F490020

General Info

Members Datasets Scaffolds Average Seq Length
1098 356 1098 334

Family's Representative Sequence

Representative Sequence 3300042876|Ga0451577_0025637|Ga0451577_0025637_989_2104
Length 371
Sequence MEKTPSPFDSRHPWACFRYNRVDPFLDLIPPTLLLEIIMTDLTTTYLGLKLKNPIVASASPLSKKLDSAKKVADAGASAIVMYSLFEEQIIHESLELDHYLTRGSESFAEAQTYLPDMGTYSLGPDNYITHLSAIKKAVNIPVIGSLNGVSKGGWVRYAKRIEDAGADALELNLYYLATDPNLTANELEDAYVDLVADVKHNIKIPLAVKLSPFFTSIPNIAKRLVLAGADGLVLFNRFYQPDFDLDELKVAPHLILSNSDEMRLPLRWIAILAGQVKTDYALTSGVHSAEDIVKAMMAGARVTMLASALLQNGISLIPTLLSDLEAWLTAHEYTSIGQMQGSMSQTSVAEPAAYERANYMKELNSFKELP

Samples

Sample ID Description Type Environment
1 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
35 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
36 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
37 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
38 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
39 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
40 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
41 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
42 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
43 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
44 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
45 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
46 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
47 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
48 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
49 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
50 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
51 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
52 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
53 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
54 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
55 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
56 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
57 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
58 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
59 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
60 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
61 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
62 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
63 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
64 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
65 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
66 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
67 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
68 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
69 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
70 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
71 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
72 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
73 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
74 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
75 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
76 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
77 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
78 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
79 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
80 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
82 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
83 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
84 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
85 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
86 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
87 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
88 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
89 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
91 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
92 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
94 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
95 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
97 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
98 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
99 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
100 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
101 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
102 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
103 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
104 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
105 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
106 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
107 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
108 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
109 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
110 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
111 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
112 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
113 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
114 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
115 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
116 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
117 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
118 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
119 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
120 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
121 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
122 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
184 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
185 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
186 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
190 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
191 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
192 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
193 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
194 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
195 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
196 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
197 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
198 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
199 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
200 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
201 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
202 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
203 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
204 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
205 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
206 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
207 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
208 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
209 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
210 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
211 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
212 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
213 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
214 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
215 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
216 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
217 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
218 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
219 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
220 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
221 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
222 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
223 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
224 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
225 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
226 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
227 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
228 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
229 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
230 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
231 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
232 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
233 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
234 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
235 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
236 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
237 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
238 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
239 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
240 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
241 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
242 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
243 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
244 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
245 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
246 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
247 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
248 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
249 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
250 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
251 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
252 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
253 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
254 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
255 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
256 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
257 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
258 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
259 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
260 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
261 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
262 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
263 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
264 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
265 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
266 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
267 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
268 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
269 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
270 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
271 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
272 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
273 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
274 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
275 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
276 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
277 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
278 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
279 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
280 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
281 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
282 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
283 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
284 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
285 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
286 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
287 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
288 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
289 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
290 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
291 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
292 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
293 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
294 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
295 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
296 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
297 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
298 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
299 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
300 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
301 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
302 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
303 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
304 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
305 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
306 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
307 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
308 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
309 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
310 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
311 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
312 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
313 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
314 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
315 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
316 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
317 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
318 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
319 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
320 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
321 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
322 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
323 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
324 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
325 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
326 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
327 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
328 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
329 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
330 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
331 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
332 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
333 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
334 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
335 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
336 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
337 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
338 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
339 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
340 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
341 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
342 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
343 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
344 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
345 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
346 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
347 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
348 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
349 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
350 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
351 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
352 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
353 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
354 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
355 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
356 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.54
Metatranscriptomes 0.46
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.91
Rhizosphere 97.45
Stem 0
Stem Tuber 0
Unclassified 0.64

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL3b_contig_681025 2162886006 Bacteria 1459
2 SwRhRL2b_contig_2683522 2162886007 Bacteria 2149
3 SwRhRL2b_contig_652773 2162886007 Bacteria 1461
4 MBSR1b_contig_601673 2162886012 Bacteria 1583
5 JGI24740J21852_10049521 3300001979 Bacteria 1213
6 JGI24034J26672_10005904 3300002239 Bacteria 1762
7 rootH1_10224381 3300003323 Bacteria 3493
8 Ga0065704_10000241 3300005289 Bacteria 55852
9 Ga0065704_10008237 3300005289 Bacteria 2265
10 Ga0065712_10046738 3300005290 Unclassified 1335
11 Ga0065712_10071124 3300005290 Bacteria 5468
12 Ga0065715_10003747 3300005293 Bacteria 6386
13 Ga0065715_10091017 3300005293 Bacteria 6192
14 Ga0065707_10000706 3300005295 Bacteria 13095
15 Ga0065707_10138711 3300005295 Bacteria 1772
16 Ga0065707_10149800 3300005295 Bacteria 1671
17 Ga0065707_10196167 3300005295 Bacteria 1324
18 Ga0070658_10023980 3300005327 Bacteria 4895
19 Ga0070658_10034204 3300005327 Bacteria 4089
20 Ga0070658_10363036 3300005327 Bacteria 1241
21 Ga0070683_100004370 3300005329 Bacteria 11629
22 Ga0070683_100005766 3300005329 Bacteria 10350
23 Ga0070683_100007607 3300005329 Bacteria 9162
24 Ga0070683_100056213 3300005329 Bacteria 3654
25 Ga0070683_100094743 3300005329 Bacteria 2806
26 Ga0070683_100237463 3300005329 Bacteria 1733
27 Ga0070683_100262099 3300005329 Unclassified 1644
28 Ga0070683_100286184 3300005329 Unclassified 1568
29 Ga0070690_100023500 3300005330 Bacteria 3780
30 Ga0070690_100204621 3300005330 Bacteria 1375
31 Ga0070670_100105102 3300005331 Bacteria 2433
32 Ga0068869_100017812 3300005334 Bacteria 4825
33 Ga0068869_100042553 3300005334 Bacteria 3256
34 Ga0068869_100057516 3300005334 Bacteria 2839
35 Ga0068869_100083554 3300005334 Bacteria 2389
36 Ga0068869_100144681 3300005334 Bacteria 1839
37 Ga0068869_100169852 3300005334 Bacteria 1703
38 Ga0070666_10093592 3300005335 Bacteria 2066
39 Ga0070680_100014282 3300005336 Bacteria 6203
40 Ga0070682_100034532 3300005337 Bacteria 3081
41 Ga0070682_100053662 3300005337 Bacteria 2527
42 Ga0068868_100015082 3300005338 Bacteria 5708
43 Ga0068868_100021815 3300005338 Bacteria 4826
44 Ga0070660_100032099 3300005339 Bacteria 3950
45 Ga0070660_100301746 3300005339 Unclassified 1313
46 Ga0070689_100000419 3300005340 Bacteria 25025
47 Ga0070689_100300757 3300005340 Bacteria 1335
48 Ga0070687_100113034 3300005343 Bacteria 1540
49 Ga0070661_100027236 3300005344 Bacteria 4114
50 Ga0070661_100104999 3300005344 Bacteria 2105
51 Ga0070661_100194398 3300005344 Bacteria 1548
52 Ga0070692_10117023 3300005345 Bacteria 1481
53 Ga0070668_100036615 3300005347 Bacteria 3745
54 Ga0070668_100078190 3300005347 Bacteria 2587
55 Ga0070668_100167284 3300005347 Bacteria 1788
56 Ga0070668_100229670 3300005347 Bacteria 1533
57 Ga0070669_100072167 3300005353 Bacteria 2555
58 Ga0070669_100090563 3300005353 Bacteria 2293
59 Ga0070669_100106929 3300005353 Bacteria 2119
60 Ga0070675_100139419 3300005354 Bacteria 2072
61 Ga0070671_100011927 3300005355 Bacteria 6991
62 Ga0070671_100017015 3300005355 Bacteria 5881
63 Ga0070674_100001100 3300005356 Bacteria 14197
64 Ga0070673_100014452 3300005364 Bacteria 5501
65 Ga0070673_100031142 3300005364 Bacteria 4000
66 Ga0070673_100057376 3300005364 Bacteria 3076
67 Ga0070688_100017343 3300005365 Bacteria 4132
68 Ga0070688_100125440 3300005365 Bacteria 1725
69 Ga0070659_100043648 3300005366 Bacteria 3507
70 Ga0070659_100118024 3300005366 Bacteria 2146
71 Ga0070659_100169346 3300005366 Unclassified 1788
72 Ga0070667_100153681 3300005367 Bacteria 2023
73 Ga0070703_10002794 3300005406 Bacteria 4999
74 Ga0070714_100335790 3300005435 Bacteria 1416
75 Ga0070713_100000174 3300005436 Bacteria 42901
76 Ga0070713_100047339 3300005436 Bacteria 3534
77 Ga0070713_100114312 3300005436 Bacteria 2358
78 Ga0070713_100162738 3300005436 Bacteria 1993
79 Ga0070713_100173904 3300005436 Bacteria 1931
80 Ga0070713_100235756 3300005436 Bacteria 1665
81 Ga0070701_10046427 3300005438 Bacteria 2233
82 Ga0070701_10050367 3300005438 Bacteria 2156
83 Ga0070701_10073707 3300005438 Bacteria 1832
84 Ga0070711_100000867 3300005439 Bacteria 15914
85 Ga0070711_100051367 3300005439 Bacteria 2831
86 Ga0070705_100003937 3300005440 Bacteria 7260
87 Ga0070705_100014354 3300005440 Bacteria 4073
88 Ga0070705_100157900 3300005440 Unclassified 1513
89 Ga0070705_100206242 3300005440 Unclassified 1351
90 Ga0070700_100000048 3300005441 Bacteria 89854
91 Ga0070700_100013640 3300005441 Bacteria 4569
92 Ga0070700_100032002 3300005441 Bacteria 3158
93 Ga0070700_100225792 3300005441 Bacteria 1330
94 Ga0070694_100013258 3300005444 Bacteria 5146
95 Ga0070694_100148928 3300005444 Bacteria 1707
96 Ga0070663_100144797 3300005455 Unclassified 1817
97 Ga0070678_100012161 3300005456 Bacteria 5338
98 Ga0070662_100161021 3300005457 Bacteria 1755
99 Ga0070662_100192912 3300005457 Bacteria 1612
100 Ga0070662_100195726 3300005457 Bacteria 1601
101 Ga0070681_10001179 3300005458 Bacteria 22582
102 Ga0070681_10001428 3300005458 Bacteria 21024
103 Ga0070681_10032325 3300005458 Bacteria 5250
104 Ga0070681_10097768 3300005458 Bacteria 2882
105 Ga0070681_10262387 3300005458 Bacteria 1639
106 Ga0068867_100021999 3300005459 Bacteria 4555
107 Ga0068867_100138575 3300005459 Bacteria 1899
108 Ga0070685_10032777 3300005466 Bacteria 2912
109 Ga0070706_100071055 3300005467 Bacteria 3219
110 Ga0070706_100238941 3300005467 Bacteria 1696
111 Ga0070698_100046771 3300005471 Bacteria 4424
112 Ga0070699_100190757 3300005518 Bacteria 1820
113 Ga0070679_100000282 3300005530 Bacteria 42961
114 Ga0070679_100004238 3300005530 Bacteria 13233
115 Ga0070679_100103795 3300005530 Bacteria 2829
116 Ga0070679_100182498 3300005530 Bacteria 2070
117 Ga0070684_100001487 3300005535 Bacteria 16916
118 Ga0070684_100019174 3300005535 Bacteria 5656
119 Ga0070684_100019798 3300005535 Bacteria 5573
120 Ga0070684_100045982 3300005535 Bacteria 3782
121 Ga0070684_100089992 3300005535 Bacteria 2728
122 Ga0070684_100243401 3300005535 Unclassified 1644
123 Ga0070684_100258961 3300005535 Bacteria 1591
124 Ga0070684_100278697 3300005535 Bacteria 1532
125 Ga0068853_100000527 3300005539 Bacteria 25905
126 Ga0068853_100009875 3300005539 Bacteria 7706
127 Ga0068853_100015941 3300005539 Bacteria 6177
128 Ga0068853_100118867 3300005539 Bacteria 2355
129 Ga0068853_100192477 3300005539 Bacteria 1853
130 Ga0068853_100324093 3300005539 Unclassified 1429
131 Ga0068853_100411846 3300005539 Bacteria 1266
132 Ga0070672_100066428 3300005543 Bacteria 2856
133 Ga0070672_100087133 3300005543 Bacteria 2512
134 Ga0070672_100245107 3300005543 Bacteria 1508
135 Ga0070686_100032724 3300005544 Bacteria 3190
136 Ga0070695_100075331 3300005545 Bacteria 2220
137 Ga0070695_100173099 3300005545 Unclassified 1524
138 Ga0070696_100007001 3300005546 Bacteria 7523
139 Ga0070696_100203446 3300005546 Bacteria 1479
140 Ga0070696_100289502 3300005546 Unclassified 1251
141 Ga0070693_100000797 3300005547 Bacteria 13939
142 Ga0070693_100021826 3300005547 Bacteria 3397
143 Ga0070665_100005415 3300005548 Bacteria 13167
144 Ga0070665_100039360 3300005548 Bacteria 4754
145 Ga0070665_100121976 3300005548 Bacteria 2608
146 Ga0070665_100180386 3300005548 Bacteria 2112
147 Ga0070704_100005092 3300005549 Bacteria 7645
148 Ga0068855_100008707 3300005563 Bacteria 12267
149 Ga0068855_100015371 3300005563 Bacteria 9215
150 Ga0068855_100029282 3300005563 Bacteria 6586
151 Ga0068855_100043128 3300005563 Bacteria 5345
152 Ga0068855_100053805 3300005563 Bacteria 4735
153 Ga0068855_100110332 3300005563 Bacteria 3158
154 Ga0068855_100216870 3300005563 Bacteria 2148
155 Ga0070664_100000979 3300005564 Bacteria 22356
156 Ga0070664_100115108 3300005564 Bacteria 2350
157 Ga0070664_100187255 3300005564 Bacteria 1843
158 Ga0068857_100000681 3300005577 Bacteria 25256
159 Ga0068857_100000870 3300005577 Bacteria 22717
160 Ga0068857_100001403 3300005577 Bacteria 19017
161 Ga0068857_100014630 3300005577 Bacteria 6843
162 Ga0068857_100034346 3300005577 Bacteria 4486
163 Ga0068857_100035684 3300005577 Bacteria 4404
164 Ga0068857_100052200 3300005577 Bacteria 3628
165 Ga0068857_100125106 3300005577 Unclassified 2316
166 Ga0068857_100323491 3300005577 Bacteria 1425
167 Ga0068857_100345503 3300005577 Bacteria 1377
168 Ga0068857_100372412 3300005577 Bacteria 1325
169 Ga0068854_100016541 3300005578 Bacteria 4919
170 Ga0068854_100052719 3300005578 Bacteria 2918
171 Ga0068856_100010085 3300005614 Bacteria 9182
172 Ga0068856_100010319 3300005614 Bacteria 9076
173 Ga0068856_100025278 3300005614 Bacteria 5788
174 Ga0068856_100043012 3300005614 Bacteria 4444
175 Ga0068856_100166164 3300005614 Bacteria 2218
176 Ga0068856_100179327 3300005614 Bacteria 2131
177 Ga0068856_100223372 3300005614 Bacteria 1899
178 Ga0070702_100197601 3300005615 Bacteria 1328
179 Ga0068852_100000003 3300005616 Bacteria 246525
180 Ga0068852_100000341 3300005616 Bacteria 31489
181 Ga0068852_100017737 3300005616 Bacteria 5593
182 Ga0068852_100043024 3300005616 Bacteria 3828
183 Ga0068852_100124042 3300005616 Bacteria 2369
184 Ga0068852_100213434 3300005616 Bacteria 1832
185 Ga0068852_100229912 3300005616 Bacteria 1767
186 Ga0068852_100264092 3300005616 Bacteria 1654
187 Ga0068852_100276776 3300005616 Unclassified 1617
188 Ga0068852_100505167 3300005616 Bacteria 1204
189 Ga0068859_100002655 3300005617 Bacteria 18164
190 Ga0068859_100004804 3300005617 Bacteria 13756
191 Ga0068859_100037039 3300005617 Bacteria 4896
192 Ga0068859_100044899 3300005617 Bacteria 4440
193 Ga0068859_100073999 3300005617 Bacteria 3445
194 Ga0068859_100081817 3300005617 Bacteria 3272
195 Ga0068859_100090690 3300005617 Bacteria 3107
196 Ga0068859_100105134 3300005617 Bacteria 2882
197 Ga0068859_100163663 3300005617 Bacteria 2304
198 Ga0068859_100225811 3300005617 Bacteria 1961
199 Ga0068859_100316950 3300005617 Bacteria 1653
200 Ga0068859_100477341 3300005617 Bacteria 1342
201 Ga0068864_100009115 3300005618 Bacteria 8180
202 Ga0068864_100057042 3300005618 Bacteria 3374
203 Ga0068864_100067133 3300005618 Bacteria 3114
204 Ga0068864_100070413 3300005618 Bacteria 3043
205 Ga0068864_100120999 3300005618 Bacteria 2340
206 Ga0068864_100175032 3300005618 Bacteria 1959
207 Ga0068864_100276860 3300005618 Bacteria 1565
208 Ga0068864_100391067 3300005618 Bacteria 1320
209 Ga0068864_100396124 3300005618 Bacteria 1311
210 Ga0068861_100049891 3300005719 Bacteria 3171
211 Ga0068861_100071782 3300005719 Bacteria 2684
212 Ga0068861_100108277 3300005719 Bacteria 2223
213 Ga0068861_100113100 3300005719 Bacteria 2178
214 Ga0068861_100160688 3300005719 Bacteria 1853
215 Ga0068851_10000999 3300005834 Bacteria 12268
216 Ga0068851_10006100 3300005834 Bacteria 5499
217 Ga0068851_10006394 3300005834 Bacteria 5377
218 Ga0068851_10030944 3300005834 Bacteria 2656
219 Ga0068851_10072590 3300005834 Bacteria 1783
220 Ga0068870_10053498 3300005840 Bacteria 2144
221 Ga0068870_10128420 3300005840 Bacteria 1469
222 Ga0068870_10205480 3300005840 Bacteria 1196
223 Ga0068863_100001291 3300005841 Bacteria 24999
224 Ga0068863_100039664 3300005841 Bacteria 4479
225 Ga0068863_100048139 3300005841 Bacteria 4043
226 Ga0068863_100163812 3300005841 Bacteria 2131
227 Ga0068863_100445652 3300005841 Bacteria 1270
228 Ga0068858_100092441 3300005842 Bacteria 2816
229 Ga0068858_100124770 3300005842 Bacteria 2410
230 Ga0068858_100136830 3300005842 Bacteria 2299
231 Ga0068858_100148194 3300005842 Bacteria 2205
232 Ga0068858_100156523 3300005842 Unclassified 2144
233 Ga0068858_100230606 3300005842 Bacteria 1755
234 Ga0068858_100238369 3300005842 Bacteria 1725
235 Ga0068858_100360710 3300005842 Bacteria 1393
236 Ga0068860_100020939 3300005843 Bacteria 6336
237 Ga0068860_100086192 3300005843 Bacteria 2989
238 Ga0068860_100246834 3300005843 Unclassified 1737
239 Ga0068860_100370797 3300005843 Unclassified 1412
240 Ga0068862_100111420 3300005844 Bacteria 2402
241 Ga0068862_100205667 3300005844 Bacteria 1777
242 Ga0068862_100205972 3300005844 Bacteria 1775
243 Ga0068862_100232506 3300005844 Bacteria 1673
244 Ga0068862_100240550 3300005844 Bacteria 1646
245 Ga0068862_100260961 3300005844 Bacteria 1581
246 Ga0070717_10011870 3300006028 Bacteria 6629
247 Ga0070717_10086684 3300006028 Bacteria 2636
248 Ga0070716_100023651 3300006173 Bacteria 3260
249 Ga0070716_100142389 3300006173 Unclassified 1531
250 Ga0070712_100001352 3300006175 Bacteria 14882
251 Ga0070712_100095543 3300006175 Bacteria 2187
252 Ga0097621_100001224 3300006237 Bacteria 17786
253 Ga0097621_100004180 3300006237 Bacteria 10016
254 Ga0097621_100005272 3300006237 Bacteria 9100
255 Ga0097621_100017286 3300006237 Bacteria 5473
256 Ga0097621_100040644 3300006237 Bacteria 3740
257 Ga0097621_100272221 3300006237 Unclassified 1488
258 Ga0068871_100003384 3300006358 Bacteria 10964
259 Ga0068871_100006260 3300006358 Bacteria 8395
260 Ga0068871_100021192 3300006358 Bacteria 4992
261 Ga0068871_100030188 3300006358 Bacteria 4266
262 Ga0068871_100231310 3300006358 Bacteria 1604
263 Ga0068871_100232449 3300006358 Bacteria 1600
264 Ga0075428_100073296 3300006844 Bacteria 3739
265 Ga0075428_100082916 3300006844 Bacteria 3498
266 Ga0075428_100120336 3300006844 Bacteria 2858
267 Ga0075428_100202163 3300006844 Bacteria 2147
268 Ga0075430_100004095 3300006846 Bacteria 12299
269 Ga0075430_100029407 3300006846 Bacteria 4663
270 Ga0075430_100114798 3300006846 Bacteria 2244
271 Ga0075431_100104680 3300006847 Unclassified 2920
272 Ga0075431_100327904 3300006847 Bacteria 1542
273 Ga0075433_10016769 3300006852 Bacteria 6048
274 Ga0075433_10225467 3300006852 Unclassified 1664
275 Ga0075434_100105754 3300006871 Bacteria 2824
276 Ga0075429_100000179 3300006880 Bacteria 41128
277 Ga0075429_100171528 3300006880 Bacteria 1900
278 Ga0075429_100192801 3300006880 Bacteria 1785
279 Ga0075429_100244645 3300006880 Unclassified 1571
280 Ga0075436_100006092 3300006914 Bacteria 8279
281 Ga0097620_100002655 3300006931 Bacteria 18164
282 Ga0097620_100004805 3300006931 Bacteria 13756
283 Ga0097620_100036153 3300006931 Bacteria 4958
284 Ga0097620_100037038 3300006931 Bacteria 4896
285 Ga0097620_100044894 3300006931 Bacteria 4440
286 Ga0097620_100071101 3300006931 Bacteria 3515
287 Ga0097620_100074004 3300006931 Bacteria 3445
288 Ga0097620_100081816 3300006931 Bacteria 3272
289 Ga0097620_100090700 3300006931 Bacteria 3107
290 Ga0097620_100105132 3300006931 Bacteria 2882
291 Ga0097620_100163670 3300006931 Bacteria 2304
292 Ga0097620_100225815 3300006931 Bacteria 1961
293 Ga0097620_100316969 3300006931 Bacteria 1653
294 Ga0097620_100477360 3300006931 Bacteria 1342
295 Ga0075435_100008999 3300007076 Bacteria 7203
296 Ga0105240_10000077 3300009093 Bacteria 197213
297 Ga0105240_10000114 3300009093 Bacteria 166405
298 Ga0105240_10001213 3300009093 Bacteria 44943
299 Ga0105240_10010907 3300009093 Bacteria 12733
300 Ga0105240_10014675 3300009093 Bacteria 10691
301 Ga0105240_10016545 3300009093 Bacteria 9983
302 Ga0105240_10030039 3300009093 Bacteria 7069
303 Ga0105240_10060412 3300009093 Bacteria 4725
304 Ga0105240_10091837 3300009093 Bacteria 3708
305 Ga0105240_10094756 3300009093 Bacteria 3641
306 Ga0105240_10095421 3300009093 Bacteria 3626
307 Ga0105240_10425188 3300009093 Bacteria 1491
308 Ga0105240_10504323 3300009093 Unclassified 1345
309 Ga0105240_10593883 3300009093 Bacteria 1220
310 Ga0105240_10650306 3300009093 Bacteria 1155
311 Ga0111539_10101956 3300009094 Bacteria 3369
312 Ga0111539_10152947 3300009094 Bacteria 2700
313 Ga0111539_10198342 3300009094 Bacteria 2341
314 Ga0111539_10222023 3300009094 Bacteria 2201
315 Ga0111539_10512008 3300009094 Bacteria 1398
316 Ga0105245_10003427 3300009098 Bacteria 14208
317 Ga0105245_10003452 3300009098 Bacteria 14163
318 Ga0105245_10067864 3300009098 Bacteria 3230
319 Ga0105245_10157598 3300009098 Bacteria 2151
320 Ga0105245_10212210 3300009098 Bacteria 1864
321 Ga0105247_10001389 3300009101 Bacteria 17563
322 Ga0105247_10020805 3300009101 Bacteria 3946
323 Ga0105247_10039696 3300009101 Bacteria 2876
324 Ga0105247_10135107 3300009101 Bacteria 1611
325 Ga0114129_10001382 3300009147 Bacteria 32663
326 Ga0114129_10012495 3300009147 Bacteria 12088
327 Ga0114129_10146958 3300009147 Bacteria 3228
328 Ga0114129_10309765 3300009147 Bacteria 2102
329 Ga0114129_10446551 3300009147 Bacteria 1697
330 Ga0105243_10352890 3300009148 Unclassified 1351
331 Ga0105241_10000112 3300009174 Bacteria 58201
332 Ga0105241_10001115 3300009174 Bacteria 20456
333 Ga0105241_10023766 3300009174 Bacteria 4548
334 Ga0105241_10040087 3300009174 Bacteria 3535
335 Ga0105241_10059397 3300009174 Bacteria 2940
336 Ga0105241_10101942 3300009174 Bacteria 2283
337 Ga0105241_10137621 3300009174 Bacteria 1985
338 Ga0105241_10168091 3300009174 Bacteria 1809
339 Ga0105241_10230088 3300009174 Bacteria 1562
340 Ga0105242_10006860 3300009176 Bacteria 8781
341 Ga0105242_10101199 3300009176 Unclassified 2442
342 Ga0105248_10000432 3300009177 Bacteria 47503
343 Ga0105248_10001800 3300009177 Bacteria 23832
344 Ga0105248_10033471 3300009177 Bacteria 5741
345 Ga0105248_10033672 3300009177 Bacteria 5725
346 Ga0105248_10036277 3300009177 Bacteria 5514
347 Ga0105248_10086266 3300009177 Bacteria 3532
348 Ga0105248_10137095 3300009177 Bacteria 2760
349 Ga0105248_10308455 3300009177 Bacteria 1782
350 Ga0105248_10437012 3300009177 Unclassified 1474
351 Ga0105248_10450867 3300009177 Unclassified 1450
352 Ga0105248_10607895 3300009177 Bacteria 1233
353 Ga0105237_10002295 3300009545 Bacteria 23777
354 Ga0105237_10003756 3300009545 Bacteria 17893
355 Ga0105237_10042887 3300009545 Bacteria 4560
356 Ga0105237_10086573 3300009545 Bacteria 3123
357 Ga0105237_10139014 3300009545 Bacteria 2423
358 Ga0105237_10140979 3300009545 Bacteria 2405
359 Ga0105237_10143703 3300009545 Bacteria 2380
360 Ga0105237_10382646 3300009545 Bacteria 1412
361 Ga0105238_10000446 3300009551 Bacteria 43281
362 Ga0105238_10001879 3300009551 Bacteria 21078
363 Ga0105238_10002900 3300009551 Bacteria 17125
364 Ga0105238_10003133 3300009551 Bacteria 16505
365 Ga0105238_10027746 3300009551 Bacteria 5770
366 Ga0105238_10064721 3300009551 Bacteria 3656
367 Ga0105238_10071794 3300009551 Bacteria 3459
368 Ga0105238_10116338 3300009551 Bacteria 2653
369 Ga0105238_10186084 3300009551 Bacteria 2053
370 Ga0105249_10001827 3300009553 Bacteria 18510
371 Ga0105249_10003348 3300009553 Bacteria 13872
372 Ga0105249_10121551 3300009553 Unclassified 2482
373 Ga0105249_10189851 3300009553 Bacteria 2005
374 Ga0105249_10470380 3300009553 Bacteria 1298
375 Ga0105239_10005246 3300010375 Bacteria 15244
376 Ga0105239_10012072 3300010375 Bacteria 9632
377 Ga0105239_10016785 3300010375 Bacteria 8093
378 Ga0105239_10067036 3300010375 Bacteria 3942
379 Ga0105239_10109075 3300010375 Bacteria 3067
380 Ga0105239_10208483 3300010375 Bacteria 2190
381 Ga0105239_10217230 3300010375 Bacteria 2144
382 Ga0105239_10388124 3300010375 Bacteria 1579
383 Ga0105246_10002464 3300011119 Bacteria 11182
384 Ga0105246_10013890 3300011119 Bacteria 5054
385 Ga0105246_10159104 3300011119 Bacteria 1719
386 Ga0157373_10023761 3300013100 Bacteria 4441
387 Ga0157373_10033812 3300013100 Bacteria 3674
388 Ga0157373_10136348 3300013100 Bacteria 1726
389 Ga0157371_10005555 3300013102 Bacteria 10601
390 Ga0157371_10016619 3300013102 Bacteria 5486
391 Ga0157370_10000001 3300013104 Bacteria 529517
392 Ga0157370_10003878 3300013104 Bacteria 17426
393 Ga0157370_10150110 3300013104 Bacteria 2169
394 Ga0157370_10402500 3300013104 Unclassified 1260
395 Ga0157369_10000066 3300013105 Bacteria 144815
396 Ga0157369_10004092 3300013105 Bacteria 17272
397 Ga0157369_10006435 3300013105 Bacteria 13616
398 Ga0157369_10007131 3300013105 Bacteria 12888
399 Ga0157369_10007580 3300013105 Bacteria 12490
400 Ga0157369_10014963 3300013105 Bacteria 8756
401 Ga0157369_10065249 3300013105 Bacteria 3919
402 Ga0157369_10101687 3300013105 Bacteria 3063
403 Ga0157369_10108310 3300013105 Bacteria 2955
404 Ga0157369_10186157 3300013105 Bacteria 2183
405 Ga0157369_10201885 3300013105 Bacteria 2086
406 Ga0157369_10202223 3300013105 Bacteria 2085
407 Ga0157369_10229224 3300013105 Bacteria 1942
408 Ga0157369_10241064 3300013105 Bacteria 1889
409 Ga0157374_10019339 3300013296 Bacteria 6028
410 Ga0157374_10022063 3300013296 Bacteria 5675
411 Ga0157374_10028405 3300013296 Bacteria 5053
412 Ga0157374_10156868 3300013296 Bacteria 2216
413 Ga0157374_10231293 3300013296 Bacteria 1816
414 Ga0157374_10323602 3300013296 Bacteria 1528
415 Ga0157374_10582203 3300013296 Unclassified 1128
416 Ga0157378_10002106 3300013297 Bacteria 17735
417 Ga0157378_10003078 3300013297 Bacteria 14816
418 Ga0157378_10005729 3300013297 Bacteria 10876
419 Ga0157378_10024665 3300013297 Bacteria 5295
420 Ga0157378_10041121 3300013297 Bacteria 4100
421 Ga0157378_10065533 3300013297 Bacteria 3251
422 Ga0157378_10246464 3300013297 Bacteria 1709
423 Ga0163162_10011531 3300013306 Bacteria 8621
424 Ga0163162_10080001 3300013306 Bacteria 3335
425 Ga0163162_10089988 3300013306 Bacteria 3150
426 Ga0163162_10195287 3300013306 Bacteria 2152
427 Ga0163162_10220681 3300013306 Bacteria 2026
428 Ga0157372_10000038 3300013307 Bacteria 167357
429 Ga0157372_10012960 3300013307 Bacteria 8891
430 Ga0157372_10026501 3300013307 Bacteria 6307
431 Ga0157372_10037252 3300013307 Bacteria 5363
432 Ga0157372_10076032 3300013307 Bacteria 3791
433 Ga0157372_10109820 3300013307 Bacteria 3159
434 Ga0157372_10132881 3300013307 Bacteria 2865
435 Ga0157372_10211101 3300013307 Bacteria 2250
436 Ga0157375_10001477 3300013308 Bacteria 20190
437 Ga0157375_10009678 3300013308 Bacteria 8474
438 Ga0157375_10014359 3300013308 Bacteria 7062
439 Ga0157375_10022781 3300013308 Bacteria 5768
440 Ga0157375_10028238 3300013308 Bacteria 5256
441 Ga0157375_10137877 3300013308 Bacteria 2565
442 Ga0157375_10168495 3300013308 Bacteria 2336
443 Ga0157375_10205848 3300013308 Bacteria 2124
444 Ga0157375_10246594 3300013308 Bacteria 1947
445 Ga0157375_10251425 3300013308 Bacteria 1928
446 Ga0157375_10398202 3300013308 Bacteria 1544
447 Ga0163163_10001025 3300014325 Bacteria 23680
448 Ga0163163_10002404 3300014325 Bacteria 15841
449 Ga0163163_10019171 3300014325 Bacteria 6419
450 Ga0163163_10022943 3300014325 Bacteria 5917
451 Ga0163163_10035662 3300014325 Bacteria 4826
452 Ga0163163_10043777 3300014325 Bacteria 4391
453 Ga0163163_10061166 3300014325 Bacteria 3731
454 Ga0163163_10091636 3300014325 Bacteria 3054
455 Ga0163163_10094084 3300014325 Bacteria 3014
456 Ga0163163_10121890 3300014325 Bacteria 2642
457 Ga0157380_10010057 3300014326 Bacteria 6791
458 Ga0157380_10031371 3300014326 Bacteria 4079
459 Ga0157380_10343737 3300014326 Bacteria 1393
460 Ga0157380_10346729 3300014326 Unclassified 1388
461 Ga0157377_10062622 3300014745 Bacteria 2128
462 Ga0157377_10148376 3300014745 Bacteria 1448
463 Ga0157379_10002365 3300014968 Bacteria 15755
464 Ga0157379_10028822 3300014968 Bacteria 4937
465 Ga0157379_10213457 3300014968 Bacteria 1747
466 Ga0157376_10000361 3300014969 Bacteria 30056
467 Ga0157376_10014459 3300014969 Bacteria 5927
468 Ga0157376_10052814 3300014969 Unclassified 3381
469 Ga0157376_10106099 3300014969 Bacteria 2464
470 Ga0163161_10191924 3300017792 Bacteria 1571
471 Ga0213872_10003691 3300021361 Bacteria 8380
472 Ga0224572_1022753 3300024225 Bacteria 1204
473 Ga0207697_10001005 3300025315 Bacteria 15781
474 Ga0207656_10020141 3300025321 Bacteria 2648
475 Ga0207656_10022576 3300025321 Bacteria 2526
476 Ga0207653_10020003 3300025885 Bacteria 2116
477 Ga0207682_10001037 3300025893 Bacteria 12816
478 Ga0207710_10007316 3300025900 Bacteria 4678
479 Ga0207710_10007728 3300025900 Bacteria 4549
480 Ga0207688_10036956 3300025901 Bacteria 2707
481 Ga0207680_10074580 3300025903 Bacteria 2113
482 Ga0207680_10099610 3300025903 Bacteria 1865
483 Ga0207647_10001387 3300025904 Bacteria 18615
484 Ga0207645_10008205 3300025907 Bacteria 7307
485 Ga0207643_10002407 3300025908 Bacteria 10126
486 Ga0207643_10014699 3300025908 Bacteria 4256
487 Ga0207643_10165265 3300025908 Bacteria 1333
488 Ga0207705_10122053 3300025909 Bacteria 1934
489 Ga0207684_10207104 3300025910 Bacteria 1692
490 Ga0207654_10000028 3300025911 Bacteria 125787
491 Ga0207654_10000923 3300025911 Bacteria 16231
492 Ga0207654_10009537 3300025911 Bacteria 4932
493 Ga0207654_10012799 3300025911 Bacteria 4305
494 Ga0207654_10017182 3300025911 Bacteria 3779
495 Ga0207654_10043148 3300025911 Bacteria 2555
496 Ga0207654_10086023 3300025911 Bacteria 1905
497 Ga0207707_10012176 3300025912 Bacteria 7478
498 Ga0207707_10029108 3300025912 Bacteria 4827
499 Ga0207695_10000026 3300025913 Bacteria 624558
500 Ga0207695_10000063 3300025913 Bacteria 349527
501 Ga0207695_10000168 3300025913 Bacteria 193087
502 Ga0207695_10000707 3300025913 Bacteria 64975
503 Ga0207695_10002562 3300025913 Bacteria 26715
504 Ga0207695_10010282 3300025913 Bacteria 11464
505 Ga0207695_10022992 3300025913 Bacteria 7060
506 Ga0207695_10092568 3300025913 Bacteria 3033
507 Ga0207695_10123138 3300025913 Bacteria 2559
508 Ga0207695_10235644 3300025913 Bacteria 1733
509 Ga0207695_10266506 3300025913 Bacteria 1609
510 Ga0207671_10000162 3300025914 Bacteria 103793
511 Ga0207671_10000279 3300025914 Bacteria 76291
512 Ga0207671_10000894 3300025914 Bacteria 37708
513 Ga0207671_10001367 3300025914 Bacteria 28449
514 Ga0207671_10092148 3300025914 Unclassified 2284
515 Ga0207671_10185120 3300025914 Bacteria 1622
516 Ga0207693_10001541 3300025915 Bacteria 20353
517 Ga0207663_10011855 3300025916 Bacteria 4692
518 Ga0207660_10101539 3300025917 Bacteria 2149
519 Ga0207662_10009332 3300025918 Bacteria 5394
520 Ga0207657_10011469 3300025919 Bacteria 8799
521 Ga0207657_10014078 3300025919 Bacteria 7827
522 Ga0207657_10278785 3300025919 Unclassified 1327
523 Ga0207649_10007401 3300025920 Bacteria 5973
524 Ga0207649_10022061 3300025920 Bacteria 3676
525 Ga0207652_10022303 3300025921 Bacteria 5237
526 Ga0207652_10081837 3300025921 Bacteria 2824
527 Ga0207652_10158373 3300025921 Bacteria 2029
528 Ga0207681_10009177 3300025923 Bacteria 6043
529 Ga0207681_10099318 3300025923 Bacteria 2096
530 Ga0207694_10000144 3300025924 Bacteria 74051
531 Ga0207694_10000346 3300025924 Bacteria 43815
532 Ga0207694_10002660 3300025924 Bacteria 14479
533 Ga0207694_10005604 3300025924 Bacteria 9621
534 Ga0207694_10014641 3300025924 Bacteria 5914
535 Ga0207694_10044001 3300025924 Bacteria 3447
536 Ga0207694_10055734 3300025924 Bacteria 3068
537 Ga0207694_10157491 3300025924 Bacteria 1833
538 Ga0207650_10002835 3300025925 Bacteria 11978
539 Ga0207650_10263554 3300025925 Bacteria 1398
540 Ga0207650_10308096 3300025925 Bacteria 1295
541 Ga0207659_10050486 3300025926 Bacteria 2955
542 Ga0207687_10038330 3300025927 Bacteria 3275
543 Ga0207687_10178857 3300025927 Bacteria 1642
544 Ga0207687_10270698 3300025927 Bacteria 1358
545 Ga0207700_10000283 3300025928 Bacteria 30148
546 Ga0207700_10030745 3300025928 Bacteria 3807
547 Ga0207700_10064688 3300025928 Bacteria 2787
548 Ga0207700_10148476 3300025928 Bacteria 1935
549 Ga0207644_10002100 3300025931 Bacteria 12912
550 Ga0207644_10007797 3300025931 Bacteria 6994
551 Ga0207644_10054347 3300025931 Bacteria 2884
552 Ga0207690_10066688 3300025932 Bacteria 2466
553 Ga0207706_10006950 3300025933 Bacteria 10462
554 Ga0207706_10026871 3300025933 Bacteria 5151
555 Ga0207706_10422490 3300025933 Bacteria 1155
556 Ga0207709_10090408 3300025935 Bacteria 1999
557 Ga0207709_10141924 3300025935 Unclassified 1652
558 Ga0207670_10002664 3300025936 Bacteria 9391
559 Ga0207670_10115971 3300025936 Bacteria 1938
560 Ga0207669_10002002 3300025937 Bacteria 8652
561 Ga0207669_10167863 3300025937 Bacteria 1559
562 Ga0207704_10046721 3300025938 Bacteria 2582
563 Ga0207704_10174750 3300025938 Bacteria 1545
564 Ga0207665_10011206 3300025939 Bacteria 5884
565 Ga0207665_10022210 3300025939 Bacteria 4172
566 Ga0207665_10041465 3300025939 Bacteria 3074
567 Ga0207691_10008092 3300025940 Bacteria 10096
568 Ga0207691_10182012 3300025940 Bacteria 1836
569 Ga0207691_10204794 3300025940 Bacteria 1716
570 Ga0207711_10000871 3300025941 Bacteria 29139
571 Ga0207711_10005683 3300025941 Bacteria 10536
572 Ga0207711_10014644 3300025941 Bacteria 6518
573 Ga0207711_10083621 3300025941 Bacteria 2792
574 Ga0207711_10124503 3300025941 Bacteria 2305
575 Ga0207711_10163373 3300025941 Bacteria 2017
576 Ga0207711_10319379 3300025941 Bacteria 1435
577 Ga0207689_10001682 3300025942 Bacteria 21004
578 Ga0207689_10004120 3300025942 Bacteria 13218
579 Ga0207689_10109215 3300025942 Bacteria 2273
580 Ga0207689_10160121 3300025942 Bacteria 1855
581 Ga0207689_10399250 3300025942 Unclassified 1146
582 Ga0207661_10002016 3300025944 Bacteria 13997
583 Ga0207661_10043546 3300025944 Bacteria 3543
584 Ga0207661_10097689 3300025944 Bacteria 2460
585 Ga0207661_10150497 3300025944 Bacteria 2011
586 Ga0207661_10162200 3300025944 Bacteria 1940
587 Ga0207661_10311235 3300025944 Unclassified 1414
588 Ga0207679_10012634 3300025945 Bacteria 5512
589 Ga0207667_10000123 3300025949 Bacteria 120422
590 Ga0207667_10001348 3300025949 Bacteria 30814
591 Ga0207667_10002645 3300025949 Bacteria 22142
592 Ga0207667_10079454 3300025949 Bacteria 3399
593 Ga0207667_10208158 3300025949 Bacteria 2005
594 Ga0207651_10004652 3300025960 Bacteria 6957
595 Ga0207651_10015215 3300025960 Bacteria 4465
596 Ga0207651_10057930 3300025960 Bacteria 2675
597 Ga0207651_10140278 3300025960 Bacteria 1866
598 Ga0207712_10199018 3300025961 Bacteria 1587
599 Ga0207712_10343925 3300025961 Bacteria 1238
600 Ga0207668_10247760 3300025972 Bacteria 1445
601 Ga0207640_10039034 3300025981 Unclassified 3002
602 Ga0207658_10022072 3300025986 Bacteria 4427
603 Ga0207658_10158118 3300025986 Bacteria 1854
604 Ga0207677_10003066 3300026023 Bacteria 8829
605 Ga0207677_10124524 3300026023 Unclassified 1945
606 Ga0207677_10189467 3300026023 Bacteria 1625
607 Ga0207703_10015003 3300026035 Bacteria 6046
608 Ga0207703_10025692 3300026035 Bacteria 4633
609 Ga0207703_10050281 3300026035 Bacteria 3373
610 Ga0207703_10055430 3300026035 Bacteria 3225
611 Ga0207703_10173700 3300026035 Bacteria 1897
612 Ga0207703_10175723 3300026035 Unclassified 1887
613 Ga0207703_10285339 3300026035 Bacteria 1501
614 Ga0207639_10001215 3300026041 Bacteria 17486
615 Ga0207639_10050627 3300026041 Bacteria 3155
616 Ga0207639_10064381 3300026041 Bacteria 2842
617 Ga0207639_10111063 3300026041 Bacteria 2234
618 Ga0207639_10123859 3300026041 Bacteria 2128
619 Ga0207639_10302564 3300026041 Unclassified 1414
620 Ga0207678_10002154 3300026067 Bacteria 17812
621 Ga0207708_10000054 3300026075 Bacteria 103599
622 Ga0207708_10003738 3300026075 Bacteria 11228
623 Ga0207708_10042425 3300026075 Bacteria 3468
624 Ga0207708_10108170 3300026075 Bacteria 2156
625 Ga0207702_10012052 3300026078 Bacteria 7189
626 Ga0207702_10041355 3300026078 Bacteria 3865
627 Ga0207702_10085261 3300026078 Bacteria 2752
628 Ga0207702_10109259 3300026078 Bacteria 2455
629 Ga0207702_10130787 3300026078 Bacteria 2258
630 Ga0207702_10595788 3300026078 Bacteria 1084
631 Ga0207641_10128820 3300026088 Bacteria 2269
632 Ga0207641_10412909 3300026088 Bacteria 1298
633 Ga0207648_10226610 3300026089 Bacteria 1662
634 Ga0207648_10241084 3300026089 Bacteria 1610
635 Ga0207676_10007279 3300026095 Bacteria 7842
636 Ga0207676_10022890 3300026095 Bacteria 4599
637 Ga0207676_10052832 3300026095 Bacteria 3178
638 Ga0207676_10064134 3300026095 Bacteria 2920
639 Ga0207676_10162623 3300026095 Bacteria 1936
640 Ga0207676_10243096 3300026095 Bacteria 1616
641 Ga0207676_10258613 3300026095 Bacteria 1570
642 Ga0207676_10272336 3300026095 Bacteria 1534
643 Ga0207674_10000488 3300026116 Bacteria 52346
644 Ga0207674_10005666 3300026116 Bacteria 14808
645 Ga0207674_10006829 3300026116 Bacteria 13385
646 Ga0207674_10007120 3300026116 Bacteria 13066
647 Ga0207674_10038045 3300026116 Bacteria 4999
648 Ga0207674_10412978 3300026116 Bacteria 1304
649 Ga0207675_100002285 3300026118 Bacteria 19034
650 Ga0207675_100022449 3300026118 Bacteria 5877
651 Ga0207675_100034625 3300026118 Bacteria 4709
652 Ga0207675_100069121 3300026118 Bacteria 3301
653 Ga0207675_100282810 3300026118 Bacteria 1612
654 Ga0207675_100298216 3300026118 Bacteria 1569
655 Ga0207675_100398261 3300026118 Unclassified 1356
656 Ga0207683_10003867 3300026121 Bacteria 12989
657 Ga0207683_10060910 3300026121 Unclassified 3319
658 Ga0207683_10109140 3300026121 Bacteria 2477
659 Ga0207683_10144404 3300026121 Bacteria 2145
660 Ga0207698_10000068 3300026142 Bacteria 69581
661 Ga0207698_10000224 3300026142 Bacteria 35191
662 Ga0207698_10009699 3300026142 Bacteria 6149
663 Ga0207698_10061577 3300026142 Bacteria 2925
664 Ga0207698_10087959 3300026142 Bacteria 2532
665 Ga0207698_10367444 3300026142 Unclassified 1364
666 Ga0207698_10442631 3300026142 Bacteria 1252
667 Ga0207698_10471203 3300026142 Bacteria 1216
668 Ga0209971_1023048 3300027682 Bacteria 1484
669 Ga0209974_10008493 3300027876 Bacteria 3509
670 Ga0207428_10013684 3300027907 Bacteria 7076
671 Ga0207428_10217621 3300027907 Bacteria 1433
672 Ga0268266_10003238 3300028379 Bacteria 16441
673 Ga0268266_10037502 3300028379 Bacteria 4128
674 Ga0268266_10256127 3300028379 Bacteria 1620
675 Ga0268265_10120983 3300028380 Bacteria 2157
676 Ga0268265_10289274 3300028380 Bacteria 1470
677 Ga0268265_10577518 3300028380 Bacteria 1071
678 Ga0268264_10008533 3300028381 Bacteria 8516
679 Ga0268264_10203779 3300028381 Unclassified 1812
680 Ga0268264_10249167 3300028381 Bacteria 1649
681 Ga0265319_1000487 3300028563 Bacteria 27649
682 Ga0265319_1004533 3300028563 Bacteria 6852
683 Ga0265319_1008838 3300028563 Bacteria 4366
684 Ga0265334_10000818 3300028573 Bacteria 15548
685 Ga0265334_10048771 3300028573 Unclassified 1630
686 Ga0265334_10053388 3300028573 Bacteria 1544
687 Ga0265318_10000369 3300028577 Bacteria 35381
688 Ga0265318_10007193 3300028577 Bacteria 5058
689 Ga0265318_10077295 3300028577 Bacteria 1231
690 Ga0265323_10016793 3300028653 Bacteria 2851
691 Ga0265323_10062036 3300028653 Bacteria 1298
692 Ga0265336_10002155 3300028666 Bacteria 8318
693 Ga0265336_10005323 3300028666 Bacteria 4763
694 Ga0265336_10024607 3300028666 Bacteria 1900
695 Ga0265338_10002513 3300028800 Bacteria 27271
696 Ga0265338_10003733 3300028800 Bacteria 21176
697 Ga0265338_10006524 3300028800 Bacteria 14835
698 Ga0265338_10016308 3300028800 Bacteria 8092
699 Ga0265338_10016699 3300028800 Bacteria 7955
700 Ga0265338_10043165 3300028800 Bacteria 4186
701 Ga0265338_10048139 3300028800 Bacteria 3883
702 Ga0265338_10048724 3300028800 Bacteria 3851
703 Ga0265762_1006038 3300030760 Bacteria 2171
704 Ga0265330_10000198 3300031235 Bacteria 46563
705 Ga0265330_10000202 3300031235 Bacteria 46065
706 Ga0265330_10000913 3300031235 Bacteria 18224
707 Ga0265330_10006383 3300031235 Bacteria 5826
708 Ga0265330_10040749 3300031235 Bacteria 2061
709 Ga0265330_10060368 3300031235 Unclassified 1650
710 Ga0265332_10000883 3300031238 Bacteria 18081
711 Ga0265332_10009085 3300031238 Bacteria 4444
712 Ga0265332_10027296 3300031238 Bacteria 2501
713 Ga0265328_10006951 3300031239 Bacteria 4750
714 Ga0265328_10012399 3300031239 Bacteria 3393
715 Ga0265328_10013313 3300031239 Bacteria 3259
716 Ga0265320_10001956 3300031240 Bacteria 14549
717 Ga0265320_10002237 3300031240 Bacteria 13579
718 Ga0265320_10002575 3300031240 Bacteria 12602
719 Ga0265320_10003710 3300031240 Bacteria 10188
720 Ga0265320_10055189 3300031240 Bacteria 1913
721 Ga0265320_10112922 3300031240 Bacteria 1243
722 Ga0265325_10000269 3300031241 Bacteria 37019
723 Ga0265325_10001559 3300031241 Bacteria 15977
724 Ga0265325_10012353 3300031241 Bacteria 4887
725 Ga0265329_10035888 3300031242 Bacteria 1600
726 Ga0265340_10013709 3300031247 Bacteria 4251
727 Ga0265340_10031007 3300031247 Bacteria 2676
728 Ga0265340_10072299 3300031247 Bacteria 1633
729 Ga0265339_10000003 3300031249 Bacteria 305994
730 Ga0265339_10000118 3300031249 Bacteria 65006
731 Ga0265339_10000324 3300031249 Bacteria 38292
732 Ga0265339_10000747 3300031249 Bacteria 25123
733 Ga0265339_10014030 3300031249 Bacteria 4840
734 Ga0265339_10025773 3300031249 Bacteria 3371
735 Ga0265339_10038891 3300031249 Bacteria 2651
736 Ga0265339_10040091 3300031249 Bacteria 2604
737 Ga0265339_10047392 3300031249 Bacteria 2360
738 Ga0265339_10087552 3300031249 Unclassified 1637
739 Ga0265327_10000029 3300031251 Bacteria 352607
740 Ga0265327_10002947 3300031251 Bacteria 17010
741 Ga0265327_10011290 3300031251 Bacteria 6171
742 Ga0265316_10000084 3300031344 Bacteria 99744
743 Ga0265316_10001391 3300031344 Bacteria 26069
744 Ga0265316_10001449 3300031344 Bacteria 25469
745 Ga0265316_10001682 3300031344 Bacteria 23511
746 Ga0265316_10002239 3300031344 Bacteria 20282
747 Ga0265316_10006013 3300031344 Bacteria 11670
748 Ga0265316_10010277 3300031344 Bacteria 8538
749 Ga0265316_10015566 3300031344 Bacteria 6643
750 Ga0265316_10033791 3300031344 Bacteria 4161
751 Ga0265316_10047095 3300031344 Bacteria 3413
752 Ga0265316_10049726 3300031344 Bacteria 3301
753 Ga0265316_10050188 3300031344 Bacteria 3283
754 Ga0265316_10132766 3300031344 Bacteria 1874
755 Ga0265316_10148638 3300031344 Bacteria 1756
756 Ga0265316_10183121 3300031344 Unclassified 1559
757 Ga0307408_100028500 3300031548 Bacteria 3859
758 Ga0265313_10003096 3300031595 Bacteria 13787
759 Ga0265313_10009568 3300031595 Bacteria 6274
760 Ga0265313_10020761 3300031595 Bacteria 3614
761 Ga0265313_10030763 3300031595 Bacteria 2759
762 Ga0316575_10006974 3300031665 Bacteria 4087
763 Ga0316575_10010767 3300031665 Bacteria 3370
764 Ga0316579_10000759 3300031691 Bacteria 11053
765 Ga0316579_10027277 3300031691 Bacteria 2592
766 Ga0316579_10065017 3300031691 Unclassified 1721
767 Ga0265314_10000064 3300031711 Bacteria 158787
768 Ga0265314_10000076 3300031711 Bacteria 146266
769 Ga0265314_10001590 3300031711 Bacteria 24962
770 Ga0265314_10003765 3300031711 Bacteria 14505
771 Ga0265314_10007667 3300031711 Bacteria 9332
772 Ga0265314_10040648 3300031711 Bacteria 3336
773 Ga0265314_10125242 3300031711 Bacteria 1610
774 Ga0265342_10000147 3300031712 Bacteria 79849
775 Ga0265342_10001403 3300031712 Bacteria 22490
776 Ga0265342_10002544 3300031712 Bacteria 15686
777 Ga0265342_10010272 3300031712 Bacteria 6516
778 Ga0265342_10011353 3300031712 Bacteria 6104
779 Ga0265342_10016372 3300031712 Bacteria 4850
780 Ga0265342_10023235 3300031712 Bacteria 3928
781 Ga0265342_10040119 3300031712 Bacteria 2840
782 Ga0265342_10040853 3300031712 Unclassified 2811
783 Ga0316576_10002147 3300031727 Bacteria 11111
784 Ga0316576_10013473 3300031727 Bacteria 5437
785 Ga0316576_10021570 3300031727 Bacteria 4458
786 Ga0316576_10022143 3300031727 Bacteria 4410
787 Ga0316576_10161689 3300031727 Bacteria 1689
788 Ga0316578_10039253 3300031728 Bacteria 2734
789 Ga0316578_10050371 3300031728 Bacteria 2436
790 Ga0307405_10027977 3300031731 Bacteria 3277
791 Ga0307405_10098876 3300031731 Unclassified 1952
792 Ga0316577_10001105 3300031733 Bacteria 12270
793 Ga0316577_10008449 3300031733 Bacteria 5520
794 Ga0316577_10012664 3300031733 Bacteria 4599
795 Ga0316577_10042730 3300031733 Bacteria 2536
796 Ga0307410_10002358 3300031852 Bacteria 9099
797 Ga0307406_10005486 3300031901 Bacteria 6941
798 Ga0307409_100278434 3300031995 Bacteria 1545
799 Ga0307414_10024781 3300032004 Bacteria 3831
800 Ga0307414_10316112 3300032004 Unclassified 1327
801 Ga0307411_10031270 3300032005 Bacteria 3273
802 Ga0307411_10131321 3300032005 Bacteria 1831
803 Ga0307415_100215914 3300032126 Bacteria 1534
804 Ga0316593_10001992 3300032168 Bacteria 4706
805 Ga0316593_10033691 3300032168 Bacteria 1678
806 Ga0316588_1046288 3300033528 Unclassified 1048
807 Ga0316596_1001557 3300033541 Bacteria 4674
808 Ga0373951_0027925 3300035091 Bacteria 1320
809 Ga0373923_0120970 3300035111 Unclassified 1170
810 Ga0373954_0102904 3300035118 Bacteria 1379
811 Ga0373955_0066978 3300035172 Bacteria 1998
812 Ga0373955_0091664 3300035172 Bacteria 1733
813 Ga0373961_0000436 3300035241 Bacteria 17183
814 Ga0316574_0000429 3300035398 Bacteria 16715
815 Ga0316574_0009950 3300035398 Bacteria 5350
816 Ga0316574_0021255 3300035398 Bacteria 3851
817 Ga0316574_0076663 3300035398 Bacteria 2118
818 Ga0373935_0020484 3300035692 Bacteria 4042
819 Ga0373935_0027606 3300035692 Bacteria 3510
820 Ga0373947_0034774 3300035725 Bacteria 2981
821 Ga0373937_0002221 3300036401 Bacteria 16223
822 Ga0373937_0033001 3300036401 Bacteria 4698
823 Ga0373937_0039188 3300036401 Bacteria 4319
824 Ga0373937_0055256 3300036401 Bacteria 3645
825 Ga0373937_0139485 3300036401 Bacteria 2268
826 Ga0373937_0263188 3300036401 Bacteria 1627
827 Ga0373937_0327727 3300036401 Bacteria 1449
828 Ga0316582_0009672 3300036647 Bacteria 5242
829 Ga0316582_0018706 3300036647 Bacteria 4038
830 Ga0316582_0018910 3300036647 Bacteria 4021
831 Ga0316582_0060036 3300036647 Bacteria 2437
832 Ga0316582_0062387 3300036647 Bacteria 2393
833 Ga0316582_0096067 3300036647 Bacteria 1957
834 Ga0316584_0005315 3300036712 Bacteria 8623
835 Ga0316584_0031833 3300036712 Bacteria 3900
836 Ga0316584_0044280 3300036712 Bacteria 3319
837 Ga0316584_0127797 3300036712 Bacteria 1898
838 Ga0316584_0200097 3300036712 Bacteria 1474
839 Ga0373925_0001621 3300037068 Bacteria 19006
840 Ga0316581_0009239 3300037588 Bacteria 2706
841 Ga0395901_0458024 3300038443 Unclassified 1304
842 Ga0400483_004982 3300039062 Bacteria 20044
843 Ga0400483_012643 3300039062 Bacteria 1717
844 Ga0400483_122934 3300039062 Unclassified 3835
845 Ga0400483_216264 3300039062 Bacteria 10204
846 Ga0400483_240193 3300039062 Bacteria 8892
847 Ga0436360_0014237 3300039438 Unclassified 1736
848 Ga0436361_0359509 3300039447 Bacteria 6092
849 Ga0436361_0656577 3300039447 Bacteria 3739
850 Ga0436363_1172370 3300039450 Bacteria 1944
851 Ga0436362_1012282 3300039453 Bacteria 1528
852 Ga0439441_011222 3300042001 Bacteria 1517
853 Ga0451577_0018124 3300042876 Bacteria 6489
854 Ga0451577_0025637 3300042876 Bacteria 5348
855 Ga0451577_0039852 3300042876 Bacteria 4219
856 Ga0451577_0075436 3300042876 Bacteria 3007
857 Ga0451577_0115455 3300042876 Bacteria 2404
858 Ga0451577_0128782 3300042876 Bacteria 2270
859 Ga0451577_0264739 3300042876 Bacteria 1556
860 Ga0451577_0298148 3300042876 Bacteria 1461
861 Ga0451577_0314594 3300042876 Unclassified 1419
862 Ga0451577_0320931 3300042876 Bacteria 1404
863 Ga0451577_0374624 3300042876 Bacteria 1292
864 Ga0453683_0000129 3300044673 Bacteria 110609
865 Ga0453683_0000638 3300044673 Bacteria 38065
866 Ga0453683_0001154 3300044673 Bacteria 23962
867 Ga0453683_0008080 3300044673 Bacteria 7080
868 Ga0453683_0010406 3300044673 Bacteria 6166
869 Ga0453683_0027971 3300044673 Bacteria 3572
870 Ga0453683_0044921 3300044673 Bacteria 2770
871 Ga0453683_0059002 3300044673 Bacteria 2400
872 Ga0453683_0064506 3300044673 Unclassified 2289
873 Ga0453683_0109605 3300044673 Bacteria 1736
874 Ga0466961_0166345 3300044693 Bacteria 1373
875 Ga0466963_0002558 3300044694 Bacteria 10198
876 Ga0453684_0000035 3300044712 Bacteria 725956
877 Ga0453684_0000627 3300044712 Bacteria 128570
878 Ga0453684_0000752 3300044712 Bacteria 112676
879 Ga0453684_0000920 3300044712 Bacteria 97531
880 Ga0453684_0001416 3300044712 Bacteria 69082
881 Ga0453684_0001422 3300044712 Bacteria 68864
882 Ga0453684_0003020 3300044712 Bacteria 39129
883 Ga0453684_0003787 3300044712 Bacteria 33392
884 Ga0453684_0005727 3300044712 Bacteria 24316
885 Ga0453684_0009719 3300044712 Bacteria 16726
886 Ga0453684_0035364 3300044712 Bacteria 6906
887 Ga0453684_0059795 3300044712 Bacteria 4909
888 Ga0453684_0078587 3300044712 Bacteria 4128
889 Ga0453684_0079221 3300044712 Bacteria 4107
890 Ga0453684_0089786 3300044712 Bacteria 3798
891 Ga0453684_0095584 3300044712 Bacteria 3652
892 Ga0453684_0112556 3300044712 Bacteria 3303
893 Ga0453684_0138626 3300044712 Bacteria 2909
894 Ga0453684_0167862 3300044712 Bacteria 2589
895 Ga0453684_0176923 3300044712 Bacteria 2508
896 Ga0453684_0178692 3300044712 Bacteria 2493
897 Ga0453684_0199884 3300044712 Bacteria 2331
898 Ga0453684_0220420 3300044712 Bacteria 2198
899 Ga0453684_0252422 3300044712 Bacteria 2025
900 Ga0453684_0273889 3300044712 Unclassified 1927
901 Ga0453684_0324172 3300044712 Bacteria 1744
902 Ga0453684_0488926 3300044712 Bacteria 1364
903 Ga0453684_0608421 3300044712 Bacteria 1197
904 Ga0453684_0643980 3300044712 Bacteria 1157
905 Ga0451576_0000311 3300045051 Bacteria 117825
906 Ga0451576_0000688 3300045051 Bacteria 68843
907 Ga0451576_0001255 3300045051 Bacteria 44559
908 Ga0451576_0002597 3300045051 Bacteria 26495
909 Ga0451576_0016491 3300045051 Bacteria 8151
910 Ga0451576_0031990 3300045051 Bacteria 5607
911 Ga0451576_0034883 3300045051 Bacteria 5341
912 Ga0451576_0041664 3300045051 Bacteria 4853
913 Ga0451576_0074132 3300045051 Bacteria 3542
914 Ga0451576_0128728 3300045051 Bacteria 2639
915 Ga0451576_0167137 3300045051 Bacteria 2296
916 Ga0451576_0221133 3300045051 Bacteria 1977
917 Ga0451576_0240250 3300045051 Unclassified 1892
918 Ga0451576_0300576 3300045051 Bacteria 1679
919 Ga0451576_0370790 3300045051 Bacteria 1500
920 Ga0451576_0412029 3300045051 Bacteria 1417
921 Ga0466967_0013758 3300045976 Bacteria 6270
922 Ga0466967_0117712 3300045976 Bacteria 2450
923 Ga0495603_0086802 3300046455 Bacteria 1831
924 Ga0495629_0000018 3300046459 Bacteria 169239
925 Ga0495629_0008737 3300046459 Bacteria 7449
926 Ga0495629_0019786 3300046459 Bacteria 4805
927 Ga0495651_0028878 3300046462 Bacteria 4324
928 Ga0495653_0028713 3300046463 Bacteria 4447
929 Ga0495580_0002833 3300046472 Bacteria 14914
930 Ga0495580_0053667 3300046472 Bacteria 2844
931 Ga0495580_0099393 3300046472 Bacteria 2024
932 Ga0495582_0001254 3300046473 Bacteria 14252
933 Ga0495582_0012389 3300046473 Bacteria 4698
934 Ga0495582_0104438 3300046473 Bacteria 1588
935 Ga0495639_0007935 3300046475 Bacteria 4562
936 Ga0495639_0037447 3300046475 Bacteria 2174
937 Ga0495639_0198196 3300046475 Unclassified 982
938 Ga0495662_0025759 3300046476 Bacteria 2840
939 Ga0495664_0038383 3300046477 Bacteria 2827
940 Ga0495618_0065773 3300046514 Bacteria 2304
941 Ga0495630_0166578 3300046517 Bacteria 1678
942 Ga0495666_0037091 3300046526 Bacteria 2372
943 Ga0495652_0101554 3300046529 Bacteria 2331
944 Ga0495665_0035363 3300046531 Bacteria 2669
945 Ga0495640_0040767 3300046533 Bacteria 3249
946 Ga0495640_0075761 3300046533 Bacteria 2246
947 Ga0495587_0004841 3300046536 Bacteria 8834
948 Ga0495587_0018096 3300046536 Bacteria 4370
949 Ga0495587_0024110 3300046536 Bacteria 3733
950 Ga0495621_0011910 3300046539 Bacteria 2703
951 Ga0495645_0009633 3300046543 Bacteria 6754
952 Ga0495645_0010293 3300046543 Bacteria 6556
953 Ga0495667_0104541 3300046559 Bacteria 1831
954 Ga0495634_0004148 3300046642 Bacteria 11453
955 Ga0495634_0181325 3300046642 Bacteria 1318
956 Ga0495635_0000069 3300046663 Bacteria 63592
957 Ga0495635_0003141 3300046663 Bacteria 11367
958 Ga0495657_0255425 3300046675 Bacteria 1054
959 Ga0495599_0051973 3300046678 Bacteria 2567
960 Ga0495623_0016415 3300046679 Bacteria 4784
961 Ga0495623_0065167 3300046679 Unclassified 2279
962 Ga0495623_0129562 3300046679 Bacteria 1512
963 Ga0495646_0047170 3300046680 Bacteria 2624
964 Ga0495647_0002903 3300046681 Bacteria 5442
965 Ga0495658_0000471 3300046683 Bacteria 22293
966 Ga0495658_0029958 3300046683 Bacteria 2951
967 Ga0495669_0029730 3300046684 Bacteria 2397
968 Ga0495613_0005080 3300046689 Bacteria 9864
969 Ga0495613_0048716 3300046689 Bacteria 3129
970 Ga0495600_0024312 3300046809 Bacteria 3899
971 Ga0495600_0098999 3300046809 Bacteria 1901
972 Ga0495600_0247853 3300046809 Unclassified 1134
973 Ga0495581_0005351 3300047315 Bacteria 7423
974 Ga0495581_0028058 3300047315 Bacteria 3263
975 Ga0495604_0059884 3300047317 Bacteria 2917
976 Ga0495674_0082868 3300047319 Bacteria 2750
977 Ga0495674_0219764 3300047319 Bacteria 1571
978 Ga0495674_0313189 3300047319 Bacteria 1280
979 Ga0495676_0161801 3300047321 Bacteria 1583
980 Ga0495680_0000044 3300047322 Bacteria 97068
981 Ga0495675_0122258 3300047444 Unclassified 1621
982 Ga0495684_0042688 3300047471 Bacteria 3472
983 Ga0495593_0093043 3300047673 Bacteria 1552
984 Ga0495602_0170795 3300048088 Bacteria 1688
985 Ga0495602_0324307 3300048088 Unclassified 1119
986 Ga0495614_0018343 3300048089 Bacteria 3031
987 Ga0496100_0130140 3300048903 Bacteria 1772
988 Ga0496101_0089193 3300048904 Bacteria 2291
989 Ga0496102_0035772 3300048905 Bacteria 4472
990 Ga0496104_0017902 3300048907 Bacteria 6460
991 Ga0496104_0198008 3300048907 Bacteria 1921
992 Ga0496105_0014830 3300048908 Bacteria 6204
993 Ga0496105_0043979 3300048908 Bacteria 3683
994 Ga0496106_0143195 3300048909 Bacteria 1881
995 Ga0496107_0122430 3300048910 Bacteria 1916
996 Ga0496108_0013093 3300048911 Bacteria 6761
997 Ga0496108_0397811 3300048911 Bacteria 1203
998 Ga0496109_0004542 3300048912 Bacteria 11594
999 Ga0496109_0027991 3300048912 Bacteria 5039
1000 Ga0496109_0302331 3300048912 Bacteria 1509
1001 Ga0496110_0027451 3300048913 Bacteria 4881
1002 Ga0496112_0080288 3300048915 Bacteria 3225
1003 Ga0496112_0142596 3300048915 Bacteria 2365
1004 Ga0496113_0068836 3300048916 Bacteria 2687
1005 Ga0496114_0007255 3300048917 Bacteria 8756
1006 Ga0496114_0008657 3300048917 Bacteria 8067
1007 Ga0496115_0093688 3300048918 Bacteria 2456
1008 Ga0501292_006916 3300049515 Unclassified 1626
1009 Ga0501296_003603 3300049519 Unclassified 1658
1010 Ga0501034_0067510 3300049571 Bacteria 3589
1011 Ga0501038_0008020 3300049574 Bacteria 9728
1012 Ga0501039_0053167 3300049575 Bacteria 3134
1013 Ga0501039_0131215 3300049575 Bacteria 1967
1014 Ga0501040_0072231 3300049576 Bacteria 2383
1015 Ga0501047_0218883 3300049581 Bacteria 1761
1016 Ga0501047_0350148 3300049581 Bacteria 1314
1017 Ga0501071_0037531 3300049587 Bacteria 3460
1018 Ga0501072_0038846 3300049588 Bacteria 3736
1019 Ga0501072_0144183 3300049588 Unclassified 1899
1020 Ga0501074_0125521 3300049590 Bacteria 1836
1021 Ga0501075_0016699 3300049591 Bacteria 5293
1022 Ga0501076_0036202 3300049592 Bacteria 3866
1023 Ga0501076_0334750 3300049592 Bacteria 1242
1024 Ga0501077_0148306 3300049593 Bacteria 1488
1025 Ga0501202_021022 3300049652 Unclassified 1301
1026 Ga0501207_001271 3300049654 Unclassified 3120
1027 Ga0501209_014613 3300049656 Unclassified 1729
1028 Ga0501217_001008 3300049661 Bacteria 5098
1029 Ga0501217_002314 3300049661 Bacteria 3731
1030 Ga0501217_021554 3300049661 Bacteria 1522
1031 Ga0501223_001628 3300049663 Bacteria 5162
1032 Ga0501223_005324 3300049663 Bacteria 2709
1033 Ga0501223_006020 3300049663 Bacteria 2523
1034 Ga0501227_000979 3300049665 Bacteria 6304
1035 Ga0501230_000225 3300049667 Bacteria 5023
1036 Ga0501235_008095 3300049669 Unclassified 2293
1037 Ga0501235_032728 3300049669 Unclassified 1176
1038 Ga0501239_000904 3300049672 Bacteria 2420
1039 Ga0501239_006106 3300049672 Bacteria 1230
1040 Ga0501243_010751 3300049675 Bacteria 1431
1041 Ga0501253_011487 3300049683 Bacteria 1362
1042 Ga0501257_002511 3300049686 Bacteria 3875
1043 Ga0501257_003460 3300049686 Bacteria 3388
1044 Ga0501261_001901 3300049690 Bacteria 2568
1045 Ga0501225_0000303 3300049705 Bacteria 15418
1046 Ga0501225_0017089 3300049705 Bacteria 2014
1047 Ga0501225_0024929 3300049705 Bacteria 1646
1048 Ga0501234_011008 3300049707 Bacteria 1412
1049 Ga0501245_013114 3300049708 Bacteria 1222
1050 Ga0501079_0081941 3300049741 Bacteria 2495
1051 Ga0501079_0132449 3300049741 Bacteria 1940
1052 Ga0501079_0135906 3300049741 Bacteria 1914
1053 Ga0501080_0104038 3300049742 Bacteria 2633
1054 Ga0501080_0115502 3300049742 Bacteria 2489
1055 Ga0501080_0246615 3300049742 Bacteria 1629
1056 Ga0501080_0502916 3300049742 Bacteria 1083
1057 Ga0501081_0019178 3300049743 Bacteria 4550
1058 Ga0501083_0179804 3300049744 Bacteria 1381
1059 Ga0501270_006308 3300049767 Unclassified 1418
1060 Ga0501272_001613 3300049769 Bacteria 2157
1061 Ga0501272_004911 3300049769 Bacteria 1399
1062 Ga0501045_0169444 3300049824 Bacteria 1626
1063 Ga0501204_002063 3300049850 Bacteria 2022
1064 Ga0501212_013401 3300049851 Bacteria 1203
1065 nmdc:mga05p37_1088_c1 3300050507 Bacteria 31183
1066 nmdc:mga05p37_158261_c1 3300050507 Unclassified 2767
1067 nmdc:mga05p37_161921_c2 3300050507 Bacteria 2237
1068 nmdc:mga05p37_188915_c1 3300050507 Bacteria 2503
1069 nmdc:mga05p37_265913_c1 3300050507 Unclassified 2051
1070 nmdc:mga05p37_437457_c1 3300050507 Bacteria 1518
1071 nmdc:mga05p37_464167_c1 3300050507 Bacteria 1462
1072 nmdc:mga09592_130481_c2 3300050508 Bacteria 1820
1073 nmdc:mga09592_1528_c1 3300050508 Bacteria 18645
1074 nmdc:mga09592_213196_c1 3300050508 Unclassified 1673
1075 nmdc:mga09592_38585_c1 3300050508 Bacteria 4010
1076 nmdc:mga09592_78200_c1 3300050508 Unclassified 2815
1077 nmdc:mga0qj67_1379_c1 3300050509 Bacteria 17019
1078 nmdc:mga06r32_157174_c1 3300050510 Bacteria 2255
1079 nmdc:mga06r32_187739_c1 3300050510 Unclassified 2054
1080 nmdc:mga08y16_102720_c1 3300050511 Bacteria 2976
1081 nmdc:mga08y16_178706_c1 3300050511 Bacteria 2204
1082 nmdc:mga08y16_7081_c1 3300050511 Bacteria 11768
1083 nmdc:mga0n895_21731_c1 3300050512 Bacteria 6005
1084 nmdc:mga0rr50_39343_c1 3300050513 Bacteria 3429
1085 nmdc:mga08x19_3938_c2 3300050514 Bacteria 6286
1086 nmdc:mga0a205_200403_c1 3300050515 Bacteria 1887
1087 nmdc:mga0a205_243996_c1 3300050515 Bacteria 1677
1088 nmdc:mga0a205_59859_c1 3300050515 Bacteria 3679
1089 Ga0495619_0003782 3300053085 Bacteria 9735
1090 Ga0495619_0061650 3300053085 Bacteria 2496
1091 Ga0495619_0130061 3300053085 Bacteria 1730
1092 Ga0501084_0036414 3300054114 Bacteria 4110
1093 Ga0501084_0100904 3300054114 Bacteria 2423
1094 Ga0501082_0049363 3300060353 Bacteria 3629
1095 Ga0501082_0074811 3300060353 Bacteria 2918
1096 Ga0530510_0021924 3300061734 Bacteria 4547
1097 Ga0530510_0040752 3300061734 Bacteria 3352
1098 Ga0530510_0063783 3300061734 Bacteria 2668

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300026118 Ga0207675_100298216 Ga0207675_1002982162 288
2 3300009174 Ga0105241_10101942 Ga0105241_101019422 289
3 3300044712 Ga0453684_0252422 Ga0453684_0252422_1047_2012 298
4 3300046455 Ga0495603_0086802 Ga0495603_0086802_291_1283 298
5 3300046459 Ga0495629_0008737 Ga0495629_0008737_4742_5734 298
6 3300046475 Ga0495639_0037447 Ga0495639_0037447_384_1376 298
7 3300046526 Ga0495666_0037091 Ga0495666_0037091_783_1775 298
8 3300046642 Ga0495634_0181325 Ga0495634_0181325_91_1083 298
9 3300046683 Ga0495658_0029958 Ga0495658_0029958_639_1631 298
10 3300047321 Ga0495676_0161801 Ga0495676_0161801_323_1315 298
11 3300009545 Ga0105237_10143703 Ga0105237_101437031 299
12 3300010375 Ga0105239_10217230 Ga0105239_102172302 299
13 3300013306 Ga0163162_10220681 Ga0163162_102206811 299
14 3300046475 Ga0495639_0198196 Ga0495639_0198196_27_935 299
15 3300046679 Ga0495623_0065167 Ga0495623_0065167_1298_2209 299
16 3300047444 Ga0495675_0122258 Ga0495675_0122258_194_1105 299
17 3300048088 Ga0495602_0324307 Ga0495602_0324307_62_979 299
18 3300048903 Ga0496100_0130140 Ga0496100_0130140_780_1697 299
19 3300048908 Ga0496105_0043979 Ga0496105_0043979_25_942 299
20 3300048905 Ga0496102_0035772 Ga0496102_0035772_1610_2524 300
21 3300048911 Ga0496108_0397811 Ga0496108_0397811_104_1018 300
22 3300048916 Ga0496113_0068836 Ga0496113_0068836_1284_2198 300
23 3300049742 Ga0501080_0502916 Ga0501080_0502916_160_1065 301
24 3300046675 Ga0495657_0255425 Ga0495657_0255425_31_945 304
25 3300005365 Ga0070688_100125440 Ga0070688_1001254403 305
26 3300035111 Ga0373923_0120970 Ga0373923_0120970_32_967 305
27 3300036401 Ga0373937_0327727 Ga0373937_0327727_15_941 306
28 3300039062 Ga0400483_012643 Ga0400483_012643_32_952 306
29 3300039062 Ga0400483_122934 Ga0400483_122934_2302_3222 306
30 3300039062 Ga0400483_216264 Ga0400483_216264_6196_7116 306
31 3300039447 Ga0436361_0656577 Ga0436361_0656577_22_954 306
32 3300044712 Ga0453684_0078587 Ga0453684_0078587_1829_2836 306
33 3300036647 Ga0316582_0096067 Ga0316582_0096067_423_1412 309
34 3300009093 Ga0105240_10091837 Ga0105240_100918373 314
35 3300025913 Ga0207695_10266506 Ga0207695_102665061 314
36 3300005435 Ga0070714_100335790 Ga0070714_1003357902 317
37 3300014326 Ga0157380_10010057 Ga0157380_100100575 317
38 3300044712 Ga0453684_0220420 Ga0453684_0220420_20_973 317
39 3300050515 nmdc:mga0a205_200403_c1 nmdc:mga0a205_200403_c1_909_1862 317
40 3300005440 Ga0070705_100003937 Ga0070705_1000039373 318
41 3300005444 Ga0070694_100013258 Ga0070694_1000132582 318
42 3300005546 Ga0070696_100007001 Ga0070696_1000070013 318
43 3300005549 Ga0070704_100005092 Ga0070704_1000050922 318
44 3300005577 Ga0068857_100034346 Ga0068857_1000343463 318
45 3300009098 Ga0105245_10157598 Ga0105245_101575982 318
46 3300026116 Ga0207674_10412978 Ga0207674_104129782 318
47 3300006880 Ga0075429_100171528 Ga0075429_1001715282 319
48 3300025938 Ga0207704_10174750 Ga0207704_101747502 319
49 3300050508 nmdc:mga09592_38585_c1 nmdc:mga09592_38585_c1_2630_3634 319
50 3300036647 Ga0316582_0060036 Ga0316582_0060036_1014_2018 322
51 3300044712 Ga0453684_0059795 Ga0453684_0059795_1481_2452 322
52 3300049571 Ga0501034_0067510 Ga0501034_0067510_23_997 323
53 3300049574 Ga0501038_0008020 Ga0501038_0008020_2172_3143 323
54 3300049581 Ga0501047_0218883 Ga0501047_0218883_130_1104 323
55 3300050507 nmdc:mga05p37_158261_c1 nmdc:mga05p37_158261_c1_418_1389 323
56 3300005327 Ga0070658_10023980 Ga0070658_100239802 324
57 3300005329 Ga0070683_100286184 Ga0070683_1002861842 324
58 3300005336 Ga0070680_100014282 Ga0070680_1000142823 324
59 3300005339 Ga0070660_100032099 Ga0070660_1000320992 324
60 3300005458 Ga0070681_10001428 Ga0070681_1000142811 324
61 3300005530 Ga0070679_100000282 Ga0070679_1000002823 324
62 3300005563 Ga0068855_100015371 Ga0068855_1000153713 324
63 3300005577 Ga0068857_100125106 Ga0068857_1001251063 324
64 3300005614 Ga0068856_100025278 Ga0068856_1000252782 324
65 3300005616 Ga0068852_100017737 Ga0068852_1000177374 324
66 3300009093 Ga0105240_10000077 Ga0105240_10000077116 324
67 3300009551 Ga0105238_10002900 Ga0105238_100029002 324
68 3300013104 Ga0157370_10003878 Ga0157370_100038788 324
69 3300013105 Ga0157369_10065249 Ga0157369_100652493 324
70 3300013307 Ga0157372_10037252 Ga0157372_100372525 324
71 3300025912 Ga0207707_10012176 Ga0207707_1001217610 324
72 3300025913 Ga0207695_10000707 Ga0207695_1000070713 324
73 3300025917 Ga0207660_10101539 Ga0207660_101015392 324
74 3300025919 Ga0207657_10011469 Ga0207657_100114694 324
75 3300025924 Ga0207694_10014641 Ga0207694_100146412 324
76 3300025949 Ga0207667_10000123 Ga0207667_1000012389 324
77 3300026078 Ga0207702_10085261 Ga0207702_100852611 324
78 3300026116 Ga0207674_10038045 Ga0207674_100380452 324
79 3300026142 Ga0207698_10009699 Ga0207698_100096997 324
80 3300042876 Ga0451577_0018124 Ga0451577_0018124_4596_5633 324
81 3300044673 Ga0453683_0000638 Ga0453683_0000638_8768_9811 324
82 3300044673 Ga0453683_0027971 Ga0453683_0027971_312_1355 324
83 3300044712 Ga0453684_0000920 Ga0453684_0000920_54030_55067 324
84 3300044712 Ga0453684_0324172 Ga0453684_0324172_548_1591 324
85 3300045051 Ga0451576_0001255 Ga0451576_0001255_300_1343 324
86 3300045051 Ga0451576_0002597 Ga0451576_0002597_8925_9968 324
87 3300047315 Ga0495581_0028058 Ga0495581_0028058_1936_2910 324
88 3300005347 Ga0070668_100167284 Ga0070668_1001672841 325
89 3300005457 Ga0070662_100161021 Ga0070662_1001610212 325
90 3300025972 Ga0207668_10247760 Ga0207668_102477601 325
91 3300045051 Ga0451576_0300576 Ga0451576_0300576_482_1459 325
92 3300005356 Ga0070674_100001100 Ga0070674_10000110011 326
93 3300005456 Ga0070678_100012161 Ga0070678_1000121613 326
94 3300025937 Ga0207669_10002002 Ga0207669_100020027 326
95 3300026121 Ga0207683_10060910 Ga0207683_100609103 326
96 3300031712 Ga0265342_10011353 Ga0265342_100113532 326
97 3300025925 Ga0207650_10263554 Ga0207650_102635541 327
98 3300005616 Ga0068852_100505167 Ga0068852_1005051671 328
99 3300009177 Ga0105248_10437012 Ga0105248_104370121 328
100 3300013102 Ga0157371_10005555 Ga0157371_100055559 328
101 3300013102 Ga0157371_10016619 Ga0157371_100166197 328
102 3300036712 Ga0316584_0044280 Ga0316584_0044280_248_1240 328
103 3300039062 Ga0400483_004982 Ga0400483_004982_5404_6390 328
104 3300039062 Ga0400483_240193 Ga0400483_240193_4169_5155 328
105 3300049669 Ga0501235_032728 Ga0501235_032728_75_1061 328
106 3300003323 rootH1_10224381 rootH1_102243813 329
107 3300005293 Ga0065715_10091017 Ga0065715_100910173 329
108 3300005347 Ga0070668_100078190 Ga0070668_1000781902 329
109 3300005457 Ga0070662_100192912 Ga0070662_1001929122 329
110 3300005719 Ga0068861_100049891 Ga0068861_1000498912 329
111 3300006844 Ga0075428_100073296 Ga0075428_1000732962 329
112 3300006846 Ga0075430_100004095 Ga0075430_1000040958 329
113 3300006852 Ga0075433_10016769 Ga0075433_100167692 329
114 3300007076 Ga0075435_100008999 Ga0075435_1000089995 329
115 3300009094 Ga0111539_10222023 Ga0111539_102220231 329
116 3300009553 Ga0105249_10003348 Ga0105249_100033487 329
117 3300009553 Ga0105249_10470380 Ga0105249_104703802 329
118 3300014326 Ga0157380_10031371 Ga0157380_100313712 329
119 3300025933 Ga0207706_10422490 Ga0207706_104224902 329
120 3300025961 Ga0207712_10343925 Ga0207712_103439251 329
121 3300026118 Ga0207675_100034625 Ga0207675_1000346252 329
122 3300031249 Ga0265339_10047392 Ga0265339_100473922 329
123 3300031344 Ga0265316_10001391 Ga0265316_1000139117 329
124 3300031548 Ga0307408_100028500 Ga0307408_1000285003 329
125 3300031595 Ga0265313_10009568 Ga0265313_100095685 329
126 3300031727 Ga0316576_10002147 Ga0316576_100021474 329
127 3300031727 Ga0316576_10022143 Ga0316576_100221432 329
128 3300031733 Ga0316577_10012664 Ga0316577_100126644 329
129 3300032126 Ga0307415_100215914 Ga0307415_1002159142 329
130 3300035398 Ga0316574_0021255 Ga0316574_0021255_1507_2502 329
131 3300036647 Ga0316582_0009672 Ga0316582_0009672_1405_2400 329
132 3300036712 Ga0316584_0031833 Ga0316584_0031833_1313_2308 329
133 3300042001 Ga0439441_011222 Ga0439441_011222_58_1065 329
134 3300042876 Ga0451577_0115455 Ga0451577_0115455_846_1835 329
135 3300044712 Ga0453684_0089786 Ga0453684_0089786_1236_2225 329
136 3300045051 Ga0451576_0167137 Ga0451576_0167137_122_1117 329
137 3300045051 Ga0451576_0412029 Ga0451576_0412029_174_1163 329
138 3300049592 Ga0501076_0334750 Ga0501076_0334750_107_1144 329
139 3300049593 Ga0501077_0148306 Ga0501077_0148306_47_1084 329
140 3300050509 nmdc:mga0qj67_1379_c1 nmdc:mga0qj67_1379_c1_61_1062 329
141 3300050513 nmdc:mga0rr50_39343_c1 nmdc:mga0rr50_39343_c1_560_1558 329
142 3300050515 nmdc:mga0a205_59859_c1 nmdc:mga0a205_59859_c1_2317_3315 329
143 2162886012 MBSR1b_contig_601673 MBSR1b_0180.00007290 330
144 3300002239 JGI24034J26672_10005904 JGI24034J26672_100059041 330
145 3300005290 Ga0065712_10071124 Ga0065712_100711243 330
146 3300005293 Ga0065715_10003747 Ga0065715_100037475 330
147 3300005327 Ga0070658_10363036 Ga0070658_103630362 330
148 3300005329 Ga0070683_100005766 Ga0070683_1000057666 330
149 3300005330 Ga0070690_100023500 Ga0070690_1000235002 330
150 3300005330 Ga0070690_100204621 Ga0070690_1002046212 330
151 3300005334 Ga0068869_100057516 Ga0068869_1000575162 330
152 3300005334 Ga0068869_100169852 Ga0068869_1001698522 330
153 3300005335 Ga0070666_10093592 Ga0070666_100935921 330
154 3300005340 Ga0070689_100300757 Ga0070689_1003007571 330
155 3300005344 Ga0070661_100104999 Ga0070661_1001049991 330
156 3300005347 Ga0070668_100229670 Ga0070668_1002296702 330
157 3300005353 Ga0070669_100072167 Ga0070669_1000721672 330
158 3300005364 Ga0070673_100014452 Ga0070673_1000144522 330
159 3300005436 Ga0070713_100000174 Ga0070713_10000017423 330
160 3300005438 Ga0070701_10050367 Ga0070701_100503672 330
161 3300005459 Ga0068867_100138575 Ga0068867_1001385752 330
162 3300005466 Ga0070685_10032777 Ga0070685_100327772 330
163 3300005543 Ga0070672_100087133 Ga0070672_1000871332 330
164 3300005544 Ga0070686_100032724 Ga0070686_1000327242 330
165 3300005546 Ga0070696_100203446 Ga0070696_1002034462 330
166 3300005548 Ga0070665_100121976 Ga0070665_1001219762 330
167 3300005577 Ga0068857_100035684 Ga0068857_1000356842 330
168 3300005577 Ga0068857_100323491 Ga0068857_1003234911 330
169 3300005578 Ga0068854_100052719 Ga0068854_1000527192 330
170 3300005614 Ga0068856_100223372 Ga0068856_1002233721 330
171 3300005616 Ga0068852_100124042 Ga0068852_1001240422 330
172 3300005616 Ga0068852_100229912 Ga0068852_1002299122 330
173 3300005617 Ga0068859_100002655 Ga0068859_1000026554 330
174 3300005617 Ga0068859_100477341 Ga0068859_1004773412 330
175 3300005618 Ga0068864_100120999 Ga0068864_1001209992 330
176 3300005618 Ga0068864_100276860 Ga0068864_1002768602 330
177 3300005719 Ga0068861_100071782 Ga0068861_1000717822 330
178 3300005719 Ga0068861_100108277 Ga0068861_1001082773 330
179 3300005834 Ga0068851_10072590 Ga0068851_100725902 330
180 3300005842 Ga0068858_100092441 Ga0068858_1000924412 330
181 3300005842 Ga0068858_100148194 Ga0068858_1001481941 330
182 3300005842 Ga0068858_100230606 Ga0068858_1002306062 330
183 3300005842 Ga0068858_100238369 Ga0068858_1002383692 330
184 3300005842 Ga0068858_100360710 Ga0068858_1003607102 330
185 3300005844 Ga0068862_100260961 Ga0068862_1002609612 330
186 3300006358 Ga0068871_100231310 Ga0068871_1002313102 330
187 3300006846 Ga0075430_100114798 Ga0075430_1001147984 330
188 3300006880 Ga0075429_100244645 Ga0075429_1002446451 330
189 3300006931 Ga0097620_100002655 Ga0097620_1000026559 330
190 3300006931 Ga0097620_100477360 Ga0097620_1004773602 330
191 3300009093 Ga0105240_10650306 Ga0105240_106503061 330
192 3300009094 Ga0111539_10198342 Ga0111539_101983422 330
193 3300009094 Ga0111539_10512008 Ga0111539_105120082 330
194 3300009147 Ga0114129_10309765 Ga0114129_103097651 330
195 3300009177 Ga0105248_10001800 Ga0105248_100018008 330
196 3300010375 Ga0105239_10388124 Ga0105239_103881242 330
197 3300013296 Ga0157374_10582203 Ga0157374_105822031 330
198 3300013297 Ga0157378_10065533 Ga0157378_100655332 330
199 3300013306 Ga0163162_10080001 Ga0163162_100800012 330
200 3300013306 Ga0163162_10195287 Ga0163162_101952872 330
201 3300013308 Ga0157375_10014359 Ga0157375_100143592 330
202 3300013308 Ga0157375_10398202 Ga0157375_103982022 330
203 3300014325 Ga0163163_10035662 Ga0163163_100356622 330
204 3300014325 Ga0163163_10043777 Ga0163163_100437773 330
205 3300014745 Ga0157377_10062622 Ga0157377_100626222 330
206 3300014968 Ga0157379_10213457 Ga0157379_102134572 330
207 3300025315 Ga0207697_10001005 Ga0207697_1000100513 330
208 3300025893 Ga0207682_10001037 Ga0207682_100010372 330
209 3300025901 Ga0207688_10036956 Ga0207688_100369561 330
210 3300025907 Ga0207645_10008205 Ga0207645_100082051 330
211 3300025908 Ga0207643_10014699 Ga0207643_100146992 330
212 3300025918 Ga0207662_10009332 Ga0207662_100093322 330
213 3300025919 Ga0207657_10014078 Ga0207657_100140785 330
214 3300025920 Ga0207649_10007401 Ga0207649_100074012 330
215 3300025923 Ga0207681_10099318 Ga0207681_100993183 330
216 3300025925 Ga0207650_10002835 Ga0207650_100028357 330
217 3300025926 Ga0207659_10050486 Ga0207659_100504863 330
218 3300025928 Ga0207700_10000283 Ga0207700_1000028310 330
219 3300025931 Ga0207644_10002100 Ga0207644_100021005 330
220 3300025933 Ga0207706_10026871 Ga0207706_100268712 330
221 3300025936 Ga0207670_10115971 Ga0207670_101159711 330
222 3300025940 Ga0207691_10182012 Ga0207691_101820122 330
223 3300025941 Ga0207711_10005683 Ga0207711_100056835 330
224 3300025941 Ga0207711_10083621 Ga0207711_100836212 330
225 3300025942 Ga0207689_10004120 Ga0207689_100041208 330
226 3300025942 Ga0207689_10399250 Ga0207689_103992501 330
227 3300025944 Ga0207661_10162200 Ga0207661_101622002 330
228 3300025960 Ga0207651_10004652 Ga0207651_100046523 330
229 3300025986 Ga0207658_10158118 Ga0207658_101581181 330
230 3300026035 Ga0207703_10055430 Ga0207703_100554302 330
231 3300026035 Ga0207703_10285339 Ga0207703_102853392 330
232 3300026067 Ga0207678_10002154 Ga0207678_100021548 330
233 3300026075 Ga0207708_10042425 Ga0207708_100424252 330
234 3300026095 Ga0207676_10243096 Ga0207676_102430962 330
235 3300026095 Ga0207676_10258613 Ga0207676_102586131 330
236 3300026116 Ga0207674_10007120 Ga0207674_100071202 330
237 3300026118 Ga0207675_100002285 Ga0207675_10000228512 330
238 3300026118 Ga0207675_100282810 Ga0207675_1002828103 330
239 3300026121 Ga0207683_10109140 Ga0207683_101091402 330
240 3300026142 Ga0207698_10367444 Ga0207698_103674442 330
241 3300027682 Ga0209971_1023048 Ga0209971_10230482 330
242 3300027876 Ga0209974_10008493 Ga0209974_100084934 330
243 3300027907 Ga0207428_10217621 Ga0207428_102176212 330
244 3300028379 Ga0268266_10037502 Ga0268266_100375021 330
245 3300028381 Ga0268264_10249167 Ga0268264_102491672 330
246 3300028563 Ga0265319_1000487 Ga0265319_10004878 330
247 3300028563 Ga0265319_1004533 Ga0265319_10045332 330
248 3300028563 Ga0265319_1008838 Ga0265319_10088382 330
249 3300028577 Ga0265318_10000369 Ga0265318_1000036917 330
250 3300028577 Ga0265318_10007193 Ga0265318_100071932 330
251 3300028666 Ga0265336_10002155 Ga0265336_100021557 330
252 3300028800 Ga0265338_10006524 Ga0265338_100065242 330
253 3300031240 Ga0265320_10001956 Ga0265320_100019567 330
254 3300031240 Ga0265320_10002237 Ga0265320_100022375 330
255 3300031240 Ga0265320_10002575 Ga0265320_100025755 330
256 3300031240 Ga0265320_10003710 Ga0265320_100037108 330
257 3300031240 Ga0265320_10055189 Ga0265320_100551892 330
258 3300031242 Ga0265329_10035888 Ga0265329_100358882 330
259 3300031251 Ga0265327_10000029 Ga0265327_1000002942 330
260 3300031251 Ga0265327_10002947 Ga0265327_100029478 330
261 3300031251 Ga0265327_10011290 Ga0265327_100112903 330
262 3300031344 Ga0265316_10006013 Ga0265316_100060133 330
263 3300031344 Ga0265316_10050188 Ga0265316_100501882 330
264 3300031595 Ga0265313_10020761 Ga0265313_100207612 330
265 3300031595 Ga0265313_10030763 Ga0265313_100307632 330
266 3300031711 Ga0265314_10001590 Ga0265314_100015908 330
267 3300031711 Ga0265314_10125242 Ga0265314_101252422 330
268 3300031712 Ga0265342_10040853 Ga0265342_100408532 330
269 3300031727 Ga0316576_10021570 Ga0316576_100215702 330
270 3300031731 Ga0307405_10027977 Ga0307405_100279772 330
271 3300031733 Ga0316577_10008449 Ga0316577_100084492 330
272 3300031733 Ga0316577_10042730 Ga0316577_100427302 330
273 3300032168 Ga0316593_10033691 Ga0316593_100336912 330
274 3300035172 Ga0373955_0091664 Ga0373955_0091664_218_1210 330
275 3300035398 Ga0316574_0076663 Ga0316574_0076663_107_1099 330
276 3300035692 Ga0373935_0020484 Ga0373935_0020484_1088_2080 330
277 3300036401 Ga0373937_0263188 Ga0373937_0263188_434_1438 330
278 3300036712 Ga0316584_0005315 Ga0316584_0005315_701_1693 330
279 3300042876 Ga0451577_0298148 Ga0451577_0298148_343_1335 330
280 3300044712 Ga0453684_0003020 Ga0453684_0003020_4074_5066 330
281 3300046459 Ga0495629_0000018 Ga0495629_0000018_80261_81253 330
282 3300046472 Ga0495580_0099393 Ga0495580_0099393_171_1163 330
283 3300046473 Ga0495582_0001254 Ga0495582_0001254_7790_8782 330
284 3300046475 Ga0495639_0007935 Ga0495639_0007935_1891_2883 330
285 3300046517 Ga0495630_0166578 Ga0495630_0166578_389_1393 330
286 3300046533 Ga0495640_0075761 Ga0495640_0075761_272_1264 330
287 3300046539 Ga0495621_0011910 Ga0495621_0011910_1355_2362 330
288 3300046663 Ga0495635_0000069 Ga0495635_0000069_24679_25671 330
289 3300046681 Ga0495647_0002903 Ga0495647_0002903_3574_4566 330
290 3300046683 Ga0495658_0000471 Ga0495658_0000471_4099_5091 330
291 3300046689 Ga0495613_0005080 Ga0495613_0005080_7247_8239 330
292 3300047315 Ga0495581_0005351 Ga0495581_0005351_317_1309 330
293 3300047319 Ga0495674_0219764 Ga0495674_0219764_401_1405 330
294 3300047322 Ga0495680_0000044 Ga0495680_0000044_46660_47652 330
295 3300047673 Ga0495593_0093043 Ga0495593_0093043_127_1119 330
296 3300048089 Ga0495614_0018343 Ga0495614_0018343_674_1666 330
297 3300048907 Ga0496104_0017902 Ga0496104_0017902_4524_5531 330
298 3300048908 Ga0496105_0014830 Ga0496105_0014830_2119_3126 330
299 3300048909 Ga0496106_0143195 Ga0496106_0143195_99_1106 330
300 3300048911 Ga0496108_0013093 Ga0496108_0013093_5676_6683 330
301 3300048912 Ga0496109_0004542 Ga0496109_0004542_1778_2785 330
302 3300048912 Ga0496109_0302331 Ga0496109_0302331_44_1051 330
303 3300048913 Ga0496110_0027451 Ga0496110_0027451_2788_3795 330
304 3300048917 Ga0496114_0008657 Ga0496114_0008657_931_1938 330
305 3300049581 Ga0501047_0350148 Ga0501047_0350148_239_1231 330
306 3300049587 Ga0501071_0037531 Ga0501071_0037531_1979_3013 330
307 3300049741 Ga0501079_0132449 Ga0501079_0132449_250_1284 330
308 3300049742 Ga0501080_0246615 Ga0501080_0246615_78_1076 330
309 3300049824 Ga0501045_0169444 Ga0501045_0169444_476_1510 330
310 3300050511 nmdc:mga08y16_102720_c1 nmdc:mga08y16_102720_c1_1164_2156 330
311 3300050511 nmdc:mga08y16_178706_c1 nmdc:mga08y16_178706_c1_345_1352 330
312 3300053085 Ga0495619_0003782 Ga0495619_0003782_603_1595 330
313 3300005334 Ga0068869_100083554 Ga0068869_1000835543 331
314 3300005343 Ga0070687_100113034 Ga0070687_1001130342 331
315 3300005353 Ga0070669_100106929 Ga0070669_1001069293 331
316 3300005365 Ga0070688_100017343 Ga0070688_1000173432 331
317 3300005438 Ga0070701_10073707 Ga0070701_100737072 331
318 3300005439 Ga0070711_100000867 Ga0070711_1000008672 331
319 3300005441 Ga0070700_100225792 Ga0070700_1002257922 331
320 3300005457 Ga0070662_100195726 Ga0070662_1001957262 331
321 3300005459 Ga0068867_100021999 Ga0068867_1000219992 331
322 3300005543 Ga0070672_100066428 Ga0070672_1000664282 331
323 3300005543 Ga0070672_100245107 Ga0070672_1002451072 331
324 3300005545 Ga0070695_100075331 Ga0070695_1000753312 331
325 3300005547 Ga0070693_100021826 Ga0070693_1000218262 331
326 3300005617 Ga0068859_100037039 Ga0068859_1000370392 331
327 3300005840 Ga0068870_10128420 Ga0068870_101284202 331
328 3300005841 Ga0068863_100445652 Ga0068863_1004456522 331
329 3300005844 Ga0068862_100111420 Ga0068862_1001114201 331
330 3300005844 Ga0068862_100205667 Ga0068862_1002056673 331
331 3300006173 Ga0070716_100023651 Ga0070716_1000236512 331
332 3300006175 Ga0070712_100001352 Ga0070712_10000135219 331
333 3300006237 Ga0097621_100272221 Ga0097621_1002722212 331
334 3300006880 Ga0075429_100192801 Ga0075429_1001928012 331
335 3300006931 Ga0097620_100037038 Ga0097620_1000370384 331
336 3300009093 Ga0105240_10504323 Ga0105240_105043231 331
337 3300009094 Ga0111539_10101956 Ga0111539_101019562 331
338 3300009147 Ga0114129_10146958 Ga0114129_101469582 331
339 3300009147 Ga0114129_10446551 Ga0114129_104465512 331
340 3300009177 Ga0105248_10308455 Ga0105248_103084552 331
341 3300009177 Ga0105248_10450867 Ga0105248_104508671 331
342 3300013308 Ga0157375_10137877 Ga0157375_101378772 331
343 3300013308 Ga0157375_10168495 Ga0157375_101684952 331
344 3300013308 Ga0157375_10251425 Ga0157375_102514251 331
345 3300024225 Ga0224572_1022753 Ga0224572_10227531 331
346 3300025908 Ga0207643_10165265 Ga0207643_101652652 331
347 3300025915 Ga0207693_10001541 Ga0207693_100015412 331
348 3300025921 Ga0207652_10158373 Ga0207652_101583732 331
349 3300025923 Ga0207681_10009177 Ga0207681_100091772 331
350 3300025931 Ga0207644_10054347 Ga0207644_100543473 331
351 3300025939 Ga0207665_10011206 Ga0207665_100112062 331
352 3300025940 Ga0207691_10204794 Ga0207691_102047942 331
353 3300025941 Ga0207711_10319379 Ga0207711_103193792 331
354 3300025942 Ga0207689_10109215 Ga0207689_101092153 331
355 3300025960 Ga0207651_10140278 Ga0207651_101402782 331
356 3300026075 Ga0207708_10108170 Ga0207708_101081702 331
357 3300026088 Ga0207641_10412909 Ga0207641_104129092 331
358 3300026089 Ga0207648_10241084 Ga0207648_102410842 331
359 3300026118 Ga0207675_100022449 Ga0207675_1000224492 331
360 3300028380 Ga0268265_10577518 Ga0268265_105775181 331
361 3300033528 Ga0316588_1046288 Ga0316588_10462881 331
362 3300033541 Ga0316596_1001557 Ga0316596_10015571 331
363 3300044712 Ga0453684_0000627 Ga0453684_0000627_84535_85530 331
364 3300044712 Ga0453684_0001422 Ga0453684_0001422_52581_53576 331
365 3300044712 Ga0453684_0003787 Ga0453684_0003787_342_1337 331
366 3300044712 Ga0453684_0199884 Ga0453684_0199884_41_1078 331
367 3300045051 Ga0451576_0031990 Ga0451576_0031990_4461_5456 331
368 3300045976 Ga0466967_0117712 Ga0466967_0117712_628_1644 331
369 3300046472 Ga0495580_0053667 Ga0495580_0053667_1572_2597 331
370 3300046536 Ga0495587_0004841 Ga0495587_0004841_2836_3849 331
371 3300047319 Ga0495674_0313189 Ga0495674_0313189_14_1039 331
372 3300049576 Ga0501040_0072231 Ga0501040_0072231_652_1653 331
373 3300049588 Ga0501072_0038846 Ga0501072_0038846_938_1939 331
374 3300049741 Ga0501079_0135906 Ga0501079_0135906_882_1883 331
375 3300049742 Ga0501080_0115502 Ga0501080_0115502_61_1062 331
376 3300049743 Ga0501081_0019178 Ga0501081_0019178_421_1422 331
377 3300049744 Ga0501083_0179804 Ga0501083_0179804_328_1329 331
378 3300050507 nmdc:mga05p37_161921_c2 nmdc:mga05p37_161921_c2_559_1554 331
379 3300050507 nmdc:mga05p37_437457_c1 nmdc:mga05p37_437457_c1_353_1387 331
380 3300050508 nmdc:mga09592_130481_c2 nmdc:mga09592_130481_c2_113_1147 331
381 3300050510 nmdc:mga06r32_157174_c1 nmdc:mga06r32_157174_c1_149_1162 331
382 3300054114 Ga0501084_0036414 Ga0501084_0036414_2503_3504 331
383 3300061734 Ga0530510_0040752 Ga0530510_0040752_1735_2736 331
384 2162886007 SwRhRL2b_contig_652773 SwRhRL2b_0752.00004570 332
385 3300001979 JGI24740J21852_10049521 JGI24740J21852_100495212 332
386 3300005290 Ga0065712_10046738 Ga0065712_100467381 332
387 3300005327 Ga0070658_10034204 Ga0070658_100342042 332
388 3300005329 Ga0070683_100004370 Ga0070683_1000043702 332
389 3300005329 Ga0070683_100007607 Ga0070683_1000076075 332
390 3300005329 Ga0070683_100056213 Ga0070683_1000562135 332
391 3300005329 Ga0070683_100094743 Ga0070683_1000947432 332
392 3300005329 Ga0070683_100262099 Ga0070683_1002620992 332
393 3300005331 Ga0070670_100105102 Ga0070670_1001051022 332
394 3300005334 Ga0068869_100017812 Ga0068869_1000178122 332
395 3300005334 Ga0068869_100042553 Ga0068869_1000425532 332
396 3300005334 Ga0068869_100144681 Ga0068869_1001446812 332
397 3300005337 Ga0070682_100034532 Ga0070682_1000345321 332
398 3300005337 Ga0070682_100053662 Ga0070682_1000536622 332
399 3300005338 Ga0068868_100015082 Ga0068868_1000150822 332
400 3300005338 Ga0068868_100021815 Ga0068868_1000218152 332
401 3300005339 Ga0070660_100301746 Ga0070660_1003017462 332
402 3300005340 Ga0070689_100000419 Ga0070689_1000004192 332
403 3300005344 Ga0070661_100027236 Ga0070661_1000272362 332
404 3300005344 Ga0070661_100194398 Ga0070661_1001943981 332
405 3300005345 Ga0070692_10117023 Ga0070692_101170231 332
406 3300005347 Ga0070668_100036615 Ga0070668_1000366152 332
407 3300005353 Ga0070669_100090563 Ga0070669_1000905631 332
408 3300005355 Ga0070671_100011927 Ga0070671_1000119272 332
409 3300005355 Ga0070671_100017015 Ga0070671_1000170152 332
410 3300005364 Ga0070673_100031142 Ga0070673_1000311421 332
411 3300005364 Ga0070673_100057376 Ga0070673_1000573762 332
412 3300005366 Ga0070659_100043648 Ga0070659_1000436482 332
413 3300005366 Ga0070659_100118024 Ga0070659_1001180242 332
414 3300005366 Ga0070659_100169346 Ga0070659_1001693461 332
415 3300005367 Ga0070667_100153681 Ga0070667_1001536812 332
416 3300005406 Ga0070703_10002794 Ga0070703_100027942 332
417 3300005436 Ga0070713_100047339 Ga0070713_1000473392 332
418 3300005436 Ga0070713_100114312 Ga0070713_1001143122 332
419 3300005436 Ga0070713_100162738 Ga0070713_1001627382 332
420 3300005436 Ga0070713_100173904 Ga0070713_1001739042 332
421 3300005438 Ga0070701_10046427 Ga0070701_100464271 332
422 3300005439 Ga0070711_100051367 Ga0070711_1000513672 332
423 3300005440 Ga0070705_100014354 Ga0070705_1000143543 332
424 3300005440 Ga0070705_100157900 Ga0070705_1001579001 332
425 3300005440 Ga0070705_100206242 Ga0070705_1002062421 332
426 3300005441 Ga0070700_100000048 Ga0070700_10000004874 332
427 3300005441 Ga0070700_100013640 Ga0070700_1000136404 332
428 3300005441 Ga0070700_100032002 Ga0070700_1000320022 332
429 3300005444 Ga0070694_100148928 Ga0070694_1001489282 332
430 3300005455 Ga0070663_100144797 Ga0070663_1001447972 332
431 3300005458 Ga0070681_10001179 Ga0070681_1000117918 332
432 3300005458 Ga0070681_10097768 Ga0070681_100977682 332
433 3300005458 Ga0070681_10262387 Ga0070681_102623872 332
434 3300005467 Ga0070706_100238941 Ga0070706_1002389412 332
435 3300005518 Ga0070699_100190757 Ga0070699_1001907572 332
436 3300005530 Ga0070679_100004238 Ga0070679_1000042385 332
437 3300005530 Ga0070679_100182498 Ga0070679_1001824982 332
438 3300005535 Ga0070684_100001487 Ga0070684_10000148714 332
439 3300005535 Ga0070684_100019174 Ga0070684_1000191742 332
440 3300005535 Ga0070684_100019798 Ga0070684_1000197982 332
441 3300005535 Ga0070684_100045982 Ga0070684_1000459822 332
442 3300005535 Ga0070684_100089992 Ga0070684_1000899922 332
443 3300005535 Ga0070684_100243401 Ga0070684_1002434012 332
444 3300005535 Ga0070684_100258961 Ga0070684_1002589612 332
445 3300005535 Ga0070684_100278697 Ga0070684_1002786972 332
446 3300005539 Ga0068853_100000527 Ga0068853_10000052710 332
447 3300005539 Ga0068853_100009875 Ga0068853_1000098755 332
448 3300005539 Ga0068853_100015941 Ga0068853_1000159412 332
449 3300005539 Ga0068853_100118867 Ga0068853_1001188672 332
450 3300005539 Ga0068853_100192477 Ga0068853_1001924772 332
451 3300005539 Ga0068853_100324093 Ga0068853_1003240931 332
452 3300005539 Ga0068853_100411846 Ga0068853_1004118462 332
453 3300005545 Ga0070695_100173099 Ga0070695_1001730992 332
454 3300005546 Ga0070696_100289502 Ga0070696_1002895021 332
455 3300005547 Ga0070693_100000797 Ga0070693_1000007978 332
456 3300005548 Ga0070665_100005415 Ga0070665_1000054156 332
457 3300005548 Ga0070665_100039360 Ga0070665_1000393603 332
458 3300005548 Ga0070665_100180386 Ga0070665_1001803862 332
459 3300005563 Ga0068855_100008707 Ga0068855_1000087072 332
460 3300005563 Ga0068855_100029282 Ga0068855_1000292823 332
461 3300005563 Ga0068855_100043128 Ga0068855_1000431282 332
462 3300005563 Ga0068855_100053805 Ga0068855_1000538054 332
463 3300005563 Ga0068855_100110332 Ga0068855_1001103322 332
464 3300005563 Ga0068855_100216870 Ga0068855_1002168702 332
465 3300005564 Ga0070664_100000979 Ga0070664_10000097919 332
466 3300005564 Ga0070664_100115108 Ga0070664_1001151082 332
467 3300005564 Ga0070664_100187255 Ga0070664_1001872552 332
468 3300005577 Ga0068857_100000681 Ga0068857_1000006812 332
469 3300005577 Ga0068857_100000870 Ga0068857_10000087012 332
470 3300005577 Ga0068857_100001403 Ga0068857_1000014037 332
471 3300005577 Ga0068857_100014630 Ga0068857_1000146302 332
472 3300005577 Ga0068857_100052200 Ga0068857_1000522002 332
473 3300005577 Ga0068857_100345503 Ga0068857_1003455031 332
474 3300005578 Ga0068854_100016541 Ga0068854_1000165412 332
475 3300005614 Ga0068856_100010085 Ga0068856_1000100856 332
476 3300005614 Ga0068856_100010319 Ga0068856_1000103193 332
477 3300005614 Ga0068856_100043012 Ga0068856_1000430122 332
478 3300005614 Ga0068856_100166164 Ga0068856_1001661642 332
479 3300005614 Ga0068856_100179327 Ga0068856_1001793271 332
480 3300005615 Ga0070702_100197601 Ga0070702_1001976011 332
481 3300005616 Ga0068852_100000003 Ga0068852_10000000350 332
482 3300005616 Ga0068852_100000341 Ga0068852_10000034119 332
483 3300005616 Ga0068852_100043024 Ga0068852_1000430242 332
484 3300005616 Ga0068852_100213434 Ga0068852_1002134342 332
485 3300005616 Ga0068852_100264092 Ga0068852_1002640922 332
486 3300005616 Ga0068852_100276776 Ga0068852_1002767761 332
487 3300005617 Ga0068859_100004804 Ga0068859_1000048042 332
488 3300005617 Ga0068859_100073999 Ga0068859_1000739992 332
489 3300005617 Ga0068859_100081817 Ga0068859_1000818171 332
490 3300005617 Ga0068859_100090690 Ga0068859_1000906901 332
491 3300005617 Ga0068859_100105134 Ga0068859_1001051342 332
492 3300005617 Ga0068859_100163663 Ga0068859_1001636632 332
493 3300005617 Ga0068859_100225811 Ga0068859_1002258112 332
494 3300005617 Ga0068859_100316950 Ga0068859_1003169502 332
495 3300005618 Ga0068864_100009115 Ga0068864_1000091152 332
496 3300005618 Ga0068864_100057042 Ga0068864_1000570422 332
497 3300005618 Ga0068864_100067133 Ga0068864_1000671333 332
498 3300005618 Ga0068864_100070413 Ga0068864_1000704132 332
499 3300005618 Ga0068864_100175032 Ga0068864_1001750322 332
500 3300005618 Ga0068864_100391067 Ga0068864_1003910671 332
501 3300005719 Ga0068861_100113100 Ga0068861_1001131002 332
502 3300005719 Ga0068861_100160688 Ga0068861_1001606882 332
503 3300005834 Ga0068851_10000999 Ga0068851_100009998 332
504 3300005834 Ga0068851_10006100 Ga0068851_100061003 332
505 3300005834 Ga0068851_10006394 Ga0068851_100063942 332
506 3300005834 Ga0068851_10030944 Ga0068851_100309442 332
507 3300005840 Ga0068870_10053498 Ga0068870_100534982 332
508 3300005840 Ga0068870_10205480 Ga0068870_102054801 332
509 3300005841 Ga0068863_100001291 Ga0068863_10000129113 332
510 3300005841 Ga0068863_100039664 Ga0068863_1000396643 332
511 3300005841 Ga0068863_100048139 Ga0068863_1000481392 332
512 3300005841 Ga0068863_100163812 Ga0068863_1001638122 332
513 3300005842 Ga0068858_100124770 Ga0068858_1001247702 332
514 3300005842 Ga0068858_100156523 Ga0068858_1001565232 332
515 3300005843 Ga0068860_100020939 Ga0068860_1000209392 332
516 3300005843 Ga0068860_100086192 Ga0068860_1000861922 332
517 3300005843 Ga0068860_100246834 Ga0068860_1002468342 332
518 3300005843 Ga0068860_100370797 Ga0068860_1003707972 332
519 3300005844 Ga0068862_100240550 Ga0068862_1002405501 332
520 3300006028 Ga0070717_10011870 Ga0070717_100118702 332
521 3300006028 Ga0070717_10086684 Ga0070717_100866842 332
522 3300006173 Ga0070716_100142389 Ga0070716_1001423892 332
523 3300006175 Ga0070712_100095543 Ga0070712_1000955431 332
524 3300006237 Ga0097621_100004180 Ga0097621_1000041802 332
525 3300006237 Ga0097621_100005272 Ga0097621_1000052722 332
526 3300006237 Ga0097621_100017286 Ga0097621_1000172863 332
527 3300006237 Ga0097621_100040644 Ga0097621_1000406442 332
528 3300006358 Ga0068871_100006260 Ga0068871_1000062607 332
529 3300006358 Ga0068871_100021192 Ga0068871_1000211922 332
530 3300006358 Ga0068871_100030188 Ga0068871_1000301883 332
531 3300006358 Ga0068871_100232449 Ga0068871_1002324492 332
532 3300006844 Ga0075428_100082916 Ga0075428_1000829161 332
533 3300006844 Ga0075428_100202163 Ga0075428_1002021632 332
534 3300006846 Ga0075430_100029407 Ga0075430_1000294073 332
535 3300006847 Ga0075431_100104680 Ga0075431_1001046803 332
536 3300006852 Ga0075433_10225467 Ga0075433_102254672 332
537 3300006871 Ga0075434_100105754 Ga0075434_1001057542 332
538 3300006914 Ga0075436_100006092 Ga0075436_1000060924 332
539 3300006931 Ga0097620_100004805 Ga0097620_1000048052 332
540 3300006931 Ga0097620_100074004 Ga0097620_1000740042 332
541 3300006931 Ga0097620_100081816 Ga0097620_1000818161 332
542 3300006931 Ga0097620_100090700 Ga0097620_1000907001 332
543 3300006931 Ga0097620_100105132 Ga0097620_1001051322 332
544 3300006931 Ga0097620_100163670 Ga0097620_1001636702 332
545 3300006931 Ga0097620_100225815 Ga0097620_1002258152 332
546 3300006931 Ga0097620_100316969 Ga0097620_1003169692 332
547 3300009093 Ga0105240_10000114 Ga0105240_1000011434 332
548 3300009093 Ga0105240_10001213 Ga0105240_100012132 332
549 3300009093 Ga0105240_10010907 Ga0105240_1001090714 332
550 3300009093 Ga0105240_10014675 Ga0105240_100146754 332
551 3300009093 Ga0105240_10016545 Ga0105240_100165455 332
552 3300009093 Ga0105240_10030039 Ga0105240_100300394 332
553 3300009093 Ga0105240_10060412 Ga0105240_100604126 332
554 3300009093 Ga0105240_10094756 Ga0105240_100947562 332
555 3300009093 Ga0105240_10095421 Ga0105240_100954212 332
556 3300009093 Ga0105240_10425188 Ga0105240_104251881 332
557 3300009093 Ga0105240_10593883 Ga0105240_105938831 332
558 3300009094 Ga0111539_10152947 Ga0111539_101529472 332
559 3300009098 Ga0105245_10003452 Ga0105245_100034529 332
560 3300009098 Ga0105245_10067864 Ga0105245_100678642 332
561 3300009098 Ga0105245_10212210 Ga0105245_102122102 332
562 3300009101 Ga0105247_10001389 Ga0105247_100013892 332
563 3300009101 Ga0105247_10020805 Ga0105247_100208052 332
564 3300009101 Ga0105247_10039696 Ga0105247_100396962 332
565 3300009101 Ga0105247_10135107 Ga0105247_101351072 332
566 3300009148 Ga0105243_10352890 Ga0105243_103528902 332
567 3300009174 Ga0105241_10000112 Ga0105241_1000011246 332
568 3300009174 Ga0105241_10001115 Ga0105241_100011152 332
569 3300009174 Ga0105241_10023766 Ga0105241_100237661 332
570 3300009174 Ga0105241_10040087 Ga0105241_100400872 332
571 3300009174 Ga0105241_10059397 Ga0105241_100593972 332
572 3300009174 Ga0105241_10137621 Ga0105241_101376212 332
573 3300009176 Ga0105242_10101199 Ga0105242_101011992 332
574 3300009177 Ga0105248_10000432 Ga0105248_1000043210 332
575 3300009177 Ga0105248_10033471 Ga0105248_100334713 332
576 3300009177 Ga0105248_10033672 Ga0105248_100336723 332
577 3300009177 Ga0105248_10036277 Ga0105248_100362776 332
578 3300009177 Ga0105248_10086266 Ga0105248_100862662 332
579 3300009177 Ga0105248_10137095 Ga0105248_101370951 332
580 3300009177 Ga0105248_10607895 Ga0105248_106078952 332
581 3300009545 Ga0105237_10002295 Ga0105237_100022952 332
582 3300009545 Ga0105237_10003756 Ga0105237_100037566 332
583 3300009545 Ga0105237_10042887 Ga0105237_100428873 332
584 3300009545 Ga0105237_10086573 Ga0105237_100865732 332
585 3300009545 Ga0105237_10139014 Ga0105237_101390141 332
586 3300009545 Ga0105237_10140979 Ga0105237_101409792 332
587 3300009545 Ga0105237_10382646 Ga0105237_103826461 332
588 3300009551 Ga0105238_10000446 Ga0105238_1000044628 332
589 3300009551 Ga0105238_10001879 Ga0105238_100018794 332
590 3300009551 Ga0105238_10003133 Ga0105238_100031334 332
591 3300009551 Ga0105238_10027746 Ga0105238_100277463 332
592 3300009551 Ga0105238_10064721 Ga0105238_100647212 332
593 3300009551 Ga0105238_10071794 Ga0105238_100717942 332
594 3300009551 Ga0105238_10116338 Ga0105238_101163382 332
595 3300009551 Ga0105238_10186084 Ga0105238_101860842 332
596 3300009553 Ga0105249_10001827 Ga0105249_100018274 332
597 3300009553 Ga0105249_10121551 Ga0105249_101215512 332
598 3300009553 Ga0105249_10189851 Ga0105249_101898511 332
599 3300010375 Ga0105239_10005246 Ga0105239_100052467 332
600 3300010375 Ga0105239_10012072 Ga0105239_100120724 332
601 3300010375 Ga0105239_10016785 Ga0105239_100167852 332
602 3300010375 Ga0105239_10067036 Ga0105239_100670362 332
603 3300010375 Ga0105239_10109075 Ga0105239_101090753 332
604 3300010375 Ga0105239_10208483 Ga0105239_102084832 332
605 3300011119 Ga0105246_10002464 Ga0105246_1000246410 332
606 3300011119 Ga0105246_10013890 Ga0105246_100138902 332
607 3300011119 Ga0105246_10159104 Ga0105246_101591042 332
608 3300013100 Ga0157373_10023761 Ga0157373_100237611 332
609 3300013100 Ga0157373_10033812 Ga0157373_100338121 332
610 3300013100 Ga0157373_10136348 Ga0157373_101363482 332
611 3300013104 Ga0157370_10000001 Ga0157370_10000001396 332
612 3300013104 Ga0157370_10150110 Ga0157370_101501102 332
613 3300013104 Ga0157370_10402500 Ga0157370_104025001 332
614 3300013105 Ga0157369_10000066 Ga0157369_100000663 332
615 3300013105 Ga0157369_10004092 Ga0157369_100040929 332
616 3300013105 Ga0157369_10006435 Ga0157369_1000643516 332
617 3300013105 Ga0157369_10007131 Ga0157369_100071312 332
618 3300013105 Ga0157369_10007580 Ga0157369_100075808 332
619 3300013105 Ga0157369_10014963 Ga0157369_100149633 332
620 3300013105 Ga0157369_10101687 Ga0157369_101016872 332
621 3300013105 Ga0157369_10108310 Ga0157369_101083102 332
622 3300013105 Ga0157369_10186157 Ga0157369_101861571 332
623 3300013105 Ga0157369_10201885 Ga0157369_102018852 332
624 3300013105 Ga0157369_10202223 Ga0157369_102022232 332
625 3300013105 Ga0157369_10241064 Ga0157369_102410642 332
626 3300013296 Ga0157374_10019339 Ga0157374_100193392 332
627 3300013296 Ga0157374_10022063 Ga0157374_100220636 332
628 3300013296 Ga0157374_10028405 Ga0157374_100284053 332
629 3300013296 Ga0157374_10156868 Ga0157374_101568682 332
630 3300013296 Ga0157374_10231293 Ga0157374_102312932 332
631 3300013296 Ga0157374_10323602 Ga0157374_103236022 332
632 3300013297 Ga0157378_10002106 Ga0157378_100021065 332
633 3300013297 Ga0157378_10005729 Ga0157378_100057294 332
634 3300013297 Ga0157378_10024665 Ga0157378_100246652 332
635 3300013297 Ga0157378_10041121 Ga0157378_100411212 332
636 3300013297 Ga0157378_10246464 Ga0157378_102464642 332
637 3300013306 Ga0163162_10011531 Ga0163162_100115318 332
638 3300013306 Ga0163162_10089988 Ga0163162_100899883 332
639 3300013307 Ga0157372_10000038 Ga0157372_1000003820 332
640 3300013307 Ga0157372_10012960 Ga0157372_100129606 332
641 3300013307 Ga0157372_10026501 Ga0157372_100265012 332
642 3300013307 Ga0157372_10076032 Ga0157372_100760322 332
643 3300013307 Ga0157372_10109820 Ga0157372_101098202 332
644 3300013307 Ga0157372_10132881 Ga0157372_101328811 332
645 3300013307 Ga0157372_10211101 Ga0157372_102111012 332
646 3300013308 Ga0157375_10001477 Ga0157375_100014772 332
647 3300013308 Ga0157375_10009678 Ga0157375_100096784 332
648 3300013308 Ga0157375_10028238 Ga0157375_100282382 332
649 3300013308 Ga0157375_10205848 Ga0157375_102058482 332
650 3300013308 Ga0157375_10246594 Ga0157375_102465942 332
651 3300014325 Ga0163163_10001025 Ga0163163_1000102513 332
652 3300014325 Ga0163163_10002404 Ga0163163_100024047 332
653 3300014325 Ga0163163_10019171 Ga0163163_100191711 332
654 3300014325 Ga0163163_10022943 Ga0163163_100229433 332
655 3300014325 Ga0163163_10061166 Ga0163163_100611662 332
656 3300014325 Ga0163163_10091636 Ga0163163_100916362 332
657 3300014325 Ga0163163_10094084 Ga0163163_100940842 332
658 3300014325 Ga0163163_10121890 Ga0163163_101218902 332
659 3300014326 Ga0157380_10343737 Ga0157380_103437372 332
660 3300014326 Ga0157380_10346729 Ga0157380_103467292 332
661 3300014745 Ga0157377_10148376 Ga0157377_101483762 332
662 3300014968 Ga0157379_10002365 Ga0157379_1000236515 332
663 3300014968 Ga0157379_10028822 Ga0157379_100288225 332
664 3300014969 Ga0157376_10000361 Ga0157376_1000036115 332
665 3300014969 Ga0157376_10014459 Ga0157376_100144592 332
666 3300014969 Ga0157376_10106099 Ga0157376_101060992 332
667 3300017792 Ga0163161_10191924 Ga0163161_101919241 332
668 3300021361 Ga0213872_10003691 Ga0213872_100036917 332
669 3300025321 Ga0207656_10020141 Ga0207656_100201412 332
670 3300025321 Ga0207656_10022576 Ga0207656_100225762 332
671 3300025885 Ga0207653_10020003 Ga0207653_100200032 332
672 3300025900 Ga0207710_10007316 Ga0207710_100073162 332
673 3300025900 Ga0207710_10007728 Ga0207710_100077282 332
674 3300025903 Ga0207680_10074580 Ga0207680_100745802 332
675 3300025904 Ga0207647_10001387 Ga0207647_100013876 332
676 3300025908 Ga0207643_10002407 Ga0207643_100024073 332
677 3300025909 Ga0207705_10122053 Ga0207705_101220532 332
678 3300025910 Ga0207684_10207104 Ga0207684_102071042 332
679 3300025911 Ga0207654_10000028 Ga0207654_1000002851 332
680 3300025911 Ga0207654_10000923 Ga0207654_1000092314 332
681 3300025911 Ga0207654_10009537 Ga0207654_100095372 332
682 3300025911 Ga0207654_10012799 Ga0207654_100127992 332
683 3300025911 Ga0207654_10017182 Ga0207654_100171822 332
684 3300025911 Ga0207654_10043148 Ga0207654_100431482 332
685 3300025911 Ga0207654_10086023 Ga0207654_100860232 332
686 3300025912 Ga0207707_10029108 Ga0207707_100291082 332
687 3300025913 Ga0207695_10000026 Ga0207695_10000026168 332
688 3300025913 Ga0207695_10000063 Ga0207695_10000063230 332
689 3300025913 Ga0207695_10000168 Ga0207695_100001682 332
690 3300025913 Ga0207695_10002562 Ga0207695_1000256216 332
691 3300025913 Ga0207695_10010282 Ga0207695_100102826 332
692 3300025913 Ga0207695_10022992 Ga0207695_100229923 332
693 3300025913 Ga0207695_10092568 Ga0207695_100925682 332
694 3300025913 Ga0207695_10123138 Ga0207695_101231384 332
695 3300025913 Ga0207695_10235644 Ga0207695_102356442 332
696 3300025914 Ga0207671_10000162 Ga0207671_1000016274 332
697 3300025914 Ga0207671_10000279 Ga0207671_1000027928 332
698 3300025914 Ga0207671_10000894 Ga0207671_1000089434 332
699 3300025914 Ga0207671_10001367 Ga0207671_1000136715 332
700 3300025914 Ga0207671_10092148 Ga0207671_100921482 332
701 3300025914 Ga0207671_10185120 Ga0207671_101851201 332
702 3300025916 Ga0207663_10011855 Ga0207663_100118552 332
703 3300025919 Ga0207657_10278785 Ga0207657_102787851 332
704 3300025920 Ga0207649_10022061 Ga0207649_100220612 332
705 3300025921 Ga0207652_10022303 Ga0207652_100223032 332
706 3300025921 Ga0207652_10081837 Ga0207652_100818372 332
707 3300025924 Ga0207694_10000144 Ga0207694_100001442 332
708 3300025924 Ga0207694_10000346 Ga0207694_1000034625 332
709 3300025924 Ga0207694_10002660 Ga0207694_100026602 332
710 3300025924 Ga0207694_10005604 Ga0207694_100056046 332
711 3300025924 Ga0207694_10044001 Ga0207694_100440012 332
712 3300025924 Ga0207694_10055734 Ga0207694_100557342 332
713 3300025924 Ga0207694_10157491 Ga0207694_101574912 332
714 3300025925 Ga0207650_10308096 Ga0207650_103080962 332
715 3300025927 Ga0207687_10038330 Ga0207687_100383302 332
716 3300025927 Ga0207687_10270698 Ga0207687_102706982 332
717 3300025928 Ga0207700_10030745 Ga0207700_100307452 332
718 3300025928 Ga0207700_10064688 Ga0207700_100646882 332
719 3300025928 Ga0207700_10148476 Ga0207700_101484762 332
720 3300025931 Ga0207644_10007797 Ga0207644_100077972 332
721 3300025932 Ga0207690_10066688 Ga0207690_100666882 332
722 3300025933 Ga0207706_10006950 Ga0207706_100069507 332
723 3300025935 Ga0207709_10141924 Ga0207709_101419242 332
724 3300025936 Ga0207670_10002664 Ga0207670_100026642 332
725 3300025937 Ga0207669_10167863 Ga0207669_101678631 332
726 3300025938 Ga0207704_10046721 Ga0207704_100467212 332
727 3300025939 Ga0207665_10022210 Ga0207665_100222102 332
728 3300025939 Ga0207665_10041465 Ga0207665_100414652 332
729 3300025940 Ga0207691_10008092 Ga0207691_100080922 332
730 3300025941 Ga0207711_10000871 Ga0207711_1000087119 332
731 3300025941 Ga0207711_10014644 Ga0207711_100146442 332
732 3300025941 Ga0207711_10124503 Ga0207711_101245032 332
733 3300025941 Ga0207711_10163373 Ga0207711_101633732 332
734 3300025942 Ga0207689_10001682 Ga0207689_1000168210 332
735 3300025942 Ga0207689_10160121 Ga0207689_101601212 332
736 3300025944 Ga0207661_10002016 Ga0207661_100020162 332
737 3300025944 Ga0207661_10043546 Ga0207661_100435465 332
738 3300025944 Ga0207661_10097689 Ga0207661_100976892 332
739 3300025944 Ga0207661_10150497 Ga0207661_101504972 332
740 3300025944 Ga0207661_10311235 Ga0207661_103112352 332
741 3300025945 Ga0207679_10012634 Ga0207679_100126342 332
742 3300025949 Ga0207667_10001348 Ga0207667_100013482 332
743 3300025949 Ga0207667_10002645 Ga0207667_1000264518 332
744 3300025949 Ga0207667_10079454 Ga0207667_100794542 332
745 3300025949 Ga0207667_10208158 Ga0207667_102081582 332
746 3300025960 Ga0207651_10015215 Ga0207651_100152152 332
747 3300025960 Ga0207651_10057930 Ga0207651_100579301 332
748 3300025961 Ga0207712_10199018 Ga0207712_101990181 332
749 3300025986 Ga0207658_10022072 Ga0207658_100220722 332
750 3300026023 Ga0207677_10003066 Ga0207677_100030665 332
751 3300026023 Ga0207677_10189467 Ga0207677_101894672 332
752 3300026035 Ga0207703_10015003 Ga0207703_100150036 332
753 3300026035 Ga0207703_10025692 Ga0207703_100256922 332
754 3300026035 Ga0207703_10050281 Ga0207703_100502812 332
755 3300026035 Ga0207703_10173700 Ga0207703_101737002 332
756 3300026035 Ga0207703_10175723 Ga0207703_101757232 332
757 3300026041 Ga0207639_10001215 Ga0207639_1000121513 332
758 3300026041 Ga0207639_10050627 Ga0207639_100506272 332
759 3300026041 Ga0207639_10064381 Ga0207639_100643812 332
760 3300026041 Ga0207639_10111063 Ga0207639_101110632 332
761 3300026041 Ga0207639_10123859 Ga0207639_101238592 332
762 3300026041 Ga0207639_10302564 Ga0207639_103025642 332
763 3300026075 Ga0207708_10000054 Ga0207708_1000005481 332
764 3300026075 Ga0207708_10003738 Ga0207708_100037383 332
765 3300026078 Ga0207702_10012052 Ga0207702_100120523 332
766 3300026078 Ga0207702_10041355 Ga0207702_100413552 332
767 3300026078 Ga0207702_10109259 Ga0207702_101092592 332
768 3300026078 Ga0207702_10130787 Ga0207702_101307872 332
769 3300026078 Ga0207702_10595788 Ga0207702_105957881 332
770 3300026088 Ga0207641_10128820 Ga0207641_101288202 332
771 3300026089 Ga0207648_10226610 Ga0207648_102266102 332
772 3300026095 Ga0207676_10007279 Ga0207676_100072792 332
773 3300026095 Ga0207676_10022890 Ga0207676_100228904 332
774 3300026095 Ga0207676_10052832 Ga0207676_100528323 332
775 3300026095 Ga0207676_10064134 Ga0207676_100641342 332
776 3300026095 Ga0207676_10162623 Ga0207676_101626232 332
777 3300026095 Ga0207676_10272336 Ga0207676_102723362 332
778 3300026116 Ga0207674_10000488 Ga0207674_1000048833 332
779 3300026116 Ga0207674_10005666 Ga0207674_100056669 332
780 3300026116 Ga0207674_10006829 Ga0207674_100068292 332
781 3300026118 Ga0207675_100069121 Ga0207675_1000691212 332
782 3300026118 Ga0207675_100398261 Ga0207675_1003982612 332
783 3300026121 Ga0207683_10003867 Ga0207683_1000386710 332
784 3300026121 Ga0207683_10144404 Ga0207683_101444041 332
785 3300026142 Ga0207698_10000068 Ga0207698_100000682 332
786 3300026142 Ga0207698_10000224 Ga0207698_1000022429 332
787 3300026142 Ga0207698_10061577 Ga0207698_100615772 332
788 3300026142 Ga0207698_10087959 Ga0207698_100879592 332
789 3300026142 Ga0207698_10442631 Ga0207698_104426311 332
790 3300026142 Ga0207698_10471203 Ga0207698_104712031 332
791 3300027907 Ga0207428_10013684 Ga0207428_100136843 332
792 3300028379 Ga0268266_10003238 Ga0268266_100032387 332
793 3300028379 Ga0268266_10256127 Ga0268266_102561271 332
794 3300028380 Ga0268265_10289274 Ga0268265_102892742 332
795 3300028381 Ga0268264_10008533 Ga0268264_100085335 332
796 3300028381 Ga0268264_10203779 Ga0268264_102037792 332
797 3300028573 Ga0265334_10000818 Ga0265334_1000081812 332
798 3300028573 Ga0265334_10048771 Ga0265334_100487712 332
799 3300028653 Ga0265323_10016793 Ga0265323_100167934 332
800 3300028653 Ga0265323_10062036 Ga0265323_100620361 332
801 3300028666 Ga0265336_10005323 Ga0265336_100053231 332
802 3300028666 Ga0265336_10024607 Ga0265336_100246072 332
803 3300028800 Ga0265338_10002513 Ga0265338_1000251313 332
804 3300028800 Ga0265338_10003733 Ga0265338_1000373313 332
805 3300028800 Ga0265338_10016308 Ga0265338_100163087 332
806 3300028800 Ga0265338_10016699 Ga0265338_100166992 332
807 3300028800 Ga0265338_10048139 Ga0265338_100481392 332
808 3300028800 Ga0265338_10048724 Ga0265338_100487242 332
809 3300030760 Ga0265762_1006038 Ga0265762_10060382 332
810 3300031235 Ga0265330_10000198 Ga0265330_1000019831 332
811 3300031235 Ga0265330_10000202 Ga0265330_1000020212 332
812 3300031235 Ga0265330_10000913 Ga0265330_100009132 332
813 3300031235 Ga0265330_10006383 Ga0265330_100063832 332
814 3300031235 Ga0265330_10040749 Ga0265330_100407491 332
815 3300031235 Ga0265330_10060368 Ga0265330_100603682 332
816 3300031238 Ga0265332_10000883 Ga0265332_100008836 332
817 3300031238 Ga0265332_10009085 Ga0265332_100090855 332
818 3300031238 Ga0265332_10027296 Ga0265332_100272962 332
819 3300031239 Ga0265328_10006951 Ga0265328_100069512 332
820 3300031239 Ga0265328_10012399 Ga0265328_100123993 332
821 3300031239 Ga0265328_10013313 Ga0265328_100133132 332
822 3300031241 Ga0265325_10000269 Ga0265325_1000026924 332
823 3300031241 Ga0265325_10001559 Ga0265325_100015593 332
824 3300031241 Ga0265325_10012353 Ga0265325_100123532 332
825 3300031247 Ga0265340_10013709 Ga0265340_100137093 332
826 3300031247 Ga0265340_10072299 Ga0265340_100722992 332
827 3300031249 Ga0265339_10000003 Ga0265339_10000003206 332
828 3300031249 Ga0265339_10000118 Ga0265339_100001185 332
829 3300031249 Ga0265339_10000324 Ga0265339_1000032415 332
830 3300031249 Ga0265339_10000747 Ga0265339_1000074712 332
831 3300031249 Ga0265339_10014030 Ga0265339_100140302 332
832 3300031249 Ga0265339_10025773 Ga0265339_100257734 332
833 3300031249 Ga0265339_10038891 Ga0265339_100388912 332
834 3300031249 Ga0265339_10040091 Ga0265339_100400912 332
835 3300031249 Ga0265339_10087552 Ga0265339_100875522 332
836 3300031344 Ga0265316_10000084 Ga0265316_1000008443 332
837 3300031344 Ga0265316_10001449 Ga0265316_1000144917 332
838 3300031344 Ga0265316_10001682 Ga0265316_100016824 332
839 3300031344 Ga0265316_10002239 Ga0265316_1000223921 332
840 3300031344 Ga0265316_10010277 Ga0265316_100102772 332
841 3300031344 Ga0265316_10015566 Ga0265316_100155662 332
842 3300031344 Ga0265316_10033791 Ga0265316_100337914 332
843 3300031344 Ga0265316_10047095 Ga0265316_100470952 332
844 3300031344 Ga0265316_10132766 Ga0265316_101327662 332
845 3300031344 Ga0265316_10148638 Ga0265316_101486382 332
846 3300031344 Ga0265316_10183121 Ga0265316_101831212 332
847 3300031595 Ga0265313_10003096 Ga0265313_1000309610 332
848 3300031711 Ga0265314_10000064 Ga0265314_10000064105 332
849 3300031711 Ga0265314_10000076 Ga0265314_1000007654 332
850 3300031711 Ga0265314_10003765 Ga0265314_1000376511 332
851 3300031711 Ga0265314_10007667 Ga0265314_100076672 332
852 3300031711 Ga0265314_10040648 Ga0265314_100406482 332
853 3300031712 Ga0265342_10000147 Ga0265342_1000014741 332
854 3300031712 Ga0265342_10001403 Ga0265342_100014039 332
855 3300031712 Ga0265342_10002544 Ga0265342_1000254413 332
856 3300031712 Ga0265342_10010272 Ga0265342_100102722 332
857 3300031712 Ga0265342_10016372 Ga0265342_100163722 332
858 3300031712 Ga0265342_10023235 Ga0265342_100232352 332
859 3300031712 Ga0265342_10040119 Ga0265342_100401191 332
860 3300031731 Ga0307405_10098876 Ga0307405_100988761 332
861 3300031852 Ga0307410_10002358 Ga0307410_100023583 332
862 3300031901 Ga0307406_10005486 Ga0307406_100054862 332
863 3300032004 Ga0307414_10024781 Ga0307414_100247812 332
864 3300032004 Ga0307414_10316112 Ga0307414_103161121 332
865 3300032005 Ga0307411_10031270 Ga0307411_100312704 332
866 3300032005 Ga0307411_10131321 Ga0307411_101313212 332
867 3300035091 Ga0373951_0027925 Ga0373951_0027925_190_1197 332
868 3300035118 Ga0373954_0102904 Ga0373954_0102904_208_1215 332
869 3300035241 Ga0373961_0000436 Ga0373961_0000436_1241_2251 332
870 3300035692 Ga0373935_0027606 Ga0373935_0027606_1490_2491 332
871 3300035725 Ga0373947_0034774 Ga0373947_0034774_1754_2758 332
872 3300036401 Ga0373937_0002221 Ga0373937_0002221_3532_4548 332
873 3300036401 Ga0373937_0033001 Ga0373937_0033001_1705_2721 332
874 3300036401 Ga0373937_0039188 Ga0373937_0039188_1201_2202 332
875 3300036401 Ga0373937_0055256 Ga0373937_0055256_2032_3048 332
876 3300036401 Ga0373937_0139485 Ga0373937_0139485_515_1531 332
877 3300036647 Ga0316582_0062387 Ga0316582_0062387_1344_2375 332
878 3300037068 Ga0373925_0001621 Ga0373925_0001621_14037_15041 332
879 3300038443 Ga0395901_0458024 Ga0395901_0458024_110_1126 332
880 3300039438 Ga0436360_0014237 Ga0436360_0014237_56_1066 332
881 3300039447 Ga0436361_0359509 Ga0436361_0359509_4035_5045 332
882 3300039450 Ga0436363_1172370 Ga0436363_1172370_829_1839 332
883 3300039453 Ga0436362_1012282 Ga0436362_1012282_387_1397 332
884 3300044693 Ga0466961_0166345 Ga0466961_0166345_44_1060 332
885 3300044694 Ga0466963_0002558 Ga0466963_0002558_6486_7502 332
886 3300044712 Ga0453684_0138626 Ga0453684_0138626_113_1111 332
887 3300044712 Ga0453684_0167862 Ga0453684_0167862_1513_2511 332
888 3300045051 Ga0451576_0074132 Ga0451576_0074132_2301_3323 332
889 3300045976 Ga0466967_0013758 Ga0466967_0013758_4086_5102 332
890 3300046459 Ga0495629_0019786 Ga0495629_0019786_1816_2832 332
891 3300046462 Ga0495651_0028878 Ga0495651_0028878_1724_2731 332
892 3300046463 Ga0495653_0028713 Ga0495653_0028713_1871_2878 332
893 3300046472 Ga0495580_0002833 Ga0495580_0002833_6301_7308 332
894 3300046473 Ga0495582_0012389 Ga0495582_0012389_2424_3428 332
895 3300046473 Ga0495582_0104438 Ga0495582_0104438_22_1038 332
896 3300046476 Ga0495662_0025759 Ga0495662_0025759_199_1215 332
897 3300046477 Ga0495664_0038383 Ga0495664_0038383_199_1206 332
898 3300046514 Ga0495618_0065773 Ga0495618_0065773_180_1187 332
899 3300046529 Ga0495652_0101554 Ga0495652_0101554_632_1639 332
900 3300046531 Ga0495665_0035363 Ga0495665_0035363_1293_2291 332
901 3300046533 Ga0495640_0040767 Ga0495640_0040767_1375_2382 332
902 3300046536 Ga0495587_0018096 Ga0495587_0018096_632_1648 332
903 3300046536 Ga0495587_0024110 Ga0495587_0024110_2104_3111 332
904 3300046543 Ga0495645_0009633 Ga0495645_0009633_1537_2544 332
905 3300046543 Ga0495645_0010293 Ga0495645_0010293_238_1254 332
906 3300046559 Ga0495667_0104541 Ga0495667_0104541_530_1546 332
907 3300046642 Ga0495634_0004148 Ga0495634_0004148_8043_9050 332
908 3300046663 Ga0495635_0003141 Ga0495635_0003141_8760_9767 332
909 3300046678 Ga0495599_0051973 Ga0495599_0051973_1510_2517 332
910 3300046679 Ga0495623_0016415 Ga0495623_0016415_1642_2649 332
911 3300046679 Ga0495623_0129562 Ga0495623_0129562_251_1267 332
912 3300046680 Ga0495646_0047170 Ga0495646_0047170_868_1875 332
913 3300046684 Ga0495669_0029730 Ga0495669_0029730_593_1591 332
914 3300046689 Ga0495613_0048716 Ga0495613_0048716_1991_2998 332
915 3300046809 Ga0495600_0024312 Ga0495600_0024312_606_1613 332
916 3300046809 Ga0495600_0098999 Ga0495600_0098999_368_1384 332
917 3300046809 Ga0495600_0247853 Ga0495600_0247853_21_1031 332
918 3300047317 Ga0495604_0059884 Ga0495604_0059884_1394_2401 332
919 3300047319 Ga0495674_0082868 Ga0495674_0082868_366_1382 332
920 3300047471 Ga0495684_0042688 Ga0495684_0042688_750_1757 332
921 3300048088 Ga0495602_0170795 Ga0495602_0170795_225_1232 332
922 3300048904 Ga0496101_0089193 Ga0496101_0089193_867_1868 332
923 3300048907 Ga0496104_0198008 Ga0496104_0198008_270_1268 332
924 3300048910 Ga0496107_0122430 Ga0496107_0122430_878_1879 332
925 3300048912 Ga0496109_0027991 Ga0496109_0027991_2826_3824 332
926 3300048915 Ga0496112_0080288 Ga0496112_0080288_881_1879 332
927 3300048915 Ga0496112_0142596 Ga0496112_0142596_1164_2165 332
928 3300048917 Ga0496114_0007255 Ga0496114_0007255_2020_3021 332
929 3300048918 Ga0496115_0093688 Ga0496115_0093688_281_1297 332
930 3300049515 Ga0501292_006916 Ga0501292_006916_569_1567 332
931 3300049519 Ga0501296_003603 Ga0501296_003603_295_1293 332
932 3300049652 Ga0501202_021022 Ga0501202_021022_238_1236 332
933 3300049654 Ga0501207_001271 Ga0501207_001271_2010_3008 332
934 3300049656 Ga0501209_014613 Ga0501209_014613_575_1573 332
935 3300049661 Ga0501217_001008 Ga0501217_001008_3675_4673 332
936 3300049661 Ga0501217_002314 Ga0501217_002314_2517_3515 332
937 3300049661 Ga0501217_021554 Ga0501217_021554_244_1242 332
938 3300049663 Ga0501223_001628 Ga0501223_001628_3928_4926 332
939 3300049663 Ga0501223_005324 Ga0501223_005324_151_1149 332
940 3300049663 Ga0501223_006020 Ga0501223_006020_945_1943 332
941 3300049665 Ga0501227_000979 Ga0501227_000979_2628_3626 332
942 3300049667 Ga0501230_000225 Ga0501230_000225_1109_2107 332
943 3300049669 Ga0501235_008095 Ga0501235_008095_964_1962 332
944 3300049672 Ga0501239_000904 Ga0501239_000904_1392_2390 332
945 3300049672 Ga0501239_006106 Ga0501239_006106_35_1033 332
946 3300049675 Ga0501243_010751 Ga0501243_010751_76_1074 332
947 3300049683 Ga0501253_011487 Ga0501253_011487_327_1325 332
948 3300049686 Ga0501257_002511 Ga0501257_002511_193_1191 332
949 3300049690 Ga0501261_001901 Ga0501261_001901_1518_2516 332
950 3300049705 Ga0501225_0000303 Ga0501225_0000303_14205_15203 332
951 3300049705 Ga0501225_0017089 Ga0501225_0017089_837_1835 332
952 3300049705 Ga0501225_0024929 Ga0501225_0024929_419_1417 332
953 3300049707 Ga0501234_011008 Ga0501234_011008_39_1037 332
954 3300049708 Ga0501245_013114 Ga0501245_013114_101_1099 332
955 3300049767 Ga0501270_006308 Ga0501270_006308_317_1315 332
956 3300049769 Ga0501272_001613 Ga0501272_001613_550_1548 332
957 3300049769 Ga0501272_004911 Ga0501272_004911_116_1114 332
958 3300049850 Ga0501204_002063 Ga0501204_002063_124_1122 332
959 3300049851 Ga0501212_013401 Ga0501212_013401_67_1065 332
960 3300050507 nmdc:mga05p37_188915_c1 nmdc:mga05p37_188915_c1_254_1252 332
961 3300050507 nmdc:mga05p37_464167_c1 nmdc:mga05p37_464167_c1_157_1155 332
962 3300050508 nmdc:mga09592_78200_c1 nmdc:mga09592_78200_c1_1492_2490 332
963 3300050511 nmdc:mga08y16_7081_c1 nmdc:mga08y16_7081_c1_832_1830 332
964 3300050512 nmdc:mga0n895_21731_c1 nmdc:mga0n895_21731_c1_3920_4927 332
965 3300050514 nmdc:mga08x19_3938_c2 nmdc:mga08x19_3938_c2_2150_3166 332
966 3300050515 nmdc:mga0a205_243996_c1 nmdc:mga0a205_243996_c1_414_1412 332
967 3300053085 Ga0495619_0061650 Ga0495619_0061650_172_1173 332
968 3300053085 Ga0495619_0130061 Ga0495619_0130061_233_1240 332
969 3300005295 Ga0065707_10149800 Ga0065707_101498002 333
970 3300005329 Ga0070683_100237463 Ga0070683_1002374632 333
971 3300005354 Ga0070675_100139419 Ga0070675_1001394192 333
972 3300005436 Ga0070713_100235756 Ga0070713_1002357561 333
973 3300005458 Ga0070681_10032325 Ga0070681_100323254 333
974 3300005530 Ga0070679_100103795 Ga0070679_1001037952 333
975 3300005577 Ga0068857_100372412 Ga0068857_1003724122 333
976 3300005842 Ga0068858_100136830 Ga0068858_1001368302 333
977 3300005844 Ga0068862_100232506 Ga0068862_1002325062 333
978 3300006237 Ga0097621_100001224 Ga0097621_1000012242 333
979 3300006358 Ga0068871_100003384 Ga0068871_1000033849 333
980 3300006844 Ga0075428_100120336 Ga0075428_1001203362 333
981 3300006931 Ga0097620_100036153 Ga0097620_1000361532 333
982 3300006931 Ga0097620_100071101 Ga0097620_1000711015 333
983 3300009098 Ga0105245_10003427 Ga0105245_1000342711 333
984 3300009147 Ga0114129_10012495 Ga0114129_100124955 333
985 3300009174 Ga0105241_10168091 Ga0105241_101680912 333
986 3300009174 Ga0105241_10230088 Ga0105241_102300882 333
987 3300009176 Ga0105242_10006860 Ga0105242_100068603 333
988 3300013105 Ga0157369_10229224 Ga0157369_102292242 333
989 3300013297 Ga0157378_10003078 Ga0157378_1000307814 333
990 3300013308 Ga0157375_10022781 Ga0157375_100227812 333
991 3300014969 Ga0157376_10052814 Ga0157376_100528142 333
992 3300025903 Ga0207680_10099610 Ga0207680_100996102 333
993 3300025927 Ga0207687_10178857 Ga0207687_101788572 333
994 3300025981 Ga0207640_10039034 Ga0207640_100390341 333
995 3300026023 Ga0207677_10124524 Ga0207677_101245241 333
996 3300028380 Ga0268265_10120983 Ga0268265_101209832 333
997 3300028573 Ga0265334_10053388 Ga0265334_100533881 333
998 3300028577 Ga0265318_10077295 Ga0265318_100772951 333
999 3300028800 Ga0265338_10043165 Ga0265338_100431651 333
1000 3300031240 Ga0265320_10112922 Ga0265320_101129221 333
1001 3300031247 Ga0265340_10031007 Ga0265340_100310072 333
1002 3300031344 Ga0265316_10049726 Ga0265316_100497262 333
1003 3300031665 Ga0316575_10006974 Ga0316575_100069745 333
1004 3300031665 Ga0316575_10010767 Ga0316575_100107672 333
1005 3300031691 Ga0316579_10000759 Ga0316579_100007597 333
1006 3300031691 Ga0316579_10027277 Ga0316579_100272772 333
1007 3300031691 Ga0316579_10065017 Ga0316579_100650171 333
1008 3300031727 Ga0316576_10013473 Ga0316576_100134733 333
1009 3300031727 Ga0316576_10161689 Ga0316576_101616891 333
1010 3300031728 Ga0316578_10039253 Ga0316578_100392532 333
1011 3300031728 Ga0316578_10050371 Ga0316578_100503712 333
1012 3300031733 Ga0316577_10001105 Ga0316577_100011054 333
1013 3300032168 Ga0316593_10001992 Ga0316593_100019921 333
1014 3300035172 Ga0373955_0066978 Ga0373955_0066978_511_1515 333
1015 3300035398 Ga0316574_0000429 Ga0316574_0000429_868_1872 333
1016 3300035398 Ga0316574_0009950 Ga0316574_0009950_2269_3294 333
1017 3300036647 Ga0316582_0018706 Ga0316582_0018706_2073_3098 333
1018 3300036647 Ga0316582_0018910 Ga0316582_0018910_1498_2502 333
1019 3300036712 Ga0316584_0127797 Ga0316584_0127797_649_1650 333
1020 3300036712 Ga0316584_0200097 Ga0316584_0200097_19_1023 333
1021 3300037588 Ga0316581_0009239 Ga0316581_0009239_631_1656 333
1022 3300042876 Ga0451577_0025637 Ga0451577_0025637_989_2104 333
1023 3300042876 Ga0451577_0075436 Ga0451577_0075436_928_1929 333
1024 3300042876 Ga0451577_0264739 Ga0451577_0264739_507_1508 333
1025 3300042876 Ga0451577_0314594 Ga0451577_0314594_278_1282 333
1026 3300042876 Ga0451577_0320931 Ga0451577_0320931_359_1360 333
1027 3300042876 Ga0451577_0374624 Ga0451577_0374624_78_1079 333
1028 3300044673 Ga0453683_0000129 Ga0453683_0000129_109231_110232 333
1029 3300044673 Ga0453683_0001154 Ga0453683_0001154_20009_21010 333
1030 3300044673 Ga0453683_0008080 Ga0453683_0008080_1825_2826 333
1031 3300044673 Ga0453683_0010406 Ga0453683_0010406_351_1352 333
1032 3300044673 Ga0453683_0044921 Ga0453683_0044921_688_1689 333
1033 3300044673 Ga0453683_0059002 Ga0453683_0059002_79_1080 333
1034 3300044673 Ga0453683_0064506 Ga0453683_0064506_738_1739 333
1035 3300044673 Ga0453683_0109605 Ga0453683_0109605_399_1400 333
1036 3300044712 Ga0453684_0000035 Ga0453684_0000035_575551_576666 333
1037 3300044712 Ga0453684_0000752 Ga0453684_0000752_86585_87586 333
1038 3300044712 Ga0453684_0001416 Ga0453684_0001416_61357_62358 333
1039 3300044712 Ga0453684_0005727 Ga0453684_0005727_21983_22984 333
1040 3300044712 Ga0453684_0009719 Ga0453684_0009719_8890_9891 333
1041 3300044712 Ga0453684_0035364 Ga0453684_0035364_5189_6190 333
1042 3300044712 Ga0453684_0079221 Ga0453684_0079221_1999_3000 333
1043 3300044712 Ga0453684_0095584 Ga0453684_0095584_2167_3168 333
1044 3300044712 Ga0453684_0176923 Ga0453684_0176923_608_1609 333
1045 3300044712 Ga0453684_0178692 Ga0453684_0178692_435_1436 333
1046 3300044712 Ga0453684_0273889 Ga0453684_0273889_718_1719 333
1047 3300044712 Ga0453684_0488926 Ga0453684_0488926_325_1326 333
1048 3300044712 Ga0453684_0608421 Ga0453684_0608421_151_1152 333
1049 3300044712 Ga0453684_0643980 Ga0453684_0643980_129_1130 333
1050 3300045051 Ga0451576_0000311 Ga0451576_0000311_113956_114957 333
1051 3300045051 Ga0451576_0000688 Ga0451576_0000688_34932_35936 333
1052 3300045051 Ga0451576_0016491 Ga0451576_0016491_6750_7751 333
1053 3300045051 Ga0451576_0034883 Ga0451576_0034883_3262_4263 333
1054 3300045051 Ga0451576_0128728 Ga0451576_0128728_197_1198 333
1055 3300045051 Ga0451576_0240250 Ga0451576_0240250_238_1239 333
1056 3300045051 Ga0451576_0370790 Ga0451576_0370790_193_1194 333
1057 3300049686 Ga0501257_003460 Ga0501257_003460_519_1532 333
1058 3300050507 nmdc:mga05p37_265913_c1 nmdc:mga05p37_265913_c1_280_1281 333
1059 3300050508 nmdc:mga09592_213196_c1 nmdc:mga09592_213196_c1_140_1141 333
1060 3300050510 nmdc:mga06r32_187739_c1 nmdc:mga06r32_187739_c1_331_1332 333
1061 2162886006 SwRhRL3b_contig_681025 SwRhRL3b_0778.00001820 334
1062 2162886007 SwRhRL2b_contig_2683522 SwRhRL2b_0071.00003520 334
1063 3300005289 Ga0065704_10000241 Ga0065704_1000024134 334
1064 3300005289 Ga0065704_10008237 Ga0065704_100082374 334
1065 3300005295 Ga0065707_10000706 Ga0065707_100007069 334
1066 3300005295 Ga0065707_10138711 Ga0065707_101387112 334
1067 3300005295 Ga0065707_10196167 Ga0065707_101961671 334
1068 3300005467 Ga0070706_100071055 Ga0070706_1000710552 334
1069 3300005471 Ga0070698_100046771 Ga0070698_1000467713 334
1070 3300005617 Ga0068859_100044899 Ga0068859_1000448991 334
1071 3300005618 Ga0068864_100396124 Ga0068864_1003961241 334
1072 3300005844 Ga0068862_100205972 Ga0068862_1002059722 334
1073 3300006847 Ga0075431_100327904 Ga0075431_1003279042 334
1074 3300006880 Ga0075429_100000179 Ga0075429_10000017914 334
1075 3300006931 Ga0097620_100044894 Ga0097620_1000448941 334
1076 3300009147 Ga0114129_10001382 Ga0114129_1000138213 334
1077 3300025935 Ga0207709_10090408 Ga0207709_100904081 334
1078 3300031995 Ga0307409_100278434 Ga0307409_1002784342 334
1079 3300042876 Ga0451577_0039852 Ga0451577_0039852_1582_2586 334
1080 3300042876 Ga0451577_0128782 Ga0451577_0128782_289_1293 334
1081 3300044712 Ga0453684_0112556 Ga0453684_0112556_1129_2133 334
1082 3300045051 Ga0451576_0041664 Ga0451576_0041664_2995_4014 334
1083 3300045051 Ga0451576_0221133 Ga0451576_0221133_358_1362 334
1084 3300049575 Ga0501039_0053167 Ga0501039_0053167_1345_2349 334
1085 3300049575 Ga0501039_0131215 Ga0501039_0131215_919_1923 334
1086 3300049588 Ga0501072_0144183 Ga0501072_0144183_387_1391 334
1087 3300049590 Ga0501074_0125521 Ga0501074_0125521_42_1046 334
1088 3300049591 Ga0501075_0016699 Ga0501075_0016699_3121_4125 334
1089 3300049592 Ga0501076_0036202 Ga0501076_0036202_75_1079 334
1090 3300049741 Ga0501079_0081941 Ga0501079_0081941_1207_2211 334
1091 3300049742 Ga0501080_0104038 Ga0501080_0104038_388_1392 334
1092 3300050507 nmdc:mga05p37_1088_c1 nmdc:mga05p37_1088_c1_9331_10335 334
1093 3300050508 nmdc:mga09592_1528_c1 nmdc:mga09592_1528_c1_15996_17000 334
1094 3300054114 Ga0501084_0100904 Ga0501084_0100904_765_1769 334
1095 3300060353 Ga0501082_0049363 Ga0501082_0049363_514_1518 334
1096 3300060353 Ga0501082_0074811 Ga0501082_0074811_1192_2295 334
1097 3300061734 Ga0530510_0021924 Ga0530510_0021924_1293_2297 334
1098 3300061734 Ga0530510_0063783 Ga0530510_0063783_1153_2256 334

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01180

DHO_dh

Dihydroorotate dehydrogenase

41

329

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
5ue9-assembly1.cif.gz_A wt dhodb with orotate bound 0.7913 3 307
5ksw-assembly1.cif.gz_A dhodb-i74d mutant 0.7907 3 307
5ue9-assembly1.cif.gz_A wt dhodb with orotate bound 0.7769 3 307
5ksw-assembly1.cif.gz_A dhodb-i74d mutant 0.7765 3 307
8f6n-assembly2.cif.gz_C dihydropyrimidine dehydrogenase (dpd) c671s mutant soaked with thymine quasi-anaerobically 0.7668 3 295
ID Description Score Start End Superfamily
af_Q58070_5_305_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8054 4 307 3.20.20.70
af_Q58070_5_305_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.7979 4 307 3.20.20.70
3c61A01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.7718 1 306 3.20.20.70
1ep1A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.7647 1 307 3.20.20.70
3c61A01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.7561 1 306 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A350V0Z1-F1-model_v4 Dihydroorotate dehydrogenase-like protein 0.9735 101 251
AF-A0A2V8DTY9-F1-model_v4 Dihydroorotate dehydrogenase-like protein 0.9711 116 331 GO:0004152
GO:0005737
GO:0006207
AF-A0A202DKU4-F1-model_v4 Dihydroorotate dehydrogenase 0.9663 87 329 GO:0004152
GO:0005737
GO:0006207
GO:0006221
AF-A0A2V5NML8-F1-model_v4 Dihydroorotate dehydrogenase-like protein 0.9656 120 331 GO:0004152
GO:0005737
GO:0006207
GO:0006221
AF-A0A847MSV2-F1-model_v4 Dihydroorotate dehydrogenase-like protein 0.964 99 333 GO:0004152
GO:0005737
GO:0006207
GO:0006221

Feature Viewer

pLDDT pTM Quality
87.58 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map