3300013296 | Bacteria | 5675 |
| 411 | Ga0157374_10028405 | 3300013296 | Bacteria | 5053 |
| 412 | Ga0157374_10156868 | 3300013296 | Bacteria | 2216 |
| 413 | Ga0157374_10231293 | 3300013296 | Bacteria | 1816 |
| 414 | Ga0157374_10323602 | 3300013296 | Bacteria | 1528 |
| 415 | Ga0157374_10582203 | 3300013296 | Unclassified | 1128 |
| 416 | Ga0157378_10002106 | 3300013297 | Bacteria | 17735 |
| 417 | Ga0157378_10003078 | 3300013297 | Bacteria | 14816 |
| 418 | Ga0157378_10005729 | 3300013297 | Bacteria | 10876 |
| 419 | Ga0157378_10024665 | 3300013297 | Bacteria | 5295 |
| 420 | Ga0157378_10041121 | 3300013297 | Bacteria | 4100 |
| 421 | Ga0157378_10065533 | 3300013297 | Bacteria | 3251 |
| 422 | Ga0157378_10246464 | 3300013297 | Bacteria | 1709 |
| 423 | Ga0163162_10011531 | 3300013306 | Bacteria | 8621 |
| 424 | Ga0163162_10080001 | 3300013306 | Bacteria | 3335 |
| 425 | Ga0163162_10089988 | 3300013306 | Bacteria | 3150 |
| 426 | Ga0163162_10195287 | 3300013306 | Bacteria | 2152 |
| 427 | Ga0163162_10220681 | 3300013306 | Bacteria | 2026 |
| 428 | Ga0157372_10000038 | 3300013307 | Bacteria | 167357 |
| 429 | Ga0157372_10012960 | 3300013307 | Bacteria | 8891 |
| 430 | Ga0157372_10026501 | 3300013307 | Bacteria | 6307 |
| 431 | Ga0157372_10037252 | 3300013307 | Bacteria | 5363 |
| 432 | Ga0157372_10076032 | 3300013307 | Bacteria | 3791 |
| 433 | Ga0157372_10109820 | 3300013307 | Bacteria | 3159 |
| 434 | Ga0157372_10132881 | 3300013307 | Bacteria | 2865 |
| 435 | Ga0157372_10211101 | 3300013307 | Bacteria | 2250 |
| 436 | Ga0157375_10001477 | 3300013308 | Bacteria | 20190 |
| 437 | Ga0157375_10009678 | 3300013308 | Bacteria | 8474 |
| 438 | Ga0157375_10014359 | 3300013308 | Bacteria | 7062 |
| 439 | Ga0157375_10022781 | 3300013308 | Bacteria | 5768 |
| 440 | Ga0157375_10028238 | 3300013308 | Bacteria | 5256 |
| 441 | Ga0157375_10137877 | 3300013308 | Bacteria | 2565 |
| 442 | Ga0157375_10168495 | 3300013308 | Bacteria | 2336 |
| 443 | Ga0157375_10205848 | 3300013308 | Bacteria | 2124 |
| 444 | Ga0157375_10246594 | 3300013308 | Bacteria | 1947 |
| 445 | Ga0157375_10251425 | 3300013308 | Bacteria | 1928 |
| 446 | Ga0157375_10398202 | 3300013308 | Bacteria | 1544 |
| 447 | Ga0163163_10001025 | 3300014325 | Bacteria | 23680 |
| 448 | Ga0163163_10002404 | 3300014325 | Bacteria | 15841 |
| 449 | Ga0163163_10019171 | 3300014325 | Bacteria | 6419 |
| 450 | Ga0163163_10022943 | 3300014325 | Bacteria | 5917 |
| 451 | Ga0163163_10035662 | 3300014325 | Bacteria | 4826 |
| 452 | Ga0163163_10043777 | 3300014325 | Bacteria | 4391 |
| 453 | Ga0163163_10061166 | 3300014325 | Bacteria | 3731 |
| 454 | Ga0163163_10091636 | 3300014325 | Bacteria | 3054 |
| 455 | Ga0163163_10094084 | 3300014325 | Bacteria | 3014 |
| 456 | Ga0163163_10121890 | 3300014325 | Bacteria | 2642 |
| 457 | Ga0157380_10010057 | 3300014326 | Bacteria | 6791 |
| 458 | Ga0157380_10031371 | 3300014326 | Bacteria | 4079 |
| 459 | Ga0157380_10343737 | 3300014326 | Bacteria | 1393 |
| 460 | Ga0157380_10346729 | 3300014326 | Unclassified | 1388 |
| 461 | Ga0157377_10062622 | 3300014745 | Bacteria | 2128 |
| 462 | Ga0157377_10148376 | 3300014745 | Bacteria | 1448 |
| 463 | Ga0157379_10002365 | 3300014968 | Bacteria | 15755 |
| 464 | Ga0157379_10028822 | 3300014968 | Bacteria | 4937 |
| 465 | Ga0157379_10213457 | 3300014968 | Bacteria | 1747 |
| 466 | Ga0157376_10000361 | 3300014969 | Bacteria | 30056 |
| 467 | Ga0157376_10014459 | 3300014969 | Bacteria | 5927 |
| 468 | Ga0157376_10052814 | 3300014969 | Unclassified | 3381 |
| 469 | Ga0157376_10106099 | 3300014969 | Bacteria | 2464 |
| 470 | Ga0163161_10191924 | 3300017792 | Bacteria | 1571 |
| 471 | Ga0213872_10003691 | 3300021361 | Bacteria | 8380 |
| 472 | Ga0224572_1022753 | 3300024225 | Bacteria | 1204 |
| 473 | Ga0207697_10001005 | 3300025315 | Bacteria | 15781 |
| 474 | Ga0207656_10020141 | 3300025321 | Bacteria | 2648 |
| 475 | Ga0207656_10022576 | 3300025321 | Bacteria | 2526 |
| 476 | Ga0207653_10020003 | 3300025885 | Bacteria | 2116 |
| 477 | Ga0207682_10001037 | 3300025893 | Bacteria | 12816 |
| 478 | Ga0207710_10007316 | 3300025900 | Bacteria | 4678 |
| 479 | Ga0207710_10007728 | 3300025900 | Bacteria | 4549 |
| 480 | Ga0207688_10036956 | 3300025901 | Bacteria | 2707 |
| 481 | Ga0207680_10074580 | 3300025903 | Bacteria | 2113 |
| 482 | Ga0207680_10099610 | 3300025903 | Bacteria | 1865 |
| 483 | Ga0207647_10001387 | 3300025904 | Bacteria | 18615 |
| 484 | Ga0207645_10008205 | 3300025907 | Bacteria | 7307 |
| 485 | Ga0207643_10002407 | 3300025908 | Bacteria | 10126 |
| 486 | Ga0207643_10014699 | 3300025908 | Bacteria | 4256 |
| 487 | Ga0207643_10165265 | 3300025908 | Bacteria | 1333 |
| 488 | Ga0207705_10122053 | 3300025909 | Bacteria | 1934 |
| 489 | Ga0207684_10207104 | 3300025910 | Bacteria | 1692 |
| 490 | Ga0207654_10000028 | 3300025911 | Bacteria | 125787 |
| 491 | Ga0207654_10000923 | 3300025911 | Bacteria | 16231 |
| 492 | Ga0207654_10009537 | 3300025911 | Bacteria | 4932 |
| 493 | Ga0207654_10012799 | 3300025911 | Bacteria | 4305 |
| 494 | Ga0207654_10017182 | 3300025911 | Bacteria | 3779 |
| 495 | Ga0207654_10043148 | 3300025911 | Bacteria | 2555 |
| 496 | Ga0207654_10086023 | 3300025911 | Bacteria | 1905 |
| 497 | Ga0207707_10012176 | 3300025912 | Bacteria | 7478 |
| 498 | Ga0207707_10029108 | 3300025912 | Bacteria | 4827 |
| 499 | Ga0207695_10000026 | 3300025913 | Bacteria | 624558 |
| 500 | Ga0207695_10000063 | 3300025913 | Bacteria | 349527 |
| 501 | Ga0207695_10000168 | 3300025913 | Bacteria | 193087 |
| 502 | Ga0207695_10000707 | 3300025913 | Bacteria | 64975 |
| 503 | Ga0207695_10002562 | 3300025913 | Bacteria | 26715 |
| 504 | Ga0207695_10010282 | 3300025913 | Bacteria | 11464 |
| 505 | Ga0207695_10022992 | 3300025913 | Bacteria | 7060 |
| 506 | Ga0207695_10092568 | 3300025913 | Bacteria | 3033 |
| 507 | Ga0207695_10123138 | 3300025913 | Bacteria | 2559 |
| 508 | Ga0207695_10235644 | 3300025913 | Bacteria | 1733 |
| 509 | Ga0207695_10266506 | 3300025913 | Bacteria | 1609 |
| 510 | Ga0207671_10000162 | 3300025914 | Bacteria | 103793 |
| 511 | Ga0207671_10000279 | 3300025914 | Bacteria | 76291 |
| 512 | Ga0207671_10000894 | 3300025914 | Bacteria | 37708 |
| 513 | Ga0207671_10001367 | 3300025914 | Bacteria | 28449 |
| 514 | Ga0207671_10092148 | 3300025914 | Unclassified | 2284 |
| 515 | Ga0207671_10185120 | 3300025914 | Bacteria | 1622 |
| 516 | Ga0207693_10001541 | 3300025915 | Bacteria | 20353 |
| 517 | Ga0207663_10011855 | 3300025916 | Bacteria | 4692 |
| 518 | Ga0207660_10101539 | 3300025917 | Bacteria | 2149 |
| 519 | Ga0207662_10009332 | 3300025918 | Bacteria | 5394 |
| 520 | Ga0207657_10011469 | 3300025919 | Bacteria | 8799 |
| 521 | Ga0207657_10014078 | 3300025919 | Bacteria | 7827 |
| 522 | Ga0207657_10278785 | 3300025919 | Unclassified | 1327 |
| 523 | Ga0207649_10007401 | 3300025920 | Bacteria | 5973 |
| 524 | Ga0207649_10022061 | 3300025920 | Bacteria | 3676 |
| 525 | Ga0207652_10022303 | 3300025921 | Bacteria | 5237 |
| 526 | Ga0207652_10081837 | 3300025921 | Bacteria | 2824 |
| 527 | Ga0207652_10158373 | 3300025921 | Bacteria | 2029 |
| 528 | Ga0207681_10009177 | 3300025923 | Bacteria | 6043 |
| 529 | Ga0207681_10099318 | 3300025923 | Bacteria | 2096 |
| 530 | Ga0207694_10000144 | 3300025924 | Bacteria | 74051 |
| 531 | Ga0207694_10000346 | 3300025924 | Bacteria | 43815 |
| 532 | Ga0207694_10002660 | 3300025924 | Bacteria | 14479 |
| 533 | Ga0207694_10005604 | 3300025924 | Bacteria | 9621 |
| 534 | Ga0207694_10014641 | 3300025924 | Bacteria | 5914 |
| 535 | Ga0207694_10044001 | 3300025924 | Bacteria | 3447 |
| 536 | Ga0207694_10055734 | 3300025924 | Bacteria | 3068 |
| 537 | Ga0207694_10157491 | 3300025924 | Bacteria | 1833 |
| 538 | Ga0207650_10002835 | 3300025925 | Bacteria | 11978 |
| 539 | Ga0207650_10263554 | 3300025925 | Bacteria | 1398 |
| 540 | Ga0207650_10308096 | 3300025925 | Bacteria | 1295 |
| 541 | Ga0207659_10050486 | 3300025926 | Bacteria | 2955 |
| 542 | Ga0207687_10038330 | 3300025927 | Bacteria | 3275 |
| 543 | Ga0207687_10178857 | 3300025927 | Bacteria | 1642 |
| 544 | Ga0207687_10270698 | 3300025927 | Bacteria | 1358 |
| 545 | Ga0207700_10000283 | 3300025928 | Bacteria | 30148 |
| 546 | Ga0207700_10030745 | 3300025928 | Bacteria | 3807 |
| 547 | Ga0207700_10064688 | 3300025928 | Bacteria | 2787 |
| 548 | Ga0207700_10148476 | 3300025928 | Bacteria | 1935 |
| 549 | Ga0207644_10002100 | 3300025931 | Bacteria | 12912 |
| 550 | Ga0207644_10007797 | 3300025931 | Bacteria | 6994 |
| 551 | Ga0207644_10054347 | 3300025931 | Bacteria | 2884 |
| 552 | Ga0207690_10066688 | 3300025932 | Bacteria | 2466 |
| 553 | Ga0207706_10006950 | 3300025933 | Bacteria | 10462 |
| 554 | Ga0207706_10026871 | 3300025933 | Bacteria | 5151 |
| 555 | Ga0207706_10422490 | 3300025933 | Bacteria | 1155 |
| 556 | Ga0207709_10090408 | 3300025935 | Bacteria | 1999 |
| 557 | Ga0207709_10141924 | 3300025935 | Unclassified | 1652 |
| 558 | Ga0207670_10002664 | 3300025936 | Bacteria | 9391 |
| 559 | Ga0207670_10115971 | 3300025936 | Bacteria | 1938 |
| 560 | Ga0207669_10002002 | 3300025937 | Bacteria | 8652 |
| 561 | Ga0207669_10167863 | 3300025937 | Bacteria | 1559 |
| 562 | Ga0207704_10046721 | 3300025938 | Bacteria | 2582 |
| 563 | Ga0207704_10174750 | 3300025938 | Bacteria | 1545 |
| 564 | Ga0207665_10011206 | 3300025939 | Bacteria | 5884 |
| 565 | Ga0207665_10022210 | 3300025939 | Bacteria | 4172 |
| 566 | Ga0207665_10041465 | 3300025939 | Bacteria | 3074 |
| 567 | Ga0207691_10008092 | 3300025940 | Bacteria | 10096 |
| 568 | Ga0207691_10182012 | 3300025940 | Bacteria | 1836 |
| 569 | Ga0207691_10204794 | 3300025940 | Bacteria | 1716 |
| 570 | Ga0207711_10000871 | 3300025941 | Bacteria | 29139 |
| 571 | Ga0207711_10005683 | 3300025941 | Bacteria | 10536 |
| 572 | Ga0207711_10014644 | 3300025941 | Bacteria | 6518 |
| 573 | Ga0207711_10083621 | 3300025941 | Bacteria | 2792 |
| 574 | Ga0207711_10124503 | 3300025941 | Bacteria | 2305 |
| 575 | Ga0207711_10163373 | 3300025941 | Bacteria | 2017 |
| 576 | Ga0207711_10319379 | 3300025941 | Bacteria | 1435 |
| 577 | Ga0207689_10001682 | 3300025942 | Bacteria | 21004 |
| 578 | Ga0207689_10004120 | 3300025942 | Bacteria | 13218 |
| 579 | Ga0207689_10109215 | 3300025942 | Bacteria | 2273 |
| 580 | Ga0207689_10160121 | 3300025942 | Bacteria | 1855 |
| 581 | Ga0207689_10399250 | 3300025942 | Unclassified | 1146 |
| 582 | Ga0207661_10002016 | 3300025944 | Bacteria | 13997 |
| 583 | Ga0207661_10043546 | 3300025944 | Bacteria | 3543 |
| 584 | Ga0207661_10097689 | 3300025944 | Bacteria | 2460 |
| 585 | Ga0207661_10150497 | 3300025944 | Bacteria | 2011 |
| 586 | Ga0207661_10162200 | 3300025944 | Bacteria | 1940 |
| 587 | Ga0207661_10311235 | 3300025944 | Unclassified | 1414 |
| 588 | Ga0207679_10012634 | 3300025945 | Bacteria | 5512 |
| 589 | Ga0207667_10000123 | 3300025949 | Bacteria | 120422 |
| 590 | Ga0207667_10001348 | 3300025949 | Bacteria | 30814 |
| 591 | Ga0207667_10002645 | 3300025949 | Bacteria | 22142 |
| 592 | Ga0207667_10079454 | 3300025949 | Bacteria | 3399 |
| 593 | Ga0207667_10208158 | 3300025949 | Bacteria | 2005 |
| 594 | Ga0207651_10004652 | 3300025960 | Bacteria | 6957 |
| 595 | Ga0207651_10015215 | 3300025960 | Bacteria | 4465 |
| 596 | Ga0207651_10057930 | 3300025960 | Bacteria | 2675 |
| 597 | Ga0207651_10140278 | 3300025960 | Bacteria | 1866 |
| 598 | Ga0207712_10199018 | 3300025961 | Bacteria | 1587 |
| 599 | Ga0207712_10343925 | 3300025961 | Bacteria | 1238 |
| 600 | Ga0207668_10247760 | 3300025972 | Bacteria | 1445 |
| 601 | Ga0207640_10039034 | 3300025981 | Unclassified | 3002 |
| 602 | Ga0207658_10022072 | 3300025986 | Bacteria | 4427 |
| 603 | Ga0207658_10158118 | 3300025986 | Bacteria | 1854 |
| 604 | Ga0207677_10003066 | 3300026023 | Bacteria | 8829 |
| 605 | Ga0207677_10124524 | 3300026023 | Unclassified | 1945 |
| 606 | Ga0207677_10189467 | 3300026023 | Bacteria | 1625 |
| 607 | Ga0207703_10015003 | 3300026035 | Bacteria | 6046 |
| 608 | Ga0207703_10025692 | 3300026035 | Bacteria | 4633 |
| 609 | Ga0207703_10050281 | 3300026035 | Bacteria | 3373 |
| 610 | Ga0207703_10055430 | 3300026035 | Bacteria | 3225 |
| 611 | Ga0207703_10173700 | 3300026035 | Bacteria | 1897 |
| 612 | Ga0207703_10175723 | 3300026035 | Unclassified | 1887 |
| 613 | Ga0207703_10285339 | 3300026035 | Bacteria | 1501 |
| 614 | Ga0207639_10001215 | 3300026041 | Bacteria | 17486 |
| 615 | Ga0207639_10050627 | 3300026041 | Bacteria | 3155 |
| 616 | Ga0207639_10064381 | 3300026041 | Bacteria | 2842 |
| 617 | Ga0207639_10111063 | 3300026041 | Bacteria | 2234 |
| 618 | Ga0207639_10123859 | 3300026041 | Bacteria | 2128 |
| 619 | Ga0207639_10302564 | 3300026041 | Unclassified | 1414 |
| 620 | Ga0207678_10002154 | 3300026067 | Bacteria | 17812 |
| 621 | Ga0207708_10000054 | 3300026075 | Bacteria | 103599 |
| 622 | Ga0207708_10003738 | 3300026075 | Bacteria | 11228 |
| 623 | Ga0207708_10042425 | 3300026075 | Bacteria | 3468 |
| 624 | Ga0207708_10108170 | 3300026075 | Bacteria | 2156 |
| 625 | Ga0207702_10012052 | 3300026078 | Bacteria | 7189 |
| 626 | Ga0207702_10041355 | 3300026078 | Bacteria | 3865 |
| 627 | Ga0207702_10085261 | 3300026078 | Bacteria | 2752 |
| 628 | Ga0207702_10109259 | 3300026078 | Bacteria | 2455 |
| 629 | Ga0207702_10130787 | 3300026078 | Bacteria | 2258 |
| 630 | Ga0207702_10595788 | 3300026078 | Bacteria | 1084 |
| 631 | Ga0207641_10128820 | 3300026088 | Bacteria | 2269 |
| 632 | Ga0207641_10412909 | 3300026088 | Bacteria | 1298 |
| 633 | Ga0207648_10226610 | 3300026089 | Bacteria | 1662 |
| 634 | Ga0207648_10241084 | 3300026089 | Bacteria | 1610 |
| 635 | Ga0207676_10007279 | 3300026095 | Bacteria | 7842 |
| 636 | Ga0207676_10022890 | 3300026095 | Bacteria | 4599 |
| 637 | Ga0207676_10052832 | 3300026095 | Bacteria | 3178 |
| 638 | Ga0207676_10064134 | 3300026095 | Bacteria | 2920 |
| 639 | Ga0207676_10162623 | 3300026095 | Bacteria | 1936 |
| 640 | Ga0207676_10243096 | 3300026095 | Bacteria | 1616 |
| 641 | Ga0207676_10258613 | 3300026095 | Bacteria | 1570 |
| 642 | Ga0207676_10272336 | 3300026095 | Bacteria | 1534 |
| 643 | Ga0207674_10000488 | 3300026116 | Bacteria | 52346 |
| 644 | Ga0207674_10005666 | 3300026116 | Bacteria | 14808 |
| 645 | Ga0207674_10006829 | 3300026116 | Bacteria | 13385 |
| 646 | Ga0207674_10007120 | 3300026116 | Bacteria | 13066 |
| 647 | Ga0207674_10038045 | 3300026116 | Bacteria | 4999 |
| 648 | Ga0207674_10412978 | 3300026116 | Bacteria | 1304 |
| 649 | Ga0207675_100002285 | 3300026118 | Bacteria | 19034 |
| 650 | Ga0207675_100022449 | 3300026118 | Bacteria | 5877 |
| 651 | Ga0207675_100034625 | 3300026118 | Bacteria | 4709 |
| 652 | Ga0207675_100069121 | 3300026118 | Bacteria | 3301 |
| 653 | Ga0207675_100282810 | 3300026118 | Bacteria | 1612 |
| 654 | Ga0207675_100298216 | 3300026118 | Bacteria | 1569 |
| 655 | Ga0207675_100398261 | 3300026118 | Unclassified | 1356 |
| 656 | Ga0207683_10003867 | 3300026121 | Bacteria | 12989 |
| 657 | Ga0207683_10060910 | 3300026121 | Unclassified | 3319 |
| 658 | Ga0207683_10109140 | 3300026121 | Bacteria | 2477 |
| 659 | Ga0207683_10144404 | 3300026121 | Bacteria | 2145 |
| 660 | Ga0207698_10000068 | 3300026142 | Bacteria | 69581 |
| 661 | Ga0207698_10000224 | 3300026142 | Bacteria | 35191 |
| 662 | Ga0207698_10009699 | 3300026142 | Bacteria | 6149 |
| 663 | Ga0207698_10061577 | 3300026142 | Bacteria | 2925 |
| 664 | Ga0207698_10087959 | 3300026142 | Bacteria | 2532 |
| 665 | Ga0207698_10367444 | 3300026142 | Unclassified | 1364 |
| 666 | Ga0207698_10442631 | 3300026142 | Bacteria | 1252 |
| 667 | Ga0207698_10471203 | 3300026142 | Bacteria | 1216 |
| 668 | Ga0209971_1023048 | 3300027682 | Bacteria | 1484 |
| 669 | Ga0209974_10008493 | 3300027876 | Bacteria | 3509 |
| 670 | Ga0207428_10013684 | 3300027907 | Bacteria | 7076 |
| 671 | Ga0207428_10217621 | 3300027907 | Bacteria | 1433 |
| 672 | Ga0268266_10003238 | 3300028379 | Bacteria | 16441 |
| 673 | Ga0268266_10037502 | 3300028379 | Bacteria | 4128 |
| 674 | Ga0268266_10256127 | 3300028379 | Bacteria | 1620 |
| 675 | Ga0268265_10120983 | 3300028380 | Bacteria | 2157 |
| 676 | Ga0268265_10289274 | 3300028380 | Bacteria | 1470 |
| 677 | Ga0268265_10577518 | 3300028380 | Bacteria | 1071 |
| 678 | Ga0268264_10008533 | 3300028381 | Bacteria | 8516 |
| 679 | Ga0268264_10203779 | 3300028381 | Unclassified | 1812 |
| 680 | Ga0268264_10249167 | 3300028381 | Bacteria | 1649 |
| 681 | Ga0265319_1000487 | 3300028563 | Bacteria | 27649 |
| 682 | Ga0265319_1004533 | 3300028563 | Bacteria | 6852 |
| 683 | Ga0265319_1008838 | 3300028563 | Bacteria | 4366 |
| 684 | Ga0265334_10000818 | 3300028573 | Bacteria | 15548 |
| 685 | Ga0265334_10048771 | 3300028573 | Unclassified | 1630 |
| 686 | Ga0265334_10053388 | 3300028573 | Bacteria | 1544 |
| 687 | Ga0265318_10000369 | 3300028577 | Bacteria | 35381 |
| 688 | Ga0265318_10007193 | 3300028577 | Bacteria | 5058 |
| 689 | Ga0265318_10077295 | 3300028577 | Bacteria | 1231 |
| 690 | Ga0265323_10016793 | 3300028653 | Bacteria | 2851 |
| 691 | Ga0265323_10062036 | 3300028653 | Bacteria | 1298 |
| 692 | Ga0265336_10002155 | 3300028666 | Bacteria | 8318 |
| 693 | Ga0265336_10005323 | 3300028666 | Bacteria | 4763 |
| 694 | Ga0265336_10024607 | 3300028666 | Bacteria | 1900 |
| 695 | Ga0265338_10002513 | 3300028800 | Bacteria | 27271 |
| 696 | Ga0265338_10003733 | 3300028800 | Bacteria | 21176 |
| 697 | Ga0265338_10006524 | 3300028800 | Bacteria | 14835 |
| 698 | Ga0265338_10016308 | 3300028800 | Bacteria | 8092 |
| 699 | Ga0265338_10016699 | 3300028800 | Bacteria | 7955 |
| 700 | Ga0265338_10043165 | 3300028800 | Bacteria | 4186 |
| 701 | Ga0265338_10048139 | 3300028800 | Bacteria | 3883 |
| 702 | Ga0265338_10048724 | 3300028800 | Bacteria | 3851 |
| 703 | Ga0265762_1006038 | 3300030760 | Bacteria | 2171 |
| 704 | Ga0265330_10000198 | 3300031235 | Bacteria | 46563 |
| 705 | Ga0265330_10000202 | 3300031235 | Bacteria | 46065 |
| 706 | Ga0265330_10000913 | 3300031235 | Bacteria | 18224 |
| 707 | Ga0265330_10006383 | 3300031235 | Bacteria | 5826 |
| 708 | Ga0265330_10040749 | 3300031235 | Bacteria | 2061 |
| 709 | Ga0265330_10060368 | 3300031235 | Unclassified | 1650 |
| 710 | Ga0265332_10000883 | 3300031238 | Bacteria | 18081 |
| 711 | Ga0265332_10009085 | 3300031238 | Bacteria | 4444 |
| 712 | Ga0265332_10027296 | 3300031238 | Bacteria | 2501 |
| 713 | Ga0265328_10006951 | 3300031239 | Bacteria | 4750 |
| 714 | Ga0265328_10012399 | 3300031239 | Bacteria | 3393 |
| 715 | Ga0265328_10013313 | 3300031239 | Bacteria | 3259 |
| 716 | Ga0265320_10001956 | 3300031240 | Bacteria | 14549 |
| 717 | Ga0265320_10002237 | 3300031240 | Bacteria | 13579 |
| 718 | Ga0265320_10002575 | 3300031240 | Bacteria | 12602 |
| 719 | Ga0265320_10003710 | 3300031240 | Bacteria | 10188 |
| 720 | Ga0265320_10055189 | 3300031240 | Bacteria | 1913 |
| 721 | Ga0265320_10112922 | 3300031240 | Bacteria | 1243 |
| 722 | Ga0265325_10000269 | 3300031241 | Bacteria | 37019 |
| 723 | Ga0265325_10001559 | 3300031241 | Bacteria | 15977 |
| 724 | Ga0265325_10012353 | 3300031241 | Bacteria | 4887 |
| 725 | Ga0265329_10035888 | 3300031242 | Bacteria | 1600 |
| 726 | Ga0265340_10013709 | 3300031247 | Bacteria | 4251 |
| 727 | Ga0265340_10031007 | 3300031247 | Bacteria | 2676 |
| 728 | Ga0265340_10072299 | 3300031247 | Bacteria | 1633 |
| 729 | Ga0265339_10000003 | 3300031249 | Bacteria | 305994 |
| 730 | Ga0265339_10000118 | 3300031249 | Bacteria | 65006 |
| 731 | Ga0265339_10000324 | 3300031249 | Bacteria | 38292 |
| 732 | Ga0265339_10000747 | 3300031249 | Bacteria | 25123 |
| 733 | Ga0265339_10014030 | 3300031249 | Bacteria | 4840 |
| 734 | Ga0265339_10025773 | 3300031249 | Bacteria | 3371 |
| 735 | Ga0265339_10038891 | 3300031249 | Bacteria | 2651 |
| 736 | Ga0265339_10040091 | 3300031249 | Bacteria | 2604 |
| 737 | Ga0265339_10047392 | 3300031249 | Bacteria | 2360 |
| 738 | Ga0265339_10087552 | 3300031249 | Unclassified | 1637 |
| 739 | Ga0265327_10000029 | 3300031251 | Bacteria | 352607 |
| 740 | Ga0265327_10002947 | 3300031251 | Bacteria | 17010 |
| 741 | Ga0265327_10011290 | 3300031251 | Bacteria | 6171 |
| 742 | Ga0265316_10000084 | 3300031344 | Bacteria | 99744 |
| 743 | Ga0265316_10001391 | 3300031344 | Bacteria | 26069 |
| 744 | Ga0265316_10001449 | 3300031344 | Bacteria | 25469 |
| 745 | Ga0265316_10001682 | 3300031344 | Bacteria | 23511 |
| 746 | Ga0265316_10002239 | 3300031344 | Bacteria | 20282 |
| 747 | Ga0265316_10006013 | 3300031344 | Bacteria | 11670 |
| 748 | Ga0265316_10010277 | 3300031344 | Bacteria | 8538 |
| 749 | Ga0265316_10015566 | 3300031344 | Bacteria | 6643 |
| 750 | Ga0265316_10033791 | 3300031344 | Bacteria | 4161 |
| 751 | Ga0265316_10047095 | 3300031344 | Bacteria | 3413 |
| 752 | Ga0265316_10049726 | 3300031344 | Bacteria | 3301 |
| 753 | Ga0265316_10050188 | 3300031344 | Bacteria | 3283 |
| 754 | Ga0265316_10132766 | 3300031344 | Bacteria | 1874 |
| 755 | Ga0265316_10148638 | 3300031344 | Bacteria | 1756 |
| 756 | Ga0265316_10183121 | 3300031344 | Unclassified | 1559 |
| 757 | Ga0307408_100028500 | 3300031548 | Bacteria | 3859 |
| 758 | Ga0265313_10003096 | 3300031595 | Bacteria | 13787 |
| 759 | Ga0265313_10009568 | 3300031595 | Bacteria | 6274 |
| 760 | Ga0265313_10020761 | 3300031595 | Bacteria | 3614 |
| 761 | Ga0265313_10030763 | 3300031595 | Bacteria | 2759 |
| 762 | Ga0316575_10006974 | 3300031665 | Bacteria | 4087 |
| 763 | Ga0316575_10010767 | 3300031665 | Bacteria | 3370 |
| 764 | Ga0316579_10000759 | 3300031691 | Bacteria | 11053 |
| 765 | Ga0316579_10027277 | 3300031691 | Bacteria | 2592 |
| 766 | Ga0316579_10065017 | 3300031691 | Unclassified | 1721 |
| 767 | Ga0265314_10000064 | 3300031711 | Bacteria | 158787 |
| 768 | Ga0265314_10000076 | 3300031711 | Bacteria | 146266 |
| 769 | Ga0265314_10001590 | 3300031711 | Bacteria | 24962 |
| 770 | Ga0265314_10003765 | 3300031711 | Bacteria | 14505 |
| 771 | Ga0265314_10007667 | 3300031711 | Bacteria | 9332 |
| 772 | Ga0265314_10040648 | 3300031711 | Bacteria | 3336 |
| 773 | Ga0265314_10125242 | 3300031711 | Bacteria | 1610 |
| 774 | Ga0265342_10000147 | 3300031712 | Bacteria | 79849 |
| 775 | Ga0265342_10001403 | 3300031712 | Bacteria | 22490 |
| 776 | Ga0265342_10002544 | 3300031712 | Bacteria | 15686 |
| 777 | Ga0265342_10010272 | 3300031712 | Bacteria | 6516 |
| 778 | Ga0265342_10011353 | 3300031712 | Bacteria | 6104 |
| 779 | Ga0265342_10016372 | 3300031712 | Bacteria | 4850 |
| 780 | Ga0265342_10023235 | 3300031712 | Bacteria | 3928 |
| 781 | Ga0265342_10040119 | 3300031712 | Bacteria | 2840 |
| 782 | Ga0265342_10040853 | 3300031712 | Unclassified | 2811 |
| 783 | Ga0316576_10002147 | 3300031727 | Bacteria | 11111 |
| 784 | Ga0316576_10013473 | 3300031727 | Bacteria | 5437 |
| 785 | Ga0316576_10021570 | 3300031727 | Bacteria | 4458 |
| 786 | Ga0316576_10022143 | 3300031727 | Bacteria | 4410 |
| 787 | Ga0316576_10161689 | 3300031727 | Bacteria | 1689 |
| 788 | Ga0316578_10039253 | 3300031728 | Bacteria | 2734 |
| 789 | Ga0316578_10050371 | 3300031728 | Bacteria | 2436 |
| 790 | Ga0307405_10027977 | 3300031731 | Bacteria | 3277 |
| 791 | Ga0307405_10098876 | 3300031731 | Unclassified | 1952 |
| 792 | Ga0316577_10001105 | 3300031733 | Bacteria | 12270 |
| 793 | Ga0316577_10008449 | 3300031733 | Bacteria | 5520 |
| 794 | Ga0316577_10012664 | 3300031733 | Bacteria | 4599 |
| 795 | Ga0316577_10042730 | 3300031733 | Bacteria | 2536 |
| 796 | Ga0307410_10002358 | 3300031852 | Bacteria | 9099 |
| 797 | Ga0307406_10005486 | 3300031901 | Bacteria | 6941 |
| 798 | Ga0307409_100278434 | 3300031995 | Bacteria | 1545 |
| 799 | Ga0307414_10024781 | 3300032004 | Bacteria | 3831 |
| 800 | Ga0307414_10316112 | 3300032004 | Unclassified | 1327 |
| 801 | Ga0307411_10031270 | 3300032005 | Bacteria | 3273 |
| 802 | Ga0307411_10131321 | 3300032005 | Bacteria | 1831 |
| 803 | Ga0307415_100215914 | 3300032126 | Bacteria | 1534 |
| 804 | Ga0316593_10001992 | 3300032168 | Bacteria | 4706 |
| 805 | Ga0316593_10033691 | 3300032168 | Bacteria | 1678 |
| 806 | Ga0316588_1046288 | 3300033528 | Unclassified | 1048 |
| 807 | Ga0316596_1001557 | 3300033541 | Bacteria | 4674 |
| 808 | Ga0373951_0027925 | 3300035091 | Bacteria | 1320 |
| 809 | Ga0373923_0120970 | 3300035111 | Unclassified | 1170 |
| 810 | Ga0373954_0102904 | 3300035118 | Bacteria | 1379 |
| 811 | Ga0373955_0066978 | 3300035172 | Bacteria | 1998 |
| 812 | Ga0373955_0091664 | 3300035172 | Bacteria | 1733 |
| 813 | Ga0373961_0000436 | 3300035241 | Bacteria | 17183 |
| 814 | Ga0316574_0000429 | 3300035398 | Bacteria | 16715 |
| 815 | Ga0316574_0009950 | 3300035398 | Bacteria | 5350 |
| 816 | Ga0316574_0021255 | 3300035398 | Bacteria | 3851 |
| 817 | Ga0316574_0076663 | 3300035398 | Bacteria | 2118 |
| 818 | Ga0373935_0020484 | 3300035692 | Bacteria | 4042 |
| 819 | Ga0373935_0027606 | 3300035692 | Bacteria | 3510 |
| 820 | Ga0373947_0034774 | 3300035725 | Bacteria | 2981 |
| 821 | Ga0373937_0002221 | 3300036401 | Bacteria | 16223 |
| 822 | Ga0373937_0033001 | 3300036401 | Bacteria | 4698 |
| 823 | Ga0373937_0039188 | 3300036401 | Bacteria | 4319 |
| 824 | Ga0373937_0055256 | 3300036401 | Bacteria | 3645 |
| 825 | Ga0373937_0139485 | 3300036401 | Bacteria | 2268 |
| 826 | Ga0373937_0263188 | 3300036401 | Bacteria | 1627 |
| 827 | Ga0373937_0327727 | 3300036401 | Bacteria | 1449 |
| 828 | Ga0316582_0009672 | 3300036647 | Bacteria | 5242 |
| 829 | Ga0316582_0018706 | 3300036647 | Bacteria | 4038 |
| 830 | Ga0316582_0018910 | 3300036647 | Bacteria | 4021 |
| 831 | Ga0316582_0060036 | 3300036647 | Bacteria | 2437 |
| 832 | Ga0316582_0062387 | 3300036647 | Bacteria | 2393 |
| 833 | Ga0316582_0096067 | 3300036647 | Bacteria | 1957 |
| 834 | Ga0316584_0005315 | 3300036712 | Bacteria | 8623 |
| 835 | Ga0316584_0031833 | 3300036712 | Bacteria | 3900 |
| 836 | Ga0316584_0044280 | 3300036712 | Bacteria | 3319 |
| 837 | Ga0316584_0127797 | 3300036712 | Bacteria | 1898 |
| 838 | Ga0316584_0200097 | 3300036712 | Bacteria | 1474 |
| 839 | Ga0373925_0001621 | 3300037068 | Bacteria | 19006 |
| 840 | Ga0316581_0009239 | 3300037588 | Bacteria | 2706 |
| 841 | Ga0395901_0458024 | 3300038443 | Unclassified | 1304 |
| 842 | Ga0400483_004982 | 3300039062 | Bacteria | 20044 |
| 843 | Ga0400483_012643 | 3300039062 | Bacteria | 1717 |
| 844 | Ga0400483_122934 | 3300039062 | Unclassified | 3835 |
| 845 | Ga0400483_216264 | 3300039062 | Bacteria | 10204 |
| 846 | Ga0400483_240193 | 3300039062 | Bacteria | 8892 |
| 847 | Ga0436360_0014237 | 3300039438 | Unclassified | 1736 |
| 848 | Ga0436361_0359509 | 3300039447 | Bacteria | 6092 |
| 849 | Ga0436361_0656577 | 3300039447 | Bacteria | 3739 |
| 850 | Ga0436363_1172370 | 3300039450 | Bacteria | 1944 |
| 851 | Ga0436362_1012282 | 3300039453 | Bacteria | 1528 |
| 852 | Ga0439441_011222 | 3300042001 | Bacteria | 1517 |
| 853 | Ga0451577_0018124 | 3300042876 | Bacteria | 6489 |
| 854 | Ga0451577_0025637 | 3300042876 | Bacteria | 5348 |
| 855 | Ga0451577_0039852 | 3300042876 | Bacteria | 4219 |
| 856 | Ga0451577_0075436 | 3300042876 | Bacteria | 3007 |
| 857 | Ga0451577_0115455 | 3300042876 | Bacteria | 2404 |
| 858 | Ga0451577_0128782 | 3300042876 | Bacteria | 2270 |
| 859 | Ga0451577_0264739 | 3300042876 | Bacteria | 1556 |
| 860 | Ga0451577_0298148 | 3300042876 | Bacteria | 1461 |
| 861 | Ga0451577_0314594 | 3300042876 | Unclassified | 1419 |
| 862 | Ga0451577_0320931 | 3300042876 | Bacteria | 1404 |
| 863 | Ga0451577_0374624 | 3300042876 | Bacteria | 1292 |
| 864 | Ga0453683_0000129 | 3300044673 | Bacteria | 110609 |
| 865 | Ga0453683_0000638 | 3300044673 | Bacteria | 38065 |
| 866 | Ga0453683_0001154 | 3300044673 | Bacteria | 23962 |
| 867 | Ga0453683_0008080 | 3300044673 | Bacteria | 7080 |
| 868 | Ga0453683_0010406 | 3300044673 | Bacteria | 6166 |
| 869 | Ga0453683_0027971 | 3300044673 | Bacteria | 3572 |
| 870 | Ga0453683_0044921 | 3300044673 | Bacteria | 2770 |
| 871 | Ga0453683_0059002 | 3300044673 | Bacteria | 2400 |
| 872 | Ga0453683_0064506 | 3300044673 | Unclassified | 2289 |
| 873 | Ga0453683_0109605 | 3300044673 | Bacteria | 1736 |
| 874 | Ga0466961_0166345 | 3300044693 | Bacteria | 1373 |
| 875 | Ga0466963_0002558 | 3300044694 | Bacteria | 10198 |
| 876 | Ga0453684_0000035 | 3300044712 | Bacteria | 725956 |
| 877 | Ga0453684_0000627 | 3300044712 | Bacteria | 128570 |
| 878 | Ga0453684_0000752 | 3300044712 | Bacteria | 112676 |
| 879 | Ga0453684_0000920 | 3300044712 | Bacteria | 97531 |
| 880 | Ga0453684_0001416 | 3300044712 | Bacteria | 69082 |
| 881 | Ga0453684_0001422 | 3300044712 | Bacteria | 68864 |
| 882 | Ga0453684_0003020 | 3300044712 | Bacteria | 39129 |
| 883 | Ga0453684_0003787 | 3300044712 | Bacteria | 33392 |
| 884 | Ga0453684_0005727 | 3300044712 | Bacteria | 24316 |
| 885 | Ga0453684_0009719 | 3300044712 | Bacteria | 16726 |
| 886 | Ga0453684_0035364 | 3300044712 | Bacteria | 6906 |
| 887 | Ga0453684_0059795 | 3300044712 | Bacteria | 4909 |
| 888 | Ga0453684_0078587 | 3300044712 | Bacteria | 4128 |
| 889 | Ga0453684_0079221 | 3300044712 | Bacteria | 4107 |
| 890 | Ga0453684_0089786 | 3300044712 | Bacteria | 3798 |
| 891 | Ga0453684_0095584 | 3300044712 | Bacteria | 3652 |
| 892 | Ga0453684_0112556 | 3300044712 | Bacteria | 3303 |
| 893 | Ga0453684_0138626 | 3300044712 | Bacteria | 2909 |
| 894 | Ga0453684_0167862 | 3300044712 | Bacteria | 2589 |
| 895 | Ga0453684_0176923 | 3300044712 | Bacteria | 2508 |
| 896 | Ga0453684_0178692 | 3300044712 | Bacteria | 2493 |
| 897 | Ga0453684_0199884 | 3300044712 | Bacteria | 2331 |
| 898 | Ga0453684_0220420 | 3300044712 | Bacteria | 2198 |
| 899 | Ga0453684_0252422 | 3300044712 | Bacteria | 2025 |
| 900 | Ga0453684_0273889 | 3300044712 | Unclassified | 1927 |
| 901 | Ga0453684_0324172 | 3300044712 | Bacteria | 1744 |
| 902 | Ga0453684_0488926 | 3300044712 | Bacteria | 1364 |
| 903 | Ga0453684_0608421 | 3300044712 | Bacteria | 1197 |
| 904 | Ga0453684_0643980 | 3300044712 | Bacteria | 1157 |
| 905 | Ga0451576_0000311 | 3300045051 | Bacteria | 117825 |
| 906 | Ga0451576_0000688 | 3300045051 | Bacteria | 68843 |
| 907 | Ga0451576_0001255 | 3300045051 | Bacteria | 44559 |
| 908 | Ga0451576_0002597 | 3300045051 | Bacteria | 26495 |
| 909 | Ga0451576_0016491 | 3300045051 | Bacteria | 8151 |
| 910 | Ga0451576_0031990 | 3300045051 | Bacteria | 5607 |
| 911 | Ga0451576_0034883 | 3300045051 | Bacteria | 5341 |
| 912 | Ga0451576_0041664 | 3300045051 | Bacteria | 4853 |
| 913 | Ga0451576_0074132 | 3300045051 | Bacteria | 3542 |
| 914 | Ga0451576_0128728 | 3300045051 | Bacteria | 2639 |
| 915 | Ga0451576_0167137 | 3300045051 | Bacteria | 2296 |
| 916 | Ga0451576_0221133 | 3300045051 | Bacteria | 1977 |
| 917 | Ga0451576_0240250 | 3300045051 | Unclassified | 1892 |
| 918 | Ga0451576_0300576 | 3300045051 | Bacteria | 1679 |
| 919 | Ga0451576_0370790 | 3300045051 | Bacteria | 1500 |
| 920 | Ga0451576_0412029 | 3300045051 | Bacteria | 1417 |
| 921 | Ga0466967_0013758 | 3300045976 | Bacteria | 6270 |
| 922 | Ga0466967_0117712 | 3300045976 | Bacteria | 2450 |
| 923 | Ga0495603_0086802 | 3300046455 | Bacteria | 1831 |
| 924 | Ga0495629_0000018 | 3300046459 | Bacteria | 169239 |
| 925 | Ga0495629_0008737 | 3300046459 | Bacteria | 7449 |
| 926 | Ga0495629_0019786 | 3300046459 | Bacteria | 4805 |
| 927 | Ga0495651_0028878 | 3300046462 | Bacteria | 4324 |
| 928 | Ga0495653_0028713 | 3300046463 | Bacteria | 4447 |
| 929 | Ga0495580_0002833 | 3300046472 | Bacteria | 14914 |
| 930 | Ga0495580_0053667 | 3300046472 | Bacteria | 2844 |
| 931 | Ga0495580_0099393 | 3300046472 | Bacteria | 2024 |
| 932 | Ga0495582_0001254 | 3300046473 | Bacteria | 14252 |
| 933 | Ga0495582_0012389 | 3300046473 | Bacteria | 4698 |
| 934 | Ga0495582_0104438 | 3300046473 | Bacteria | 1588 |
| 935 | Ga0495639_0007935 | 3300046475 | Bacteria | 4562 |
| 936 | Ga0495639_0037447 | 3300046475 | Bacteria | 2174 |
| 937 | Ga0495639_0198196 | 3300046475 | Unclassified | 982 |
| 938 | Ga0495662_0025759 | 3300046476 | Bacteria | 2840 |
| 939 | Ga0495664_0038383 | 3300046477 | Bacteria | 2827 |
| 940 | Ga0495618_0065773 | 3300046514 | Bacteria | 2304 |
| 941 | Ga0495630_0166578 | 3300046517 | Bacteria | 1678 |
| 942 | Ga0495666_0037091 | 3300046526 | Bacteria | 2372 |
| 943 | Ga0495652_0101554 | 3300046529 | Bacteria | 2331 |
| 944 | Ga0495665_0035363 | 3300046531 | Bacteria | 2669 |
| 945 | Ga0495640_0040767 | 3300046533 | Bacteria | 3249 |
| 946 | Ga0495640_0075761 | 3300046533 | Bacteria | 2246 |
| 947 | Ga0495587_0004841 | 3300046536 | Bacteria | 8834 |
| 948 | Ga0495587_0018096 | 3300046536 | Bacteria | 4370 |
| 949 | Ga0495587_0024110 | 3300046536 | Bacteria | 3733 |
| 950 | Ga0495621_0011910 | 3300046539 | Bacteria | 2703 |
| 951 | Ga0495645_0009633 | 3300046543 | Bacteria | 6754 |
| 952 | Ga0495645_0010293 | 3300046543 | Bacteria | 6556 |
| 953 | Ga0495667_0104541 | 3300046559 | Bacteria | 1831 |
| 954 | Ga0495634_0004148 | 3300046642 | Bacteria | 11453 |
| 955 | Ga0495634_0181325 | 3300046642 | Bacteria | 1318 |
| 956 | Ga0495635_0000069 | 3300046663 | Bacteria | 63592 |
| 957 | Ga0495635_0003141 | 3300046663 | Bacteria | 11367 |
| 958 | Ga0495657_0255425 | 3300046675 | Bacteria | 1054 |
| 959 | Ga0495599_0051973 | 3300046678 | Bacteria | 2567 |
| 960 | Ga0495623_0016415 | 3300046679 | Bacteria | 4784 |
| 961 | Ga0495623_0065167 | 3300046679 | Unclassified | 2279 |
| 962 | Ga0495623_0129562 | 3300046679 | Bacteria | 1512 |
| 963 | Ga0495646_0047170 | 3300046680 | Bacteria | 2624 |
| 964 | Ga0495647_0002903 | 3300046681 | Bacteria | 5442 |
| 965 | Ga0495658_0000471 | 3300046683 | Bacteria | 22293 |
| 966 | Ga0495658_0029958 | 3300046683 | Bacteria | 2951 |
| 967 | Ga0495669_0029730 | 3300046684 | Bacteria | 2397 |
| 968 | Ga0495613_0005080 | 3300046689 | Bacteria | 9864 |
| 969 | Ga0495613_0048716 | 3300046689 | Bacteria | 3129 |
| 970 | Ga0495600_0024312 | 3300046809 | Bacteria | 3899 |
| 971 | Ga0495600_0098999 | 3300046809 | Bacteria | 1901 |
| 972 | Ga0495600_0247853 | 3300046809 | Unclassified | 1134 |
| 973 | Ga0495581_0005351 | 3300047315 | Bacteria | 7423 |
| 974 | Ga0495581_0028058 | 3300047315 | Bacteria | 3263 |
| 975 | Ga0495604_0059884 | 3300047317 | Bacteria | 2917 |
| 976 | Ga0495674_0082868 | 3300047319 | Bacteria | 2750 |
| 977 | Ga0495674_0219764 | 3300047319 | Bacteria | 1571 |
| 978 | Ga0495674_0313189 | 3300047319 | Bacteria | 1280 |
| 979 | Ga0495676_0161801 | 3300047321 | Bacteria | 1583 |
| 980 | Ga0495680_0000044 | 3300047322 | Bacteria | 97068 |
| 981 | Ga0495675_0122258 | 3300047444 | Unclassified | 1621 |
| 982 | Ga0495684_0042688 | 3300047471 | Bacteria | 3472 |
| 983 | Ga0495593_0093043 | 3300047673 | Bacteria | 1552 |
| 984 | Ga0495602_0170795 | 3300048088 | Bacteria | 1688 |
| 985 | Ga0495602_0324307 | 3300048088 | Unclassified | 1119 |
| 986 | Ga0495614_0018343 | 3300048089 | Bacteria | 3031 |
| 987 | Ga0496100_0130140 | 3300048903 | Bacteria | 1772 |
| 988 | Ga0496101_0089193 | 3300048904 | Bacteria | 2291 |
| 989 | Ga0496102_0035772 | 3300048905 | Bacteria | 4472 |
| 990 | Ga0496104_0017902 | 3300048907 | Bacteria | 6460 |
| 991 | Ga0496104_0198008 | 3300048907 | Bacteria | 1921 |
| 992 | Ga0496105_0014830 | 3300048908 | Bacteria | 6204 |
| 993 | Ga0496105_0043979 | 3300048908 | Bacteria | 3683 |
| 994 | Ga0496106_0143195 | 3300048909 | Bacteria | 1881 |
| 995 | Ga0496107_0122430 | 3300048910 | Bacteria | 1916 |
| 996 | Ga0496108_0013093 | 3300048911 | Bacteria | 6761 |
| 997 | Ga0496108_0397811 | 3300048911 | Bacteria | 1203 |
| 998 | Ga0496109_0004542 | 3300048912 | Bacteria | 11594 |
| 999 | Ga0496109_0027991 | 3300048912 | Bacteria | 5039 |
| 1000 | Ga0496109_0302331 | 3300048912 | Bacteria | 1509 |
| 1001 | Ga0496110_0027451 | 3300048913 | Bacteria | 4881 |
| 1002 | Ga0496112_0080288 | 3300048915 | Bacteria | 3225 |
| 1003 | Ga0496112_0142596 | 3300048915 | Bacteria | 2365 |
| 1004 | Ga0496113_0068836 | 3300048916 | Bacteria | 2687 |
| 1005 | Ga0496114_0007255 | 3300048917 | Bacteria | 8756 |
| 1006 | Ga0496114_0008657 | 3300048917 | Bacteria | 8067 |
| 1007 | Ga0496115_0093688 | 3300048918 | Bacteria | 2456 |
| 1008 | Ga0501292_006916 | 3300049515 | Unclassified | 1626 |
| 1009 | Ga0501296_003603 | 3300049519 | Unclassified | 1658 |
| 1010 | Ga0501034_0067510 | 3300049571 | Bacteria | 3589 |
| 1011 | Ga0501038_0008020 | 3300049574 | Bacteria | 9728 |
| 1012 | Ga0501039_0053167 | 3300049575 | Bacteria | 3134 |
| 1013 | Ga0501039_0131215 | 3300049575 | Bacteria | 1967 |
| 1014 | Ga0501040_0072231 | 3300049576 | Bacteria | 2383 |
| 1015 | Ga0501047_0218883 | 3300049581 | Bacteria | 1761 |
| 1016 | Ga0501047_0350148 | 3300049581 | Bacteria | 1314 |
| 1017 | Ga0501071_0037531 | 3300049587 | Bacteria | 3460 |
| 1018 | Ga0501072_0038846 | 3300049588 | Bacteria | 3736 |
| 1019 | Ga0501072_0144183 | 3300049588 | Unclassified | 1899 |
| 1020 | Ga0501074_0125521 | 3300049590 | Bacteria | 1836 |
| 1021 | Ga0501075_0016699 | 3300049591 | Bacteria | 5293 |
| 1022 | Ga0501076_0036202 | 3300049592 | Bacteria | 3866 |
| 1023 | Ga0501076_0334750 | 3300049592 | Bacteria | 1242 |
| 1024 | Ga0501077_0148306 | 3300049593 | Bacteria | 1488 |
| 1025 | Ga0501202_021022 | 3300049652 | Unclassified | 1301 |
| 1026 | Ga0501207_001271 | 3300049654 | Unclassified | 3120 |
| 1027 | Ga0501209_014613 | 3300049656 | Unclassified | 1729 |
| 1028 | Ga0501217_001008 | 3300049661 | Bacteria | 5098 |
| 1029 | Ga0501217_002314 | 3300049661 | Bacteria | 3731 |
| 1030 | Ga0501217_021554 | 3300049661 | Bacteria | 1522 |
| 1031 | Ga0501223_001628 | 3300049663 | Bacteria | 5162 |
| 1032 | Ga0501223_005324 | 3300049663 | Bacteria | 2709 |
| 1033 | Ga0501223_006020 | 3300049663 | Bacteria | 2523 |
| 1034 | Ga0501227_000979 | 3300049665 | Bacteria | 6304 |
| 1035 | Ga0501230_000225 | 3300049667 | Bacteria | 5023 |
| 1036 | Ga0501235_008095 | 3300049669 | Unclassified | 2293 |
| 1037 | Ga0501235_032728 | 3300049669 | Unclassified | 1176 |
| 1038 | Ga0501239_000904 | 3300049672 | Bacteria | 2420 |
| 1039 | Ga0501239_006106 | 3300049672 | Bacteria | 1230 |
| 1040 | Ga0501243_010751 | 3300049675 | Bacteria | 1431 |
| 1041 | Ga0501253_011487 | 3300049683 | Bacteria | 1362 |
| 1042 | Ga0501257_002511 | 3300049686 | Bacteria | 3875 |
| 1043 | Ga0501257_003460 | 3300049686 | Bacteria | 3388 |
| 1044 | Ga0501261_001901 | 3300049690 | Bacteria | 2568 |
| 1045 | Ga0501225_0000303 | 3300049705 | Bacteria | 15418 |
| 1046 | Ga0501225_0017089 | 3300049705 | Bacteria | 2014 |
| 1047 | Ga0501225_0024929 | 3300049705 | Bacteria | 1646 |
| 1048 | Ga0501234_011008 | 3300049707 | Bacteria | 1412 |
| 1049 | Ga0501245_013114 | 3300049708 | Bacteria | 1222 |
| 1050 | Ga0501079_0081941 | 3300049741 | Bacteria | 2495 |
| 1051 | Ga0501079_0132449 | 3300049741 | Bacteria | 1940 |
| 1052 | Ga0501079_0135906 | 3300049741 | Bacteria | 1914 |
| 1053 | Ga0501080_0104038 | 3300049742 | Bacteria | 2633 |
| 1054 | Ga0501080_0115502 | 3300049742 | Bacteria | 2489 |
| 1055 | Ga0501080_0246615 | 3300049742 | Bacteria | 1629 |
| 1056 | Ga0501080_0502916 | 3300049742 | Bacteria | 1083 |
| 1057 | Ga0501081_0019178 | 3300049743 | Bacteria | 4550 |
| 1058 | Ga0501083_0179804 | 3300049744 | Bacteria | 1381 |
| 1059 | Ga0501270_006308 | 3300049767 | Unclassified | 1418 |
| 1060 | Ga0501272_001613 | 3300049769 | Bacteria | 2157 |
| 1061 | Ga0501272_004911 | 3300049769 | Bacteria | 1399 |
| 1062 | Ga0501045_0169444 | 3300049824 | Bacteria | 1626 |
| 1063 | Ga0501204_002063 | 3300049850 | Bacteria | 2022 |
| 1064 | Ga0501212_013401 | 3300049851 | Bacteria | 1203 |
| 1065 | nmdc:mga05p37_1088_c1 | 3300050507 | Bacteria | 31183 |
| 1066 | nmdc:mga05p37_158261_c1 | 3300050507 | Unclassified | 2767 |
| 1067 | nmdc:mga05p37_161921_c2 | 3300050507 | Bacteria | 2237 |
| 1068 | nmdc:mga05p37_188915_c1 | 3300050507 | Bacteria | 2503 |
| 1069 | nmdc:mga05p37_265913_c1 | 3300050507 | Unclassified | 2051 |
| 1070 | nmdc:mga05p37_437457_c1 | 3300050507 | Bacteria | 1518 |
| 1071 | nmdc:mga05p37_464167_c1 | 3300050507 | Bacteria | 1462 |
| 1072 | nmdc:mga09592_130481_c2 | 3300050508 | Bacteria | 1820 |
| 1073 | nmdc:mga09592_1528_c1 | 3300050508 | Bacteria | 18645 |
| 1074 | nmdc:mga09592_213196_c1 | 3300050508 | Unclassified | 1673 |
| 1075 | nmdc:mga09592_38585_c1 | 3300050508 | Bacteria | 4010 |
| 1076 | nmdc:mga09592_78200_c1 | 3300050508 | Unclassified | 2815 |
| 1077 | nmdc:mga0qj67_1379_c1 | 3300050509 | Bacteria | 17019 |
| 1078 | nmdc:mga06r32_157174_c1 | 3300050510 | Bacteria | 2255 |
| 1079 | nmdc:mga06r32_187739_c1 | 3300050510 | Unclassified | 2054 |
| 1080 | nmdc:mga08y16_102720_c1 | 3300050511 | Bacteria | 2976 |
| 1081 | nmdc:mga08y16_178706_c1 | 3300050511 | Bacteria | 2204 |
| 1082 | nmdc:mga08y16_7081_c1 | 3300050511 | Bacteria | 11768 |
| 1083 | nmdc:mga0n895_21731_c1 | 3300050512 | Bacteria | 6005 |
| 1084 | nmdc:mga0rr50_39343_c1 | 3300050513 | Bacteria | 3429 |
| 1085 | nmdc:mga08x19_3938_c2 | 3300050514 | Bacteria | 6286 |
| 1086 | nmdc:mga0a205_200403_c1 | 3300050515 | Bacteria | 1887 |
| 1087 | nmdc:mga0a205_243996_c1 | 3300050515 | Bacteria | 1677 |
| 1088 | nmdc:mga0a205_59859_c1 | 3300050515 | Bacteria | 3679 |
| 1089 | Ga0495619_0003782 | 3300053085 | Bacteria | 9735 |
| 1090 | Ga0495619_0061650 | 3300053085 | Bacteria | 2496 |
| 1091 | Ga0495619_0130061 | 3300053085 | Bacteria | 1730 |
| 1092 | Ga0501084_0036414 | 3300054114 | Bacteria | 4110 |
| 1093 | Ga0501084_0100904 | 3300054114 | Bacteria | 2423 |
| 1094 | Ga0501082_0049363 | 3300060353 | Bacteria | 3629 |
| 1095 | Ga0501082_0074811 | 3300060353 | Bacteria | 2918 |
| 1096 | Ga0530510_0021924 | 3300061734 | Bacteria | 4547 |
| 1097 | Ga0530510_0040752 | 3300061734 | Bacteria | 3352 |
| 1098 | Ga0530510_0063783 | 3300061734 | Bacteria | 2668 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300026118 | Ga0207675_100298216 | Ga0207675_1002982162 | 288 |
| 2 | 3300009174 | Ga0105241_10101942 | Ga0105241_101019422 | 289 |
| 3 | 3300044712 | Ga0453684_0252422 | Ga0453684_0252422_1047_2012 | 298 |
| 4 | 3300046455 | Ga0495603_0086802 | Ga0495603_0086802_291_1283 | 298 |
| 5 | 3300046459 | Ga0495629_0008737 | Ga0495629_0008737_4742_5734 | 298 |
| 6 | 3300046475 | Ga0495639_0037447 | Ga0495639_0037447_384_1376 | 298 |
| 7 | 3300046526 | Ga0495666_0037091 | Ga0495666_0037091_783_1775 | 298 |
| 8 | 3300046642 | Ga0495634_0181325 | Ga0495634_0181325_91_1083 | 298 |
| 9 | 3300046683 | Ga0495658_0029958 | Ga0495658_0029958_639_1631 | 298 |
| 10 | 3300047321 | Ga0495676_0161801 | Ga0495676_0161801_323_1315 | 298 |
| 11 | 3300009545 | Ga0105237_10143703 | Ga0105237_101437031 | 299 |
| 12 | 3300010375 | Ga0105239_10217230 | Ga0105239_102172302 | 299 |
| 13 | 3300013306 | Ga0163162_10220681 | Ga0163162_102206811 | 299 |
| 14 | 3300046475 | Ga0495639_0198196 | Ga0495639_0198196_27_935 | 299 |
| 15 | 3300046679 | Ga0495623_0065167 | Ga0495623_0065167_1298_2209 | 299 |
| 16 | 3300047444 | Ga0495675_0122258 | Ga0495675_0122258_194_1105 | 299 |
| 17 | 3300048088 | Ga0495602_0324307 | Ga0495602_0324307_62_979 | 299 |
| 18 | 3300048903 | Ga0496100_0130140 | Ga0496100_0130140_780_1697 | 299 |
| 19 | 3300048908 | Ga0496105_0043979 | Ga0496105_0043979_25_942 | 299 |
| 20 | 3300048905 | Ga0496102_0035772 | Ga0496102_0035772_1610_2524 | 300 |
| 21 | 3300048911 | Ga0496108_0397811 | Ga0496108_0397811_104_1018 | 300 |
| 22 | 3300048916 | Ga0496113_0068836 | Ga0496113_0068836_1284_2198 | 300 |
| 23 | 3300049742 | Ga0501080_0502916 | Ga0501080_0502916_160_1065 | 301 |
| 24 | 3300046675 | Ga0495657_0255425 | Ga0495657_0255425_31_945 | 304 |
| 25 | 3300005365 | Ga0070688_100125440 | Ga0070688_1001254403 | 305 |
| 26 | 3300035111 | Ga0373923_0120970 | Ga0373923_0120970_32_967 | 305 |
| 27 | 3300036401 | Ga0373937_0327727 | Ga0373937_0327727_15_941 | 306 |
| 28 | 3300039062 | Ga0400483_012643 | Ga0400483_012643_32_952 | 306 |
| 29 | 3300039062 | Ga0400483_122934 | Ga0400483_122934_2302_3222 | 306 |
| 30 | 3300039062 | Ga0400483_216264 | Ga0400483_216264_6196_7116 | 306 |
| 31 | 3300039447 | Ga0436361_0656577 | Ga0436361_0656577_22_954 | 306 |
| 32 | 3300044712 | Ga0453684_0078587 | Ga0453684_0078587_1829_2836 | 306 |
| 33 | 3300036647 | Ga0316582_0096067 | Ga0316582_0096067_423_1412 | 309 |
| 34 | 3300009093 | Ga0105240_10091837 | Ga0105240_100918373 | 314 |
| 35 | 3300025913 | Ga0207695_10266506 | Ga0207695_102665061 | 314 |
| 36 | 3300005435 | Ga0070714_100335790 | Ga0070714_1003357902 | 317 |
| 37 | 3300014326 | Ga0157380_10010057 | Ga0157380_100100575 | 317 |
| 38 | 3300044712 | Ga0453684_0220420 | Ga0453684_0220420_20_973 | 317 |
| 39 | 3300050515 | nmdc:mga0a205_200403_c1 | nmdc:mga0a205_200403_c1_909_1862 | 317 |
| 40 | 3300005440 | Ga0070705_100003937 | Ga0070705_1000039373 | 318 |
| 41 | 3300005444 | Ga0070694_100013258 | Ga0070694_1000132582 | 318 |
| 42 | 3300005546 | Ga0070696_100007001 | Ga0070696_1000070013 | 318 |
| 43 | 3300005549 | Ga0070704_100005092 | Ga0070704_1000050922 | 318 |
| 44 | 3300005577 | Ga0068857_100034346 | Ga0068857_1000343463 | 318 |
| 45 | 3300009098 | Ga0105245_10157598 | Ga0105245_101575982 | 318 |
| 46 | 3300026116 | Ga0207674_10412978 | Ga0207674_104129782 | 318 |
| 47 | 3300006880 | Ga0075429_100171528 | Ga0075429_1001715282 | 319 |
| 48 | 3300025938 | Ga0207704_10174750 | Ga0207704_101747502 | 319 |
| 49 | 3300050508 | nmdc:mga09592_38585_c1 | nmdc:mga09592_38585_c1_2630_3634 | 319 |
| 50 | 3300036647 | Ga0316582_0060036 | Ga0316582_0060036_1014_2018 | 322 |
| 51 | 3300044712 | Ga0453684_0059795 | Ga0453684_0059795_1481_2452 | 322 |
| 52 | 3300049571 | Ga0501034_0067510 | Ga0501034_0067510_23_997 | 323 |
| 53 | 3300049574 | Ga0501038_0008020 | Ga0501038_0008020_2172_3143 | 323 |
| 54 | 3300049581 | Ga0501047_0218883 | Ga0501047_0218883_130_1104 | 323 |
| 55 | 3300050507 | nmdc:mga05p37_158261_c1 | nmdc:mga05p37_158261_c1_418_1389 | 323 |
| 56 | 3300005327 | Ga0070658_10023980 | Ga0070658_100239802 | 324 |
| 57 | 3300005329 | Ga0070683_100286184 | Ga0070683_1002861842 | 324 |
| 58 | 3300005336 | Ga0070680_100014282 | Ga0070680_1000142823 | 324 |
| 59 | 3300005339 | Ga0070660_100032099 | Ga0070660_1000320992 | 324 |
| 60 | 3300005458 | Ga0070681_10001428 | Ga0070681_1000142811 | 324 |
| 61 | 3300005530 | Ga0070679_100000282 | Ga0070679_1000002823 | 324 |
| 62 | 3300005563 | Ga0068855_100015371 | Ga0068855_1000153713 | 324 |
| 63 | 3300005577 | Ga0068857_100125106 | Ga0068857_1001251063 | 324 |
| 64 | 3300005614 | Ga0068856_100025278 | Ga0068856_1000252782 | 324 |
| 65 | 3300005616 | Ga0068852_100017737 | Ga0068852_1000177374 | 324 |
| 66 | 3300009093 | Ga0105240_10000077 | Ga0105240_10000077116 | 324 |
| 67 | 3300009551 | Ga0105238_10002900 | Ga0105238_100029002 | 324 |
| 68 | 3300013104 | Ga0157370_10003878 | Ga0157370_100038788 | 324 |
| 69 | 3300013105 | Ga0157369_10065249 | Ga0157369_100652493 | 324 |
| 70 | 3300013307 | Ga0157372_10037252 | Ga0157372_100372525 | 324 |
| 71 | 3300025912 | Ga0207707_10012176 | Ga0207707_1001217610 | 324 |
| 72 | 3300025913 | Ga0207695_10000707 | Ga0207695_1000070713 | 324 |
| 73 | 3300025917 | Ga0207660_10101539 | Ga0207660_101015392 | 324 |
| 74 | 3300025919 | Ga0207657_10011469 | Ga0207657_100114694 | 324 |
| 75 | 3300025924 | Ga0207694_10014641 | Ga0207694_100146412 | 324 |
| 76 | 3300025949 | Ga0207667_10000123 | Ga0207667_1000012389 | 324 |
| 77 | 3300026078 | Ga0207702_10085261 | Ga0207702_100852611 | 324 |
| 78 | 3300026116 | Ga0207674_10038045 | Ga0207674_100380452 | 324 |
| 79 | 3300026142 | Ga0207698_10009699 | Ga0207698_100096997 | 324 |
| 80 | 3300042876 | Ga0451577_0018124 | Ga0451577_0018124_4596_5633 | 324 |
| 81 | 3300044673 | Ga0453683_0000638 | Ga0453683_0000638_8768_9811 | 324 |
| 82 | 3300044673 | Ga0453683_0027971 | Ga0453683_0027971_312_1355 | 324 |
| 83 | 3300044712 | Ga0453684_0000920 | Ga0453684_0000920_54030_55067 | 324 |
| 84 | 3300044712 | Ga0453684_0324172 | Ga0453684_0324172_548_1591 | 324 |
| 85 | 3300045051 | Ga0451576_0001255 | Ga0451576_0001255_300_1343 | 324 |
| 86 | 3300045051 | Ga0451576_0002597 | Ga0451576_0002597_8925_9968 | 324 |
| 87 | 3300047315 | Ga0495581_0028058 | Ga0495581_0028058_1936_2910 | 324 |
| 88 | 3300005347 | Ga0070668_100167284 | Ga0070668_1001672841 | 325 |
| 89 | 3300005457 | Ga0070662_100161021 | Ga0070662_1001610212 | 325 |
| 90 | 3300025972 | Ga0207668_10247760 | Ga0207668_102477601 | 325 |
| 91 | 3300045051 | Ga0451576_0300576 | Ga0451576_0300576_482_1459 | 325 |
| 92 | 3300005356 | Ga0070674_100001100 | Ga0070674_10000110011 | 326 |
| 93 | 3300005456 | Ga0070678_100012161 | Ga0070678_1000121613 | 326 |
| 94 | 3300025937 | Ga0207669_10002002 | Ga0207669_100020027 | 326 |
| 95 | 3300026121 | Ga0207683_10060910 | Ga0207683_100609103 | 326 |
| 96 | 3300031712 | Ga0265342_10011353 | Ga0265342_100113532 | 326 |
| 97 | 3300025925 | Ga0207650_10263554 | Ga0207650_102635541 | 327 |
| 98 | 3300005616 | Ga0068852_100505167 | Ga0068852_1005051671 | 328 |
| 99 | 3300009177 | Ga0105248_10437012 | Ga0105248_104370121 | 328 |
| 100 | 3300013102 | Ga0157371_10005555 | Ga0157371_100055559 | 328 |
| 101 | 3300013102 | Ga0157371_10016619 | Ga0157371_100166197 | 328 |
| 102 | 3300036712 | Ga0316584_0044280 | Ga0316584_0044280_248_1240 | 328 |
| 103 | 3300039062 | Ga0400483_004982 | Ga0400483_004982_5404_6390 | 328 |
| 104 | 3300039062 | Ga0400483_240193 | Ga0400483_240193_4169_5155 | 328 |
| 105 | 3300049669 | Ga0501235_032728 | Ga0501235_032728_75_1061 | 328 |
| 106 | 3300003323 | rootH1_10224381 | rootH1_102243813 | 329 |
| 107 | 3300005293 | Ga0065715_10091017 | Ga0065715_100910173 | 329 |
| 108 | 3300005347 | Ga0070668_100078190 | Ga0070668_1000781902 | 329 |
| 109 | 3300005457 | Ga0070662_100192912 | Ga0070662_1001929122 | 329 |
| 110 | 3300005719 | Ga0068861_100049891 | Ga0068861_1000498912 | 329 |
| 111 | 3300006844 | Ga0075428_100073296 | Ga0075428_1000732962 | 329 |
| 112 | 3300006846 | Ga0075430_100004095 | Ga0075430_1000040958 | 329 |
| 113 | 3300006852 | Ga0075433_10016769 | Ga0075433_100167692 | 329 |
| 114 | 3300007076 | Ga0075435_100008999 | Ga0075435_1000089995 | 329 |
| 115 | 3300009094 | Ga0111539_10222023 | Ga0111539_102220231 | 329 |
| 116 | 3300009553 | Ga0105249_10003348 | Ga0105249_100033487 | 329 |
| 117 | 3300009553 | Ga0105249_10470380 | Ga0105249_104703802 | 329 |
| 118 | 3300014326 | Ga0157380_10031371 | Ga0157380_100313712 | 329 |
| 119 | 3300025933 | Ga0207706_10422490 | Ga0207706_104224902 | 329 |
| 120 | 3300025961 | Ga0207712_10343925 | Ga0207712_103439251 | 329 |
| 121 | 3300026118 | Ga0207675_100034625 | Ga0207675_1000346252 | 329 |
| 122 | 3300031249 | Ga0265339_10047392 | Ga0265339_100473922 | 329 |
| 123 | 3300031344 | Ga0265316_10001391 | Ga0265316_1000139117 | 329 |
| 124 | 3300031548 | Ga0307408_100028500 | Ga0307408_1000285003 | 329 |
| 125 | 3300031595 | Ga0265313_10009568 | Ga0265313_100095685 | 329 |
| 126 | 3300031727 | Ga0316576_10002147 | Ga0316576_100021474 | 329 |
| 127 | 3300031727 | Ga0316576_10022143 | Ga0316576_100221432 | 329 |
| 128 | 3300031733 | Ga0316577_10012664 | Ga0316577_100126644 | 329 |
| 129 | 3300032126 | Ga0307415_100215914 | Ga0307415_1002159142 | 329 |
| 130 | 3300035398 | Ga0316574_0021255 | Ga0316574_0021255_1507_2502 | 329 |
| 131 | 3300036647 | Ga0316582_0009672 | Ga0316582_0009672_1405_2400 | 329 |
| 132 | 3300036712 | Ga0316584_0031833 | Ga0316584_0031833_1313_2308 | 329 |
| 133 | 3300042001 | Ga0439441_011222 | Ga0439441_011222_58_1065 | 329 |
| 134 | 3300042876 | Ga0451577_0115455 | Ga0451577_0115455_846_1835 | 329 |
| 135 | 3300044712 | Ga0453684_0089786 | Ga0453684_0089786_1236_2225 | 329 |
| 136 | 3300045051 | Ga0451576_0167137 | Ga0451576_0167137_122_1117 | 329 |
| 137 | 3300045051 | Ga0451576_0412029 | Ga0451576_0412029_174_1163 | 329 |
| 138 | 3300049592 | Ga0501076_0334750 | Ga0501076_0334750_107_1144 | 329 |
| 139 | 3300049593 | Ga0501077_0148306 | Ga0501077_0148306_47_1084 | 329 |
| 140 | 3300050509 | nmdc:mga0qj67_1379_c1 | nmdc:mga0qj67_1379_c1_61_1062 | 329 |
| 141 | 3300050513 | nmdc:mga0rr50_39343_c1 | nmdc:mga0rr50_39343_c1_560_1558 | 329 |
| 142 | 3300050515 | nmdc:mga0a205_59859_c1 | nmdc:mga0a205_59859_c1_2317_3315 | 329 |
| 143 | 2162886012 | MBSR1b_contig_601673 | MBSR1b_0180.00007290 | 330 |
| 144 | 3300002239 | JGI24034J26672_10005904 | JGI24034J26672_100059041 | 330 |
| 145 | 3300005290 | Ga0065712_10071124 | Ga0065712_100711243 | 330 |
| 146 | 3300005293 | Ga0065715_10003747 | Ga0065715_100037475 | 330 |
| 147 | 3300005327 | Ga0070658_10363036 | Ga0070658_103630362 | 330 |
| 148 | 3300005329 | Ga0070683_100005766 | Ga0070683_1000057666 | 330 |
| 149 | 3300005330 | Ga0070690_100023500 | Ga0070690_1000235002 | 330 |
| 150 | 3300005330 | Ga0070690_100204621 | Ga0070690_1002046212 | 330 |
| 151 | 3300005334 | Ga0068869_100057516 | Ga0068869_1000575162 | 330 |
| 152 | 3300005334 | Ga0068869_100169852 | Ga0068869_1001698522 | 330 |
| 153 | 3300005335 | Ga0070666_10093592 | Ga0070666_100935921 | 330 |
| 154 | 3300005340 | Ga0070689_100300757 | Ga0070689_1003007571 | 330 |
| 155 | 3300005344 | Ga0070661_100104999 | Ga0070661_1001049991 | 330 |
| 156 | 3300005347 | Ga0070668_100229670 | Ga0070668_1002296702 | 330 |
| 157 | 3300005353 | Ga0070669_100072167 | Ga0070669_1000721672 | 330 |
| 158 | 3300005364 | Ga0070673_100014452 | Ga0070673_1000144522 | 330 |
| 159 | 3300005436 | Ga0070713_100000174 | Ga0070713_10000017423 | 330 |
| 160 | 3300005438 | Ga0070701_10050367 | Ga0070701_100503672 | 330 |
| 161 | 3300005459 | Ga0068867_100138575 | Ga0068867_1001385752 | 330 |
| 162 | 3300005466 | Ga0070685_10032777 | Ga0070685_100327772 | 330 |
| 163 | 3300005543 | Ga0070672_100087133 | Ga0070672_1000871332 | 330 |
| 164 | 3300005544 | Ga0070686_100032724 | Ga0070686_1000327242 | 330 |
| 165 | 3300005546 | Ga0070696_100203446 | Ga0070696_1002034462 | 330 |
| 166 | 3300005548 | Ga0070665_100121976 | Ga0070665_1001219762 | 330 |
| 167 | 3300005577 | Ga0068857_100035684 | Ga0068857_1000356842 | 330 |
| 168 | 3300005577 | Ga0068857_100323491 | Ga0068857_1003234911 | 330 |
| 169 | 3300005578 | Ga0068854_100052719 | Ga0068854_1000527192 | 330 |
| 170 | 3300005614 | Ga0068856_100223372 | Ga0068856_1002233721 | 330 |
| 171 | 3300005616 | Ga0068852_100124042 | Ga0068852_1001240422 | 330 |
| 172 | 3300005616 | Ga0068852_100229912 | Ga0068852_1002299122 | 330 |
| 173 | 3300005617 | Ga0068859_100002655 | Ga0068859_1000026554 | 330 |
| 174 | 3300005617 | Ga0068859_100477341 | Ga0068859_1004773412 | 330 |
| 175 | 3300005618 | Ga0068864_100120999 | Ga0068864_1001209992 | 330 |
| 176 | 3300005618 | Ga0068864_100276860 | Ga0068864_1002768602 | 330 |
| 177 | 3300005719 | Ga0068861_100071782 | Ga0068861_1000717822 | 330 |
| 178 | 3300005719 | Ga0068861_100108277 | Ga0068861_1001082773 | 330 |
| 179 | 3300005834 | Ga0068851_10072590 | Ga0068851_100725902 | 330 |
| 180 | 3300005842 | Ga0068858_100092441 | Ga0068858_1000924412 | 330 |
| 181 | 3300005842 | Ga0068858_100148194 | Ga0068858_1001481941 | 330 |
| 182 | 3300005842 | Ga0068858_100230606 | Ga0068858_1002306062 | 330 |
| 183 | 3300005842 | Ga0068858_100238369 | Ga0068858_1002383692 | 330 |
| 184 | 3300005842 | Ga0068858_100360710 | Ga0068858_1003607102 | 330 |
| 185 | 3300005844 | Ga0068862_100260961 | Ga0068862_1002609612 | 330 |
| 186 | 3300006358 | Ga0068871_100231310 | Ga0068871_1002313102 | 330 |
| 187 | 3300006846 | Ga0075430_100114798 | Ga0075430_1001147984 | 330 |
| 188 | 3300006880 | Ga0075429_100244645 | Ga0075429_1002446451 | 330 |
| 189 | 3300006931 | Ga0097620_100002655 | Ga0097620_1000026559 | 330 |
| 190 | 3300006931 | Ga0097620_100477360 | Ga0097620_1004773602 | 330 |
| 191 | 3300009093 | Ga0105240_10650306 | Ga0105240_106503061 | 330 |
| 192 | 3300009094 | Ga0111539_10198342 | Ga0111539_101983422 | 330 |
| 193 | 3300009094 | Ga0111539_10512008 | Ga0111539_105120082 | 330 |
| 194 | 3300009147 | Ga0114129_10309765 | Ga0114129_103097651 | 330 |
| 195 | 3300009177 | Ga0105248_10001800 | Ga0105248_100018008 | 330 |
| 196 | 3300010375 | Ga0105239_10388124 | Ga0105239_103881242 | 330 |
| 197 | 3300013296 | Ga0157374_10582203 | Ga0157374_105822031 | 330 |
| 198 | 3300013297 | Ga0157378_10065533 | Ga0157378_100655332 | 330 |
| 199 | 3300013306 | Ga0163162_10080001 | Ga0163162_100800012 | 330 |
| 200 | 3300013306 | Ga0163162_10195287 | Ga0163162_101952872 | 330 |
| 201 | 3300013308 | Ga0157375_10014359 | Ga0157375_100143592 | 330 |
| 202 | 3300013308 | Ga0157375_10398202 | Ga0157375_103982022 | 330 |
| 203 | 3300014325 | Ga0163163_10035662 | Ga0163163_100356622 | 330 |
| 204 | 3300014325 | Ga0163163_10043777 | Ga0163163_100437773 | 330 |
| 205 | 3300014745 | Ga0157377_10062622 | Ga0157377_100626222 | 330 |
| 206 | 3300014968 | Ga0157379_10213457 | Ga0157379_102134572 | 330 |
| 207 | 3300025315 | Ga0207697_10001005 | Ga0207697_1000100513 | 330 |
| 208 | 3300025893 | Ga0207682_10001037 | Ga0207682_100010372 | 330 |
| 209 | 3300025901 | Ga0207688_10036956 | Ga0207688_100369561 | 330 |
| 210 | 3300025907 | Ga0207645_10008205 | Ga0207645_100082051 | 330 |
| 211 | 3300025908 | Ga0207643_10014699 | Ga0207643_100146992 | 330 |
| 212 | 3300025918 | Ga0207662_10009332 | Ga0207662_100093322 | 330 |
| 213 | 3300025919 | Ga0207657_10014078 | Ga0207657_100140785 | 330 |
| 214 | 3300025920 | Ga0207649_10007401 | Ga0207649_100074012 | 330 |
| 215 | 3300025923 | Ga0207681_10099318 | Ga0207681_100993183 | 330 |
| 216 | 3300025925 | Ga0207650_10002835 | Ga0207650_100028357 | 330 |
| 217 | 3300025926 | Ga0207659_10050486 | Ga0207659_100504863 | 330 |
| 218 | 3300025928 | Ga0207700_10000283 | Ga0207700_1000028310 | 330 |
| 219 | 3300025931 | Ga0207644_10002100 | Ga0207644_100021005 | 330 |
| 220 | 3300025933 | Ga0207706_10026871 | Ga0207706_100268712 | 330 |
| 221 | 3300025936 | Ga0207670_10115971 | Ga0207670_101159711 | 330 |
| 222 | 3300025940 | Ga0207691_10182012 | Ga0207691_101820122 | 330 |
| 223 | 3300025941 | Ga0207711_10005683 | Ga0207711_100056835 | 330 |
| 224 | 3300025941 | Ga0207711_10083621 | Ga0207711_100836212 | 330 |
| 225 | 3300025942 | Ga0207689_10004120 | Ga0207689_100041208 | 330 |
| 226 | 3300025942 | Ga0207689_10399250 | Ga0207689_103992501 | 330 |
| 227 | 3300025944 | Ga0207661_10162200 | Ga0207661_101622002 | 330 |
| 228 | 3300025960 | Ga0207651_10004652 | Ga0207651_100046523 | 330 |
| 229 | 3300025986 | Ga0207658_10158118 | Ga0207658_101581181 | 330 |
| 230 | 3300026035 | Ga0207703_10055430 | Ga0207703_100554302 | 330 |
| 231 | 3300026035 | Ga0207703_10285339 | Ga0207703_102853392 | 330 |
| 232 | 3300026067 | Ga0207678_10002154 | Ga0207678_100021548 | 330 |
| 233 | 3300026075 | Ga0207708_10042425 | Ga0207708_100424252 | 330 |
| 234 | 3300026095 | Ga0207676_10243096 | Ga0207676_102430962 | 330 |
| 235 | 3300026095 | Ga0207676_10258613 | Ga0207676_102586131 | 330 |
| 236 | 3300026116 | Ga0207674_10007120 | Ga0207674_100071202 | 330 |
| 237 | 3300026118 | Ga0207675_100002285 | Ga0207675_10000228512 | 330 |
| 238 | 3300026118 | Ga0207675_100282810 | Ga0207675_1002828103 | 330 |
| 239 | 3300026121 | Ga0207683_10109140 | Ga0207683_101091402 | 330 |
| 240 | 3300026142 | Ga0207698_10367444 | Ga0207698_103674442 | 330 |
| 241 | 3300027682 | Ga0209971_1023048 | Ga0209971_10230482 | 330 |
| 242 | 3300027876 | Ga0209974_10008493 | Ga0209974_100084934 | 330 |
| 243 | 3300027907 | Ga0207428_10217621 | Ga0207428_102176212 | 330 |
| 244 | 3300028379 | Ga0268266_10037502 | Ga0268266_100375021 | 330 |
| 245 | 3300028381 | Ga0268264_10249167 | Ga0268264_102491672 | 330 |
| 246 | 3300028563 | Ga0265319_1000487 | Ga0265319_10004878 | 330 |
| 247 | 3300028563 | Ga0265319_1004533 | Ga0265319_10045332 | 330 |
| 248 | 3300028563 | Ga0265319_1008838 | Ga0265319_10088382 | 330 |
| 249 | 3300028577 | Ga0265318_10000369 | Ga0265318_1000036917 | 330 |
| 250 | 3300028577 | Ga0265318_10007193 | Ga0265318_100071932 | 330 |
| 251 | 3300028666 | Ga0265336_10002155 | Ga0265336_100021557 | 330 |
| 252 | 3300028800 | Ga0265338_10006524 | Ga0265338_100065242 | 330 |
| 253 | 3300031240 | Ga0265320_10001956 | Ga0265320_100019567 | 330 |
| 254 | 3300031240 | Ga0265320_10002237 | Ga0265320_100022375 | 330 |
| 255 | 3300031240 | Ga0265320_10002575 | Ga0265320_100025755 | 330 |
| 256 | 3300031240 | Ga0265320_10003710 | Ga0265320_100037108 | 330 |
| 257 | 3300031240 | Ga0265320_10055189 | Ga0265320_100551892 | 330 |
| 258 | 3300031242 | Ga0265329_10035888 | Ga0265329_100358882 | 330 |
| 259 | 3300031251 | Ga0265327_10000029 | Ga0265327_1000002942 | 330 |
| 260 | 3300031251 | Ga0265327_10002947 | Ga0265327_100029478 | 330 |
| 261 | 3300031251 | Ga0265327_10011290 | Ga0265327_100112903 | 330 |
| 262 | 3300031344 | Ga0265316_10006013 | Ga0265316_100060133 | 330 |
| 263 | 3300031344 | Ga0265316_10050188 | Ga0265316_100501882 | 330 |
| 264 | 3300031595 | Ga0265313_10020761 | Ga0265313_100207612 | 330 |
| 265 | 3300031595 | Ga0265313_10030763 | Ga0265313_100307632 | 330 |
| 266 | 3300031711 | Ga0265314_10001590 | Ga0265314_100015908 | 330 |
| 267 | 3300031711 | Ga0265314_10125242 | Ga0265314_101252422 | 330 |
| 268 | 3300031712 | Ga0265342_10040853 | Ga0265342_100408532 | 330 |
| 269 | 3300031727 | Ga0316576_10021570 | Ga0316576_100215702 | 330 |
| 270 | 3300031731 | Ga0307405_10027977 | Ga0307405_100279772 | 330 |
| 271 | 3300031733 | Ga0316577_10008449 | Ga0316577_100084492 | 330 |
| 272 | 3300031733 | Ga0316577_10042730 | Ga0316577_100427302 | 330 |
| 273 | 3300032168 | Ga0316593_10033691 | Ga0316593_100336912 | 330 |
| 274 | 3300035172 | Ga0373955_0091664 | Ga0373955_0091664_218_1210 | 330 |
| 275 | 3300035398 | Ga0316574_0076663 | Ga0316574_0076663_107_1099 | 330 |
| 276 | 3300035692 | Ga0373935_0020484 | Ga0373935_0020484_1088_2080 | 330 |
| 277 | 3300036401 | Ga0373937_0263188 | Ga0373937_0263188_434_1438 | 330 |
| 278 | 3300036712 | Ga0316584_0005315 | Ga0316584_0005315_701_1693 | 330 |
| 279 | 3300042876 | Ga0451577_0298148 | Ga0451577_0298148_343_1335 | 330 |
| 280 | 3300044712 | Ga0453684_0003020 | Ga0453684_0003020_4074_5066 | 330 |
| 281 | 3300046459 | Ga0495629_0000018 | Ga0495629_0000018_80261_81253 | 330 |
| 282 | 3300046472 | Ga0495580_0099393 | Ga0495580_0099393_171_1163 | 330 |
| 283 | 3300046473 | Ga0495582_0001254 | Ga0495582_0001254_7790_8782 | 330 |
| 284 | 3300046475 | Ga0495639_0007935 | Ga0495639_0007935_1891_2883 | 330 |
| 285 | 3300046517 | Ga0495630_0166578 | Ga0495630_0166578_389_1393 | 330 |
| 286 | 3300046533 | Ga0495640_0075761 | Ga0495640_0075761_272_1264 | 330 |
| 287 | 3300046539 | Ga0495621_0011910 | Ga0495621_0011910_1355_2362 | 330 |
| 288 | 3300046663 | Ga0495635_0000069 | Ga0495635_0000069_24679_25671 | 330 |
| 289 | 3300046681 | Ga0495647_0002903 | Ga0495647_0002903_3574_4566 | 330 |
| 290 | 3300046683 | Ga0495658_0000471 | Ga0495658_0000471_4099_5091 | 330 |
| 291 | 3300046689 | Ga0495613_0005080 | Ga0495613_0005080_7247_8239 | 330 |
| 292 | 3300047315 | Ga0495581_0005351 | Ga0495581_0005351_317_1309 | 330 |
| 293 | 3300047319 | Ga0495674_0219764 | Ga0495674_0219764_401_1405 | 330 |
| 294 | 3300047322 | Ga0495680_0000044 | Ga0495680_0000044_46660_47652 | 330 |
| 295 | 3300047673 | Ga0495593_0093043 | Ga0495593_0093043_127_1119 | 330 |
| 296 | 3300048089 | Ga0495614_0018343 | Ga0495614_0018343_674_1666 | 330 |
| 297 | 3300048907 | Ga0496104_0017902 | Ga0496104_0017902_4524_5531 | 330 |
| 298 | 3300048908 | Ga0496105_0014830 | Ga0496105_0014830_2119_3126 | 330 |
| 299 | 3300048909 | Ga0496106_0143195 | Ga0496106_0143195_99_1106 | 330 |
| 300 | 3300048911 | Ga0496108_0013093 | Ga0496108_0013093_5676_6683 | 330 |
| 301 | 3300048912 | Ga0496109_0004542 | Ga0496109_0004542_1778_2785 | 330 |
| 302 | 3300048912 | Ga0496109_0302331 | Ga0496109_0302331_44_1051 | 330 |
| 303 | 3300048913 | Ga0496110_0027451 | Ga0496110_0027451_2788_3795 | 330 |
| 304 | 3300048917 | Ga0496114_0008657 | Ga0496114_0008657_931_1938 | 330 |
| 305 | 3300049581 | Ga0501047_0350148 | Ga0501047_0350148_239_1231 | 330 |
| 306 | 3300049587 | Ga0501071_0037531 | Ga0501071_0037531_1979_3013 | 330 |
| 307 | 3300049741 | Ga0501079_0132449 | Ga0501079_0132449_250_1284 | 330 |
| 308 | 3300049742 | Ga0501080_0246615 | Ga0501080_0246615_78_1076 | 330 |
| 309 | 3300049824 | Ga0501045_0169444 | Ga0501045_0169444_476_1510 | 330 |
| 310 | 3300050511 | nmdc:mga08y16_102720_c1 | nmdc:mga08y16_102720_c1_1164_2156 | 330 |
| 311 | 3300050511 | nmdc:mga08y16_178706_c1 | nmdc:mga08y16_178706_c1_345_1352 | 330 |
| 312 | 3300053085 | Ga0495619_0003782 | Ga0495619_0003782_603_1595 | 330 |
| 313 | 3300005334 | Ga0068869_100083554 | Ga0068869_1000835543 | 331 |
| 314 | 3300005343 | Ga0070687_100113034 | Ga0070687_1001130342 | 331 |
| 315 | 3300005353 | Ga0070669_100106929 | Ga0070669_1001069293 | 331 |
| 316 | 3300005365 | Ga0070688_100017343 | Ga0070688_1000173432 | 331 |
| 317 | 3300005438 | Ga0070701_10073707 | Ga0070701_100737072 | 331 |
| 318 | 3300005439 | Ga0070711_100000867 | Ga0070711_1000008672 | 331 |
| 319 | 3300005441 | Ga0070700_100225792 | Ga0070700_1002257922 | 331 |
| 320 | 3300005457 | Ga0070662_100195726 | Ga0070662_1001957262 | 331 |
| 321 | 3300005459 | Ga0068867_100021999 | Ga0068867_1000219992 | 331 |
| 322 | 3300005543 | Ga0070672_100066428 | Ga0070672_1000664282 | 331 |
| 323 | 3300005543 | Ga0070672_100245107 | Ga0070672_1002451072 | 331 |
| 324 | 3300005545 | Ga0070695_100075331 | Ga0070695_1000753312 | 331 |
| 325 | 3300005547 | Ga0070693_100021826 | Ga0070693_1000218262 | 331 |
| 326 | 3300005617 | Ga0068859_100037039 | Ga0068859_1000370392 | 331 |
| 327 | 3300005840 | Ga0068870_10128420 | Ga0068870_101284202 | 331 |
| 328 | 3300005841 | Ga0068863_100445652 | Ga0068863_1004456522 | 331 |
| 329 | 3300005844 | Ga0068862_100111420 | Ga0068862_1001114201 | 331 |
| 330 | 3300005844 | Ga0068862_100205667 | Ga0068862_1002056673 | 331 |
| 331 | 3300006173 | Ga0070716_100023651 | Ga0070716_1000236512 | 331 |
| 332 | 3300006175 | Ga0070712_100001352 | Ga0070712_10000135219 | 331 |
| 333 | 3300006237 | Ga0097621_100272221 | Ga0097621_1002722212 | 331 |
| 334 | 3300006880 | Ga0075429_100192801 | Ga0075429_1001928012 | 331 |
| 335 | 3300006931 | Ga0097620_100037038 | Ga0097620_1000370384 | 331 |
| 336 | 3300009093 | Ga0105240_10504323 | Ga0105240_105043231 | 331 |
| 337 | 3300009094 | Ga0111539_10101956 | Ga0111539_101019562 | 331 |
| 338 | 3300009147 | Ga0114129_10146958 | Ga0114129_101469582 | 331 |
| 339 | 3300009147 | Ga0114129_10446551 | Ga0114129_104465512 | 331 |
| 340 | 3300009177 | Ga0105248_10308455 | Ga0105248_103084552 | 331 |
| 341 | 3300009177 | Ga0105248_10450867 | Ga0105248_104508671 | 331 |
| 342 | 3300013308 | Ga0157375_10137877 | Ga0157375_101378772 | 331 |
| 343 | 3300013308 | Ga0157375_10168495 | Ga0157375_101684952 | 331 |
| 344 | 3300013308 | Ga0157375_10251425 | Ga0157375_102514251 | 331 |
| 345 | 3300024225 | Ga0224572_1022753 | Ga0224572_10227531 | 331 |
| 346 | 3300025908 | Ga0207643_10165265 | Ga0207643_101652652 | 331 |
| 347 | 3300025915 | Ga0207693_10001541 | Ga0207693_100015412 | 331 |
| 348 | 3300025921 | Ga0207652_10158373 | Ga0207652_101583732 | 331 |
| 349 | 3300025923 | Ga0207681_10009177 | Ga0207681_100091772 | 331 |
| 350 | 3300025931 | Ga0207644_10054347 | Ga0207644_100543473 | 331 |
| 351 | 3300025939 | Ga0207665_10011206 | Ga0207665_100112062 | 331 |
| 352 | 3300025940 | Ga0207691_10204794 | Ga0207691_102047942 | 331 |
| 353 | 3300025941 | Ga0207711_10319379 | Ga0207711_103193792 | 331 |
| 354 | 3300025942 | Ga0207689_10109215 | Ga0207689_101092153 | 331 |
| 355 | 3300025960 | Ga0207651_10140278 | Ga0207651_101402782 | 331 |
| 356 | 3300026075 | Ga0207708_10108170 | Ga0207708_101081702 | 331 |
| 357 | 3300026088 | Ga0207641_10412909 | Ga0207641_104129092 | 331 |
| 358 | 3300026089 | Ga0207648_10241084 | Ga0207648_102410842 | 331 |
| 359 | 3300026118 | Ga0207675_100022449 | Ga0207675_1000224492 | 331 |
| 360 | 3300028380 | Ga0268265_10577518 | Ga0268265_105775181 | 331 |
| 361 | 3300033528 | Ga0316588_1046288 | Ga0316588_10462881 | 331 |
| 362 | 3300033541 | Ga0316596_1001557 | Ga0316596_10015571 | 331 |
| 363 | 3300044712 | Ga0453684_0000627 | Ga0453684_0000627_84535_85530 | 331 |
| 364 | 3300044712 | Ga0453684_0001422 | Ga0453684_0001422_52581_53576 | 331 |
| 365 | 3300044712 | Ga0453684_0003787 | Ga0453684_0003787_342_1337 | 331 |
| 366 | 3300044712 | Ga0453684_0199884 | Ga0453684_0199884_41_1078 | 331 |
| 367 | 3300045051 | Ga0451576_0031990 | Ga0451576_0031990_4461_5456 | 331 |
| 368 | 3300045976 | Ga0466967_0117712 | Ga0466967_0117712_628_1644 | 331 |
| 369 | 3300046472 | Ga0495580_0053667 | Ga0495580_0053667_1572_2597 | 331 |
| 370 | 3300046536 | Ga0495587_0004841 | Ga0495587_0004841_2836_3849 | 331 |
| 371 | 3300047319 | Ga0495674_0313189 | Ga0495674_0313189_14_1039 | 331 |
| 372 | 3300049576 | Ga0501040_0072231 | Ga0501040_0072231_652_1653 | 331 |
| 373 | 3300049588 | Ga0501072_0038846 | Ga0501072_0038846_938_1939 | 331 |
| 374 | 3300049741 | Ga0501079_0135906 | Ga0501079_0135906_882_1883 | 331 |
| 375 | 3300049742 | Ga0501080_0115502 | Ga0501080_0115502_61_1062 | 331 |
| 376 | 3300049743 | Ga0501081_0019178 | Ga0501081_0019178_421_1422 | 331 |
| 377 | 3300049744 | Ga0501083_0179804 | Ga0501083_0179804_328_1329 | 331 |
| 378 | 3300050507 | nmdc:mga05p37_161921_c2 | nmdc:mga05p37_161921_c2_559_1554 | 331 |
| 379 | 3300050507 | nmdc:mga05p37_437457_c1 | nmdc:mga05p37_437457_c1_353_1387 | 331 |
| 380 | 3300050508 | nmdc:mga09592_130481_c2 | nmdc:mga09592_130481_c2_113_1147 | 331 |
| 381 | 3300050510 | nmdc:mga06r32_157174_c1 | nmdc:mga06r32_157174_c1_149_1162 | 331 |
| 382 | 3300054114 | Ga0501084_0036414 | Ga0501084_0036414_2503_3504 | 331 |
| 383 | 3300061734 | Ga0530510_0040752 | Ga0530510_0040752_1735_2736 | 331 |
| 384 | 2162886007 | SwRhRL2b_contig_652773 | SwRhRL2b_0752.00004570 | 332 |
| 385 | 3300001979 | JGI24740J21852_10049521 | JGI24740J21852_100495212 | 332 |
| 386 | 3300005290 | Ga0065712_10046738 | Ga0065712_100467381 | 332 |
| 387 | 3300005327 | Ga0070658_10034204 | Ga0070658_100342042 | 332 |
| 388 | 3300005329 | Ga0070683_100004370 | Ga0070683_1000043702 | 332 |
| 389 | 3300005329 | Ga0070683_100007607 | Ga0070683_1000076075 | 332 |
| 390 | 3300005329 | Ga0070683_100056213 | Ga0070683_1000562135 | 332 |
| 391 | 3300005329 | Ga0070683_100094743 | Ga0070683_1000947432 | 332 |
| 392 | 3300005329 | Ga0070683_100262099 | Ga0070683_1002620992 | 332 |
| 393 | 3300005331 | Ga0070670_100105102 | Ga0070670_1001051022 | 332 |
| 394 | 3300005334 | Ga0068869_100017812 | Ga0068869_1000178122 | 332 |
| 395 | 3300005334 | Ga0068869_100042553 | Ga0068869_1000425532 | 332 |
| 396 | 3300005334 | Ga0068869_100144681 | Ga0068869_1001446812 | 332 |
| 397 | 3300005337 | Ga0070682_100034532 | Ga0070682_1000345321 | 332 |
| 398 | 3300005337 | Ga0070682_100053662 | Ga0070682_1000536622 | 332 |
| 399 | 3300005338 | Ga0068868_100015082 | Ga0068868_1000150822 | 332 |
| 400 | 3300005338 | Ga0068868_100021815 | Ga0068868_1000218152 | 332 |
| 401 | 3300005339 | Ga0070660_100301746 | Ga0070660_1003017462 | 332 |
| 402 | 3300005340 | Ga0070689_100000419 | Ga0070689_1000004192 | 332 |
| 403 | 3300005344 | Ga0070661_100027236 | Ga0070661_1000272362 | 332 |
| 404 | 3300005344 | Ga0070661_100194398 | Ga0070661_1001943981 | 332 |
| 405 | 3300005345 | Ga0070692_10117023 | Ga0070692_101170231 | 332 |
| 406 | 3300005347 | Ga0070668_100036615 | Ga0070668_1000366152 | 332 |
| 407 | 3300005353 | Ga0070669_100090563 | Ga0070669_1000905631 | 332 |
| 408 | 3300005355 | Ga0070671_100011927 | Ga0070671_1000119272 | 332 |
| 409 | 3300005355 | Ga0070671_100017015 | Ga0070671_1000170152 | 332 |
| 410 | 3300005364 | Ga0070673_100031142 | Ga0070673_1000311421 | 332 |
| 411 | 3300005364 | Ga0070673_100057376 | Ga0070673_1000573762 | 332 |
| 412 | 3300005366 | Ga0070659_100043648 | Ga0070659_1000436482 | 332 |
| 413 | 3300005366 | Ga0070659_100118024 | Ga0070659_1001180242 | 332 |
| 414 | 3300005366 | Ga0070659_100169346 | Ga0070659_1001693461 | 332 |
| 415 | 3300005367 | Ga0070667_100153681 | Ga0070667_1001536812 | 332 |
| 416 | 3300005406 | Ga0070703_10002794 | Ga0070703_100027942 | 332 |
| 417 | 3300005436 | Ga0070713_100047339 | Ga0070713_1000473392 | 332 |
| 418 | 3300005436 | Ga0070713_100114312 | Ga0070713_1001143122 | 332 |
| 419 | 3300005436 | Ga0070713_100162738 | Ga0070713_1001627382 | 332 |
| 420 | 3300005436 | Ga0070713_100173904 | Ga0070713_1001739042 | 332 |
| 421 | 3300005438 | Ga0070701_10046427 | Ga0070701_100464271 | 332 |
| 422 | 3300005439 | Ga0070711_100051367 | Ga0070711_1000513672 | 332 |
| 423 | 3300005440 | Ga0070705_100014354 | Ga0070705_1000143543 | 332 |
| 424 | 3300005440 | Ga0070705_100157900 | Ga0070705_1001579001 | 332 |
| 425 | 3300005440 | Ga0070705_100206242 | Ga0070705_1002062421 | 332 |
| 426 | 3300005441 | Ga0070700_100000048 | Ga0070700_10000004874 | 332 |
| 427 | 3300005441 | Ga0070700_100013640 | Ga0070700_1000136404 | 332 |
| 428 | 3300005441 | Ga0070700_100032002 | Ga0070700_1000320022 | 332 |
| 429 | 3300005444 | Ga0070694_100148928 | Ga0070694_1001489282 | 332 |
| 430 | 3300005455 | Ga0070663_100144797 | Ga0070663_1001447972 | 332 |
| 431 | 3300005458 | Ga0070681_10001179 | Ga0070681_1000117918 | 332 |
| 432 | 3300005458 | Ga0070681_10097768 | Ga0070681_100977682 | 332 |
| 433 | 3300005458 | Ga0070681_10262387 | Ga0070681_102623872 | 332 |
| 434 | 3300005467 | Ga0070706_100238941 | Ga0070706_1002389412 | 332 |
| 435 | 3300005518 | Ga0070699_100190757 | Ga0070699_1001907572 | 332 |
| 436 | 3300005530 | Ga0070679_100004238 | Ga0070679_1000042385 | 332 |
| 437 | 3300005530 | Ga0070679_100182498 | Ga0070679_1001824982 | 332 |
| 438 | 3300005535 | Ga0070684_100001487 | Ga0070684_10000148714 | 332 |
| 439 | 3300005535 | Ga0070684_100019174 | Ga0070684_1000191742 | 332 |
| 440 | 3300005535 | Ga0070684_100019798 | Ga0070684_1000197982 | 332 |
| 441 | 3300005535 | Ga0070684_100045982 | Ga0070684_1000459822 | 332 |
| 442 | 3300005535 | Ga0070684_100089992 | Ga0070684_1000899922 | 332 |
| 443 | 3300005535 | Ga0070684_100243401 | Ga0070684_1002434012 | 332 |
| 444 | 3300005535 | Ga0070684_100258961 | Ga0070684_1002589612 | 332 |
| 445 | 3300005535 | Ga0070684_100278697 | Ga0070684_1002786972 | 332 |
| 446 | 3300005539 | Ga0068853_100000527 | Ga0068853_10000052710 | 332 |
| 447 | 3300005539 | Ga0068853_100009875 | Ga0068853_1000098755 | 332 |
| 448 | 3300005539 | Ga0068853_100015941 | Ga0068853_1000159412 | 332 |
| 449 | 3300005539 | Ga0068853_100118867 | Ga0068853_1001188672 | 332 |
| 450 | 3300005539 | Ga0068853_100192477 | Ga0068853_1001924772 | 332 |
| 451 | 3300005539 | Ga0068853_100324093 | Ga0068853_1003240931 | 332 |
| 452 | 3300005539 | Ga0068853_100411846 | Ga0068853_1004118462 | 332 |
| 453 | 3300005545 | Ga0070695_100173099 | Ga0070695_1001730992 | 332 |
| 454 | 3300005546 | Ga0070696_100289502 | Ga0070696_1002895021 | 332 |
| 455 | 3300005547 | Ga0070693_100000797 | Ga0070693_1000007978 | 332 |
| 456 | 3300005548 | Ga0070665_100005415 | Ga0070665_1000054156 | 332 |
| 457 | 3300005548 | Ga0070665_100039360 | Ga0070665_1000393603 | 332 |
| 458 | 3300005548 | Ga0070665_100180386 | Ga0070665_1001803862 | 332 |
| 459 | 3300005563 | Ga0068855_100008707 | Ga0068855_1000087072 | 332 |
| 460 | 3300005563 | Ga0068855_100029282 | Ga0068855_1000292823 | 332 |
| 461 | 3300005563 | Ga0068855_100043128 | Ga0068855_1000431282 | 332 |
| 462 | 3300005563 | Ga0068855_100053805 | Ga0068855_1000538054 | 332 |
| 463 | 3300005563 | Ga0068855_100110332 | Ga0068855_1001103322 | 332 |
| 464 | 3300005563 | Ga0068855_100216870 | Ga0068855_1002168702 | 332 |
| 465 | 3300005564 | Ga0070664_100000979 | Ga0070664_10000097919 | 332 |
| 466 | 3300005564 | Ga0070664_100115108 | Ga0070664_1001151082 | 332 |
| 467 | 3300005564 | Ga0070664_100187255 | Ga0070664_1001872552 | 332 |
| 468 | 3300005577 | Ga0068857_100000681 | Ga0068857_1000006812 | 332 |
| 469 | 3300005577 | Ga0068857_100000870 | Ga0068857_10000087012 | 332 |
| 470 | 3300005577 | Ga0068857_100001403 | Ga0068857_1000014037 | 332 |
| 471 | 3300005577 | Ga0068857_100014630 | Ga0068857_1000146302 | 332 |
| 472 | 3300005577 | Ga0068857_100052200 | Ga0068857_1000522002 | 332 |
| 473 | 3300005577 | Ga0068857_100345503 | Ga0068857_1003455031 | 332 |
| 474 | 3300005578 | Ga0068854_100016541 | Ga0068854_1000165412 | 332 |
| 475 | 3300005614 | Ga0068856_100010085 | Ga0068856_1000100856 | 332 |
| 476 | 3300005614 | Ga0068856_100010319 | Ga0068856_1000103193 | 332 |
| 477 | 3300005614 | Ga0068856_100043012 | Ga0068856_1000430122 | 332 |
| 478 | 3300005614 | Ga0068856_100166164 | Ga0068856_1001661642 | 332 |
| 479 | 3300005614 | Ga0068856_100179327 | Ga0068856_1001793271 | 332 |
| 480 | 3300005615 | Ga0070702_100197601 | Ga0070702_1001976011 | 332 |
| 481 | 3300005616 | Ga0068852_100000003 | Ga0068852_10000000350 | 332 |
| 482 | 3300005616 | Ga0068852_100000341 | Ga0068852_10000034119 | 332 |
| 483 | 3300005616 | Ga0068852_100043024 | Ga0068852_1000430242 | 332 |
| 484 | 3300005616 | Ga0068852_100213434 | Ga0068852_1002134342 | 332 |
| 485 | 3300005616 | Ga0068852_100264092 | Ga0068852_1002640922 | 332 |
| 486 | 3300005616 | Ga0068852_100276776 | Ga0068852_1002767761 | 332 |
| 487 | 3300005617 | Ga0068859_100004804 | Ga0068859_1000048042 | 332 |
| 488 | 3300005617 | Ga0068859_100073999 | Ga0068859_1000739992 | 332 |
| 489 | 3300005617 | Ga0068859_100081817 | Ga0068859_1000818171 | 332 |
| 490 | 3300005617 | Ga0068859_100090690 | Ga0068859_1000906901 | 332 |
| 491 | 3300005617 | Ga0068859_100105134 | Ga0068859_1001051342 | 332 |
| 492 | 3300005617 | Ga0068859_100163663 | Ga0068859_1001636632 | 332 |
| 493 | 3300005617 | Ga0068859_100225811 | Ga0068859_1002258112 | 332 |
| 494 | 3300005617 | Ga0068859_100316950 | Ga0068859_1003169502 | 332 |
| 495 | 3300005618 | Ga0068864_100009115 | Ga0068864_1000091152 | 332 |
| 496 | 3300005618 | Ga0068864_100057042 | Ga0068864_1000570422 | 332 |
| 497 | 3300005618 | Ga0068864_100067133 | Ga0068864_1000671333 | 332 |
| 498 | 3300005618 | Ga0068864_100070413 | Ga0068864_1000704132 | 332 |
| 499 | 3300005618 | Ga0068864_100175032 | Ga0068864_1001750322 | 332 |
| 500 | 3300005618 | Ga0068864_100391067 | Ga0068864_1003910671 | 332 |
| 501 | 3300005719 | Ga0068861_100113100 | Ga0068861_1001131002 | 332 |
| 502 | 3300005719 | Ga0068861_100160688 | Ga0068861_1001606882 | 332 |
| 503 | 3300005834 | Ga0068851_10000999 | Ga0068851_100009998 | 332 |
| 504 | 3300005834 | Ga0068851_10006100 | Ga0068851_100061003 | 332 |
| 505 | 3300005834 | Ga0068851_10006394 | Ga0068851_100063942 | 332 |
| 506 | 3300005834 | Ga0068851_10030944 | Ga0068851_100309442 | 332 |
| 507 | 3300005840 | Ga0068870_10053498 | Ga0068870_100534982 | 332 |
| 508 | 3300005840 | Ga0068870_10205480 | Ga0068870_102054801 | 332 |
| 509 | 3300005841 | Ga0068863_100001291 | Ga0068863_10000129113 | 332 |
| 510 | 3300005841 | Ga0068863_100039664 | Ga0068863_1000396643 | 332 |
| 511 | 3300005841 | Ga0068863_100048139 | Ga0068863_1000481392 | 332 |
| 512 | 3300005841 | Ga0068863_100163812 | Ga0068863_1001638122 | 332 |
| 513 | 3300005842 | Ga0068858_100124770 | Ga0068858_1001247702 | 332 |
| 514 | 3300005842 | Ga0068858_100156523 | Ga0068858_1001565232 | 332 |
| 515 | 3300005843 | Ga0068860_100020939 | Ga0068860_1000209392 | 332 |
| 516 | 3300005843 | Ga0068860_100086192 | Ga0068860_1000861922 | 332 |
| 517 | 3300005843 | Ga0068860_100246834 | Ga0068860_1002468342 | 332 |
| 518 | 3300005843 | Ga0068860_100370797 | Ga0068860_1003707972 | 332 |
| 519 | 3300005844 | Ga0068862_100240550 | Ga0068862_1002405501 | 332 |
| 520 | 3300006028 | Ga0070717_10011870 | Ga0070717_100118702 | 332 |
| 521 | 3300006028 | Ga0070717_10086684 | Ga0070717_100866842 | 332 |
| 522 | 3300006173 | Ga0070716_100142389 | Ga0070716_1001423892 | 332 |
| 523 | 3300006175 | Ga0070712_100095543 | Ga0070712_1000955431 | 332 |
| 524 | 3300006237 | Ga0097621_100004180 | Ga0097621_1000041802 | 332 |
| 525 | 3300006237 | Ga0097621_100005272 | Ga0097621_1000052722 | 332 |
| 526 | 3300006237 | Ga0097621_100017286 | Ga0097621_1000172863 | 332 |
| 527 | 3300006237 | Ga0097621_100040644 | Ga0097621_1000406442 | 332 |
| 528 | 3300006358 | Ga0068871_100006260 | Ga0068871_1000062607 | 332 |
| 529 | 3300006358 | Ga0068871_100021192 | Ga0068871_1000211922 | 332 |
| 530 | 3300006358 | Ga0068871_100030188 | Ga0068871_1000301883 | 332 |
| 531 | 3300006358 | Ga0068871_100232449 | Ga0068871_1002324492 | 332 |
| 532 | 3300006844 | Ga0075428_100082916 | Ga0075428_1000829161 | 332 |
| 533 | 3300006844 | Ga0075428_100202163 | Ga0075428_1002021632 | 332 |
| 534 | 3300006846 | Ga0075430_100029407 | Ga0075430_1000294073 | 332 |
| 535 | 3300006847 | Ga0075431_100104680 | Ga0075431_1001046803 | 332 |
| 536 | 3300006852 | Ga0075433_10225467 | Ga0075433_102254672 | 332 |
| 537 | 3300006871 | Ga0075434_100105754 | Ga0075434_1001057542 | 332 |
| 538 | 3300006914 | Ga0075436_100006092 | Ga0075436_1000060924 | 332 |
| 539 | 3300006931 | Ga0097620_100004805 | Ga0097620_1000048052 | 332 |
| 540 | 3300006931 | Ga0097620_100074004 | Ga0097620_1000740042 | 332 |
| 541 | 3300006931 | Ga0097620_100081816 | Ga0097620_1000818161 | 332 |
| 542 | 3300006931 | Ga0097620_100090700 | Ga0097620_1000907001 | 332 |
| 543 | 3300006931 | Ga0097620_100105132 | Ga0097620_1001051322 | 332 |
| 544 | 3300006931 | Ga0097620_100163670 | Ga0097620_1001636702 | 332 |
| 545 | 3300006931 | Ga0097620_100225815 | Ga0097620_1002258152 | 332 |
| 546 | 3300006931 | Ga0097620_100316969 | Ga0097620_1003169692 | 332 |
| 547 | 3300009093 | Ga0105240_10000114 | Ga0105240_1000011434 | 332 |
| 548 | 3300009093 | Ga0105240_10001213 | Ga0105240_100012132 | 332 |
| 549 | 3300009093 | Ga0105240_10010907 | Ga0105240_1001090714 | 332 |
| 550 | 3300009093 | Ga0105240_10014675 | Ga0105240_100146754 | 332 |
| 551 | 3300009093 | Ga0105240_10016545 | Ga0105240_100165455 | 332 |
| 552 | 3300009093 | Ga0105240_10030039 | Ga0105240_100300394 | 332 |
| 553 | 3300009093 | Ga0105240_10060412 | Ga0105240_100604126 | 332 |
| 554 | 3300009093 | Ga0105240_10094756 | Ga0105240_100947562 | 332 |
| 555 | 3300009093 | Ga0105240_10095421 | Ga0105240_100954212 | 332 |
| 556 | 3300009093 | Ga0105240_10425188 | Ga0105240_104251881 | 332 |
| 557 | 3300009093 | Ga0105240_10593883 | Ga0105240_105938831 | 332 |
| 558 | 3300009094 | Ga0111539_10152947 | Ga0111539_101529472 | 332 |
| 559 | 3300009098 | Ga0105245_10003452 | Ga0105245_100034529 | 332 |
| 560 | 3300009098 | Ga0105245_10067864 | Ga0105245_100678642 | 332 |
| 561 | 3300009098 | Ga0105245_10212210 | Ga0105245_102122102 | 332 |
| 562 | 3300009101 | Ga0105247_10001389 | Ga0105247_100013892 | 332 |
| 563 | 3300009101 | Ga0105247_10020805 | Ga0105247_100208052 | 332 |
| 564 | 3300009101 | Ga0105247_10039696 | Ga0105247_100396962 | 332 |
| 565 | 3300009101 | Ga0105247_10135107 | Ga0105247_101351072 | 332 |
| 566 | 3300009148 | Ga0105243_10352890 | Ga0105243_103528902 | 332 |
| 567 | 3300009174 | Ga0105241_10000112 | Ga0105241_1000011246 | 332 |
| 568 | 3300009174 | Ga0105241_10001115 | Ga0105241_100011152 | 332 |
| 569 | 3300009174 | Ga0105241_10023766 | Ga0105241_100237661 | 332 |
| 570 | 3300009174 | Ga0105241_10040087 | Ga0105241_100400872 | 332 |
| 571 | 3300009174 | Ga0105241_10059397 | Ga0105241_100593972 | 332 |
| 572 | 3300009174 | Ga0105241_10137621 | Ga0105241_101376212 | 332 |
| 573 | 3300009176 | Ga0105242_10101199 | Ga0105242_101011992 | 332 |
| 574 | 3300009177 | Ga0105248_10000432 | Ga0105248_1000043210 | 332 |
| 575 | 3300009177 | Ga0105248_10033471 | Ga0105248_100334713 | 332 |
| 576 | 3300009177 | Ga0105248_10033672 | Ga0105248_100336723 | 332 |
| 577 | 3300009177 | Ga0105248_10036277 | Ga0105248_100362776 | 332 |
| 578 | 3300009177 | Ga0105248_10086266 | Ga0105248_100862662 | 332 |
| 579 | 3300009177 | Ga0105248_10137095 | Ga0105248_101370951 | 332 |
| 580 | 3300009177 | Ga0105248_10607895 | Ga0105248_106078952 | 332 |
| 581 | 3300009545 | Ga0105237_10002295 | Ga0105237_100022952 | 332 |
| 582 | 3300009545 | Ga0105237_10003756 | Ga0105237_100037566 | 332 |
| 583 | 3300009545 | Ga0105237_10042887 | Ga0105237_100428873 | 332 |
| 584 | 3300009545 | Ga0105237_10086573 | Ga0105237_100865732 | 332 |
| 585 | 3300009545 | Ga0105237_10139014 | Ga0105237_101390141 | 332 |
| 586 | 3300009545 | Ga0105237_10140979 | Ga0105237_101409792 | 332 |
| 587 | 3300009545 | Ga0105237_10382646 | Ga0105237_103826461 | 332 |
| 588 | 3300009551 | Ga0105238_10000446 | Ga0105238_1000044628 | 332 |
| 589 | 3300009551 | Ga0105238_10001879 | Ga0105238_100018794 | 332 |
| 590 | 3300009551 | Ga0105238_10003133 | Ga0105238_100031334 | 332 |
| 591 | 3300009551 | Ga0105238_10027746 | Ga0105238_100277463 | 332 |
| 592 | 3300009551 | Ga0105238_10064721 | Ga0105238_100647212 | 332 |
| 593 | 3300009551 | Ga0105238_10071794 | Ga0105238_100717942 | 332 |
| 594 | 3300009551 | Ga0105238_10116338 | Ga0105238_101163382 | 332 |
| 595 | 3300009551 | Ga0105238_10186084 | Ga0105238_101860842 | 332 |
| 596 | 3300009553 | Ga0105249_10001827 | Ga0105249_100018274 | 332 |
| 597 | 3300009553 | Ga0105249_10121551 | Ga0105249_101215512 | 332 |
| 598 | 3300009553 | Ga0105249_10189851 | Ga0105249_101898511 | 332 |
| 599 | 3300010375 | Ga0105239_10005246 | Ga0105239_100052467 | 332 |
| 600 | 3300010375 | Ga0105239_10012072 | Ga0105239_100120724 | 332 |
| 601 | 3300010375 | Ga0105239_10016785 | Ga0105239_100167852 | 332 |
| 602 | 3300010375 | Ga0105239_10067036 | Ga0105239_100670362 | 332 |
| 603 | 3300010375 | Ga0105239_10109075 | Ga0105239_101090753 | 332 |
| 604 | 3300010375 | Ga0105239_10208483 | Ga0105239_102084832 | 332 |
| 605 | 3300011119 | Ga0105246_10002464 | Ga0105246_1000246410 | 332 |
| 606 | 3300011119 | Ga0105246_10013890 | Ga0105246_100138902 | 332 |
| 607 | 3300011119 | Ga0105246_10159104 | Ga0105246_101591042 | 332 |
| 608 | 3300013100 | Ga0157373_10023761 | Ga0157373_100237611 | 332 |
| 609 | 3300013100 | Ga0157373_10033812 | Ga0157373_100338121 | 332 |
| 610 | 3300013100 | Ga0157373_10136348 | Ga0157373_101363482 | 332 |
| 611 | 3300013104 | Ga0157370_10000001 | Ga0157370_10000001396 | 332 |
| 612 | 3300013104 | Ga0157370_10150110 | Ga0157370_101501102 | 332 |
| 613 | 3300013104 | Ga0157370_10402500 | Ga0157370_104025001 | 332 |
| 614 | 3300013105 | Ga0157369_10000066 | Ga0157369_100000663 | 332 |
| 615 | 3300013105 | Ga0157369_10004092 | Ga0157369_100040929 | 332 |
| 616 | 3300013105 | Ga0157369_10006435 | Ga0157369_1000643516 | 332 |
| 617 | 3300013105 | Ga0157369_10007131 | Ga0157369_100071312 | 332 |
| 618 | 3300013105 | Ga0157369_10007580 | Ga0157369_100075808 | 332 |
| 619 | 3300013105 | Ga0157369_10014963 | Ga0157369_100149633 | 332 |
| 620 | 3300013105 | Ga0157369_10101687 | Ga0157369_101016872 | 332 |
| 621 | 3300013105 | Ga0157369_10108310 | Ga0157369_101083102 | 332 |
| 622 | 3300013105 | Ga0157369_10186157 | Ga0157369_101861571 | 332 |
| 623 | 3300013105 | Ga0157369_10201885 | Ga0157369_102018852 | 332 |
| 624 | 3300013105 | Ga0157369_10202223 | Ga0157369_102022232 | 332 |
| 625 | 3300013105 | Ga0157369_10241064 | Ga0157369_102410642 | 332 |
| 626 | 3300013296 | Ga0157374_10019339 | Ga0157374_100193392 | 332 |
| 627 | 3300013296 | Ga0157374_10022063 | Ga0157374_100220636 | 332 |
| 628 | 3300013296 | Ga0157374_10028405 | Ga0157374_100284053 | 332 |
| 629 | 3300013296 | Ga0157374_10156868 | Ga0157374_101568682 | 332 |
| 630 | 3300013296 | Ga0157374_10231293 | Ga0157374_102312932 | 332 |
| 631 | 3300013296 | Ga0157374_10323602 | Ga0157374_103236022 | 332 |
| 632 | 3300013297 | Ga0157378_10002106 | Ga0157378_100021065 | 332 |
| 633 | 3300013297 | Ga0157378_10005729 | Ga0157378_100057294 | 332 |
| 634 | 3300013297 | Ga0157378_10024665 | Ga0157378_100246652 | 332 |
| 635 | 3300013297 | Ga0157378_10041121 | Ga0157378_100411212 | 332 |
| 636 | 3300013297 | Ga0157378_10246464 | Ga0157378_102464642 | 332 |
| 637 | 3300013306 | Ga0163162_10011531 | Ga0163162_100115318 | 332 |
| 638 | 3300013306 | Ga0163162_10089988 | Ga0163162_100899883 | 332 |
| 639 | 3300013307 | Ga0157372_10000038 | Ga0157372_1000003820 | 332 |
| 640 | 3300013307 | Ga0157372_10012960 | Ga0157372_100129606 | 332 |
| 641 | 3300013307 | Ga0157372_10026501 | Ga0157372_100265012 | 332 |
| 642 | 3300013307 | Ga0157372_10076032 | Ga0157372_100760322 | 332 |
| 643 | 3300013307 | Ga0157372_10109820 | Ga0157372_101098202 | 332 |
| 644 | 3300013307 | Ga0157372_10132881 | Ga0157372_101328811 | 332 |
| 645 | 3300013307 | Ga0157372_10211101 | Ga0157372_102111012 | 332 |
| 646 | 3300013308 | Ga0157375_10001477 | Ga0157375_100014772 | 332 |
| 647 | 3300013308 | Ga0157375_10009678 | Ga0157375_100096784 | 332 |
| 648 | 3300013308 | Ga0157375_10028238 | Ga0157375_100282382 | 332 |
| 649 | 3300013308 | Ga0157375_10205848 | Ga0157375_102058482 | 332 |
| 650 | 3300013308 | Ga0157375_10246594 | Ga0157375_102465942 | 332 |
| 651 | 3300014325 | Ga0163163_10001025 | Ga0163163_1000102513 | 332 |
| 652 | 3300014325 | Ga0163163_10002404 | Ga0163163_100024047 | 332 |
| 653 | 3300014325 | Ga0163163_10019171 | Ga0163163_100191711 | 332 |
| 654 | 3300014325 | Ga0163163_10022943 | Ga0163163_100229433 | 332 |
| 655 | 3300014325 | Ga0163163_10061166 | Ga0163163_100611662 | 332 |
| 656 | 3300014325 | Ga0163163_10091636 | Ga0163163_100916362 | 332 |
| 657 | 3300014325 | Ga0163163_10094084 | Ga0163163_100940842 | 332 |
| 658 | 3300014325 | Ga0163163_10121890 | Ga0163163_101218902 | 332 |
| 659 | 3300014326 | Ga0157380_10343737 | Ga0157380_103437372 | 332 |
| 660 | 3300014326 | Ga0157380_10346729 | Ga0157380_103467292 | 332 |
| 661 | 3300014745 | Ga0157377_10148376 | Ga0157377_101483762 | 332 |
| 662 | 3300014968 | Ga0157379_10002365 | Ga0157379_1000236515 | 332 |
| 663 | 3300014968 | Ga0157379_10028822 | Ga0157379_100288225 | 332 |
| 664 | 3300014969 | Ga0157376_10000361 | Ga0157376_1000036115 | 332 |
| 665 | 3300014969 | Ga0157376_10014459 | Ga0157376_100144592 | 332 |
| 666 | 3300014969 | Ga0157376_10106099 | Ga0157376_101060992 | 332 |
| 667 | 3300017792 | Ga0163161_10191924 | Ga0163161_101919241 | 332 |
| 668 | 3300021361 | Ga0213872_10003691 | Ga0213872_100036917 | 332 |
| 669 | 3300025321 | Ga0207656_10020141 | Ga0207656_100201412 | 332 |
| 670 | 3300025321 | Ga0207656_10022576 | Ga0207656_100225762 | 332 |
| 671 | 3300025885 | Ga0207653_10020003 | Ga0207653_100200032 | 332 |
| 672 | 3300025900 | Ga0207710_10007316 | Ga0207710_100073162 | 332 |
| 673 | 3300025900 | Ga0207710_10007728 | Ga0207710_100077282 | 332 |
| 674 | 3300025903 | Ga0207680_10074580 | Ga0207680_100745802 | 332 |
| 675 | 3300025904 | Ga0207647_10001387 | Ga0207647_100013876 | 332 |
| 676 | 3300025908 | Ga0207643_10002407 | Ga0207643_100024073 | 332 |
| 677 | 3300025909 | Ga0207705_10122053 | Ga0207705_101220532 | 332 |
| 678 | 3300025910 | Ga0207684_10207104 | Ga0207684_102071042 | 332 |
| 679 | 3300025911 | Ga0207654_10000028 | Ga0207654_1000002851 | 332 |
| 680 | 3300025911 | Ga0207654_10000923 | Ga0207654_1000092314 | 332 |
| 681 | 3300025911 | Ga0207654_10009537 | Ga0207654_100095372 | 332 |
| 682 | 3300025911 | Ga0207654_10012799 | Ga0207654_100127992 | 332 |
| 683 | 3300025911 | Ga0207654_10017182 | Ga0207654_100171822 | 332 |
| 684 | 3300025911 | Ga0207654_10043148 | Ga0207654_100431482 | 332 |
| 685 | 3300025911 | Ga0207654_10086023 | Ga0207654_100860232 | 332 |
| 686 | 3300025912 | Ga0207707_10029108 | Ga0207707_100291082 | 332 |
| 687 | 3300025913 | Ga0207695_10000026 | Ga0207695_10000026168 | 332 |
| 688 | 3300025913 | Ga0207695_10000063 | Ga0207695_10000063230 | 332 |
| 689 | 3300025913 | Ga0207695_10000168 | Ga0207695_100001682 | 332 |
| 690 | 3300025913 | Ga0207695_10002562 | Ga0207695_1000256216 | 332 |
| 691 | 3300025913 | Ga0207695_10010282 | Ga0207695_100102826 | 332 |
| 692 | 3300025913 | Ga0207695_10022992 | Ga0207695_100229923 | 332 |
| 693 | 3300025913 | Ga0207695_10092568 | Ga0207695_100925682 | 332 |
| 694 | 3300025913 | Ga0207695_10123138 | Ga0207695_101231384 | 332 |
| 695 | 3300025913 | Ga0207695_10235644 | Ga0207695_102356442 | 332 |
| 696 | 3300025914 | Ga0207671_10000162 | Ga0207671_1000016274 | 332 |
| 697 | 3300025914 | Ga0207671_10000279 | Ga0207671_1000027928 | 332 |
| 698 | 3300025914 | Ga0207671_10000894 | Ga0207671_1000089434 | 332 |
| 699 | 3300025914 | Ga0207671_10001367 | Ga0207671_1000136715 | 332 |
| 700 | 3300025914 | Ga0207671_10092148 | Ga0207671_100921482 | 332 |
| 701 | 3300025914 | Ga0207671_10185120 | Ga0207671_101851201 | 332 |
| 702 | 3300025916 | Ga0207663_10011855 | Ga0207663_100118552 | 332 |
| 703 | 3300025919 | Ga0207657_10278785 | Ga0207657_102787851 | 332 |
| 704 | 3300025920 | Ga0207649_10022061 | Ga0207649_100220612 | 332 |
| 705 | 3300025921 | Ga0207652_10022303 | Ga0207652_100223032 | 332 |
| 706 | 3300025921 | Ga0207652_10081837 | Ga0207652_100818372 | 332 |
| 707 | 3300025924 | Ga0207694_10000144 | Ga0207694_100001442 | 332 |
| 708 | 3300025924 | Ga0207694_10000346 | Ga0207694_1000034625 | 332 |
| 709 | 3300025924 | Ga0207694_10002660 | Ga0207694_100026602 | 332 |
| 710 | 3300025924 | Ga0207694_10005604 | Ga0207694_100056046 | 332 |
| 711 | 3300025924 | Ga0207694_10044001 | Ga0207694_100440012 | 332 |
| 712 | 3300025924 | Ga0207694_10055734 | Ga0207694_100557342 | 332 |
| 713 | 3300025924 | Ga0207694_10157491 | Ga0207694_101574912 | 332 |
| 714 | 3300025925 | Ga0207650_10308096 | Ga0207650_103080962 | 332 |
| 715 | 3300025927 | Ga0207687_10038330 | Ga0207687_100383302 | 332 |
| 716 | 3300025927 | Ga0207687_10270698 | Ga0207687_102706982 | 332 |
| 717 | 3300025928 | Ga0207700_10030745 | Ga0207700_100307452 | 332 |
| 718 | 3300025928 | Ga0207700_10064688 | Ga0207700_100646882 | 332 |
| 719 | 3300025928 | Ga0207700_10148476 | Ga0207700_101484762 | 332 |
| 720 | 3300025931 | Ga0207644_10007797 | Ga0207644_100077972 | 332 |
| 721 | 3300025932 | Ga0207690_10066688 | Ga0207690_100666882 | 332 |
| 722 | 3300025933 | Ga0207706_10006950 | Ga0207706_100069507 | 332 |
| 723 | 3300025935 | Ga0207709_10141924 | Ga0207709_101419242 | 332 |
| 724 | 3300025936 | Ga0207670_10002664 | Ga0207670_100026642 | 332 |
| 725 | 3300025937 | Ga0207669_10167863 | Ga0207669_101678631 | 332 |
| 726 | 3300025938 | Ga0207704_10046721 | Ga0207704_100467212 | 332 |
| 727 | 3300025939 | Ga0207665_10022210 | Ga0207665_100222102 | 332 |
| 728 | 3300025939 | Ga0207665_10041465 | Ga0207665_100414652 | 332 |
| 729 | 3300025940 | Ga0207691_10008092 | Ga0207691_100080922 | 332 |
| 730 | 3300025941 | Ga0207711_10000871 | Ga0207711_1000087119 | 332 |
| 731 | 3300025941 | Ga0207711_10014644 | Ga0207711_100146442 | 332 |
| 732 | 3300025941 | Ga0207711_10124503 | Ga0207711_101245032 | 332 |
| 733 | 3300025941 | Ga0207711_10163373 | Ga0207711_101633732 | 332 |
| 734 | 3300025942 | Ga0207689_10001682 | Ga0207689_1000168210 | 332 |
| 735 | 3300025942 | Ga0207689_10160121 | Ga0207689_101601212 | 332 |
| 736 | 3300025944 | Ga0207661_10002016 | Ga0207661_100020162 | 332 |
| 737 | 3300025944 | Ga0207661_10043546 | Ga0207661_100435465 | 332 |
| 738 | 3300025944 | Ga0207661_10097689 | Ga0207661_100976892 | 332 |
| 739 | 3300025944 | Ga0207661_10150497 | Ga0207661_101504972 | 332 |
| 740 | 3300025944 | Ga0207661_10311235 | Ga0207661_103112352 | 332 |
| 741 | 3300025945 | Ga0207679_10012634 | Ga0207679_100126342 | 332 |
| 742 | 3300025949 | Ga0207667_10001348 | Ga0207667_100013482 | 332 |
| 743 | 3300025949 | Ga0207667_10002645 | Ga0207667_1000264518 | 332 |
| 744 | 3300025949 | Ga0207667_10079454 | Ga0207667_100794542 | 332 |
| 745 | 3300025949 | Ga0207667_10208158 | Ga0207667_102081582 | 332 |
| 746 | 3300025960 | Ga0207651_10015215 | Ga0207651_100152152 | 332 |
| 747 | 3300025960 | Ga0207651_10057930 | Ga0207651_100579301 | 332 |
| 748 | 3300025961 | Ga0207712_10199018 | Ga0207712_101990181 | 332 |
| 749 | 3300025986 | Ga0207658_10022072 | Ga0207658_100220722 | 332 |
| 750 | 3300026023 | Ga0207677_10003066 | Ga0207677_100030665 | 332 |
| 751 | 3300026023 | Ga0207677_10189467 | Ga0207677_101894672 | 332 |
| 752 | 3300026035 | Ga0207703_10015003 | Ga0207703_100150036 | 332 |
| 753 | 3300026035 | Ga0207703_10025692 | Ga0207703_100256922 | 332 |
| 754 | 3300026035 | Ga0207703_10050281 | Ga0207703_100502812 | 332 |
| 755 | 3300026035 | Ga0207703_10173700 | Ga0207703_101737002 | 332 |
| 756 | 3300026035 | Ga0207703_10175723 | Ga0207703_101757232 | 332 |
| 757 | 3300026041 | Ga0207639_10001215 | Ga0207639_1000121513 | 332 |
| 758 | 3300026041 | Ga0207639_10050627 | Ga0207639_100506272 | 332 |
| 759 | 3300026041 | Ga0207639_10064381 | Ga0207639_100643812 | 332 |
| 760 | 3300026041 | Ga0207639_10111063 | Ga0207639_101110632 | 332 |
| 761 | 3300026041 | Ga0207639_10123859 | Ga0207639_101238592 | 332 |
| 762 | 3300026041 | Ga0207639_10302564 | Ga0207639_103025642 | 332 |
| 763 | 3300026075 | Ga0207708_10000054 | Ga0207708_1000005481 | 332 |
| 764 | 3300026075 | Ga0207708_10003738 | Ga0207708_100037383 | 332 |
| 765 | 3300026078 | Ga0207702_10012052 | Ga0207702_100120523 | 332 |
| 766 | 3300026078 | Ga0207702_10041355 | Ga0207702_100413552 | 332 |
| 767 | 3300026078 | Ga0207702_10109259 | Ga0207702_101092592 | 332 |
| 768 | 3300026078 | Ga0207702_10130787 | Ga0207702_101307872 | 332 |
| 769 | 3300026078 | Ga0207702_10595788 | Ga0207702_105957881 | 332 |
| 770 | 3300026088 | Ga0207641_10128820 | Ga0207641_101288202 | 332 |
| 771 | 3300026089 | Ga0207648_10226610 | Ga0207648_102266102 | 332 |
| 772 | 3300026095 | Ga0207676_10007279 | Ga0207676_100072792 | 332 |
| 773 | 3300026095 | Ga0207676_10022890 | Ga0207676_100228904 | 332 |
| 774 | 3300026095 | Ga0207676_10052832 | Ga0207676_100528323 | 332 |
| 775 | 3300026095 | Ga0207676_10064134 | Ga0207676_100641342 | 332 |
| 776 | 3300026095 | Ga0207676_10162623 | Ga0207676_101626232 | 332 |
| 777 | 3300026095 | Ga0207676_10272336 | Ga0207676_102723362 | 332 |
| 778 | 3300026116 | Ga0207674_10000488 | Ga0207674_1000048833 | 332 |
| 779 | 3300026116 | Ga0207674_10005666 | Ga0207674_100056669 | 332 |
| 780 | 3300026116 | Ga0207674_10006829 | Ga0207674_100068292 | 332 |
| 781 | 3300026118 | Ga0207675_100069121 | Ga0207675_1000691212 | 332 |
| 782 | 3300026118 | Ga0207675_100398261 | Ga0207675_1003982612 | 332 |
| 783 | 3300026121 | Ga0207683_10003867 | Ga0207683_1000386710 | 332 |
| 784 | 3300026121 | Ga0207683_10144404 | Ga0207683_101444041 | 332 |
| 785 | 3300026142 | Ga0207698_10000068 | Ga0207698_100000682 | 332 |
| 786 | 3300026142 | Ga0207698_10000224 | Ga0207698_1000022429 | 332 |
| 787 | 3300026142 | Ga0207698_10061577 | Ga0207698_100615772 | 332 |
| 788 | 3300026142 | Ga0207698_10087959 | Ga0207698_100879592 | 332 |
| 789 | 3300026142 | Ga0207698_10442631 | Ga0207698_104426311 | 332 |
| 790 | 3300026142 | Ga0207698_10471203 | Ga0207698_104712031 | 332 |
| 791 | 3300027907 | Ga0207428_10013684 | Ga0207428_100136843 | 332 |
| 792 | 3300028379 | Ga0268266_10003238 | Ga0268266_100032387 | 332 |
| 793 | 3300028379 | Ga0268266_10256127 | Ga0268266_102561271 | 332 |
| 794 | 3300028380 | Ga0268265_10289274 | Ga0268265_102892742 | 332 |
| 795 | 3300028381 | Ga0268264_10008533 | Ga0268264_100085335 | 332 |
| 796 | 3300028381 | Ga0268264_10203779 | Ga0268264_102037792 | 332 |
| 797 | 3300028573 | Ga0265334_10000818 | Ga0265334_1000081812 | 332 |
| 798 | 3300028573 | Ga0265334_10048771 | Ga0265334_100487712 | 332 |
| 799 | 3300028653 | Ga0265323_10016793 | Ga0265323_100167934 | 332 |
| 800 | 3300028653 | Ga0265323_10062036 | Ga0265323_100620361 | 332 |
| 801 | 3300028666 | Ga0265336_10005323 | Ga0265336_100053231 | 332 |
| 802 | 3300028666 | Ga0265336_10024607 | Ga0265336_100246072 | 332 |
| 803 | 3300028800 | Ga0265338_10002513 | Ga0265338_1000251313 | 332 |
| 804 | 3300028800 | Ga0265338_10003733 | Ga0265338_1000373313 | 332 |
| 805 | 3300028800 | Ga0265338_10016308 | Ga0265338_100163087 | 332 |
| 806 | 3300028800 | Ga0265338_10016699 | Ga0265338_100166992 | 332 |
| 807 | 3300028800 | Ga0265338_10048139 | Ga0265338_100481392 | 332 |
| 808 | 3300028800 | Ga0265338_10048724 | Ga0265338_100487242 | 332 |
| 809 | 3300030760 | Ga0265762_1006038 | Ga0265762_10060382 | 332 |
| 810 | 3300031235 | Ga0265330_10000198 | Ga0265330_1000019831 | 332 |
| 811 | 3300031235 | Ga0265330_10000202 | Ga0265330_1000020212 | 332 |
| 812 | 3300031235 | Ga0265330_10000913 | Ga0265330_100009132 | 332 |
| 813 | 3300031235 | Ga0265330_10006383 | Ga0265330_100063832 | 332 |
| 814 | 3300031235 | Ga0265330_10040749 | Ga0265330_100407491 | 332 |
| 815 | 3300031235 | Ga0265330_10060368 | Ga0265330_100603682 | 332 |
| 816 | 3300031238 | Ga0265332_10000883 | Ga0265332_100008836 | 332 |
| 817 | 3300031238 | Ga0265332_10009085 | Ga0265332_100090855 | 332 |
| 818 | 3300031238 | Ga0265332_10027296 | Ga0265332_100272962 | 332 |
| 819 | 3300031239 | Ga0265328_10006951 | Ga0265328_100069512 | 332 |
| 820 | 3300031239 | Ga0265328_10012399 | Ga0265328_100123993 | 332 |
| 821 | 3300031239 | Ga0265328_10013313 | Ga0265328_100133132 | 332 |
| 822 | 3300031241 | Ga0265325_10000269 | Ga0265325_1000026924 | 332 |
| 823 | 3300031241 | Ga0265325_10001559 | Ga0265325_100015593 | 332 |
| 824 | 3300031241 | Ga0265325_10012353 | Ga0265325_100123532 | 332 |
| 825 | 3300031247 | Ga0265340_10013709 | Ga0265340_100137093 | 332 |
| 826 | 3300031247 | Ga0265340_10072299 | Ga0265340_100722992 | 332 |
| 827 | 3300031249 | Ga0265339_10000003 | Ga0265339_10000003206 | 332 |
| 828 | 3300031249 | Ga0265339_10000118 | Ga0265339_100001185 | 332 |
| 829 | 3300031249 | Ga0265339_10000324 | Ga0265339_1000032415 | 332 |
| 830 | 3300031249 | Ga0265339_10000747 | Ga0265339_1000074712 | 332 |
| 831 | 3300031249 | Ga0265339_10014030 | Ga0265339_100140302 | 332 |
| 832 | 3300031249 | Ga0265339_10025773 | Ga0265339_100257734 | 332 |
| 833 | 3300031249 | Ga0265339_10038891 | Ga0265339_100388912 | 332 |
| 834 | 3300031249 | Ga0265339_10040091 | Ga0265339_100400912 | 332 |
| 835 | 3300031249 | Ga0265339_10087552 | Ga0265339_100875522 | 332 |
| 836 | 3300031344 | Ga0265316_10000084 | Ga0265316_1000008443 | 332 |
| 837 | 3300031344 | Ga0265316_10001449 | Ga0265316_1000144917 | 332 |
| 838 | 3300031344 | Ga0265316_10001682 | Ga0265316_100016824 | 332 |
| 839 | 3300031344 | Ga0265316_10002239 | Ga0265316_1000223921 | 332 |
| 840 | 3300031344 | Ga0265316_10010277 | Ga0265316_100102772 | 332 |
| 841 | 3300031344 | Ga0265316_10015566 | Ga0265316_100155662 | 332 |
| 842 | 3300031344 | Ga0265316_10033791 | Ga0265316_100337914 | 332 |
| 843 | 3300031344 | Ga0265316_10047095 | Ga0265316_100470952 | 332 |
| 844 | 3300031344 | Ga0265316_10132766 | Ga0265316_101327662 | 332 |
| 845 | 3300031344 | Ga0265316_10148638 | Ga0265316_101486382 | 332 |
| 846 | 3300031344 | Ga0265316_10183121 | Ga0265316_101831212 | 332 |
| 847 | 3300031595 | Ga0265313_10003096 | Ga0265313_1000309610 | 332 |
| 848 | 3300031711 | Ga0265314_10000064 | Ga0265314_10000064105 | 332 |
| 849 | 3300031711 | Ga0265314_10000076 | Ga0265314_1000007654 | 332 |
| 850 | 3300031711 | Ga0265314_10003765 | Ga0265314_1000376511 | 332 |
| 851 | 3300031711 | Ga0265314_10007667 | Ga0265314_100076672 | 332 |
| 852 | 3300031711 | Ga0265314_10040648 | Ga0265314_100406482 | 332 |
| 853 | 3300031712 | Ga0265342_10000147 | Ga0265342_1000014741 | 332 |
| 854 | 3300031712 | Ga0265342_10001403 | Ga0265342_100014039 | 332 |
| 855 | 3300031712 | Ga0265342_10002544 | Ga0265342_1000254413 | 332 |
| 856 | 3300031712 | Ga0265342_10010272 | Ga0265342_100102722 | 332 |
| 857 | 3300031712 | Ga0265342_10016372 | Ga0265342_100163722 | 332 |
| 858 | 3300031712 | Ga0265342_10023235 | Ga0265342_100232352 | 332 |
| 859 | 3300031712 | Ga0265342_10040119 | Ga0265342_100401191 | 332 |
| 860 | 3300031731 | Ga0307405_10098876 | Ga0307405_100988761 | 332 |
| 861 | 3300031852 | Ga0307410_10002358 | Ga0307410_100023583 | 332 |
| 862 | 3300031901 | Ga0307406_10005486 | Ga0307406_100054862 | 332 |
| 863 | 3300032004 | Ga0307414_10024781 | Ga0307414_100247812 | 332 |
| 864 | 3300032004 | Ga0307414_10316112 | Ga0307414_103161121 | 332 |
| 865 | 3300032005 | Ga0307411_10031270 | Ga0307411_100312704 | 332 |
| 866 | 3300032005 | Ga0307411_10131321 | Ga0307411_101313212 | 332 |
| 867 | 3300035091 | Ga0373951_0027925 | Ga0373951_0027925_190_1197 | 332 |
| 868 | 3300035118 | Ga0373954_0102904 | Ga0373954_0102904_208_1215 | 332 |
| 869 | 3300035241 | Ga0373961_0000436 | Ga0373961_0000436_1241_2251 | 332 |
| 870 | 3300035692 | Ga0373935_0027606 | Ga0373935_0027606_1490_2491 | 332 |
| 871 | 3300035725 | Ga0373947_0034774 | Ga0373947_0034774_1754_2758 | 332 |
| 872 | 3300036401 | Ga0373937_0002221 | Ga0373937_0002221_3532_4548 | 332 |
| 873 | 3300036401 | Ga0373937_0033001 | Ga0373937_0033001_1705_2721 | 332 |
| 874 | 3300036401 | Ga0373937_0039188 | Ga0373937_0039188_1201_2202 | 332 |
| 875 | 3300036401 | Ga0373937_0055256 | Ga0373937_0055256_2032_3048 | 332 |
| 876 | 3300036401 | Ga0373937_0139485 | Ga0373937_0139485_515_1531 | 332 |
| 877 | 3300036647 | Ga0316582_0062387 | Ga0316582_0062387_1344_2375 | 332 |
| 878 | 3300037068 | Ga0373925_0001621 | Ga0373925_0001621_14037_15041 | 332 |
| 879 | 3300038443 | Ga0395901_0458024 | Ga0395901_0458024_110_1126 | 332 |
| 880 | 3300039438 | Ga0436360_0014237 | Ga0436360_0014237_56_1066 | 332 |
| 881 | 3300039447 | Ga0436361_0359509 | Ga0436361_0359509_4035_5045 | 332 |
| 882 | 3300039450 | Ga0436363_1172370 | Ga0436363_1172370_829_1839 | 332 |
| 883 | 3300039453 | Ga0436362_1012282 | Ga0436362_1012282_387_1397 | 332 |
| 884 | 3300044693 | Ga0466961_0166345 | Ga0466961_0166345_44_1060 | 332 |
| 885 | 3300044694 | Ga0466963_0002558 | Ga0466963_0002558_6486_7502 | 332 |
| 886 | 3300044712 | Ga0453684_0138626 | Ga0453684_0138626_113_1111 | 332 |
| 887 | 3300044712 | Ga0453684_0167862 | Ga0453684_0167862_1513_2511 | 332 |
| 888 | 3300045051 | Ga0451576_0074132 | Ga0451576_0074132_2301_3323 | 332 |
| 889 | 3300045976 | Ga0466967_0013758 | Ga0466967_0013758_4086_5102 | 332 |
| 890 | 3300046459 | Ga0495629_0019786 | Ga0495629_0019786_1816_2832 | 332 |
| 891 | 3300046462 | Ga0495651_0028878 | Ga0495651_0028878_1724_2731 | 332 |
| 892 | 3300046463 | Ga0495653_0028713 | Ga0495653_0028713_1871_2878 | 332 |
| 893 | 3300046472 | Ga0495580_0002833 | Ga0495580_0002833_6301_7308 | 332 |
| 894 | 3300046473 | Ga0495582_0012389 | Ga0495582_0012389_2424_3428 | 332 |
| 895 | 3300046473 | Ga0495582_0104438 | Ga0495582_0104438_22_1038 | 332 |
| 896 | 3300046476 | Ga0495662_0025759 | Ga0495662_0025759_199_1215 | 332 |
| 897 | 3300046477 | Ga0495664_0038383 | Ga0495664_0038383_199_1206 | 332 |
| 898 | 3300046514 | Ga0495618_0065773 | Ga0495618_0065773_180_1187 | 332 |
| 899 | 3300046529 | Ga0495652_0101554 | Ga0495652_0101554_632_1639 | 332 |
| 900 | 3300046531 | Ga0495665_0035363 | Ga0495665_0035363_1293_2291 | 332 |
| 901 | 3300046533 | Ga0495640_0040767 | Ga0495640_0040767_1375_2382 | 332 |
| 902 | 3300046536 | Ga0495587_0018096 | Ga0495587_0018096_632_1648 | 332 |
| 903 | 3300046536 | Ga0495587_0024110 | Ga0495587_0024110_2104_3111 | 332 |
| 904 | 3300046543 | Ga0495645_0009633 | Ga0495645_0009633_1537_2544 | 332 |
| 905 | 3300046543 | Ga0495645_0010293 | Ga0495645_0010293_238_1254 | 332 |
| 906 | 3300046559 | Ga0495667_0104541 | Ga0495667_0104541_530_1546 | 332 |
| 907 | 3300046642 | Ga0495634_0004148 | Ga0495634_0004148_8043_9050 | 332 |
| 908 | 3300046663 | Ga0495635_0003141 | Ga0495635_0003141_8760_9767 | 332 |
| 909 | 3300046678 | Ga0495599_0051973 | Ga0495599_0051973_1510_2517 | 332 |
| 910 | 3300046679 | Ga0495623_0016415 | Ga0495623_0016415_1642_2649 | 332 |
| 911 | 3300046679 | Ga0495623_0129562 | Ga0495623_0129562_251_1267 | 332 |
| 912 | 3300046680 | Ga0495646_0047170 | Ga0495646_0047170_868_1875 | 332 |
| 913 | 3300046684 | Ga0495669_0029730 | Ga0495669_0029730_593_1591 | 332 |
| 914 | 3300046689 | Ga0495613_0048716 | Ga0495613_0048716_1991_2998 | 332 |
| 915 | 3300046809 | Ga0495600_0024312 | Ga0495600_0024312_606_1613 | 332 |
| 916 | 3300046809 | Ga0495600_0098999 | Ga0495600_0098999_368_1384 | 332 |
| 917 | 3300046809 | Ga0495600_0247853 | Ga0495600_0247853_21_1031 | 332 |
| 918 | 3300047317 | Ga0495604_0059884 | Ga0495604_0059884_1394_2401 | 332 |
| 919 | 3300047319 | Ga0495674_0082868 | Ga0495674_0082868_366_1382 | 332 |
| 920 | 3300047471 | Ga0495684_0042688 | Ga0495684_0042688_750_1757 | 332 |
| 921 | 3300048088 | Ga0495602_0170795 | Ga0495602_0170795_225_1232 | 332 |
| 922 | 3300048904 | Ga0496101_0089193 | Ga0496101_0089193_867_1868 | 332 |
| 923 | 3300048907 | Ga0496104_0198008 | Ga0496104_0198008_270_1268 | 332 |
| 924 | 3300048910 | Ga0496107_0122430 | Ga0496107_0122430_878_1879 | 332 |
| 925 | 3300048912 | Ga0496109_0027991 | Ga0496109_0027991_2826_3824 | 332 |
| 926 | 3300048915 | Ga0496112_0080288 | Ga0496112_0080288_881_1879 | 332 |
| 927 | 3300048915 | Ga0496112_0142596 | Ga0496112_0142596_1164_2165 | 332 |
| 928 | 3300048917 | Ga0496114_0007255 | Ga0496114_0007255_2020_3021 | 332 |
| 929 | 3300048918 | Ga0496115_0093688 | Ga0496115_0093688_281_1297 | 332 |
| 930 | 3300049515 | Ga0501292_006916 | Ga0501292_006916_569_1567 | 332 |
| 931 | 3300049519 | Ga0501296_003603 | Ga0501296_003603_295_1293 | 332 |
| 932 | 3300049652 | Ga0501202_021022 | Ga0501202_021022_238_1236 | 332 |
| 933 | 3300049654 | Ga0501207_001271 | Ga0501207_001271_2010_3008 | 332 |
| 934 | 3300049656 | Ga0501209_014613 | Ga0501209_014613_575_1573 | 332 |
| 935 | 3300049661 | Ga0501217_001008 | Ga0501217_001008_3675_4673 | 332 |
| 936 | 3300049661 | Ga0501217_002314 | Ga0501217_002314_2517_3515 | 332 |
| 937 | 3300049661 | Ga0501217_021554 | Ga0501217_021554_244_1242 | 332 |
| 938 | 3300049663 | Ga0501223_001628 | Ga0501223_001628_3928_4926 | 332 |
| 939 | 3300049663 | Ga0501223_005324 | Ga0501223_005324_151_1149 | 332 |
| 940 | 3300049663 | Ga0501223_006020 | Ga0501223_006020_945_1943 | 332 |
| 941 | 3300049665 | Ga0501227_000979 | Ga0501227_000979_2628_3626 | 332 |
| 942 | 3300049667 | Ga0501230_000225 | Ga0501230_000225_1109_2107 | 332 |
| 943 | 3300049669 | Ga0501235_008095 | Ga0501235_008095_964_1962 | 332 |
| 944 | 3300049672 | Ga0501239_000904 | Ga0501239_000904_1392_2390 | 332 |
| 945 | 3300049672 | Ga0501239_006106 | Ga0501239_006106_35_1033 | 332 |
| 946 | 3300049675 | Ga0501243_010751 | Ga0501243_010751_76_1074 | 332 |
| 947 | 3300049683 | Ga0501253_011487 | Ga0501253_011487_327_1325 | 332 |
| 948 | 3300049686 | Ga0501257_002511 | Ga0501257_002511_193_1191 | 332 |
| 949 | 3300049690 | Ga0501261_001901 | Ga0501261_001901_1518_2516 | 332 |
| 950 | 3300049705 | Ga0501225_0000303 | Ga0501225_0000303_14205_15203 | 332 |
| 951 | 3300049705 | Ga0501225_0017089 | Ga0501225_0017089_837_1835 | 332 |
| 952 | 3300049705 | Ga0501225_0024929 | Ga0501225_0024929_419_1417 | 332 |
| 953 | 3300049707 | Ga0501234_011008 | Ga0501234_011008_39_1037 | 332 |
| 954 | 3300049708 | Ga0501245_013114 | Ga0501245_013114_101_1099 | 332 |
| 955 | 3300049767 | Ga0501270_006308 | Ga0501270_006308_317_1315 | 332 |
| 956 | 3300049769 | Ga0501272_001613 | Ga0501272_001613_550_1548 | 332 |
| 957 | 3300049769 | Ga0501272_004911 | Ga0501272_004911_116_1114 | 332 |
| 958 | 3300049850 | Ga0501204_002063 | Ga0501204_002063_124_1122 | 332 |
| 959 | 3300049851 | Ga0501212_013401 | Ga0501212_013401_67_1065 | 332 |
| 960 | 3300050507 | nmdc:mga05p37_188915_c1 | nmdc:mga05p37_188915_c1_254_1252 | 332 |
| 961 | 3300050507 | nmdc:mga05p37_464167_c1 | nmdc:mga05p37_464167_c1_157_1155 | 332 |
| 962 | 3300050508 | nmdc:mga09592_78200_c1 | nmdc:mga09592_78200_c1_1492_2490 | 332 |
| 963 | 3300050511 | nmdc:mga08y16_7081_c1 | nmdc:mga08y16_7081_c1_832_1830 | 332 |
| 964 | 3300050512 | nmdc:mga0n895_21731_c1 | nmdc:mga0n895_21731_c1_3920_4927 | 332 |
| 965 | 3300050514 | nmdc:mga08x19_3938_c2 | nmdc:mga08x19_3938_c2_2150_3166 | 332 |
| 966 | 3300050515 | nmdc:mga0a205_243996_c1 | nmdc:mga0a205_243996_c1_414_1412 | 332 |
| 967 | 3300053085 | Ga0495619_0061650 | Ga0495619_0061650_172_1173 | 332 |
| 968 | 3300053085 | Ga0495619_0130061 | Ga0495619_0130061_233_1240 | 332 |
| 969 | 3300005295 | Ga0065707_10149800 | Ga0065707_101498002 | 333 |
| 970 | 3300005329 | Ga0070683_100237463 | Ga0070683_1002374632 | 333 |
| 971 | 3300005354 | Ga0070675_100139419 | Ga0070675_1001394192 | 333 |
| 972 | 3300005436 | Ga0070713_100235756 | Ga0070713_1002357561 | 333 |
| 973 | 3300005458 | Ga0070681_10032325 | Ga0070681_100323254 | 333 |
| 974 | 3300005530 | Ga0070679_100103795 | Ga0070679_1001037952 | 333 |
| 975 | 3300005577 | Ga0068857_100372412 | Ga0068857_1003724122 | 333 |
| 976 | 3300005842 | Ga0068858_100136830 | Ga0068858_1001368302 | 333 |
| 977 | 3300005844 | Ga0068862_100232506 | Ga0068862_1002325062 | 333 |
| 978 | 3300006237 | Ga0097621_100001224 | Ga0097621_1000012242 | 333 |
| 979 | 3300006358 | Ga0068871_100003384 | Ga0068871_1000033849 | 333 |
| 980 | 3300006844 | Ga0075428_100120336 | Ga0075428_1001203362 | 333 |
| 981 | 3300006931 | Ga0097620_100036153 | Ga0097620_1000361532 | 333 |
| 982 | 3300006931 | Ga0097620_100071101 | Ga0097620_1000711015 | 333 |
| 983 | 3300009098 | Ga0105245_10003427 | Ga0105245_1000342711 | 333 |
| 984 | 3300009147 | Ga0114129_10012495 | Ga0114129_100124955 | 333 |
| 985 | 3300009174 | Ga0105241_10168091 | Ga0105241_101680912 | 333 |
| 986 | 3300009174 | Ga0105241_10230088 | Ga0105241_102300882 | 333 |
| 987 | 3300009176 | Ga0105242_10006860 | Ga0105242_100068603 | 333 |
| 988 | 3300013105 | Ga0157369_10229224 | Ga0157369_102292242 | 333 |
| 989 | 3300013297 | Ga0157378_10003078 | Ga0157378_1000307814 | 333 |
| 990 | 3300013308 | Ga0157375_10022781 | Ga0157375_100227812 | 333 |
| 991 | 3300014969 | Ga0157376_10052814 | Ga0157376_100528142 | 333 |
| 992 | 3300025903 | Ga0207680_10099610 | Ga0207680_100996102 | 333 |
| 993 | 3300025927 | Ga0207687_10178857 | Ga0207687_101788572 | 333 |
| 994 | 3300025981 | Ga0207640_10039034 | Ga0207640_100390341 | 333 |
| 995 | 3300026023 | Ga0207677_10124524 | Ga0207677_101245241 | 333 |
| 996 | 3300028380 | Ga0268265_10120983 | Ga0268265_101209832 | 333 |
| 997 | 3300028573 | Ga0265334_10053388 | Ga0265334_100533881 | 333 |
| 998 | 3300028577 | Ga0265318_10077295 | Ga0265318_100772951 | 333 |
| 999 | 3300028800 | Ga0265338_10043165 | Ga0265338_100431651 | 333 |
| 1000 | 3300031240 | Ga0265320_10112922 | Ga0265320_101129221 | 333 |
| 1001 | 3300031247 | Ga0265340_10031007 | Ga0265340_100310072 | 333 |
| 1002 | 3300031344 | Ga0265316_10049726 | Ga0265316_100497262 | 333 |
| 1003 | 3300031665 | Ga0316575_10006974 | Ga0316575_100069745 | 333 |
| 1004 | 3300031665 | Ga0316575_10010767 | Ga0316575_100107672 | 333 |
| 1005 | 3300031691 | Ga0316579_10000759 | Ga0316579_100007597 | 333 |
| 1006 | 3300031691 | Ga0316579_10027277 | Ga0316579_100272772 | 333 |
| 1007 | 3300031691 | Ga0316579_10065017 | Ga0316579_100650171 | 333 |
| 1008 | 3300031727 | Ga0316576_10013473 | Ga0316576_100134733 | 333 |
| 1009 | 3300031727 | Ga0316576_10161689 | Ga0316576_101616891 | 333 |
| 1010 | 3300031728 | Ga0316578_10039253 | Ga0316578_100392532 | 333 |
| 1011 | 3300031728 | Ga0316578_10050371 | Ga0316578_100503712 | 333 |
| 1012 | 3300031733 | Ga0316577_10001105 | Ga0316577_100011054 | 333 |
| 1013 | 3300032168 | Ga0316593_10001992 | Ga0316593_100019921 | 333 |
| 1014 | 3300035172 | Ga0373955_0066978 | Ga0373955_0066978_511_1515 | 333 |
| 1015 | 3300035398 | Ga0316574_0000429 | Ga0316574_0000429_868_1872 | 333 |
| 1016 | 3300035398 | Ga0316574_0009950 | Ga0316574_0009950_2269_3294 | 333 |
| 1017 | 3300036647 | Ga0316582_0018706 | Ga0316582_0018706_2073_3098 | 333 |
| 1018 | 3300036647 | Ga0316582_0018910 | Ga0316582_0018910_1498_2502 | 333 |
| 1019 | 3300036712 | Ga0316584_0127797 | Ga0316584_0127797_649_1650 | 333 |
| 1020 | 3300036712 | Ga0316584_0200097 | Ga0316584_0200097_19_1023 | 333 |
| 1021 | 3300037588 | Ga0316581_0009239 | Ga0316581_0009239_631_1656 | 333 |
| 1022 | 3300042876 | Ga0451577_0025637 | Ga0451577_0025637_989_2104 | 333 |
| 1023 | 3300042876 | Ga0451577_0075436 | Ga0451577_0075436_928_1929 | 333 |
| 1024 | 3300042876 | Ga0451577_0264739 | Ga0451577_0264739_507_1508 | 333 |
| 1025 | 3300042876 | Ga0451577_0314594 | Ga0451577_0314594_278_1282 | 333 |
| 1026 | 3300042876 | Ga0451577_0320931 | Ga0451577_0320931_359_1360 | 333 |
| 1027 | 3300042876 | Ga0451577_0374624 | Ga0451577_0374624_78_1079 | 333 |
| 1028 | 3300044673 | Ga0453683_0000129 | Ga0453683_0000129_109231_110232 | 333 |
| 1029 | 3300044673 | Ga0453683_0001154 | Ga0453683_0001154_20009_21010 | 333 |
| 1030 | 3300044673 | Ga0453683_0008080 | Ga0453683_0008080_1825_2826 | 333 |
| 1031 | 3300044673 | Ga0453683_0010406 | Ga0453683_0010406_351_1352 | 333 |
| 1032 | 3300044673 | Ga0453683_0044921 | Ga0453683_0044921_688_1689 | 333 |
| 1033 | 3300044673 | Ga0453683_0059002 | Ga0453683_0059002_79_1080 | 333 |
| 1034 | 3300044673 | Ga0453683_0064506 | Ga0453683_0064506_738_1739 | 333 |
| 1035 | 3300044673 | Ga0453683_0109605 | Ga0453683_0109605_399_1400 | 333 |
| 1036 | 3300044712 | Ga0453684_0000035 | Ga0453684_0000035_575551_576666 | 333 |
| 1037 | 3300044712 | Ga0453684_0000752 | Ga0453684_0000752_86585_87586 | 333 |
| 1038 | 3300044712 | Ga0453684_0001416 | Ga0453684_0001416_61357_62358 | 333 |
| 1039 | 3300044712 | Ga0453684_0005727 | Ga0453684_0005727_21983_22984 | 333 |
| 1040 | 3300044712 | Ga0453684_0009719 | Ga0453684_0009719_8890_9891 | 333 |
| 1041 | 3300044712 | Ga0453684_0035364 | Ga0453684_0035364_5189_6190 | 333 |
| 1042 | 3300044712 | Ga0453684_0079221 | Ga0453684_0079221_1999_3000 | 333 |
| 1043 | 3300044712 | Ga0453684_0095584 | Ga0453684_0095584_2167_3168 | 333 |
| 1044 | 3300044712 | Ga0453684_0176923 | Ga0453684_0176923_608_1609 | 333 |
| 1045 | 3300044712 | Ga0453684_0178692 | Ga0453684_0178692_435_1436 | 333 |
| 1046 | 3300044712 | Ga0453684_0273889 | Ga0453684_0273889_718_1719 | 333 |
| 1047 | 3300044712 | Ga0453684_0488926 | Ga0453684_0488926_325_1326 | 333 |
| 1048 | 3300044712 | Ga0453684_0608421 | Ga0453684_0608421_151_1152 | 333 |
| 1049 | 3300044712 | Ga0453684_0643980 | Ga0453684_0643980_129_1130 | 333 |
| 1050 | 3300045051 | Ga0451576_0000311 | Ga0451576_0000311_113956_114957 | 333 |
| 1051 | 3300045051 | Ga0451576_0000688 | Ga0451576_0000688_34932_35936 | 333 |
| 1052 | 3300045051 | Ga0451576_0016491 | Ga0451576_0016491_6750_7751 | 333 |
| 1053 | 3300045051 | Ga0451576_0034883 | Ga0451576_0034883_3262_4263 | 333 |
| 1054 | 3300045051 | Ga0451576_0128728 | Ga0451576_0128728_197_1198 | 333 |
| 1055 | 3300045051 | Ga0451576_0240250 | Ga0451576_0240250_238_1239 | 333 |
| 1056 | 3300045051 | Ga0451576_0370790 | Ga0451576_0370790_193_1194 | 333 |
| 1057 | 3300049686 | Ga0501257_003460 | Ga0501257_003460_519_1532 | 333 |
| 1058 | 3300050507 | nmdc:mga05p37_265913_c1 | nmdc:mga05p37_265913_c1_280_1281 | 333 |
| 1059 | 3300050508 | nmdc:mga09592_213196_c1 | nmdc:mga09592_213196_c1_140_1141 | 333 |
| 1060 | 3300050510 | nmdc:mga06r32_187739_c1 | nmdc:mga06r32_187739_c1_331_1332 | 333 |
| 1061 | 2162886006 | SwRhRL3b_contig_681025 | SwRhRL3b_0778.00001820 | 334 |
| 1062 | 2162886007 | SwRhRL2b_contig_2683522 | SwRhRL2b_0071.00003520 | 334 |
| 1063 | 3300005289 | Ga0065704_10000241 | Ga0065704_1000024134 | 334 |
| 1064 | 3300005289 | Ga0065704_10008237 | Ga0065704_100082374 | 334 |
| 1065 | 3300005295 | Ga0065707_10000706 | Ga0065707_100007069 | 334 |
| 1066 | 3300005295 | Ga0065707_10138711 | Ga0065707_101387112 | 334 |
| 1067 | 3300005295 | Ga0065707_10196167 | Ga0065707_101961671 | 334 |
| 1068 | 3300005467 | Ga0070706_100071055 | Ga0070706_1000710552 | 334 |
| 1069 | 3300005471 | Ga0070698_100046771 | Ga0070698_1000467713 | 334 |
| 1070 | 3300005617 | Ga0068859_100044899 | Ga0068859_1000448991 | 334 |
| 1071 | 3300005618 | Ga0068864_100396124 | Ga0068864_1003961241 | 334 |
| 1072 | 3300005844 | Ga0068862_100205972 | Ga0068862_1002059722 | 334 |
| 1073 | 3300006847 | Ga0075431_100327904 | Ga0075431_1003279042 | 334 |
| 1074 | 3300006880 | Ga0075429_100000179 | Ga0075429_10000017914 | 334 |
| 1075 | 3300006931 | Ga0097620_100044894 | Ga0097620_1000448941 | 334 |
| 1076 | 3300009147 | Ga0114129_10001382 | Ga0114129_1000138213 | 334 |
| 1077 | 3300025935 | Ga0207709_10090408 | Ga0207709_100904081 | 334 |
| 1078 | 3300031995 | Ga0307409_100278434 | Ga0307409_1002784342 | 334 |
| 1079 | 3300042876 | Ga0451577_0039852 | Ga0451577_0039852_1582_2586 | 334 |
| 1080 | 3300042876 | Ga0451577_0128782 | Ga0451577_0128782_289_1293 | 334 |
| 1081 | 3300044712 | Ga0453684_0112556 | Ga0453684_0112556_1129_2133 | 334 |
| 1082 | 3300045051 | Ga0451576_0041664 | Ga0451576_0041664_2995_4014 | 334 |
| 1083 | 3300045051 | Ga0451576_0221133 | Ga0451576_0221133_358_1362 | 334 |
| 1084 | 3300049575 | Ga0501039_0053167 | Ga0501039_0053167_1345_2349 | 334 |
| 1085 | 3300049575 | Ga0501039_0131215 | Ga0501039_0131215_919_1923 | 334 |
| 1086 | 3300049588 | Ga0501072_0144183 | Ga0501072_0144183_387_1391 | 334 |
| 1087 | 3300049590 | Ga0501074_0125521 | Ga0501074_0125521_42_1046 | 334 |
| 1088 | 3300049591 | Ga0501075_0016699 | Ga0501075_0016699_3121_4125 | 334 |
| 1089 | 3300049592 | Ga0501076_0036202 | Ga0501076_0036202_75_1079 | 334 |
| 1090 | 3300049741 | Ga0501079_0081941 | Ga0501079_0081941_1207_2211 | 334 |
| 1091 | 3300049742 | Ga0501080_0104038 | Ga0501080_0104038_388_1392 | 334 |
| 1092 | 3300050507 | nmdc:mga05p37_1088_c1 | nmdc:mga05p37_1088_c1_9331_10335 | 334 |
| 1093 | 3300050508 | nmdc:mga09592_1528_c1 | nmdc:mga09592_1528_c1_15996_17000 | 334 |
| 1094 | 3300054114 | Ga0501084_0100904 | Ga0501084_0100904_765_1769 | 334 |
| 1095 | 3300060353 | Ga0501082_0049363 | Ga0501082_0049363_514_1518 | 334 |
| 1096 | 3300060353 | Ga0501082_0074811 | Ga0501082_0074811_1192_2295 | 334 |
| 1097 | 3300061734 | Ga0530510_0021924 | Ga0530510_0021924_1293_2297 | 334 |
| 1098 | 3300061734 | Ga0530510_0063783 | Ga0530510_0063783_1153_2256 | 334 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5ue9-assembly1.cif.gz_A | wt dhodb with orotate bound | 0.7913 | 3 | 307 |
| 5ksw-assembly1.cif.gz_A | dhodb-i74d mutant | 0.7907 | 3 | 307 |
| 5ue9-assembly1.cif.gz_A | wt dhodb with orotate bound | 0.7769 | 3 | 307 |
| 5ksw-assembly1.cif.gz_A | dhodb-i74d mutant | 0.7765 | 3 | 307 |
| 8f6n-assembly2.cif.gz_C | dihydropyrimidine dehydrogenase (dpd) c671s mutant soaked with thymine quasi-anaerobically | 0.7668 | 3 | 295 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q58070_5_305_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.8054 | 4 | 307 | 3.20.20.70 |
| af_Q58070_5_305_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.7979 | 4 | 307 | 3.20.20.70 |
| 3c61A01 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.7718 | 1 | 306 | 3.20.20.70 |
| 1ep1A00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.7647 | 1 | 307 | 3.20.20.70 |
| 3c61A01 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.7561 | 1 | 306 | 3.20.20.70 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A350V0Z1-F1-model_v4 | Dihydroorotate dehydrogenase-like protein | 0.9735 | 101 | 251 |
|
| AF-A0A2V8DTY9-F1-model_v4 | Dihydroorotate dehydrogenase-like protein | 0.9711 | 116 | 331 |
GO:0004152
GO:0005737 GO:0006207 |
| AF-A0A202DKU4-F1-model_v4 | Dihydroorotate dehydrogenase | 0.9663 | 87 | 329 |
GO:0004152
GO:0005737 GO:0006207 GO:0006221 |
| AF-A0A2V5NML8-F1-model_v4 | Dihydroorotate dehydrogenase-like protein | 0.9656 | 120 | 331 |
GO:0004152
GO:0005737 GO:0006207 GO:0006221 |
| AF-A0A847MSV2-F1-model_v4 | Dihydroorotate dehydrogenase-like protein | 0.964 | 99 | 333 |
GO:0004152
GO:0005737 GO:0006207 GO:0006221 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar