F489340

General Info

Members Datasets Scaffolds Average Seq Length
1064 399 2128 81

Family's Representative Sequence

Representative Sequence 3300005289|Ga0065704_10126472|Ga0065704_101264724
Length 96
Sequence LQAENRTGKLFCMITPEQIKDFLGKSLPISVCETQDLTGGGDHWQLIVVSPAFEGKGLLEQHRLVNEALKEPMSDQRIHALALKTFSPSQWEKLGC

Samples

Sample ID Description Type Environment
1 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
2 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
3 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
4 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
5 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
6 3300003349 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM Metagenome Rhizosphere
7 3300003503 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM Metagenome Rhizosphere
8 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
9 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
10 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
11 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
12 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
13 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
14 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
15 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
16 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
17 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
18 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
19 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
20 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
21 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
22 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
23 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
24 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
25 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
26 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
27 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
28 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
29 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
30 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
31 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
32 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
33 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
34 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
35 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
36 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
37 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
38 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
39 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
40 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
41 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
42 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
43 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
44 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
45 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
46 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
47 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
48 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
49 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
50 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
51 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
52 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
53 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
54 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
55 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
56 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
57 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
58 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
59 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
60 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
61 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
62 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
63 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
64 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
65 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
66 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
67 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
68 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
69 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
70 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
71 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
72 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
73 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
74 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
75 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
76 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
77 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
78 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
79 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
80 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
81 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
82 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
83 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
84 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
85 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
86 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
87 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
88 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
89 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
90 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
91 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
92 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
93 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
94 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
95 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
96 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
97 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
98 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
99 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
100 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
101 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
102 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
103 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
104 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
105 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
106 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
107 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
108 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
109 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
110 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
111 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
112 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
113 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
114 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
115 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
116 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
117 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
118 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
119 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
120 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
121 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
122 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
123 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
124 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
125 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
126 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
127 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
128 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
129 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
130 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
131 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
132 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
133 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
134 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
135 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
136 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
137 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
138 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
201 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
202 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
203 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
204 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
205 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
206 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
207 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
208 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
209 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
210 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
211 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
215 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
216 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
217 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
218 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
219 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
220 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
221 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
222 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
223 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
224 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
225 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
226 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
227 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
228 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
229 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
230 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
231 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
232 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
233 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
234 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
235 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
236 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
237 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
238 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
239 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
240 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
241 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
242 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
243 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
244 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
245 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
246 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
247 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
248 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
249 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
250 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
251 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
252 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
253 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
254 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
255 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
256 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
257 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
258 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
259 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
260 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
261 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
262 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
263 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
264 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
265 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
266 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
267 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
268 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
269 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
270 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
271 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
272 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
273 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
274 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
275 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
276 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
277 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
278 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
279 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
280 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
281 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
282 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
283 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
284 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
285 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
286 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
287 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
288 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
289 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
290 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
291 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
292 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
293 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
294 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
295 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
296 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
297 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
298 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
299 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
300 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
301 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
302 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
303 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
304 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
305 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
306 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
307 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
308 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
309 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
310 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
311 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
312 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
313 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
314 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
315 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
316 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
317 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
318 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
319 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
320 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
321 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
322 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
323 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
324 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
325 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
326 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
327 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
328 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
329 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
330 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
331 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
332 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
333 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
334 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
335 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
336 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
337 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
338 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
339 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
340 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
341 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
342 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
343 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
344 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
345 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
346 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
347 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
348 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
349 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
350 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
351 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
352 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
353 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
354 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
355 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
356 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
357 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
358 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
359 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
360 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
361 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
362 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
363 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
364 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
365 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
366 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
367 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
368 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
369 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
370 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
371 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
372 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
373 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
374 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
375 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
376 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
377 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
378 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
379 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
380 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
381 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
382 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
383 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
384 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
385 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
386 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
387 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
388 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
389 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
390 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
391 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
392 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
393 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
394 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
395 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
396 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
397 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
398 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
399 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.44
Metatranscriptomes 0.56
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.28
Nodule 0
Rhizoplane 7.52
Rhizosphere 91.92
Stem 0
Stem Tuber 0
Unclassified 17.76

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065704_10126472 3300005289 Unclassified 1689
2 SwRhRL3b_contig_1296379 2162886006 Bacteria 2225
3 ARSoilOldRDRAFT_c007671 3300000044 Bacteria 898
4 JGI24744J21845_10050039 3300002077 Bacteria 771
5 JGI24742J22300_10027238 3300002244 Bacteria 990
6 JGI26129J50193_1005351 3300003349 Unclassified 915
7 JGI26141J51220_1016473 3300003503 Bacteria 508
8 JGI25405J52794_10000972 3300003911 Bacteria 4510
9 Ga0058859_11814659 3300004798 Unclassified 1445
10 Ga0058861_11337636 3300004800 Bacteria 922
11 Ga0058862_10108325 3300004803 Unclassified 614
12 Ga0065704_10247922 3300005289 Bacteria 997
13 Ga0065704_10250528 3300005289 Bacteria 984
14 Ga0065712_10005198 3300005290 Unclassified 3766
15 Ga0065712_10083595 3300005290 Unclassified 2812
16 Ga0065715_10001245 3300005293 Bacteria 12652
17 Ga0065715_10009782 3300005293 Bacteria 2430
18 Ga0065715_11191938 3300005293 Unclassified 500
19 Ga0065707_10002967 3300005295 Bacteria 10427
20 Ga0065707_10015515 3300005295 Bacteria 1669
21 Ga0065707_10428092 3300005295 Bacteria 818
22 Ga0065707_10732491 3300005295 Unclassified 626
23 Ga0070676_10399610 3300005328 Bacteria 956
24 Ga0070683_100001708 3300005329 Bacteria 17088
25 Ga0070690_100341121 3300005330 Bacteria 1085
26 Ga0070670_100002504 3300005331 Bacteria 15150
27 Ga0070670_100153305 3300005331 Unclassified 1995
28 Ga0070670_101104771 3300005331 Unclassified 723
29 Ga0068869_100445125 3300005334 Bacteria 1073
30 Ga0070666_10061309 3300005335 Unclassified 2547
31 Ga0070666_10063655 3300005335 Unclassified 2500
32 Ga0070666_10250905 3300005335 Bacteria 1253
33 Ga0070680_100086954 3300005336 Bacteria 2585
34 Ga0070680_100192827 3300005336 Bacteria 1717
35 Ga0070680_100218396 3300005336 Bacteria 1609
36 Ga0070680_100387419 3300005336 Bacteria 1190
37 Ga0070680_101033560 3300005336 Bacteria 710
38 Ga0070680_101564153 3300005336 Unclassified 571
39 Ga0070680_101749608 3300005336 Unclassified 539
40 Ga0070682_100002331 3300005337 Bacteria 10498
41 Ga0070682_100019799 3300005337 Bacteria 3952
42 Ga0070682_100873408 3300005337 Unclassified 737
43 Ga0068868_100015257 3300005338 Bacteria 5678
44 Ga0068868_100124128 3300005338 Bacteria 2108
45 Ga0068868_100190192 3300005338 Bacteria 1707
46 Ga0070660_100004253 3300005339 Bacteria 9880
47 Ga0070660_100034848 3300005339 Unclassified 3806
48 Ga0070660_100074301 3300005339 Bacteria 2660
49 Ga0070660_100896560 3300005339 Bacteria 748
50 Ga0070689_100011564 3300005340 Bacteria 6324
51 Ga0070691_10044381 3300005341 Bacteria 2108
52 Ga0070691_10208129 3300005341 Bacteria 1031
53 Ga0070687_100146086 3300005343 Unclassified 1383
54 Ga0070687_101108211 3300005343 Bacteria 579
55 Ga0070661_100060435 3300005344 Bacteria 2781
56 Ga0070661_100524184 3300005344 Bacteria 951
57 Ga0070692_10003563 3300005345 Bacteria 6339
58 Ga0070668_100013432 3300005347 Bacteria 6113
59 Ga0070668_100059870 3300005347 Bacteria 2948
60 Ga0070669_100012929 3300005353 Bacteria 5928
61 Ga0070669_101241397 3300005353 Bacteria 644
62 Ga0070675_100008011 3300005354 Bacteria 8190
63 Ga0070675_100065803 3300005354 Unclassified 2997
64 Ga0070675_102061908 3300005354 Unclassified 526
65 Ga0070671_100043036 3300005355 Bacteria 3755
66 Ga0070671_100231357 3300005355 Bacteria 1568
67 Ga0070671_101353339 3300005355 Unclassified 628
68 Ga0070674_100086678 3300005356 Bacteria 2250
69 Ga0070674_100290390 3300005356 Bacteria 1300
70 Ga0070674_100681818 3300005356 Unclassified 877
71 Ga0070674_101528736 3300005356 Bacteria 600
72 Ga0070674_101734986 3300005356 Unclassified 565
73 Ga0070673_100075688 3300005364 Bacteria 2716
74 Ga0070673_101113435 3300005364 Bacteria 738
75 Ga0070688_100040381 3300005365 Bacteria 2859
76 Ga0070688_100807044 3300005365 Unclassified 734
77 Ga0070688_101077616 3300005365 Bacteria 641
78 Ga0070688_101220076 3300005365 Unclassified 605
79 Ga0070659_100047318 3300005366 Bacteria 3373
80 Ga0070659_100188912 3300005366 Bacteria 1692
81 Ga0070659_101292078 3300005366 Unclassified 647
82 Ga0070703_10032462 3300005406 Bacteria 1586
83 Ga0070709_10076295 3300005434 Bacteria 2176
84 Ga0070709_10679171 3300005434 Bacteria 800
85 Ga0070709_11313779 3300005434 Bacteria 584
86 Ga0070714_100041626 3300005435 Bacteria 3878
87 Ga0070714_100183372 3300005435 Bacteria 1906
88 Ga0070713_100045171 3300005436 Bacteria 3608
89 Ga0070713_101244707 3300005436 Bacteria 721
90 Ga0070710_10471467 3300005437 Bacteria 854
91 Ga0070701_10521768 3300005438 Bacteria 775
92 Ga0070701_10586011 3300005438 Bacteria 737
93 Ga0070711_100163024 3300005439 Bacteria 1692
94 Ga0070711_100824316 3300005439 Bacteria 788
95 Ga0070711_101360597 3300005439 Bacteria 617
96 Ga0070705_100027122 3300005440 Bacteria 3124
97 Ga0070705_100244979 3300005440 Bacteria 1255
98 Ga0070705_101172981 3300005440 Bacteria 632
99 Ga0070705_101243250 3300005440 Bacteria 615
100 Ga0070705_101471926 3300005440 Bacteria 570
101 Ga0070705_101814950 3300005440 Unclassified 517
102 Ga0070700_100167547 3300005441 Bacteria 1518
103 Ga0070700_100807438 3300005441 Unclassified 756
104 Ga0070694_100013842 3300005444 Bacteria 5045
105 Ga0070694_100322877 3300005444 Bacteria 1189
106 Ga0070694_100867243 3300005444 Bacteria 744
107 Ga0070694_101750504 3300005444 Unclassified 529
108 Ga0070708_100033833 3300005445 Bacteria 4441
109 Ga0070708_100165815 3300005445 Bacteria 2061
110 Ga0070708_100182640 3300005445 Unclassified 1961
111 Ga0070708_100852899 3300005445 Bacteria 856
112 Ga0070708_101458860 3300005445 Bacteria 638
113 Ga0070663_100024320 3300005455 Bacteria 4075
114 Ga0070663_100118302 3300005455 Bacteria 1999
115 Ga0070678_100023683 3300005456 Unclassified 4096
116 Ga0070678_100749113 3300005456 Bacteria 883
117 Ga0070678_101030470 3300005456 Bacteria 757
118 Ga0070678_101269382 3300005456 Bacteria 685
119 Ga0070662_100058636 3300005457 Bacteria 2802
120 Ga0070662_100085694 3300005457 Unclassified 2354
121 Ga0070662_100590736 3300005457 Bacteria 933
122 Ga0070662_101067310 3300005457 Unclassified 692
123 Ga0070681_10003379 3300005458 Bacteria 14927
124 Ga0070681_10013046 3300005458 Bacteria 8252
125 Ga0070681_10026142 3300005458 Bacteria 5870
126 Ga0070681_10371403 3300005458 Bacteria 1341
127 Ga0070681_10741291 3300005458 Bacteria 899
128 Ga0068867_100028830 3300005459 Bacteria 3997
129 Ga0068867_101189124 3300005459 Bacteria 700
130 Ga0070685_10007842 3300005466 Bacteria 5467
131 Ga0070685_11256882 3300005466 Unclassified 564
132 Ga0070706_100004764 3300005467 Bacteria 13011
133 Ga0070706_100043493 3300005467 Bacteria 4151
134 Ga0070706_100284698 3300005467 Bacteria 1542
135 Ga0070706_100672156 3300005467 Bacteria 961
136 Ga0070707_100002038 3300005468 Bacteria 19331
137 Ga0070698_100010227 3300005471 Bacteria 10020
138 Ga0070698_100068315 3300005471 Bacteria 3572
139 Ga0070698_100133341 3300005471 Bacteria 2438
140 Ga0070698_100331131 3300005471 Unclassified 1454
141 Ga0070698_100341116 3300005471 Unclassified 1430
142 Ga0070698_100386996 3300005471 Bacteria 1331
143 Ga0070698_100902779 3300005471 Bacteria 829
144 Ga0070699_100003507 3300005518 Bacteria 13861
145 Ga0070699_100070518 3300005518 Bacteria 3038
146 Ga0070699_100331423 3300005518 Unclassified 1369
147 Ga0070699_100653334 3300005518 Bacteria 960
148 Ga0070699_100899185 3300005518 Bacteria 811
149 Ga0070699_100942130 3300005518 Bacteria 791
150 Ga0070699_101394799 3300005518 Bacteria 643
151 Ga0070699_101457280 3300005518 Bacteria 628
152 Ga0070679_100003063 3300005530 Bacteria 15280
153 Ga0070679_100233674 3300005530 Bacteria 1798
154 Ga0070684_100000634 3300005535 Bacteria 24130
155 Ga0070684_101370312 3300005535 Bacteria 666
156 Ga0070684_101666289 3300005535 Bacteria 602
157 Ga0070697_100241836 3300005536 Unclassified 1541
158 Ga0070697_100284423 3300005536 Bacteria 1419
159 Ga0070697_100328056 3300005536 Unclassified 1319
160 Ga0070697_100356625 3300005536 Bacteria 1264
161 Ga0070697_100940073 3300005536 Unclassified 767
162 Ga0068853_100069721 3300005539 Bacteria 3059
163 Ga0068853_100114904 3300005539 Bacteria 2395
164 Ga0070672_100174911 3300005543 Bacteria 1787
165 Ga0070672_100504614 3300005543 Bacteria 1047
166 Ga0070686_100006796 3300005544 Bacteria 6368
167 Ga0070686_100122399 3300005544 Bacteria 1788
168 Ga0070686_101839624 3300005544 Bacteria 516
169 Ga0070686_101900156 3300005544 Bacteria 508
170 Ga0070695_100083596 3300005545 Bacteria 2115
171 Ga0070695_100224967 3300005545 Bacteria 1354
172 Ga0070695_100431987 3300005545 Bacteria 1005
173 Ga0070695_101281045 3300005545 Bacteria 605
174 Ga0070696_100152824 3300005546 Bacteria 1695
175 Ga0070696_100195626 3300005546 Bacteria 1507
176 Ga0070696_100355183 3300005546 Bacteria 1136
177 Ga0070696_100587896 3300005546 Unclassified 896
178 Ga0070696_101110469 3300005546 Bacteria 665
179 Ga0070693_100095920 3300005547 Bacteria 1797
180 Ga0070693_100131372 3300005547 Bacteria 1566
181 Ga0070693_100219174 3300005547 Bacteria 1246
182 Ga0070693_100705496 3300005547 Unclassified 739
183 Ga0070665_100184545 3300005548 Bacteria 2087
184 Ga0070665_100739652 3300005548 Bacteria 997
185 Ga0070704_100015880 3300005549 Bacteria 4742
186 Ga0070704_100364269 3300005549 Bacteria 1224
187 Ga0070704_100505297 3300005549 Bacteria 1049
188 Ga0070704_101577188 3300005549 Bacteria 605
189 Ga0070704_101677895 3300005549 Bacteria 587
190 Ga0068855_100497248 3300005563 Bacteria 1325
191 Ga0068855_101089611 3300005563 Unclassified 835
192 Ga0068855_101351068 3300005563 Bacteria 736
193 Ga0068855_101849575 3300005563 Bacteria 613
194 Ga0070664_100001324 3300005564 Bacteria 19752
195 Ga0070664_100026787 3300005564 Bacteria 4787
196 Ga0068857_100993146 3300005577 Bacteria 808
197 Ga0068857_101830660 3300005577 Bacteria 594
198 Ga0068854_100730842 3300005578 Bacteria 857
199 Ga0068854_101565407 3300005578 Bacteria 600
200 Ga0068854_101885263 3300005578 Unclassified 549
201 Ga0068856_100005850 3300005614 Bacteria 12119
202 Ga0068856_100029736 3300005614 Bacteria 5336
203 Ga0068856_100106040 3300005614 Bacteria 2804
204 Ga0070702_100038046 3300005615 Bacteria 2676
205 Ga0070702_100133455 3300005615 Bacteria 1571
206 Ga0068852_100070992 3300005616 Bacteria 3057
207 Ga0068852_100934740 3300005616 Bacteria 885
208 Ga0068859_100147263 3300005617 Bacteria 2430
209 Ga0068859_100159693 3300005617 Bacteria 2333
210 Ga0068864_100382039 3300005618 Bacteria 1335
211 Ga0068864_100619472 3300005618 Bacteria 1052
212 Ga0068864_100883778 3300005618 Bacteria 882
213 Ga0068866_10013281 3300005718 Bacteria 3610
214 Ga0068866_10784575 3300005718 Unclassified 661
215 Ga0068861_100327242 3300005719 Bacteria 1337
216 Ga0068861_100393425 3300005719 Unclassified 1228
217 Ga0068851_10151247 3300005834 Unclassified 1269
218 Ga0068870_10499247 3300005840 Bacteria 811
219 Ga0068870_10885118 3300005840 Bacteria 630
220 Ga0068863_100695513 3300005841 Unclassified 1010
221 Ga0068863_102282324 3300005841 Bacteria 551
222 Ga0068860_100045868 3300005843 Bacteria 4168
223 Ga0068860_100937950 3300005843 Bacteria 882
224 Ga0081455_10000380 3300005937 Bacteria 58685
225 Ga0081455_10115812 3300005937 Bacteria 2121
226 Ga0081455_10124410 3300005937 Bacteria 2026
227 Ga0081455_10791391 3300005937 Bacteria 596
228 Ga0081538_10063940 3300005981 Bacteria 2085
229 Ga0081539_10255656 3300005985 Bacteria 776
230 Ga0070717_10050699 3300006028 Bacteria 3412
231 Ga0070717_10714014 3300006028 Bacteria 911
232 Ga0070717_11186737 3300006028 Bacteria 695
233 Ga0075365_10103578 3300006038 Bacteria 1950
234 Ga0075363_100073831 3300006048 Bacteria 1856
235 Ga0070715_10102578 3300006163 Bacteria 1337
236 Ga0070716_100186264 3300006173 Bacteria 1367
237 Ga0070716_100933833 3300006173 Bacteria 682
238 Ga0070716_101306115 3300006173 Bacteria 587
239 Ga0070712_100015819 3300006175 Bacteria 4864
240 Ga0070712_100326804 3300006175 Bacteria 1248
241 Ga0070712_100594406 3300006175 Bacteria 936
242 Ga0097621_100173479 3300006237 Bacteria 1860
243 Ga0097621_100308869 3300006237 Bacteria 1398
244 Ga0097621_100516421 3300006237 Unclassified 1084
245 Ga0097621_101774051 3300006237 Unclassified 588
246 Ga0097621_101830908 3300006237 Bacteria 579
247 Ga0068871_100004038 3300006358 Bacteria 10141
248 Ga0068871_100122770 3300006358 Bacteria 2196
249 Ga0068871_102282319 3300006358 Unclassified 516
250 Ga0075428_100111958 3300006844 Bacteria 2973
251 Ga0075428_100485330 3300006844 Bacteria 1322
252 Ga0075428_100547825 3300006844 Bacteria 1237
253 Ga0075428_100690858 3300006844 Unclassified 1087
254 Ga0075428_100886049 3300006844 Unclassified 947
255 Ga0075430_100012157 3300006846 Bacteria 7329
256 Ga0075430_100067979 3300006846 Bacteria 2990
257 Ga0075430_100656701 3300006846 Bacteria 865
258 Ga0075431_100004509 3300006847 Bacteria 13671
259 Ga0075431_100122533 3300006847 Bacteria 2683
260 Ga0075431_100290587 3300006847 Unclassified 1654
261 Ga0075431_100573692 3300006847 Bacteria 1114
262 Ga0075431_101205288 3300006847 Bacteria 720
263 Ga0075433_10008315 3300006852 Bacteria 8273
264 Ga0075433_10046004 3300006852 Unclassified 3794
265 Ga0075433_10112589 3300006852 Bacteria 2414
266 Ga0075433_10112682 3300006852 Unclassified 2413
267 Ga0075433_10226423 3300006852 Bacteria 1661
268 Ga0075433_10316724 3300006852 Unclassified 1380
269 Ga0075433_10408907 3300006852 Bacteria 1197
270 Ga0075433_10415244 3300006852 Bacteria 1187
271 Ga0075433_10567591 3300006852 Bacteria 997
272 Ga0075433_10766864 3300006852 Bacteria 843
273 Ga0075433_10944564 3300006852 Bacteria 752
274 Ga0075434_100000952 3300006871 Bacteria 23322
275 Ga0075434_100023988 3300006871 Bacteria 5956
276 Ga0075434_100054294 3300006871 Unclassified 3981
277 Ga0075434_100167666 3300006871 Bacteria 2216
278 Ga0075434_100340053 3300006871 Bacteria 1522
279 Ga0075434_100387584 3300006871 Bacteria 1418
280 Ga0075434_100875659 3300006871 Bacteria 913
281 Ga0075434_102079265 3300006871 Unclassified 573
282 Ga0075429_100253453 3300006880 Bacteria 1541
283 Ga0075429_100255460 3300006880 Unclassified 1534
284 Ga0068865_100002544 3300006881 Bacteria 10808
285 Ga0068865_100395841 3300006881 Bacteria 1130
286 Ga0068865_101055268 3300006881 Unclassified 714
287 Ga0068865_101709460 3300006881 Bacteria 567
288 Ga0075436_100027413 3300006914 Bacteria 3920
289 Ga0075436_100087509 3300006914 Bacteria 2164
290 Ga0075436_100211234 3300006914 Bacteria 1376
291 Ga0075436_100462732 3300006914 Bacteria 925
292 Ga0097620_100147261 3300006931 Bacteria 2430
293 Ga0097620_100159695 3300006931 Bacteria 2333
294 Ga0075435_100005736 3300007076 Bacteria 8711
295 Ga0075435_100096103 3300007076 Unclassified 2451
296 Ga0075435_100176127 3300007076 Unclassified 1806
297 Ga0075435_100764130 3300007076 Bacteria 841
298 Ga0075435_100788930 3300007076 Unclassified 827
299 Ga0105240_11873270 3300009093 Bacteria 624
300 Ga0111539_10120525 3300009094 Unclassified 3074
301 Ga0111539_10617451 3300009094 Bacteria 1263
302 Ga0111539_10971698 3300009094 Unclassified 987
303 Ga0111539_11134294 3300009094 Bacteria 908
304 Ga0111539_11810310 3300009094 Bacteria 708
305 Ga0105245_10038631 3300009098 Bacteria 4247
306 Ga0105245_10133461 3300009098 Unclassified 2331
307 Ga0105245_10556325 3300009098 Bacteria 1169
308 Ga0105245_10655210 3300009098 Bacteria 1080
309 Ga0105245_11307625 3300009098 Unclassified 774
310 Ga0105245_11312138 3300009098 Bacteria 773
311 Ga0105247_10225374 3300009101 Bacteria 1271
312 Ga0105247_10828864 3300009101 Unclassified 708
313 Ga0114129_10017997 3300009147 Bacteria 10062
314 Ga0114129_10036998 3300009147 Bacteria 6891
315 Ga0114129_10084947 3300009147 Bacteria 4392
316 Ga0114129_10125006 3300009147 Bacteria 3537
317 Ga0114129_10215223 3300009147 Bacteria 2595
318 Ga0114129_10384400 3300009147 Bacteria 1853
319 Ga0114129_10858768 3300009147 Bacteria 1153
320 Ga0114129_10915858 3300009147 Bacteria 1110
321 Ga0114129_11055888 3300009147 Bacteria 1019
322 Ga0114129_11636291 3300009147 Bacteria 787
323 Ga0114129_12666162 3300009147 Bacteria 596
324 Ga0114129_13196924 3300009147 Unclassified 533
325 Ga0105243_10028603 3300009148 Bacteria 4280
326 Ga0105243_10042188 3300009148 Unclassified 3571
327 Ga0105243_10251139 3300009148 Bacteria 1579
328 Ga0105243_10555925 3300009148 Bacteria 1097
329 Ga0105243_10880820 3300009148 Bacteria 889
330 Ga0105243_12253155 3300009148 Unclassified 582
331 Ga0105241_10031940 3300009174 Bacteria 3943
332 Ga0105241_10104276 3300009174 Bacteria 2259
333 Ga0105242_10033342 3300009176 Bacteria 4123
334 Ga0105242_10168398 3300009176 Bacteria 1923
335 Ga0105242_10470451 3300009176 Unclassified 1189
336 Ga0105242_11269349 3300009176 Unclassified 759
337 Ga0105242_12499890 3300009176 Bacteria 565
338 Ga0105242_12574333 3300009176 Bacteria 558
339 Ga0105248_10038075 3300009177 Bacteria 5382
340 Ga0105248_10148863 3300009177 Bacteria 2641
341 Ga0105248_12153101 3300009177 Bacteria 634
342 Ga0105237_10989364 3300009545 Bacteria 848
343 Ga0105238_10130585 3300009551 Bacteria 2490
344 Ga0105238_10944455 3300009551 Bacteria 882
345 Ga0105249_10144561 3300009553 Bacteria 2284
346 Ga0105249_10161606 3300009553 Bacteria 2165
347 Ga0105239_10021863 3300010375 Bacteria 7051
348 Ga0105239_10806330 3300010375 Bacteria 1076
349 Ga0105239_12101654 3300010375 Unclassified 656
350 Ga0105239_13524585 3300010375 Bacteria 509
351 Ga0105246_10032927 3300011119 Bacteria 3440
352 Ga0105246_10074911 3300011119 Bacteria 2394
353 Ga0105246_10153466 3300011119 Bacteria 1746
354 Ga0105246_10220806 3300011119 Unclassified 1485
355 Ga0105246_10571753 3300011119 Bacteria 972
356 Ga0157314_1006438 3300012500 Bacteria 920
357 Ga0157371_10398773 3300013102 Bacteria 1006
358 Ga0157371_10799652 3300013102 Bacteria 711
359 Ga0157371_11019147 3300013102 Bacteria 632
360 Ga0157370_11981648 3300013104 Bacteria 522
361 Ga0157369_10409315 3300013105 Bacteria 1407
362 Ga0157369_10851924 3300013105 Unclassified 936
363 Ga0157374_10003624 3300013296 Bacteria 12994
364 Ga0157374_10035114 3300013296 Unclassified 4586
365 Ga0157374_10058576 3300013296 Bacteria 3600
366 Ga0157374_10337487 3300013296 Unclassified 1495
367 Ga0157378_10082685 3300013297 Bacteria 2904
368 Ga0157378_10244342 3300013297 Bacteria 1716
369 Ga0157378_10344708 3300013297 Bacteria 1454
370 Ga0157378_10567261 3300013297 Bacteria 1142
371 Ga0157378_11037074 3300013297 Bacteria 855
372 Ga0157378_11684521 3300013297 Unclassified 681
373 Ga0157378_12205434 3300013297 Bacteria 602
374 Ga0157378_12409186 3300013297 Bacteria 578
375 Ga0163162_10015451 3300013306 Bacteria 7460
376 Ga0163162_10119829 3300013306 Bacteria 2735
377 Ga0163162_11415164 3300013306 Bacteria 791
378 Ga0163162_12686126 3300013306 Unclassified 573
379 Ga0157372_10106332 3300013307 Bacteria 3210
380 Ga0157372_10504078 3300013307 Unclassified 1411
381 Ga0157372_11994921 3300013307 Bacteria 667
382 Ga0157375_10004528 3300013308 Bacteria 12077
383 Ga0157375_10188691 3300013308 Bacteria 2216
384 Ga0157375_10202258 3300013308 Unclassified 2142
385 Ga0157375_10497979 3300013308 Bacteria 1383
386 Ga0157375_10555130 3300013308 Bacteria 1310
387 Ga0163163_10153148 3300014325 Bacteria 2349
388 Ga0163163_10317257 3300014325 Bacteria 1612
389 Ga0163163_10579143 3300014325 Bacteria 1185
390 Ga0163163_10693821 3300014325 Bacteria 1082
391 Ga0157380_10106664 3300014326 Bacteria 2345
392 Ga0157380_11272072 3300014326 Bacteria 782
393 Ga0157380_11671359 3300014326 Bacteria 694
394 Ga0157380_12566042 3300014326 Bacteria 576
395 Ga0157380_12691376 3300014326 Bacteria 564
396 Ga0157377_10003876 3300014745 Bacteria 6814
397 Ga0157377_10436502 3300014745 Bacteria 901
398 Ga0157377_10439370 3300014745 Bacteria 898
399 Ga0157379_10811926 3300014968 Bacteria 883
400 Ga0157379_10844039 3300014968 Bacteria 866
401 Ga0157376_10007962 3300014969 Bacteria 7604
402 Ga0157376_10042364 3300014969 Bacteria 3731
403 Ga0157376_11400079 3300014969 Unclassified 731
404 Ga0157376_12710327 3300014969 Unclassified 536
405 Ga0182007_10036999 3300015262 Bacteria 1640
406 Ga0182005_1262778 3300015265 Bacteria 537
407 Ga0163161_10062387 3300017792 Bacteria 2715
408 Ga0163161_10277807 3300017792 Bacteria 1313
409 Ga0163161_11296291 3300017792 Bacteria 633
410 Ga0206350_10706521 3300020080 Unclassified 898
411 Ga0207697_10003782 3300025315 Bacteria 7389
412 Ga0207653_10031353 3300025885 Bacteria 1717
413 Ga0207682_10267574 3300025893 Bacteria 798
414 Ga0207692_10116434 3300025898 Bacteria 1490
415 Ga0207642_10041691 3300025899 Bacteria 2012
416 Ga0207688_10007295 3300025901 Bacteria 6014
417 Ga0207688_10082165 3300025901 Bacteria 1841
418 Ga0207680_10277619 3300025903 Bacteria 1163
419 Ga0207685_10082309 3300025905 Bacteria 1335
420 Ga0207685_10569617 3300025905 Bacteria 604
421 Ga0207699_10540698 3300025906 Bacteria 844
422 Ga0207699_10579859 3300025906 Bacteria 815
423 Ga0207699_10638913 3300025906 Unclassified 777
424 Ga0207645_10005624 3300025907 Bacteria 9060
425 Ga0207645_10398374 3300025907 Bacteria 925
426 Ga0207645_10409774 3300025907 Bacteria 912
427 Ga0207643_10072386 3300025908 Bacteria 1985
428 Ga0207705_10202503 3300025909 Bacteria 1504
429 Ga0207684_10031300 3300025910 Bacteria 4526
430 Ga0207684_10188568 3300025910 Bacteria 1778
431 Ga0207684_11143875 3300025910 Unclassified 646
432 Ga0207654_10030702 3300025911 Bacteria 2952
433 Ga0207654_10647457 3300025911 Bacteria 757
434 Ga0207654_10987972 3300025911 Bacteria 612
435 Ga0207707_10011900 3300025912 Bacteria 7570
436 Ga0207707_10040791 3300025912 Bacteria 4054
437 Ga0207707_10050201 3300025912 Bacteria 3635
438 Ga0207707_10500414 3300025912 Unclassified 1036
439 Ga0207693_10000406 3300025915 Bacteria 39259
440 Ga0207693_10037141 3300025915 Bacteria 3839
441 Ga0207693_10095453 3300025915 Bacteria 2331
442 Ga0207663_10168956 3300025916 Bacteria 1551
443 Ga0207660_10001253 3300025917 Bacteria 17006
444 Ga0207660_10162633 3300025917 Bacteria 1723
445 Ga0207660_10318832 3300025917 Bacteria 1241
446 Ga0207660_10662922 3300025917 Unclassified 851
447 Ga0207660_11575970 3300025917 Bacteria 530
448 Ga0207662_10025152 3300025918 Unclassified 3428
449 Ga0207662_10112777 3300025918 Bacteria 1697
450 Ga0207657_10011355 3300025919 Bacteria 8847
451 Ga0207657_10018755 3300025919 Bacteria 6590
452 Ga0207657_10127884 3300025919 Bacteria 2085
453 Ga0207649_10037277 3300025920 Bacteria 2936
454 Ga0207649_10043667 3300025920 Bacteria 2742
455 Ga0207652_10002068 3300025921 Bacteria 17274
456 Ga0207652_10006890 3300025921 Bacteria 9157
457 Ga0207652_10342097 3300025921 Bacteria 1350
458 Ga0207646_10016601 3300025922 Bacteria 6906
459 Ga0207646_10536157 3300025922 Bacteria 1053
460 Ga0207646_11172979 3300025922 Bacteria 674
461 Ga0207681_10350171 3300025923 Bacteria 1182
462 Ga0207681_10778724 3300025923 Unclassified 798
463 Ga0207681_10968888 3300025923 Bacteria 713
464 Ga0207650_10001105 3300025925 Bacteria 19847
465 Ga0207650_10125019 3300025925 Unclassified 2007
466 Ga0207650_10649397 3300025925 Unclassified 889
467 Ga0207659_10041333 3300025926 Unclassified 3228
468 Ga0207659_10046872 3300025926 Bacteria 3055
469 Ga0207659_11500368 3300025926 Unclassified 577
470 Ga0207687_10004309 3300025927 Bacteria 9502
471 Ga0207687_10054274 3300025927 Bacteria 2803
472 Ga0207687_10698160 3300025927 Bacteria 861
473 Ga0207687_11572232 3300025927 Unclassified 564
474 Ga0207687_11921744 3300025927 Unclassified 506
475 Ga0207700_10365287 3300025928 Bacteria 1259
476 Ga0207700_10951756 3300025928 Bacteria 769
477 Ga0207664_10006068 3300025929 Bacteria 8275
478 Ga0207664_10293062 3300025929 Bacteria 1430
479 Ga0207664_10819988 3300025929 Bacteria 837
480 Ga0207644_10324060 3300025931 Bacteria 1246
481 Ga0207644_10553030 3300025931 Bacteria 953
482 Ga0207690_10149500 3300025932 Bacteria 1730
483 Ga0207690_10165037 3300025932 Bacteria 1654
484 Ga0207690_11323266 3300025932 Unclassified 602
485 Ga0207706_10004096 3300025933 Bacteria 13775
486 Ga0207706_10134372 3300025933 Unclassified 2176
487 Ga0207706_10397329 3300025933 Bacteria 1195
488 Ga0207706_10423444 3300025933 Bacteria 1153
489 Ga0207706_11031607 3300025933 Unclassified 690
490 Ga0207686_10535455 3300025934 Unclassified 914
491 Ga0207709_10009766 3300025935 Bacteria 5289
492 Ga0207709_10023343 3300025935 Bacteria 3520
493 Ga0207670_10237202 3300025936 Bacteria 1403
494 Ga0207670_10570902 3300025936 Unclassified 926
495 Ga0207669_10021079 3300025937 Bacteria 3432
496 Ga0207669_10050219 3300025937 Bacteria 2492
497 Ga0207669_10426255 3300025937 Bacteria 1045
498 Ga0207704_10170706 3300025938 Bacteria 1560
499 Ga0207704_10233568 3300025938 Bacteria 1369
500 Ga0207704_10241856 3300025938 Bacteria 1349
501 Ga0207704_11051727 3300025938 Bacteria 690
502 Ga0207665_10066334 3300025939 Bacteria 2456
503 Ga0207665_10351731 3300025939 Bacteria 1112
504 Ga0207665_10387471 3300025939 Bacteria 1062
505 Ga0207665_11382218 3300025939 Unclassified 561
506 Ga0207691_10024161 3300025940 Bacteria 5715
507 Ga0207691_10029192 3300025940 Bacteria 5159
508 Ga0207691_10340186 3300025940 Bacteria 1284
509 Ga0207711_10219939 3300025941 Bacteria 1737
510 Ga0207711_11301078 3300025941 Unclassified 669
511 Ga0207711_12153562 3300025941 Unclassified 500
512 Ga0207689_10119157 3300025942 Bacteria 2171
513 Ga0207661_10001504 3300025944 Bacteria 15791
514 Ga0207661_10716495 3300025944 Bacteria 921
515 Ga0207661_11018262 3300025944 Unclassified 763
516 Ga0207679_10038022 3300025945 Bacteria 3427
517 Ga0207667_10175533 3300025949 Bacteria 2201
518 Ga0207651_10070351 3300025960 Unclassified 2475
519 Ga0207651_10655614 3300025960 Bacteria 922
520 Ga0207651_10725483 3300025960 Bacteria 877
521 Ga0207712_10390720 3300025961 Bacteria 1167
522 Ga0207712_10440224 3300025961 Bacteria 1103
523 Ga0207668_10262900 3300025972 Unclassified 1407
524 Ga0207668_10356053 3300025972 Bacteria 1225
525 Ga0207668_11760930 3300025972 Unclassified 559
526 Ga0207640_10124217 3300025981 Bacteria 1855
527 Ga0207640_10591224 3300025981 Bacteria 938
528 Ga0207640_10858301 3300025981 Bacteria 790
529 Ga0207640_11533209 3300025981 Bacteria 599
530 Ga0207658_10448497 3300025986 Bacteria 1142
531 Ga0207677_10086544 3300026023 Bacteria 2265
532 Ga0207677_10140893 3300026023 Bacteria 1846
533 Ga0207677_11245250 3300026023 Bacteria 682
534 Ga0207703_11890608 3300026035 Bacteria 573
535 Ga0207639_10268493 3300026041 Unclassified 1495
536 Ga0207678_10003484 3300026067 Bacteria 14159
537 Ga0207678_10017335 3300026067 Bacteria 6322
538 Ga0207678_10183412 3300026067 Bacteria 1787
539 Ga0207708_10004802 3300026075 Bacteria 9953
540 Ga0207708_10300178 3300026075 Bacteria 1306
541 Ga0207708_10574598 3300026075 Archaea 953
542 Ga0207702_10007087 3300026078 Bacteria 9590
543 Ga0207702_10082982 3300026078 Bacteria 2788
544 Ga0207702_10435923 3300026078 Bacteria 1269
545 Ga0207641_10423545 3300026088 Bacteria 1282
546 Ga0207641_11006243 3300026088 Unclassified 830
547 Ga0207648_10001155 3300026089 Bacteria 29566
548 Ga0207648_10292297 3300026089 Bacteria 1459
549 Ga0207648_10731419 3300026089 Bacteria 918
550 Ga0207648_12054019 3300026089 Unclassified 533
551 Ga0207676_10088388 3300026095 Bacteria 2537
552 Ga0207676_10539478 3300026095 Bacteria 1113
553 Ga0207676_11251068 3300026095 Bacteria 736
554 Ga0207674_11222507 3300026116 Bacteria 721
555 Ga0207675_100065036 3300026118 Bacteria 3409
556 Ga0207675_100175058 3300026118 Bacteria 2053
557 Ga0207675_100311620 3300026118 Bacteria 1535
558 Ga0207675_100769095 3300026118 Bacteria 975
559 Ga0207683_10001368 3300026121 Bacteria 22057
560 Ga0207683_10022734 3300026121 Bacteria 5385
561 Ga0207683_10043811 3300026121 Bacteria 3911
562 Ga0207698_10339997 3300026142 Bacteria 1413
563 Ga0207698_10737479 3300026142 Unclassified 983
564 Ga0207698_12182957 3300026142 Unclassified 567
565 Ga0209984_1027167 3300027424 Unclassified 801
566 Ga0210000_1009531 3300027462 Bacteria 1430
567 Ga0209968_1028095 3300027526 Bacteria 933
568 Ga0209982_1054123 3300027552 Bacteria 649
569 Ga0209970_1010762 3300027614 Bacteria 1499
570 Ga0210002_1025406 3300027617 Bacteria 969
571 Ga0209983_1010383 3300027665 Bacteria 1904
572 Ga0209971_1002140 3300027682 Bacteria 4805
573 Ga0209971_1025794 3300027682 Bacteria 1404
574 Ga0209998_10002978 3300027717 Bacteria 3776
575 Ga0209974_10000172 3300027876 Bacteria 19968
576 Ga0207428_10335863 3300027907 Bacteria 1114
577 Ga0207428_10796234 3300027907 Unclassified 672
578 Ga0268266_10250841 3300028379 Bacteria 1637
579 Ga0268266_10696775 3300028379 Bacteria 979
580 Ga0268265_10749286 3300028380 Bacteria 948
581 Ga0268265_12187100 3300028380 Unclassified 560
582 Ga0268264_10516690 3300028381 Bacteria 1167
583 Ga0268264_10674117 3300028381 Bacteria 1025
584 Ga0268264_12510556 3300028381 Bacteria 520
585 Ga0265326_10016113 3300028558 Bacteria 2162
586 Ga0265319_1001334 3300028563 Bacteria 14893
587 Ga0265319_1002094 3300028563 Bacteria 11181
588 Ga0265319_1064540 3300028563 Bacteria 1182
589 Ga0265319_1248877 3300028563 Bacteria 542
590 Ga0265334_10000322 3300028573 Bacteria 26260
591 Ga0265334_10010198 3300028573 Bacteria 3966
592 Ga0265334_10011959 3300028573 Bacteria 3646
593 Ga0265334_10044976 3300028573 Bacteria 1711
594 Ga0265318_10001871 3300028577 Bacteria 11838
595 Ga0265318_10005443 3300028577 Bacteria 5979
596 Ga0265323_10108406 3300028653 Bacteria 913
597 Ga0265322_10002108 3300028654 Bacteria 6229
598 Ga0265322_10199678 3300028654 Bacteria 572
599 Ga0265336_10018293 3300028666 Bacteria 2271
600 Ga0265336_10184334 3300028666 Bacteria 620
601 Ga0265338_10003330 3300028800 Bacteria 22715
602 Ga0265338_10006995 3300028800 Bacteria 14168
603 Ga0265338_10022905 3300028800 Bacteria 6445
604 Ga0265338_10090464 3300028800 Bacteria 2532
605 Ga0265338_10097530 3300028800 Bacteria 2408
606 Ga0265338_10520521 3300028800 Bacteria 835
607 Ga0265324_10055753 3300029957 Bacteria 1355
608 Ga0265330_10003034 3300031235 Bacteria 8912
609 Ga0265330_10031370 3300031235 Unclassified 2382
610 Ga0265332_10027056 3300031238 Bacteria 2513
611 Ga0265332_10047516 3300031238 Unclassified 1847
612 Ga0265328_10004790 3300031239 Bacteria 5842
613 Ga0265320_10028343 3300031240 Bacteria 2908
614 Ga0265320_10054006 3300031240 Bacteria 1940
615 Ga0265320_10067175 3300031240 Unclassified 1697
616 Ga0265320_10128489 3300031240 Bacteria 1152
617 Ga0265325_10011495 3300031241 Bacteria 5084
618 Ga0265325_10063780 3300031241 Unclassified 1864
619 Ga0265329_10019276 3300031242 Bacteria 2318
620 Ga0265340_10008992 3300031247 Bacteria 5379
621 Ga0265340_10012083 3300031247 Bacteria 4567
622 Ga0265339_10007646 3300031249 Bacteria 6959
623 Ga0265339_10047116 3300031249 Bacteria 2367
624 Ga0265339_10143175 3300031249 Bacteria 1214
625 Ga0265331_10002581 3300031250 Bacteria 12179
626 Ga0265327_10004211 3300031251 Bacteria 12930
627 Ga0265327_10044043 3300031251 Bacteria 2382
628 Ga0265316_10017801 3300031344 Bacteria 6125
629 Ga0265316_10021439 3300031344 Bacteria 5471
630 Ga0307408_100034320 3300031548 Bacteria 3553
631 Ga0265313_10006244 3300031595 Bacteria 8506
632 Ga0265313_10014033 3300031595 Bacteria 4768
633 Ga0265313_10037004 3300031595 Bacteria 2446
634 Ga0316575_10270804 3300031665 Bacteria 715
635 Ga0316579_10001025 3300031691 Bacteria 9840
636 Ga0265314_10002715 3300031711 Bacteria 17709
637 Ga0265314_10105890 3300031711 Bacteria 1797
638 Ga0265342_10041110 3300031712 Bacteria 2801
639 Ga0265342_10075846 3300031712 Bacteria 1949
640 Ga0316578_10298545 3300031728 Bacteria 963
641 Ga0307405_10069030 3300031731 Bacteria 2264
642 Ga0316577_10044611 3300031733 Bacteria 2480
643 Ga0307410_10810593 3300031852 Bacteria 797
644 Ga0307406_10039612 3300031901 Bacteria 2925
645 Ga0307412_10015147 3300031911 Bacteria 4563
646 Ga0307409_100082546 3300031995 Bacteria 2602
647 Ga0307416_100507537 3300032002 Bacteria 1271
648 Ga0316593_10001140 3300032168 Bacteria 5632
649 Ga0373944_0108474 3300035089 Unclassified 945
650 Ga0373944_0364219 3300035089 Bacteria 552
651 Ga0373952_0049961 3300035092 Unclassified 994
652 Ga0373923_0257598 3300035111 Bacteria 818
653 Ga0373923_0313069 3300035111 Bacteria 745
654 Ga0373932_0051433 3300035112 Bacteria 1224
655 Ga0373932_0340694 3300035112 Unclassified 568
656 Ga0373936_0462244 3300035113 Bacteria 588
657 Ga0373939_0240948 3300035114 Bacteria 700
658 Ga0373945_0074096 3300035116 Bacteria 1294
659 Ga0373956_0199189 3300035119 Bacteria 949
660 Ga0373946_0139395 3300035171 Bacteria 1123
661 Ga0373961_0246874 3300035241 Unclassified 645
662 Ga0373962_0109860 3300035242 Bacteria 869
663 Ga0373962_0148032 3300035242 Bacteria 767
664 Ga0373931_0009347 3300035691 Unclassified 4685
665 Ga0373931_0105006 3300035691 Bacteria 1594
666 Ga0373931_0287847 3300035691 Bacteria 1011
667 Ga0373935_0070171 3300035692 Bacteria 2258
668 Ga0373935_0208180 3300035692 Bacteria 1354
669 Ga0373935_0546524 3300035692 Unclassified 844
670 Ga0373927_0116197 3300035695 Bacteria 1745
671 Ga0373937_0063777 3300036401 Bacteria 3389
672 Ga0316582_0000662 3300036647 Bacteria 13499
673 Ga0316584_0010521 3300036712 Bacteria 6470
674 Ga0373925_0298362 3300037068 Bacteria 1301
675 Ga0373925_0893000 3300037068 Bacteria 732
676 Ga0395899_0003270 3300037312 Bacteria 12847
677 Ga0395899_0033443 3300037312 Bacteria 3861
678 Ga0395899_0414557 3300037312 Bacteria 888
679 Ga0395900_0022252 3300037418 Bacteria 6486
680 Ga0395900_0024871 3300037418 Bacteria 6128
681 Ga0395900_0126297 3300037418 Bacteria 2623
682 Ga0395900_0501942 3300037418 Bacteria 1163
683 Ga0395900_0631020 3300037418 Bacteria 1010
684 Ga0395900_0917298 3300037418 Bacteria 799
685 Ga0395898_0003471 3300037466 Bacteria 17603
686 Ga0395898_0009931 3300037466 Bacteria 9969
687 Ga0395898_0161150 3300037466 Bacteria 2145
688 Ga0395898_0578424 3300037466 Bacteria 1065
689 Ga0395898_1053946 3300037466 Bacteria 748
690 Ga0395905_0052710 3300037471 Bacteria 3808
691 Ga0395905_0066323 3300037471 Bacteria 3380
692 Ga0395905_0256517 3300037471 Bacteria 1633
693 Ga0395905_0345425 3300037471 Bacteria 1379
694 Ga0316581_0001886 3300037588 Bacteria 4884
695 Ga0395901_0024550 3300038443 Bacteria 6189
696 Ga0395901_0172907 3300038443 Bacteria 2266
697 Ga0395901_0182269 3300038443 Bacteria 2202
698 Ga0395901_0283990 3300038443 Bacteria 1719
699 Ga0395901_0626734 3300038443 Bacteria 1081
700 Ga0242420_055523 3300038996 Bacteria 782
701 Ga0436360_0959266 3300039438 Bacteria 1673
702 Ga0451798_0326687 3300041458 Bacteria 893
703 Ga0451802_0368654 3300041460 Bacteria 628
704 Ga0451853_2372324 3300041512 Bacteria 536
705 Ga0451853_2728074 3300041512 Bacteria 782
706 Ga0450905_021693 3300042142 Bacteria 951
707 Ga0466963_0120056 3300044694 Bacteria 1808
708 Ga0453684_0159451 3300044712 Unclassified 2670
709 Ga0466968_0297620 3300044735 Archaea 775
710 Ga0466957_0053182 3300044842 Bacteria 2468
711 Ga0466957_0349182 3300044842 Bacteria 1003
712 Ga0466957_0751448 3300044842 Bacteria 691
713 Ga0466960_0898405 3300044901 Bacteria 540
714 Ga0451576_0080051 3300045051 Bacteria 3399
715 Ga0451576_0458790 3300045051 Unclassified 1338
716 Ga0451576_0914256 3300045051 Unclassified 920
717 Ga0466958_0035946 3300045836 Bacteria 2962
718 Ga0466958_0461954 3300045836 Bacteria 822
719 Ga0466967_0485790 3300045976 Unclassified 1210
720 Ga0466967_0618600 3300045976 Bacteria 1070
721 Ga0466967_2178838 3300045976 Bacteria 550
722 Ga0495603_0076715 3300046455 Bacteria 1961
723 Ga0495603_0195120 3300046455 Bacteria 1170
724 Ga0495629_0053496 3300046459 Bacteria 2824
725 Ga0495629_0921436 3300046459 Bacteria 572
726 Ga0495629_0993267 3300046459 Unclassified 547
727 Ga0495641_0128025 3300046461 Bacteria 1133
728 Ga0495641_0143319 3300046461 Bacteria 1067
729 Ga0495641_0183396 3300046461 Bacteria 937
730 Ga0495641_0290946 3300046461 Bacteria 736
731 Ga0495653_0506740 3300046463 Bacteria 752
732 Ga0495580_0128707 3300046472 Bacteria 1757
733 Ga0495580_0459923 3300046472 Unclassified 853
734 Ga0495582_0055327 3300046473 Bacteria 2187
735 Ga0495582_0067352 3300046473 Bacteria 1978
736 Ga0495582_0237333 3300046473 Bacteria 1045
737 Ga0495605_0156860 3300046474 Unclassified 1012
738 Ga0495605_0226456 3300046474 Bacteria 806
739 Ga0495605_0278895 3300046474 Bacteria 711
740 Ga0495639_0053402 3300046475 Bacteria 1841
741 Ga0495584_0081020 3300046491 Bacteria 1634
742 Ga0495584_0096017 3300046491 Bacteria 1497
743 Ga0495584_0184057 3300046491 Bacteria 1061
744 Ga0495585_0125181 3300046492 Bacteria 1357
745 Ga0495594_0232371 3300046499 Bacteria 1051
746 Ga0495594_0437822 3300046499 Bacteria 743
747 Ga0495594_0602332 3300046499 Bacteria 623
748 Ga0495596_0133685 3300046500 Bacteria 963
749 Ga0495618_0404144 3300046514 Bacteria 835
750 Ga0495630_0490291 3300046517 Unclassified 942
751 Ga0495630_1125567 3300046517 Bacteria 595
752 Ga0495632_0436902 3300046519 Bacteria 569
753 Ga0495644_0130386 3300046523 Bacteria 958
754 Ga0495644_0215673 3300046523 Bacteria 741
755 Ga0495644_0447391 3300046523 Unclassified 514
756 Ga0495663_0131090 3300046525 Bacteria 845
757 Ga0495663_0343527 3300046525 Bacteria 543
758 Ga0495642_0040762 3300046528 Bacteria 1887
759 Ga0495642_0183693 3300046528 Bacteria 910
760 Ga0495665_0154227 3300046531 Bacteria 1198
761 Ga0495586_0283847 3300046535 Bacteria 948
762 Ga0495598_0353795 3300046537 Bacteria 566
763 Ga0495609_0090509 3300046538 Bacteria 1331
764 Ga0495609_0188628 3300046538 Bacteria 866
765 Ga0495609_0224261 3300046538 Unclassified 780
766 Ga0495633_0196479 3300046558 Bacteria 927
767 Ga0495633_0322686 3300046558 Bacteria 701
768 Ga0495656_0046893 3300046615 Bacteria 1830
769 Ga0495656_0329901 3300046615 Bacteria 787
770 Ga0495634_0339551 3300046642 Bacteria 901
771 Ga0495634_0507867 3300046642 Unclassified 706
772 Ga0495635_0291771 3300046663 Bacteria 1094
773 Ga0495635_0943897 3300046663 Bacteria 551
774 Ga0495659_0008068 3300046664 Bacteria 3344
775 Ga0495661_0370088 3300046665 Unclassified 702
776 Ga0495588_0129807 3300046674 Bacteria 1329
777 Ga0495588_0371867 3300046674 Bacteria 751
778 Ga0495657_0500747 3300046675 Bacteria 708
779 Ga0495647_0008542 3300046681 Bacteria 3445
780 Ga0495647_0040462 3300046681 Bacteria 1771
781 Ga0495658_0314091 3300046683 Bacteria 992
782 Ga0495658_0513795 3300046683 Bacteria 767
783 Ga0495613_0342085 3300046689 Bacteria 1029
784 Ga0495613_0418582 3300046689 Bacteria 912
785 Ga0495613_0458627 3300046689 Bacteria 863
786 Ga0495613_1015565 3300046689 Bacteria 532
787 Ga0495670_0125502 3300046691 Bacteria 1336
788 Ga0495671_0123217 3300046692 Bacteria 1264
789 Ga0495589_0162387 3300046794 Bacteria 1064
790 Ga0495581_0001339 3300047315 Bacteria 13606
791 Ga0495581_0026920 3300047315 Bacteria 3334
792 Ga0495636_0232906 3300047318 Bacteria 848
793 Ga0495674_0932136 3300047319 Bacteria 669
794 Ga0495676_0112220 3300047321 Bacteria 1998
795 Ga0495680_0196753 3300047322 Unclassified 1448
796 Ga0495680_0305903 3300047322 Bacteria 1115
797 Ga0495683_0416222 3300047323 Bacteria 556
798 Ga0495677_0033528 3300047445 Bacteria 1872
799 Ga0495677_0243218 3300047445 Bacteria 703
800 Ga0495685_303962 3300047447 Unclassified 501
801 Ga0495684_0881134 3300047471 Bacteria 578
802 Ga0495684_1060006 3300047471 Bacteria 511
803 Ga0495614_0083571 3300048089 Bacteria 1385
804 Ga0495614_0259594 3300048089 Bacteria 796
805 Ga0496100_0064483 3300048903 Bacteria 2424
806 Ga0496100_0346477 3300048903 Unclassified 1121
807 Ga0496100_1099190 3300048903 Bacteria 626
808 Ga0496101_0012096 3300048904 Bacteria 5752
809 Ga0496101_0064414 3300048904 Bacteria 2670
810 Ga0496101_0084510 3300048904 Bacteria 2350
811 Ga0496101_0675783 3300048904 Unclassified 816
812 Ga0496102_0001619 3300048905 Bacteria 19836
813 Ga0496102_0003519 3300048905 Bacteria 13271
814 Ga0496102_0270062 3300048905 Bacteria 1603
815 Ga0496102_0305497 3300048905 Bacteria 1499
816 Ga0496102_0457413 3300048905 Bacteria 1197
817 Ga0496102_1278023 3300048905 Bacteria 653
818 Ga0496103_0003260 3300048906 Bacteria 9944
819 Ga0496103_0029954 3300048906 Bacteria 3309
820 Ga0496103_0043372 3300048906 Bacteria 2769
821 Ga0496103_0536027 3300048906 Unclassified 748
822 Ga0496104_0000698 3300048907 Bacteria 28892
823 Ga0496104_0001046 3300048907 Bacteria 23659
824 Ga0496104_0009894 3300048907 Bacteria 8513
825 Ga0496104_0356211 3300048907 Unclassified 1376
826 Ga0496104_0588316 3300048907 Bacteria 1023
827 Ga0496105_0000377 3300048908 Bacteria 29481
828 Ga0496105_0048769 3300048908 Bacteria 3495
829 Ga0496105_0129487 3300048908 Bacteria 2081
830 Ga0496105_0232354 3300048908 Bacteria 1498
831 Ga0496105_1421653 3300048908 Unclassified 502
832 Ga0496106_0124286 3300048909 Bacteria 2019
833 Ga0496106_0218534 3300048909 Bacteria 1519
834 Ga0496106_1110412 3300048909 Bacteria 619
835 Ga0496106_1399612 3300048909 Unclassified 540
836 Ga0496107_0011180 3300048910 Bacteria 6249
837 Ga0496107_0116854 3300048910 Bacteria 1964
838 Ga0496107_0355417 3300048910 Bacteria 1090
839 Ga0496107_0777274 3300048910 Bacteria 702
840 Ga0496108_0022580 3300048911 Bacteria 5174
841 Ga0496108_0058653 3300048911 Bacteria 3236
842 Ga0496108_0079904 3300048911 Bacteria 2769
843 Ga0496108_0138930 3300048911 Bacteria 2092
844 Ga0496108_1162091 3300048911 Unclassified 654
845 Ga0496109_0000283 3300048912 Bacteria 48503
846 Ga0496109_0008233 3300048912 Bacteria 8851
847 Ga0496109_0018123 3300048912 Bacteria 6182
848 Ga0496109_0030646 3300048912 Bacteria 4821
849 Ga0496109_0297884 3300048912 Bacteria 1521
850 Ga0496109_0336530 3300048912 Bacteria 1425
851 Ga0496109_0781339 3300048912 Bacteria 893
852 Ga0496110_0000421 3300048913 Bacteria 28725
853 Ga0496110_0053942 3300048913 Unclassified 3536
854 Ga0496110_0074374 3300048913 Unclassified 3017
855 Ga0496110_0131141 3300048913 Bacteria 2263
856 Ga0496110_0988482 3300048913 Bacteria 749
857 Ga0496110_1365033 3300048913 Bacteria 618
858 Ga0496111_0010483 3300048914 Bacteria 6222
859 Ga0496111_0011174 3300048914 Bacteria 6042
860 Ga0496111_0094587 3300048914 Bacteria 2192
861 Ga0496111_0248317 3300048914 Bacteria 1321
862 Ga0496112_0020222 3300048915 Bacteria 6304
863 Ga0496112_0028386 3300048915 Bacteria 5400
864 Ga0496112_0031596 3300048915 Bacteria 5137
865 Ga0496112_0164841 3300048915 Bacteria 2182
866 Ga0496112_0966738 3300048915 Bacteria 772
867 Ga0496112_1010401 3300048915 Bacteria 751
868 Ga0496113_0020678 3300048916 Bacteria 4633
869 Ga0496113_0049095 3300048916 Bacteria 3142
870 Ga0496113_0076488 3300048916 Bacteria 2557
871 Ga0496113_0476916 3300048916 Bacteria 1002
872 Ga0496113_0591410 3300048916 Bacteria 889
873 Ga0496113_0617693 3300048916 Unclassified 868
874 Ga0496114_0000356 3300048917 Bacteria 33554
875 Ga0496114_0000404 3300048917 Bacteria 31906
876 Ga0496114_0028777 3300048917 Bacteria 4562
877 Ga0496114_0556489 3300048917 Bacteria 1013
878 Ga0496114_0625826 3300048917 Bacteria 948
879 Ga0496115_0005787 3300048918 Bacteria 9000
880 Ga0496115_0022227 3300048918 Bacteria 4912
881 Ga0496115_0212232 3300048918 Bacteria 1599
882 Ga0496115_0904930 3300048918 Bacteria 680
883 Ga0501031_0027243 3300049568 Bacteria 3726
884 Ga0501031_0191614 3300049568 Bacteria 1335
885 Ga0501032_0013942 3300049569 Bacteria 5702
886 Ga0501033_0183667 3300049570 Bacteria 1498
887 Ga0501033_0581643 3300049570 Bacteria 769
888 Ga0501034_0150771 3300049571 Bacteria 2301
889 Ga0501036_0058101 3300049572 Bacteria 3277
890 Ga0501036_0590150 3300049572 Bacteria 922
891 Ga0501036_1040599 3300049572 Bacteria 669
892 Ga0501037_0088672 3300049573 Bacteria 2239
893 Ga0501038_0001813 3300049574 Bacteria 19780
894 Ga0501038_0401415 3300049574 Bacteria 1060
895 Ga0501038_0466079 3300049574 Bacteria 970
896 Ga0501039_0002116 3300049575 Bacteria 14703
897 Ga0501039_0130202 3300049575 Bacteria 1974
898 Ga0501039_0418098 3300049575 Bacteria 1053
899 Ga0501039_0746954 3300049575 Bacteria 764
900 Ga0501039_1205342 3300049575 Unclassified 585
901 Ga0501040_0001107 3300049576 Bacteria 17068
902 Ga0501040_0040991 3300049576 Bacteria 3153
903 Ga0501040_0101146 3300049576 Bacteria 2011
904 Ga0501040_0333393 3300049576 Bacteria 1086
905 Ga0501040_0511618 3300049576 Bacteria 865
906 Ga0501040_0611108 3300049576 Unclassified 788
907 Ga0501040_0662039 3300049576 Bacteria 755
908 Ga0501041_0000320 3300049577 Bacteria 23433
909 Ga0501041_0611755 3300049577 Bacteria 696
910 Ga0501041_0807828 3300049577 Bacteria 601
911 Ga0501042_0000344 3300049578 Bacteria 23309
912 Ga0501042_0029779 3300049578 Bacteria 3850
913 Ga0501042_0808880 3300049578 Bacteria 682
914 Ga0501043_0033912 3300049579 Bacteria 4016
915 Ga0501043_0297292 3300049579 Bacteria 1235
916 Ga0501043_0660542 3300049579 Unclassified 767
917 Ga0501046_0015331 3300049580 Bacteria 6443
918 Ga0501046_0016773 3300049580 Bacteria 6123
919 Ga0501046_0377149 3300049580 Bacteria 1027
920 Ga0501047_0992199 3300049581 Bacteria 653
921 Ga0501048_0019818 3300049582 Bacteria 4932
922 Ga0501048_0178823 3300049582 Bacteria 1503
923 Ga0501048_0962286 3300049582 Bacteria 614
924 Ga0501048_1138155 3300049582 Bacteria 561
925 Ga0501068_0050250 3300049584 Bacteria 2520
926 Ga0501068_0073902 3300049584 Unclassified 2083
927 Ga0501068_0126473 3300049584 Bacteria 1596
928 Ga0501069_0039979 3300049585 Bacteria 2592
929 Ga0501070_0522428 3300049586 Unclassified 952
930 Ga0501070_0615991 3300049586 Bacteria 864
931 Ga0501071_0000317 3300049587 Bacteria 23301
932 Ga0501071_0240978 3300049587 Unclassified 1363
933 Ga0501071_0514503 3300049587 Bacteria 918
934 Ga0501072_0000574 3300049588 Bacteria 26476
935 Ga0501072_0121134 3300049588 Bacteria 2084
936 Ga0501072_0256662 3300049588 Bacteria 1392
937 Ga0501072_0355110 3300049588 Bacteria 1163
938 Ga0501072_0426560 3300049588 Bacteria 1051
939 Ga0501072_0778764 3300049588 Bacteria 750
940 Ga0501073_0059639 3300049589 Bacteria 2664
941 Ga0501073_0381498 3300049589 Viruses 974
942 Ga0501073_0638563 3300049589 Bacteria 735
943 Ga0501074_0056267 3300049590 Bacteria 2835
944 Ga0501074_0364277 3300049590 Bacteria 1025
945 Ga0501074_0965866 3300049590 Unclassified 599
946 Ga0501075_0000513 3300049591 Bacteria 23373
947 Ga0501075_0018980 3300049591 Bacteria 4986
948 Ga0501075_0043348 3300049591 Bacteria 3375
949 Ga0501075_0177238 3300049591 Bacteria 1627
950 Ga0501075_0223316 3300049591 Bacteria 1437
951 Ga0501075_0281321 3300049591 Bacteria 1267
952 Ga0501075_1372668 3300049591 Bacteria 535
953 Ga0501076_0000576 3300049592 Bacteria 23425
954 Ga0501076_0156952 3300049592 Bacteria 1852
955 Ga0501076_0199587 3300049592 Bacteria 1633
956 Ga0501077_0003494 3300049593 Bacteria 9436
957 Ga0501077_0050431 3300049593 Bacteria 2645
958 Ga0501077_0103335 3300049593 Bacteria 1805
959 Ga0501077_0128955 3300049593 Bacteria 1603
960 Ga0501077_0245896 3300049593 Bacteria 1137
961 Ga0501077_0815335 3300049593 Bacteria 600
962 Ga0501077_0925627 3300049593 Unclassified 561
963 Ga0501077_1091832 3300049593 Unclassified 513
964 Ga0501249_024466 3300049679 Bacteria 1331
965 Ga0501079_0016181 3300049741 Bacteria 5700
966 Ga0501079_0016305 3300049741 Bacteria 5678
967 Ga0501079_0040025 3300049741 Bacteria 3616
968 Ga0501079_0503392 3300049741 Bacteria 952
969 Ga0501079_1044947 3300049741 Bacteria 643
970 Ga0501080_0004673 3300049742 Bacteria 12216
971 Ga0501080_0041786 3300049742 Bacteria 4270
972 Ga0501080_0110860 3300049742 Unclassified 2543
973 Ga0501080_0958930 3300049742 Bacteria 743
974 Ga0501081_0000423 3300049743 Bacteria 23363
975 Ga0501081_0039647 3300049743 Unclassified 3224
976 Ga0501081_0119550 3300049743 Bacteria 1875
977 Ga0501081_0299821 3300049743 Bacteria 1179
978 Ga0501081_0384583 3300049743 Bacteria 1037
979 Ga0501081_1059822 3300049743 Bacteria 613
980 Ga0501083_0248335 3300049744 Unclassified 1158
981 Ga0501083_1060623 3300049744 Bacteria 527
982 Ga0501262_015981 3300049759 Bacteria 990
983 Ga0501035_0025060 3300049822 Bacteria 5469
984 Ga0501035_1074868 3300049822 Bacteria 629
985 Ga0501044_0178695 3300049823 Bacteria 2090
986 Ga0501045_0031588 3300049824 Bacteria 3835
987 Ga0501045_0115338 3300049824 Bacteria 1992
988 nmdc:mga03n38_460771_c1 3300050490 Unclassified 708
989 nmdc:mga05p37_1846538_c1 3300050507 Bacteria 580
990 nmdc:mga05p37_19422_c1 3300050507 Bacteria 8221
991 nmdc:mga05p37_259977_c1 3300050507 Bacteria 2078
992 nmdc:mga05p37_34025_c1 3300050507 Bacteria 6242
993 nmdc:mga05p37_35873_c1 3300050507 Bacteria 6084
994 nmdc:mga05p37_491785_c1 3300050507 Unclassified 1410
995 nmdc:mga05p37_560548_c1 3300050507 Bacteria 1298
996 nmdc:mga05p37_60335_c1 3300050507 Bacteria 4671
997 nmdc:mga05p37_693176_c1 3300050507 Bacteria 1133
998 nmdc:mga05p37_74032_c1 3300050507 Unclassified 4192
999 nmdc:mga09592_1678241_c1 3300050508 Unclassified 513
1000 nmdc:mga09592_240494_c1 3300050508 Unclassified 1569
1001 nmdc:mga09592_409898_c1 3300050508 Bacteria 1171
1002 nmdc:mga09592_611705_c1 3300050508 Unclassified 933
1003 nmdc:mga0qj67_138991_c1 3300050509 Unclassified 1969
1004 nmdc:mga0qj67_462539_c1 3300050509 Bacteria 1021
1005 nmdc:mga0qj67_69933_c1 3300050509 Bacteria 2799
1006 nmdc:mga06r32_1065853_c1 3300050510 Bacteria 758
1007 nmdc:mga06r32_1695926_c1 3300050510 Unclassified 569
1008 nmdc:mga06r32_214866_c1 3300050510 Unclassified 1911
1009 nmdc:mga06r32_334682_c1 3300050510 Bacteria 1499
1010 nmdc:mga06r32_663715_c1 3300050510 Unclassified 1010
1011 nmdc:mga06r32_682196_c1 3300050510 Bacteria 994
1012 nmdc:mga08y16_1259750_c1 3300050511 Unclassified 708
1013 nmdc:mga08y16_1417291_c1 3300050511 Bacteria 657
1014 nmdc:mga08y16_1623738_c1 3300050511 Archaea 604
1015 nmdc:mga08y16_637842_c1 3300050511 Bacteria 1071
1016 nmdc:mga0n895_108971_c1 3300050512 Bacteria 2785
1017 nmdc:mga0n895_1254366_c1 3300050512 Bacteria 713
1018 nmdc:mga0n895_141967_c1 3300050512 Bacteria 2430
1019 nmdc:mga0n895_1677431_c1 3300050512 Bacteria 598
1020 nmdc:mga0n895_1865749_c1 3300050512 Unclassified 561
1021 nmdc:mga0n895_21024_c1 3300050512 Bacteria 6098
1022 nmdc:mga0n895_2319_c1 3300050512 Bacteria 14822
1023 nmdc:mga0n895_255871_c1 3300050512 Unclassified 1777
1024 nmdc:mga0n895_729112_c1 3300050512 Bacteria 985
1025 nmdc:mga0n895_880082_c1 3300050512 Bacteria 882
1026 nmdc:mga0rr50_1237780_c1 3300050513 Unclassified 634
1027 nmdc:mga0rr50_1325911_c1 3300050513 Bacteria 610
1028 nmdc:mga0rr50_205196_c1 3300050513 Unclassified 1622
1029 nmdc:mga0rr50_323791_c1 3300050513 Unclassified 1293
1030 nmdc:mga0rr50_355271_c1 3300050513 Unclassified 1233
1031 nmdc:mga0rr50_5398_c1 3300050513 Bacteria 7619
1032 nmdc:mga0rr50_615625_c1 3300050513 Bacteria 926
1033 nmdc:mga0rr50_746733_c1 3300050513 Unclassified 835
1034 nmdc:mga08x19_159186_c1 3300050514 Bacteria 1533
1035 nmdc:mga08x19_288102_c1 3300050514 Bacteria 1139
1036 nmdc:mga08x19_293667_c1 3300050514 Bacteria 1128
1037 nmdc:mga08x19_6320_c1 3300050514 Bacteria 7012
1038 nmdc:mga0a205_1185041_c1 3300050515 Unclassified 612
1039 nmdc:mga0a205_268924_c1 3300050515 Bacteria 1582
1040 nmdc:mga0a205_28114_c1 3300050515 Bacteria 5374
1041 nmdc:mga0a205_355823_c1 3300050515 Bacteria 1331
1042 nmdc:mga0a205_399499_c1 3300050515 Unclassified 1238
1043 nmdc:mga0a205_416967_c1 3300050515 Bacteria 1205
1044 nmdc:mga0a205_46191_c2 3300050515 Unclassified 3884
1045 nmdc:mga0a205_580247_c1 3300050515 Bacteria 975
1046 Ga0495619_0010339 3300053085 Bacteria 5872
1047 Ga0495619_0103711 3300053085 Bacteria 1938
1048 Ga0501084_0001468 3300054114 Bacteria 18724
1049 Ga0501084_0060273 3300054114 Bacteria 3177
1050 Ga0501084_0432140 3300054114 Bacteria 1113
1051 Ga0501084_0494567 3300054114 Unclassified 1033
1052 Ga0590077_005279 3300059426 Unclassified 2647
1053 Ga0590077_145514 3300059426 Unclassified 566
1054 Ga0587107_113151 3300059652 Unclassified 551
1055 Ga0501082_0018437 3300060353 Bacteria 6011
1056 Ga0501082_0035809 3300060353 Bacteria 4278
1057 Ga0501082_0102827 3300060353 Unclassified 2471
1058 Ga0501082_0104813 3300060353 Bacteria 2446
1059 Ga0501082_0165948 3300060353 Bacteria 1919
1060 Ga0466962_0059781 3300061719 Bacteria 1819
1061 Ga0530510_0076114 3300061734 Bacteria 2438
1062 Ga0530510_0202512 3300061734 Bacteria 1474
1063 Ga0530510_0236698 3300061734 Bacteria 1359
1064 Ga0530510_0258442 3300061734 Bacteria 1298
1065 Ga0065704_10126472
1066 SwRhRL3b_contig_1296379
1067 ARSoilOldRDRAFT_c007671
1068 JGI24744J21845_10050039
1069 JGI24742J22300_10027238
1070 JGI26129J50193_1005351
1071 JGI26141J51220_1016473
1072 JGI25405J52794_10000972
1073 Ga0058859_11814659
1074 Ga0058861_11337636
1075 Ga0058862_10108325
1076 Ga0065704_10247922
1077 Ga0065704_10250528
1078 Ga0065712_10005198
1079 Ga0065712_10083595
1080 Ga0065715_10001245
1081 Ga0065715_10009782
1082 Ga0065715_11191938
1083 Ga0065707_10002967
1084 Ga0065707_10015515
1085 Ga0065707_10428092
1086 Ga0065707_10732491
1087 Ga0070676_10399610
1088 Ga0070683_100001708
1089 Ga0070690_100341121
1090 Ga0070670_100002504
1091 Ga0070670_100153305
1092 Ga0070670_101104771
1093 Ga0068869_100445125
1094 Ga0070666_10061309
1095 Ga0070666_10063655
1096 Ga0070666_10250905
1097 Ga0070680_100086954
1098 Ga0070680_100192827
1099 Ga0070680_100218396
1100 Ga0070680_100387419
1101 Ga0070680_101033560
1102 Ga0070680_101564153
1103 Ga0070680_101749608
1104 Ga0070682_100002331
1105 Ga0070682_100019799
1106 Ga0070682_100873408
1107 Ga0068868_100015257
1108 Ga0068868_100124128
1109 Ga0068868_100190192
1110 Ga0070660_100004253
1111 Ga0070660_100034848
1112 Ga0070660_100074301
1113 Ga0070660_100896560
1114 Ga0070689_100011564
1115 Ga0070691_10044381
1116 Ga0070691_10208129
1117 Ga0070687_100146086
1118 Ga0070687_101108211
1119 Ga0070661_100060435
1120 Ga0070661_100524184
1121 Ga0070692_10003563
1122 Ga0070668_100013432
1123 Ga0070668_100059870
1124 Ga0070669_100012929
1125 Ga0070669_101241397
1126 Ga0070675_100008011
1127 Ga0070675_100065803
1128 Ga0070675_102061908
1129 Ga0070671_100043036
1130 Ga0070671_100231357
1131 Ga0070671_101353339
1132 Ga0070674_100086678
1133 Ga0070674_100290390
1134 Ga0070674_100681818
1135 Ga0070674_101528736
1136 Ga0070674_101734986
1137 Ga0070673_100075688
1138 Ga0070673_101113435
1139 Ga0070688_100040381
1140 Ga0070688_100807044
1141 Ga0070688_101077616
1142 Ga0070688_101220076
1143 Ga0070659_100047318
1144 Ga0070659_100188912
1145 Ga0070659_101292078
1146 Ga0070703_10032462
1147 Ga0070709_10076295
1148 Ga0070709_10679171
1149 Ga0070709_11313779
1150 Ga0070714_100041626
1151 Ga0070714_100183372
1152 Ga0070713_100045171
1153 Ga0070713_101244707
1154 Ga0070710_10471467
1155 Ga0070701_10521768
1156 Ga0070701_10586011
1157 Ga0070711_100163024
1158 Ga0070711_100824316
1159 Ga0070711_101360597
1160 Ga0070705_100027122
1161 Ga0070705_100244979
1162 Ga0070705_101172981
1163 Ga0070705_101243250
1164 Ga0070705_101471926
1165 Ga0070705_101814950
1166 Ga0070700_100167547
1167 Ga0070700_100807438
1168 Ga0070694_100013842
1169 Ga0070694_100322877
1170 Ga0070694_100867243
1171 Ga0070694_101750504
1172 Ga0070708_100033833
1173 Ga0070708_100165815
1174 Ga0070708_100182640
1175 Ga0070708_100852899
1176 Ga0070708_101458860
1177 Ga0070663_100024320
1178 Ga0070663_100118302
1179 Ga0070678_100023683
1180 Ga0070678_100749113
1181 Ga0070678_101030470
1182 Ga0070678_101269382
1183 Ga0070662_100058636
1184 Ga0070662_100085694
1185 Ga0070662_100590736
1186 Ga0070662_101067310
1187 Ga0070681_10003379
1188 Ga0070681_10013046
1189 Ga0070681_10026142
1190 Ga0070681_10371403
1191 Ga0070681_10741291
1192 Ga0068867_100028830
1193 Ga0068867_101189124
1194 Ga0070685_10007842
1195 Ga0070685_11256882
1196 Ga0070706_100004764
1197 Ga0070706_100043493
1198 Ga0070706_100284698
1199 Ga0070706_100672156
1200 Ga0070707_100002038
1201 Ga0070698_100010227
1202 Ga0070698_100068315
1203 Ga0070698_100133341
1204 Ga0070698_100331131
1205 Ga0070698_100341116
1206 Ga0070698_100386996
1207 Ga0070698_100902779
1208 Ga0070699_100003507
1209 Ga0070699_100070518
1210 Ga0070699_100331423
1211 Ga0070699_100653334
1212 Ga0070699_100899185
1213 Ga0070699_100942130
1214 Ga0070699_101394799
1215 Ga0070699_101457280
1216 Ga0070679_100003063
1217 Ga0070679_100233674
1218 Ga0070684_100000634
1219 Ga0070684_101370312
1220 Ga0070684_101666289
1221 Ga0070697_100241836
1222 Ga0070697_100284423
1223 Ga0070697_100328056
1224 Ga0070697_100356625
1225 Ga0070697_100940073
1226 Ga0068853_100069721
1227 Ga0068853_100114904
1228 Ga0070672_100174911
1229 Ga0070672_100504614
1230 Ga0070686_100006796
1231 Ga0070686_100122399
1232 Ga0070686_101839624
1233 Ga0070686_101900156
1234 Ga0070695_100083596
1235 Ga0070695_100224967
1236 Ga0070695_100431987
1237 Ga0070695_101281045
1238 Ga0070696_100152824
1239 Ga0070696_100195626
1240 Ga0070696_100355183
1241 Ga0070696_100587896
1242 Ga0070696_101110469
1243 Ga0070693_100095920
1244 Ga0070693_100131372
1245 Ga0070693_100219174
1246 Ga0070693_100705496
1247 Ga0070665_100184545
1248 Ga0070665_100739652
1249 Ga0070704_100015880
1250 Ga0070704_100364269
1251 Ga0070704_100505297
1252 Ga0070704_101577188
1253 Ga0070704_101677895
1254 Ga0068855_100497248
1255 Ga0068855_101089611
1256 Ga0068855_101351068
1257 Ga0068855_101849575
1258 Ga0070664_100001324
1259 Ga0070664_100026787
1260 Ga0068857_100993146
1261 Ga0068857_101830660
1262 Ga0068854_100730842
1263 Ga0068854_101565407
1264 Ga0068854_101885263
1265 Ga0068856_100005850
1266 Ga0068856_100029736
1267 Ga0068856_100106040
1268 Ga0070702_100038046
1269 Ga0070702_100133455
1270 Ga0068852_100070992
1271 Ga0068852_100934740
1272 Ga0068859_100147263
1273 Ga0068859_100159693
1274 Ga0068864_100382039
1275 Ga0068864_100619472
1276 Ga0068864_100883778
1277 Ga0068866_10013281
1278 Ga0068866_10784575
1279 Ga0068861_100327242
1280 Ga0068861_100393425
1281 Ga0068851_10151247
1282 Ga0068870_10499247
1283 Ga0068870_10885118
1284 Ga0068863_100695513
1285 Ga0068863_102282324
1286 Ga0068860_100045868
1287 Ga0068860_100937950
1288 Ga0081455_10000380
1289 Ga0081455_10115812
1290 Ga0081455_10124410
1291 Ga0081455_10791391
1292 Ga0081538_10063940
1293 Ga0081539_10255656
1294 Ga0070717_10050699
1295 Ga0070717_10714014
1296 Ga0070717_11186737
1297 Ga0075365_10103578
1298 Ga0075363_100073831
1299 Ga0070715_10102578
1300 Ga0070716_100186264
1301 Ga0070716_100933833
1302 Ga0070716_101306115
1303 Ga0070712_100015819
1304 Ga0070712_100326804
1305 Ga0070712_100594406
1306 Ga0097621_100173479
1307 Ga0097621_100308869
1308 Ga0097621_100516421
1309 Ga0097621_101774051
1310 Ga0097621_101830908
1311 Ga0068871_100004038
1312 Ga0068871_100122770
1313 Ga0068871_102282319
1314 Ga0075428_100111958
1315 Ga0075428_100485330
1316 Ga0075428_100547825
1317 Ga0075428_100690858
1318 Ga0075428_100886049
1319 Ga0075430_100012157
1320 Ga0075430_100067979
1321 Ga0075430_100656701
1322 Ga0075431_100004509
1323 Ga0075431_100122533
1324 Ga0075431_100290587
1325 Ga0075431_100573692
1326 Ga0075431_101205288
1327 Ga0075433_10008315
1328 Ga0075433_10046004
1329 Ga0075433_10112589
1330 Ga0075433_10112682
1331 Ga0075433_10226423
1332 Ga0075433_10316724
1333 Ga0075433_10408907
1334 Ga0075433_10415244
1335 Ga0075433_10567591
1336 Ga0075433_10766864
1337 Ga0075433_10944564
1338 Ga0075434_100000952
1339 Ga0075434_100023988
1340 Ga0075434_100054294
1341 Ga0075434_100167666
1342 Ga0075434_100340053
1343 Ga0075434_100387584
1344 Ga0075434_100875659
1345 Ga0075434_102079265
1346 Ga0075429_100253453
1347 Ga0075429_100255460
1348 Ga0068865_100002544
1349 Ga0068865_100395841
1350 Ga0068865_101055268
1351 Ga0068865_101709460
1352 Ga0075436_100027413
1353 Ga0075436_100087509
1354 Ga0075436_100211234
1355 Ga0075436_100462732
1356 Ga0097620_100147261
1357 Ga0097620_100159695
1358 Ga0075435_100005736
1359 Ga0075435_100096103
1360 Ga0075435_100176127
1361 Ga0075435_100764130
1362 Ga0075435_100788930
1363 Ga0105240_11873270
1364 Ga0111539_10120525
1365 Ga0111539_10617451
1366 Ga0111539_10971698
1367 Ga0111539_11134294
1368 Ga0111539_11810310
1369 Ga0105245_10038631
1370 Ga0105245_10133461
1371 Ga0105245_10556325
1372 Ga0105245_10655210
1373 Ga0105245_11307625
1374 Ga0105245_11312138
1375 Ga0105247_10225374
1376 Ga0105247_10828864
1377 Ga0114129_10017997
1378 Ga0114129_10036998
1379 Ga0114129_10084947
1380 Ga0114129_10125006
1381 Ga0114129_10215223
1382 Ga0114129_10384400
1383 Ga0114129_10858768
1384 Ga0114129_10915858
1385 Ga0114129_11055888
1386 Ga0114129_11636291
1387 Ga0114129_12666162
1388 Ga0114129_13196924
1389 Ga0105243_10028603
1390 Ga0105243_10042188
1391 Ga0105243_10251139
1392 Ga0105243_10555925
1393 Ga0105243_10880820
1394 Ga0105243_12253155
1395 Ga0105241_10031940
1396 Ga0105241_10104276
1397 Ga0105242_10033342
1398 Ga0105242_10168398
1399 Ga0105242_10470451
1400 Ga0105242_11269349
1401 Ga0105242_12499890
1402 Ga0105242_12574333
1403 Ga0105248_10038075
1404 Ga0105248_10148863
1405 Ga0105248_12153101
1406 Ga0105237_10989364
1407 Ga0105238_10130585
1408 Ga0105238_10944455
1409 Ga0105249_10144561
1410 Ga0105249_10161606
1411 Ga0105239_10021863
1412 Ga0105239_10806330
1413 Ga0105239_12101654
1414 Ga0105239_13524585
1415 Ga0105246_10032927
1416 Ga0105246_10074911
1417 Ga0105246_10153466
1418 Ga0105246_10220806
1419 Ga0105246_10571753
1420 Ga0157314_1006438
1421 Ga0157371_10398773
1422 Ga0157371_10799652
1423 Ga0157371_11019147
1424 Ga0157370_11981648
1425 Ga0157369_10409315
1426 Ga0157369_10851924
1427 Ga0157374_10003624
1428 Ga0157374_10035114
1429 Ga0157374_10058576
1430 Ga0157374_10337487
1431 Ga0157378_10082685
1432 Ga0157378_10244342
1433 Ga0157378_10344708
1434 Ga0157378_10567261
1435 Ga0157378_11037074
1436 Ga0157378_11684521
1437 Ga0157378_12205434
1438 Ga0157378_12409186
1439 Ga0163162_10015451
1440 Ga0163162_10119829
1441 Ga0163162_11415164
1442 Ga0163162_12686126
1443 Ga0157372_10106332
1444 Ga0157372_10504078
1445 Ga0157372_11994921
1446 Ga0157375_10004528
1447 Ga0157375_10188691
1448 Ga0157375_10202258
1449 Ga0157375_10497979
1450 Ga0157375_10555130
1451 Ga0163163_10153148
1452 Ga0163163_10317257
1453 Ga0163163_10579143
1454 Ga0163163_10693821
1455 Ga0157380_10106664
1456 Ga0157380_11272072
1457 Ga0157380_11671359
1458 Ga0157380_12566042
1459 Ga0157380_12691376
1460 Ga0157377_10003876
1461 Ga0157377_10436502
1462 Ga0157377_10439370
1463 Ga0157379_10811926
1464 Ga0157379_10844039
1465 Ga0157376_10007962
1466 Ga0157376_10042364
1467 Ga0157376_11400079
1468 Ga0157376_12710327
1469 Ga0182007_10036999
1470 Ga0182005_1262778
1471 Ga0163161_10062387
1472 Ga0163161_10277807
1473 Ga0163161_11296291
1474 Ga0206350_10706521
1475 Ga0207697_10003782
1476 Ga0207653_10031353
1477 Ga0207682_10267574
1478 Ga0207692_10116434
1479 Ga0207642_10041691
1480 Ga0207688_10007295
1481 Ga0207688_10082165
1482 Ga0207680_10277619
1483 Ga0207685_10082309
1484 Ga0207685_10569617
1485 Ga0207699_10540698
1486 Ga0207699_10579859
1487 Ga0207699_10638913
1488 Ga0207645_10005624
1489 Ga0207645_10398374
1490 Ga0207645_10409774
1491 Ga0207643_10072386
1492 Ga0207705_10202503
1493 Ga0207684_10031300
1494 Ga0207684_10188568
1495 Ga0207684_11143875
1496 Ga0207654_10030702
1497 Ga0207654_10647457
1498 Ga0207654_10987972
1499 Ga0207707_10011900
1500 Ga0207707_10040791
1501 Ga0207707_10050201
1502 Ga0207707_10500414
1503 Ga0207693_10000406
1504 Ga0207693_10037141
1505 Ga0207693_10095453
1506 Ga0207663_10168956
1507 Ga0207660_10001253
1508 Ga0207660_10162633
1509 Ga0207660_10318832
1510 Ga0207660_10662922
1511 Ga0207660_11575970
1512 Ga0207662_10025152
1513 Ga0207662_10112777
1514 Ga0207657_10011355
1515 Ga0207657_10018755
1516 Ga0207657_10127884
1517 Ga0207649_10037277
1518 Ga0207649_10043667
1519 Ga0207652_10002068
1520 Ga0207652_10006890
1521 Ga0207652_10342097
1522 Ga0207646_10016601
1523 Ga0207646_10536157
1524 Ga0207646_11172979
1525 Ga0207681_10350171
1526 Ga0207681_10778724
1527 Ga0207681_10968888
1528 Ga0207650_10001105
1529 Ga0207650_10125019
1530 Ga0207650_10649397
1531 Ga0207659_10041333
1532 Ga0207659_10046872
1533 Ga0207659_11500368
1534 Ga0207687_10004309
1535 Ga0207687_10054274
1536 Ga0207687_10698160
1537 Ga0207687_11572232
1538 Ga0207687_11921744
1539 Ga0207700_10365287
1540 Ga0207700_10951756
1541 Ga0207664_10006068
1542 Ga0207664_10293062
1543 Ga0207664_10819988
1544 Ga0207644_10324060
1545 Ga0207644_10553030
1546 Ga0207690_10149500
1547 Ga0207690_10165037
1548 Ga0207690_11323266
1549 Ga0207706_10004096
1550 Ga0207706_10134372
1551 Ga0207706_10397329
1552 Ga0207706_10423444
1553 Ga0207706_11031607
1554 Ga0207686_10535455
1555 Ga0207709_10009766
1556 Ga0207709_10023343
1557 Ga0207670_10237202
1558 Ga0207670_10570902
1559 Ga0207669_10021079
1560 Ga0207669_10050219
1561 Ga0207669_10426255
1562 Ga0207704_10170706
1563 Ga0207704_10233568
1564 Ga0207704_10241856
1565 Ga0207704_11051727
1566 Ga0207665_10066334
1567 Ga0207665_10351731
1568 Ga0207665_10387471
1569 Ga0207665_11382218
1570 Ga0207691_10024161
1571 Ga0207691_10029192
1572 Ga0207691_10340186
1573 Ga0207711_10219939
1574 Ga0207711_11301078
1575 Ga0207711_12153562
1576 Ga0207689_10119157
1577 Ga0207661_10001504
1578 Ga0207661_10716495
1579 Ga0207661_11018262
1580 Ga0207679_10038022
1581 Ga0207667_10175533
1582 Ga0207651_10070351
1583 Ga0207651_10655614
1584 Ga0207651_10725483
1585 Ga0207712_10390720
1586 Ga0207712_10440224
1587 Ga0207668_10262900
1588 Ga0207668_10356053
1589 Ga0207668_11760930
1590 Ga0207640_10124217
1591 Ga0207640_10591224
1592 Ga0207640_10858301
1593 Ga0207640_11533209
1594 Ga0207658_10448497
1595 Ga0207677_10086544
1596 Ga0207677_10140893
1597 Ga0207677_11245250
1598 Ga0207703_11890608
1599 Ga0207639_10268493
1600 Ga0207678_10003484
1601 Ga0207678_10017335
1602 Ga0207678_10183412
1603 Ga0207708_10004802
1604 Ga0207708_10300178
1605 Ga0207708_10574598
1606 Ga0207702_10007087
1607 Ga0207702_10082982
1608 Ga0207702_10435923
1609 Ga0207641_10423545
1610 Ga0207641_11006243
1611 Ga0207648_10001155
1612 Ga0207648_10292297
1613 Ga0207648_10731419
1614 Ga0207648_12054019
1615 Ga0207676_10088388
1616 Ga0207676_10539478
1617 Ga0207676_11251068
1618 Ga0207674_11222507
1619 Ga0207675_100065036
1620 Ga0207675_100175058
1621 Ga0207675_100311620
1622 Ga0207675_100769095
1623 Ga0207683_10001368
1624 Ga0207683_10022734
1625 Ga0207683_10043811
1626 Ga0207698_10339997
1627 Ga0207698_10737479
1628 Ga0207698_12182957
1629 Ga0209984_1027167
1630 Ga0210000_1009531
1631 Ga0209968_1028095
1632 Ga0209982_1054123
1633 Ga0209970_1010762
1634 Ga0210002_1025406
1635 Ga0209983_1010383
1636 Ga0209971_1002140
1637 Ga0209971_1025794
1638 Ga0209998_10002978
1639 Ga0209974_10000172
1640 Ga0207428_10335863
1641 Ga0207428_10796234
1642 Ga0268266_10250841
1643 Ga0268266_10696775
1644 Ga0268265_10749286
1645 Ga0268265_12187100
1646 Ga0268264_10516690
1647 Ga0268264_10674117
1648 Ga0268264_12510556
1649 Ga0265326_10016113
1650 Ga0265319_1001334
1651 Ga0265319_1002094
1652 Ga0265319_1064540
1653 Ga0265319_1248877
1654 Ga0265334_10000322
1655 Ga0265334_10010198
1656 Ga0265334_10011959
1657 Ga0265334_10044976
1658 Ga0265318_10001871
1659 Ga0265318_10005443
1660 Ga0265323_10108406
1661 Ga0265322_10002108
1662 Ga0265322_10199678
1663 Ga0265336_10018293
1664 Ga0265336_10184334
1665 Ga0265338_10003330
1666 Ga0265338_10006995
1667 Ga0265338_10022905
1668 Ga0265338_10090464
1669 Ga0265338_10097530
1670 Ga0265338_10520521
1671 Ga0265324_10055753
1672 Ga0265330_10003034
1673 Ga0265330_10031370
1674 Ga0265332_10027056
1675 Ga0265332_10047516
1676 Ga0265328_10004790
1677 Ga0265320_10028343
1678 Ga0265320_10054006
1679 Ga0265320_10067175
1680 Ga0265320_10128489
1681 Ga0265325_10011495
1682 Ga0265325_10063780
1683 Ga0265329_10019276
1684 Ga0265340_10008992
1685 Ga0265340_10012083
1686 Ga0265339_10007646
1687 Ga0265339_10047116
1688 Ga0265339_10143175
1689 Ga0265331_10002581
1690 Ga0265327_10004211
1691 Ga0265327_10044043
1692 Ga0265316_10017801
1693 Ga0265316_10021439
1694 Ga0307408_100034320
1695 Ga0265313_10006244
1696 Ga0265313_10014033
1697 Ga0265313_10037004
1698 Ga0316575_10270804
1699 Ga0316579_10001025
1700 Ga0265314_10002715
1701 Ga0265314_10105890
1702 Ga0265342_10041110
1703 Ga0265342_10075846
1704 Ga0316578_10298545
1705 Ga0307405_10069030
1706 Ga0316577_10044611
1707 Ga0307410_10810593
1708 Ga0307406_10039612
1709 Ga0307412_10015147
1710 Ga0307409_100082546
1711 Ga0307416_100507537
1712 Ga0316593_10001140
1713 Ga0373944_0108474
1714 Ga0373944_0364219
1715 Ga0373952_0049961
1716 Ga0373923_0257598
1717 Ga0373923_0313069
1718 Ga0373932_0051433
1719 Ga0373932_0340694
1720 Ga0373936_0462244
1721 Ga0373939_0240948
1722 Ga0373945_0074096
1723 Ga0373956_0199189
1724 Ga0373946_0139395
1725 Ga0373961_0246874
1726 Ga0373962_0109860
1727 Ga0373962_0148032
1728 Ga0373931_0009347
1729 Ga0373931_0105006
1730 Ga0373931_0287847
1731 Ga0373935_0070171
1732 Ga0373935_0208180
1733 Ga0373935_0546524
1734 Ga0373927_0116197
1735 Ga0373937_0063777
1736 Ga0316582_0000662
1737 Ga0316584_0010521
1738 Ga0373925_0298362
1739 Ga0373925_0893000
1740 Ga0395899_0003270
1741 Ga0395899_0033443
1742 Ga0395899_0414557
1743 Ga0395900_0022252
1744 Ga0395900_0024871
1745 Ga0395900_0126297
1746 Ga0395900_0501942
1747 Ga0395900_0631020
1748 Ga0395900_0917298
1749 Ga0395898_0003471
1750 Ga0395898_0009931
1751 Ga0395898_0161150
1752 Ga0395898_0578424
1753 Ga0395898_1053946
1754 Ga0395905_0052710
1755 Ga0395905_0066323
1756 Ga0395905_0256517
1757 Ga0395905_0345425
1758 Ga0316581_0001886
1759 Ga0395901_0024550
1760 Ga0395901_0172907
1761 Ga0395901_0182269
1762 Ga0395901_0283990
1763 Ga0395901_0626734
1764 Ga0242420_055523
1765 Ga0436360_0959266
1766 Ga0451798_0326687
1767 Ga0451802_0368654
1768 Ga0451853_2372324
1769 Ga0451853_2728074
1770 Ga0450905_021693
1771 Ga0466963_0120056
1772 Ga0453684_0159451
1773 Ga0466968_0297620
1774 Ga0466957_0053182
1775 Ga0466957_0349182
1776 Ga0466957_0751448
1777 Ga0466960_0898405
1778 Ga0451576_0080051
1779 Ga0451576_0458790
1780 Ga0451576_0914256
1781 Ga0466958_0035946
1782 Ga0466958_0461954
1783 Ga0466967_0485790
1784 Ga0466967_0618600
1785 Ga0466967_2178838
1786 Ga0495603_0076715
1787 Ga0495603_0195120
1788 Ga0495629_0053496
1789 Ga0495629_0921436
1790 Ga0495629_0993267
1791 Ga0495641_0128025
1792 Ga0495641_0143319
1793 Ga0495641_0183396
1794 Ga0495641_0290946
1795 Ga0495653_0506740
1796 Ga0495580_0128707
1797 Ga0495580_0459923
1798 Ga0495582_0055327
1799 Ga0495582_0067352
1800 Ga0495582_0237333
1801 Ga0495605_0156860
1802 Ga0495605_0226456
1803 Ga0495605_0278895
1804 Ga0495639_0053402
1805 Ga0495584_0081020
1806 Ga0495584_0096017
1807 Ga0495584_0184057
1808 Ga0495585_0125181
1809 Ga0495594_0232371
1810 Ga0495594_0437822
1811 Ga0495594_0602332
1812 Ga0495596_0133685
1813 Ga0495618_0404144
1814 Ga0495630_0490291
1815 Ga0495630_1125567
1816 Ga0495632_0436902
1817 Ga0495644_0130386
1818 Ga0495644_0215673
1819 Ga0495644_0447391
1820 Ga0495663_0131090
1821 Ga0495663_0343527
1822 Ga0495642_0040762
1823 Ga0495642_0183693
1824 Ga0495665_0154227
1825 Ga0495586_0283847
1826 Ga0495598_0353795
1827 Ga0495609_0090509
1828 Ga0495609_0188628
1829 Ga0495609_0224261
1830 Ga0495633_0196479
1831 Ga0495633_0322686
1832 Ga0495656_0046893
1833 Ga0495656_0329901
1834 Ga0495634_0339551
1835 Ga0495634_0507867
1836 Ga0495635_0291771
1837 Ga0495635_0943897
1838 Ga0495659_0008068
1839 Ga0495661_0370088
1840 Ga0495588_0129807
1841 Ga0495588_0371867
1842 Ga0495657_0500747
1843 Ga0495647_0008542
1844 Ga0495647_0040462
1845 Ga0495658_0314091
1846 Ga0495658_0513795
1847 Ga0495613_0342085
1848 Ga0495613_0418582
1849 Ga0495613_0458627
1850 Ga0495613_1015565
1851 Ga0495670_0125502
1852 Ga0495671_0123217
1853 Ga0495589_0162387
1854 Ga0495581_0001339
1855 Ga0495581_0026920
1856 Ga0495636_0232906
1857 Ga0495674_0932136
1858 Ga0495676_0112220
1859 Ga0495680_0196753
1860 Ga0495680_0305903
1861 Ga0495683_0416222
1862 Ga0495677_0033528
1863 Ga0495677_0243218
1864 Ga0495685_303962
1865 Ga0495684_0881134
1866 Ga0495684_1060006
1867 Ga0495614_0083571
1868 Ga0495614_0259594
1869 Ga0496100_0064483
1870 Ga0496100_0346477
1871 Ga0496100_1099190
1872 Ga0496101_0012096
1873 Ga0496101_0064414
1874 Ga0496101_0084510
1875 Ga0496101_0675783
1876 Ga0496102_0001619
1877 Ga0496102_0003519
1878 Ga0496102_0270062
1879 Ga0496102_0305497
1880 Ga0496102_0457413
1881 Ga0496102_1278023
1882 Ga0496103_0003260
1883 Ga0496103_0029954
1884 Ga0496103_0043372
1885 Ga0496103_0536027
1886 Ga0496104_0000698
1887 Ga0496104_0001046
1888 Ga0496104_0009894
1889 Ga0496104_0356211
1890 Ga0496104_0588316
1891 Ga0496105_0000377
1892 Ga0496105_0048769
1893 Ga0496105_0129487
1894 Ga0496105_0232354
1895 Ga0496105_1421653
1896 Ga0496106_0124286
1897 Ga0496106_0218534
1898 Ga0496106_1110412
1899 Ga0496106_1399612
1900 Ga0496107_0011180
1901 Ga0496107_0116854
1902 Ga0496107_0355417
1903 Ga0496107_0777274
1904 Ga0496108_0022580
1905 Ga0496108_0058653
1906 Ga0496108_0079904
1907 Ga0496108_0138930
1908 Ga0496108_1162091
1909 Ga0496109_0000283
1910 Ga0496109_0008233
1911 Ga0496109_0018123
1912 Ga0496109_0030646
1913 Ga0496109_0297884
1914 Ga0496109_0336530
1915 Ga0496109_0781339
1916 Ga0496110_0000421
1917 Ga0496110_0053942
1918 Ga0496110_0074374
1919 Ga0496110_0131141
1920 Ga0496110_0988482
1921 Ga0496110_1365033
1922 Ga0496111_0010483
1923 Ga0496111_0011174
1924 Ga0496111_0094587
1925 Ga0496111_0248317
1926 Ga0496112_0020222
1927 Ga0496112_0028386
1928 Ga0496112_0031596
1929 Ga0496112_0164841
1930 Ga0496112_0966738
1931 Ga0496112_1010401
1932 Ga0496113_0020678
1933 Ga0496113_0049095
1934 Ga0496113_0076488
1935 Ga0496113_0476916
1936 Ga0496113_0591410
1937 Ga0496113_0617693
1938 Ga0496114_0000356
1939 Ga0496114_0000404
1940 Ga0496114_0028777
1941 Ga0496114_0556489
1942 Ga0496114_0625826
1943 Ga0496115_0005787
1944 Ga0496115_0022227
1945 Ga0496115_0212232
1946 Ga0496115_0904930
1947 Ga0501031_0027243
1948 Ga0501031_0191614
1949 Ga0501032_0013942
1950 Ga0501033_0183667
1951 Ga0501033_0581643
1952 Ga0501034_0150771
1953 Ga0501036_0058101
1954 Ga0501036_0590150
1955 Ga0501036_1040599
1956 Ga0501037_0088672
1957 Ga0501038_0001813
1958 Ga0501038_0401415
1959 Ga0501038_0466079
1960 Ga0501039_0002116
1961 Ga0501039_0130202
1962 Ga0501039_0418098
1963 Ga0501039_0746954
1964 Ga0501039_1205342
1965 Ga0501040_0001107
1966 Ga0501040_0040991
1967 Ga0501040_0101146
1968 Ga0501040_0333393
1969 Ga0501040_0511618
1970 Ga0501040_0611108
1971 Ga0501040_0662039
1972 Ga0501041_0000320
1973 Ga0501041_0611755
1974 Ga0501041_0807828
1975 Ga0501042_0000344
1976 Ga0501042_0029779
1977 Ga0501042_0808880
1978 Ga0501043_0033912
1979 Ga0501043_0297292
1980 Ga0501043_0660542
1981 Ga0501046_0015331
1982 Ga0501046_0016773
1983 Ga0501046_0377149
1984 Ga0501047_0992199
1985 Ga0501048_0019818
1986 Ga0501048_0178823
1987 Ga0501048_0962286
1988 Ga0501048_1138155
1989 Ga0501068_0050250
1990 Ga0501068_0073902
1991 Ga0501068_0126473
1992 Ga0501069_0039979
1993 Ga0501070_0522428
1994 Ga0501070_0615991
1995 Ga0501071_0000317
1996 Ga0501071_0240978
1997 Ga0501071_0514503
1998 Ga0501072_0000574
1999 Ga0501072_0121134
2000 Ga0501072_0256662
2001 Ga0501072_0355110
2002 Ga0501072_0426560
2003 Ga0501072_0778764
2004 Ga0501073_0059639
2005 Ga0501073_0381498
2006 Ga0501073_0638563
2007 Ga0501074_0056267
2008 Ga0501074_0364277
2009 Ga0501074_0965866
2010 Ga0501075_0000513
2011 Ga0501075_0018980
2012 Ga0501075_0043348
2013 Ga0501075_0177238
2014 Ga0501075_0223316
2015 Ga0501075_0281321
2016 Ga0501075_1372668
2017 Ga0501076_0000576
2018 Ga0501076_0156952
2019 Ga0501076_0199587
2020 Ga0501077_0003494
2021 Ga0501077_0050431
2022 Ga0501077_0103335
2023 Ga0501077_0128955
2024 Ga0501077_0245896
2025 Ga0501077_0815335
2026 Ga0501077_0925627
2027 Ga0501077_1091832
2028 Ga0501249_024466
2029 Ga0501079_0016181
2030 Ga0501079_0016305
2031 Ga0501079_0040025
2032 Ga0501079_0503392
2033 Ga0501079_1044947
2034 Ga0501080_0004673
2035 Ga0501080_0041786
2036 Ga0501080_0110860
2037 Ga0501080_0958930
2038 Ga0501081_0000423
2039 Ga0501081_0039647
2040 Ga0501081_0119550
2041 Ga0501081_0299821
2042 Ga0501081_0384583
2043 Ga0501081_1059822
2044 Ga0501083_0248335
2045 Ga0501083_1060623
2046 Ga0501262_015981
2047 Ga0501035_0025060
2048 Ga0501035_1074868
2049 Ga0501044_0178695
2050 Ga0501045_0031588
2051 Ga0501045_0115338
2052 nmdc:mga03n38_460771_c1
2053 nmdc:mga05p37_1846538_c1
2054 nmdc:mga05p37_19422_c1
2055 nmdc:mga05p37_259977_c1
2056 nmdc:mga05p37_34025_c1
2057 nmdc:mga05p37_35873_c1
2058 nmdc:mga05p37_491785_c1
2059 nmdc:mga05p37_560548_c1
2060 nmdc:mga05p37_60335_c1
2061 nmdc:mga05p37_693176_c1
2062 nmdc:mga05p37_74032_c1
2063 nmdc:mga09592_1678241_c1
2064 nmdc:mga09592_240494_c1
2065 nmdc:mga09592_409898_c1
2066 nmdc:mga09592_611705_c1
2067 nmdc:mga0qj67_138991_c1
2068 nmdc:mga0qj67_462539_c1
2069 nmdc:mga0qj67_69933_c1
2070 nmdc:mga06r32_1065853_c1
2071 nmdc:mga06r32_1695926_c1
2072 nmdc:mga06r32_214866_c1
2073 nmdc:mga06r32_334682_c1
2074 nmdc:mga06r32_663715_c1
2075 nmdc:mga06r32_682196_c1
2076 nmdc:mga08y16_1259750_c1
2077 nmdc:mga08y16_1417291_c1
2078 nmdc:mga08y16_1623738_c1
2079 nmdc:mga08y16_637842_c1
2080 nmdc:mga0n895_108971_c1
2081 nmdc:mga0n895_1254366_c1
2082 nmdc:mga0n895_141967_c1
2083 nmdc:mga0n895_1677431_c1
2084 nmdc:mga0n895_1865749_c1
2085 nmdc:mga0n895_21024_c1
2086 nmdc:mga0n895_2319_c1
2087 nmdc:mga0n895_255871_c1
2088 nmdc:mga0n895_729112_c1
2089 nmdc:mga0n895_880082_c1
2090 nmdc:mga0rr50_1237780_c1
2091 nmdc:mga0rr50_1325911_c1
2092 nmdc:mga0rr50_205196_c1
2093 nmdc:mga0rr50_323791_c1
2094 nmdc:mga0rr50_355271_c1
2095 nmdc:mga0rr50_5398_c1
2096 nmdc:mga0rr50_615625_c1
2097 nmdc:mga0rr50_746733_c1
2098 nmdc:mga08x19_159186_c1
2099 nmdc:mga08x19_288102_c1
2100 nmdc:mga08x19_293667_c1
2101 nmdc:mga08x19_6320_c1
2102 nmdc:mga0a205_1185041_c1
2103 nmdc:mga0a205_268924_c1
2104 nmdc:mga0a205_28114_c1
2105 nmdc:mga0a205_355823_c1
2106 nmdc:mga0a205_399499_c1
2107 nmdc:mga0a205_416967_c1
2108 nmdc:mga0a205_46191_c2
2109 nmdc:mga0a205_580247_c1
2110 Ga0495619_0010339
2111 Ga0495619_0103711
2112 Ga0501084_0001468
2113 Ga0501084_0060273
2114 Ga0501084_0432140
2115 Ga0501084_0494567
2116 Ga0590077_005279
2117 Ga0590077_145514
2118 Ga0587107_113151
2119 Ga0501082_0018437
2120 Ga0501082_0035809
2121 Ga0501082_0102827
2122 Ga0501082_0104813
2123 Ga0501082_0165948
2124 Ga0466962_0059781
2125 Ga0530510_0076114
2126 Ga0530510_0202512
2127 Ga0530510_0236698
2128 Ga0530510_0258442

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01722

BolA

BolA-like protein

23

90

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
2mma-assembly1.cif.gz_B nmr-based docking model of grxs14-bola2 apo-heterodimer from arabidopsis thaliana 0.8975 2 79
3o2e-assembly1.cif.gz_A crystal structure of a bol-like protein from babesia bovis 0.8746 1 84
5nfl-assembly1.cif.gz_A crystal structure of yrba from sinorhizobium meliloti in complex with cobalt. 0.8742 3 76
2mma-assembly1.cif.gz_B nmr-based docking model of grxs14-bola2 apo-heterodimer from arabidopsis thaliana 0.8666 2 79
4pui-assembly1.cif.gz_A bola domain of sufe1 from arabidopsis thaliana 0.8655 1 77
ID Description Score Start End Superfamily
af_P0A9W6_1_84_3.30.300.90 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;BolA-like 0.9436 2 81 3.30.300.90
af_O14280_1_84_3.30.300.90 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;BolA-like 0.9391 1 82 3.30.300.90
af_Q67VQ4_70_166_3.10.20.90 Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 0.9381 4 82 3.10.20.90
af_P53082_9_118_3.10.20.90 Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 0.9266 2 81 3.10.20.90
af_Q8I3V0_1_83_3.10.20.90 Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 0.9139 4 84 3.10.20.90
ID Description Score Start End GO Terms
AF-A0A7V9M9E2-F1-model_v4 BolA family transcriptional regulator 0.9922 18 76
AF-A0A7V9M9E2-F1-model_v4 BolA family transcriptional regulator 0.9758 18 76
AF-A0A2W7B6Y1-F1-model_v4 BolA family transcriptional regulator 0.9686 1 76
AF-A0A0R0MGN0-F1-model_v4 BolA family transcriptional regulator 0.9618 1 76
AF-A0A845K3G4-F1-model_v4 BolA family transcriptional regulator 0.9561 1 76

Map