F489340
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1064 | 399 | 2128 | 81 |
Family's Representative Sequence
| Representative Sequence | 3300005289|Ga0065704_10126472|Ga0065704_101264724 |
| Length | 96 |
| Sequence | LQAENRTGKLFCMITPEQIKDFLGKSLPISVCETQDLTGGGDHWQLIVVSPAFEGKGLLEQHRLVNEALKEPMSDQRIHALALKTFSPSQWEKLGC |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 2 | 2162886006 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 | Metagenome | Rhizosphere |
| 3 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 4 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 5 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 6 | 3300003349 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM | Metagenome | Rhizosphere |
| 7 | 3300003503 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM | Metagenome | Rhizosphere |
| 8 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 9 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 10 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 11 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 12 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 13 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 14 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 15 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 20 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 22 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 24 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 26 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 37 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 53 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 54 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 60 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 61 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 63 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 65 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 66 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 70 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 71 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 73 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 74 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 75 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 77 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 78 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 79 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 80 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 81 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 82 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 83 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 84 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 85 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 86 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 87 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 88 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 90 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 91 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 92 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 93 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 94 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 96 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 97 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 98 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 99 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 100 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 101 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 102 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 103 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 104 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 106 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300012500 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 | Metagenome | Rhizosphere |
| 121 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 135 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 136 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 138 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300027424 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 211 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 215 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 216 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 217 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 218 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 219 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 220 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 221 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 222 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 223 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 224 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 225 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 226 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 227 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 228 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 229 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 230 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 231 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 232 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 233 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 234 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 235 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 236 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 237 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 238 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 239 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 240 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 241 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 242 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 243 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 244 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 245 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 246 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 247 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 248 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 249 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 250 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 251 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 252 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 253 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 254 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 255 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 256 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 257 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 258 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 259 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 260 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 261 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 262 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 263 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 264 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 265 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 266 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 267 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 268 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 269 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 270 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 271 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 272 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 273 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 274 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 275 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 276 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 277 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 278 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 279 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 280 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 281 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 282 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 283 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 284 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 285 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 286 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 287 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 334 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 335 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 336 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 337 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 338 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 339 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 340 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 341 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 342 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 343 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 344 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 345 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 346 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 347 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 348 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 349 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 350 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 351 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 352 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 353 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 354 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 355 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 356 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 357 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 358 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 359 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 360 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 361 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 362 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 363 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 364 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 365 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 366 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 367 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 368 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 369 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 370 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 371 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 372 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 373 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 374 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 375 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 376 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 377 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 378 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 379 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 380 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 381 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 382 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 383 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 384 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 385 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 386 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 387 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 388 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 389 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 390 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 391 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 392 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 393 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 395 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 396 | 3300059652 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 397 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 398 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 399 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.44 |
| Metatranscriptomes | 0.56 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.28 |
| Nodule | 0 |
| Rhizoplane | 7.52 |
| Rhizosphere | 91.92 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 17.76 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0065704_10126472 | 3300005289 | Unclassified | 1689 |
| 2 | SwRhRL3b_contig_1296379 | 2162886006 | Bacteria | 2225 |
| 3 | ARSoilOldRDRAFT_c007671 | 3300000044 | Bacteria | 898 |
| 4 | JGI24744J21845_10050039 | 3300002077 | Bacteria | 771 |
| 5 | JGI24742J22300_10027238 | 3300002244 | Bacteria | 990 |
| 6 | JGI26129J50193_1005351 | 3300003349 | Unclassified | 915 |
| 7 | JGI26141J51220_1016473 | 3300003503 | Bacteria | 508 |
| 8 | JGI25405J52794_10000972 | 3300003911 | Bacteria | 4510 |
| 9 | Ga0058859_11814659 | 3300004798 | Unclassified | 1445 |
| 10 | Ga0058861_11337636 | 3300004800 | Bacteria | 922 |
| 11 | Ga0058862_10108325 | 3300004803 | Unclassified | 614 |
| 12 | Ga0065704_10247922 | 3300005289 | Bacteria | 997 |
| 13 | Ga0065704_10250528 | 3300005289 | Bacteria | 984 |
| 14 | Ga0065712_10005198 | 3300005290 | Unclassified | 3766 |
| 15 | Ga0065712_10083595 | 3300005290 | Unclassified | 2812 |
| 16 | Ga0065715_10001245 | 3300005293 | Bacteria | 12652 |
| 17 | Ga0065715_10009782 | 3300005293 | Bacteria | 2430 |
| 18 | Ga0065715_11191938 | 3300005293 | Unclassified | 500 |
| 19 | Ga0065707_10002967 | 3300005295 | Bacteria | 10427 |
| 20 | Ga0065707_10015515 | 3300005295 | Bacteria | 1669 |
| 21 | Ga0065707_10428092 | 3300005295 | Bacteria | 818 |
| 22 | Ga0065707_10732491 | 3300005295 | Unclassified | 626 |
| 23 | Ga0070676_10399610 | 3300005328 | Bacteria | 956 |
| 24 | Ga0070683_100001708 | 3300005329 | Bacteria | 17088 |
| 25 | Ga0070690_100341121 | 3300005330 | Bacteria | 1085 |
| 26 | Ga0070670_100002504 | 3300005331 | Bacteria | 15150 |
| 27 | Ga0070670_100153305 | 3300005331 | Unclassified | 1995 |
| 28 | Ga0070670_101104771 | 3300005331 | Unclassified | 723 |
| 29 | Ga0068869_100445125 | 3300005334 | Bacteria | 1073 |
| 30 | Ga0070666_10061309 | 3300005335 | Unclassified | 2547 |
| 31 | Ga0070666_10063655 | 3300005335 | Unclassified | 2500 |
| 32 | Ga0070666_10250905 | 3300005335 | Bacteria | 1253 |
| 33 | Ga0070680_100086954 | 3300005336 | Bacteria | 2585 |
| 34 | Ga0070680_100192827 | 3300005336 | Bacteria | 1717 |
| 35 | Ga0070680_100218396 | 3300005336 | Bacteria | 1609 |
| 36 | Ga0070680_100387419 | 3300005336 | Bacteria | 1190 |
| 37 | Ga0070680_101033560 | 3300005336 | Bacteria | 710 |
| 38 | Ga0070680_101564153 | 3300005336 | Unclassified | 571 |
| 39 | Ga0070680_101749608 | 3300005336 | Unclassified | 539 |
| 40 | Ga0070682_100002331 | 3300005337 | Bacteria | 10498 |
| 41 | Ga0070682_100019799 | 3300005337 | Bacteria | 3952 |
| 42 | Ga0070682_100873408 | 3300005337 | Unclassified | 737 |
| 43 | Ga0068868_100015257 | 3300005338 | Bacteria | 5678 |
| 44 | Ga0068868_100124128 | 3300005338 | Bacteria | 2108 |
| 45 | Ga0068868_100190192 | 3300005338 | Bacteria | 1707 |
| 46 | Ga0070660_100004253 | 3300005339 | Bacteria | 9880 |
| 47 | Ga0070660_100034848 | 3300005339 | Unclassified | 3806 |
| 48 | Ga0070660_100074301 | 3300005339 | Bacteria | 2660 |
| 49 | Ga0070660_100896560 | 3300005339 | Bacteria | 748 |
| 50 | Ga0070689_100011564 | 3300005340 | Bacteria | 6324 |
| 51 | Ga0070691_10044381 | 3300005341 | Bacteria | 2108 |
| 52 | Ga0070691_10208129 | 3300005341 | Bacteria | 1031 |
| 53 | Ga0070687_100146086 | 3300005343 | Unclassified | 1383 |
| 54 | Ga0070687_101108211 | 3300005343 | Bacteria | 579 |
| 55 | Ga0070661_100060435 | 3300005344 | Bacteria | 2781 |
| 56 | Ga0070661_100524184 | 3300005344 | Bacteria | 951 |
| 57 | Ga0070692_10003563 | 3300005345 | Bacteria | 6339 |
| 58 | Ga0070668_100013432 | 3300005347 | Bacteria | 6113 |
| 59 | Ga0070668_100059870 | 3300005347 | Bacteria | 2948 |
| 60 | Ga0070669_100012929 | 3300005353 | Bacteria | 5928 |
| 61 | Ga0070669_101241397 | 3300005353 | Bacteria | 644 |
| 62 | Ga0070675_100008011 | 3300005354 | Bacteria | 8190 |
| 63 | Ga0070675_100065803 | 3300005354 | Unclassified | 2997 |
| 64 | Ga0070675_102061908 | 3300005354 | Unclassified | 526 |
| 65 | Ga0070671_100043036 | 3300005355 | Bacteria | 3755 |
| 66 | Ga0070671_100231357 | 3300005355 | Bacteria | 1568 |
| 67 | Ga0070671_101353339 | 3300005355 | Unclassified | 628 |
| 68 | Ga0070674_100086678 | 3300005356 | Bacteria | 2250 |
| 69 | Ga0070674_100290390 | 3300005356 | Bacteria | 1300 |
| 70 | Ga0070674_100681818 | 3300005356 | Unclassified | 877 |
| 71 | Ga0070674_101528736 | 3300005356 | Bacteria | 600 |
| 72 | Ga0070674_101734986 | 3300005356 | Unclassified | 565 |
| 73 | Ga0070673_100075688 | 3300005364 | Bacteria | 2716 |
| 74 | Ga0070673_101113435 | 3300005364 | Bacteria | 738 |
| 75 | Ga0070688_100040381 | 3300005365 | Bacteria | 2859 |
| 76 | Ga0070688_100807044 | 3300005365 | Unclassified | 734 |
| 77 | Ga0070688_101077616 | 3300005365 | Bacteria | 641 |
| 78 | Ga0070688_101220076 | 3300005365 | Unclassified | 605 |
| 79 | Ga0070659_100047318 | 3300005366 | Bacteria | 3373 |
| 80 | Ga0070659_100188912 | 3300005366 | Bacteria | 1692 |
| 81 | Ga0070659_101292078 | 3300005366 | Unclassified | 647 |
| 82 | Ga0070703_10032462 | 3300005406 | Bacteria | 1586 |
| 83 | Ga0070709_10076295 | 3300005434 | Bacteria | 2176 |
| 84 | Ga0070709_10679171 | 3300005434 | Bacteria | 800 |
| 85 | Ga0070709_11313779 | 3300005434 | Bacteria | 584 |
| 86 | Ga0070714_100041626 | 3300005435 | Bacteria | 3878 |
| 87 | Ga0070714_100183372 | 3300005435 | Bacteria | 1906 |
| 88 | Ga0070713_100045171 | 3300005436 | Bacteria | 3608 |
| 89 | Ga0070713_101244707 | 3300005436 | Bacteria | 721 |
| 90 | Ga0070710_10471467 | 3300005437 | Bacteria | 854 |
| 91 | Ga0070701_10521768 | 3300005438 | Bacteria | 775 |
| 92 | Ga0070701_10586011 | 3300005438 | Bacteria | 737 |
| 93 | Ga0070711_100163024 | 3300005439 | Bacteria | 1692 |
| 94 | Ga0070711_100824316 | 3300005439 | Bacteria | 788 |
| 95 | Ga0070711_101360597 | 3300005439 | Bacteria | 617 |
| 96 | Ga0070705_100027122 | 3300005440 | Bacteria | 3124 |
| 97 | Ga0070705_100244979 | 3300005440 | Bacteria | 1255 |
| 98 | Ga0070705_101172981 | 3300005440 | Bacteria | 632 |
| 99 | Ga0070705_101243250 | 3300005440 | Bacteria | 615 |
| 100 | Ga0070705_101471926 | 3300005440 | Bacteria | 570 |
| 101 | Ga0070705_101814950 | 3300005440 | Unclassified | 517 |
| 102 | Ga0070700_100167547 | 3300005441 | Bacteria | 1518 |
| 103 | Ga0070700_100807438 | 3300005441 | Unclassified | 756 |
| 104 | Ga0070694_100013842 | 3300005444 | Bacteria | 5045 |
| 105 | Ga0070694_100322877 | 3300005444 | Bacteria | 1189 |
| 106 | Ga0070694_100867243 | 3300005444 | Bacteria | 744 |
| 107 | Ga0070694_101750504 | 3300005444 | Unclassified | 529 |
| 108 | Ga0070708_100033833 | 3300005445 | Bacteria | 4441 |
| 109 | Ga0070708_100165815 | 3300005445 | Bacteria | 2061 |
| 110 | Ga0070708_100182640 | 3300005445 | Unclassified | 1961 |
| 111 | Ga0070708_100852899 | 3300005445 | Bacteria | 856 |
| 112 | Ga0070708_101458860 | 3300005445 | Bacteria | 638 |
| 113 | Ga0070663_100024320 | 3300005455 | Bacteria | 4075 |
| 114 | Ga0070663_100118302 | 3300005455 | Bacteria | 1999 |
| 115 | Ga0070678_100023683 | 3300005456 | Unclassified | 4096 |
| 116 | Ga0070678_100749113 | 3300005456 | Bacteria | 883 |
| 117 | Ga0070678_101030470 | 3300005456 | Bacteria | 757 |
| 118 | Ga0070678_101269382 | 3300005456 | Bacteria | 685 |
| 119 | Ga0070662_100058636 | 3300005457 | Bacteria | 2802 |
| 120 | Ga0070662_100085694 | 3300005457 | Unclassified | 2354 |
| 121 | Ga0070662_100590736 | 3300005457 | Bacteria | 933 |
| 122 | Ga0070662_101067310 | 3300005457 | Unclassified | 692 |
| 123 | Ga0070681_10003379 | 3300005458 | Bacteria | 14927 |
| 124 | Ga0070681_10013046 | 3300005458 | Bacteria | 8252 |
| 125 | Ga0070681_10026142 | 3300005458 | Bacteria | 5870 |
| 126 | Ga0070681_10371403 | 3300005458 | Bacteria | 1341 |
| 127 | Ga0070681_10741291 | 3300005458 | Bacteria | 899 |
| 128 | Ga0068867_100028830 | 3300005459 | Bacteria | 3997 |
| 129 | Ga0068867_101189124 | 3300005459 | Bacteria | 700 |
| 130 | Ga0070685_10007842 | 3300005466 | Bacteria | 5467 |
| 131 | Ga0070685_11256882 | 3300005466 | Unclassified | 564 |
| 132 | Ga0070706_100004764 | 3300005467 | Bacteria | 13011 |
| 133 | Ga0070706_100043493 | 3300005467 | Bacteria | 4151 |
| 134 | Ga0070706_100284698 | 3300005467 | Bacteria | 1542 |
| 135 | Ga0070706_100672156 | 3300005467 | Bacteria | 961 |
| 136 | Ga0070707_100002038 | 3300005468 | Bacteria | 19331 |
| 137 | Ga0070698_100010227 | 3300005471 | Bacteria | 10020 |
| 138 | Ga0070698_100068315 | 3300005471 | Bacteria | 3572 |
| 139 | Ga0070698_100133341 | 3300005471 | Bacteria | 2438 |
| 140 | Ga0070698_100331131 | 3300005471 | Unclassified | 1454 |
| 141 | Ga0070698_100341116 | 3300005471 | Unclassified | 1430 |
| 142 | Ga0070698_100386996 | 3300005471 | Bacteria | 1331 |
| 143 | Ga0070698_100902779 | 3300005471 | Bacteria | 829 |
| 144 | Ga0070699_100003507 | 3300005518 | Bacteria | 13861 |
| 145 | Ga0070699_100070518 | 3300005518 | Bacteria | 3038 |
| 146 | Ga0070699_100331423 | 3300005518 | Unclassified | 1369 |
| 147 | Ga0070699_100653334 | 3300005518 | Bacteria | 960 |
| 148 | Ga0070699_100899185 | 3300005518 | Bacteria | 811 |
| 149 | Ga0070699_100942130 | 3300005518 | Bacteria | 791 |
| 150 | Ga0070699_101394799 | 3300005518 | Bacteria | 643 |
| 151 | Ga0070699_101457280 | 3300005518 | Bacteria | 628 |
| 152 | Ga0070679_100003063 | 3300005530 | Bacteria | 15280 |
| 153 | Ga0070679_100233674 | 3300005530 | Bacteria | 1798 |
| 154 | Ga0070684_100000634 | 3300005535 | Bacteria | 24130 |
| 155 | Ga0070684_101370312 | 3300005535 | Bacteria | 666 |
| 156 | Ga0070684_101666289 | 3300005535 | Bacteria | 602 |
| 157 | Ga0070697_100241836 | 3300005536 | Unclassified | 1541 |
| 158 | Ga0070697_100284423 | 3300005536 | Bacteria | 1419 |
| 159 | Ga0070697_100328056 | 3300005536 | Unclassified | 1319 |
| 160 | Ga0070697_100356625 | 3300005536 | Bacteria | 1264 |
| 161 | Ga0070697_100940073 | 3300005536 | Unclassified | 767 |
| 162 | Ga0068853_100069721 | 3300005539 | Bacteria | 3059 |
| 163 | Ga0068853_100114904 | 3300005539 | Bacteria | 2395 |
| 164 | Ga0070672_100174911 | 3300005543 | Bacteria | 1787 |
| 165 | Ga0070672_100504614 | 3300005543 | Bacteria | 1047 |
| 166 | Ga0070686_100006796 | 3300005544 | Bacteria | 6368 |
| 167 | Ga0070686_100122399 | 3300005544 | Bacteria | 1788 |
| 168 | Ga0070686_101839624 | 3300005544 | Bacteria | 516 |
| 169 | Ga0070686_101900156 | 3300005544 | Bacteria | 508 |
| 170 | Ga0070695_100083596 | 3300005545 | Bacteria | 2115 |
| 171 | Ga0070695_100224967 | 3300005545 | Bacteria | 1354 |
| 172 | Ga0070695_100431987 | 3300005545 | Bacteria | 1005 |
| 173 | Ga0070695_101281045 | 3300005545 | Bacteria | 605 |
| 174 | Ga0070696_100152824 | 3300005546 | Bacteria | 1695 |
| 175 | Ga0070696_100195626 | 3300005546 | Bacteria | 1507 |
| 176 | Ga0070696_100355183 | 3300005546 | Bacteria | 1136 |
| 177 | Ga0070696_100587896 | 3300005546 | Unclassified | 896 |
| 178 | Ga0070696_101110469 | 3300005546 | Bacteria | 665 |
| 179 | Ga0070693_100095920 | 3300005547 | Bacteria | 1797 |
| 180 | Ga0070693_100131372 | 3300005547 | Bacteria | 1566 |
| 181 | Ga0070693_100219174 | 3300005547 | Bacteria | 1246 |
| 182 | Ga0070693_100705496 | 3300005547 | Unclassified | 739 |
| 183 | Ga0070665_100184545 | 3300005548 | Bacteria | 2087 |
| 184 | Ga0070665_100739652 | 3300005548 | Bacteria | 997 |
| 185 | Ga0070704_100015880 | 3300005549 | Bacteria | 4742 |
| 186 | Ga0070704_100364269 | 3300005549 | Bacteria | 1224 |
| 187 | Ga0070704_100505297 | 3300005549 | Bacteria | 1049 |
| 188 | Ga0070704_101577188 | 3300005549 | Bacteria | 605 |
| 189 | Ga0070704_101677895 | 3300005549 | Bacteria | 587 |
| 190 | Ga0068855_100497248 | 3300005563 | Bacteria | 1325 |
| 191 | Ga0068855_101089611 | 3300005563 | Unclassified | 835 |
| 192 | Ga0068855_101351068 | 3300005563 | Bacteria | 736 |
| 193 | Ga0068855_101849575 | 3300005563 | Bacteria | 613 |
| 194 | Ga0070664_100001324 | 3300005564 | Bacteria | 19752 |
| 195 | Ga0070664_100026787 | 3300005564 | Bacteria | 4787 |
| 196 | Ga0068857_100993146 | 3300005577 | Bacteria | 808 |
| 197 | Ga0068857_101830660 | 3300005577 | Bacteria | 594 |
| 198 | Ga0068854_100730842 | 3300005578 | Bacteria | 857 |
| 199 | Ga0068854_101565407 | 3300005578 | Bacteria | 600 |
| 200 | Ga0068854_101885263 | 3300005578 | Unclassified | 549 |
| 201 | Ga0068856_100005850 | 3300005614 | Bacteria | 12119 |
| 202 | Ga0068856_100029736 | 3300005614 | Bacteria | 5336 |
| 203 | Ga0068856_100106040 | 3300005614 | Bacteria | 2804 |
| 204 | Ga0070702_100038046 | 3300005615 | Bacteria | 2676 |
| 205 | Ga0070702_100133455 | 3300005615 | Bacteria | 1571 |
| 206 | Ga0068852_100070992 | 3300005616 | Bacteria | 3057 |
| 207 | Ga0068852_100934740 | 3300005616 | Bacteria | 885 |
| 208 | Ga0068859_100147263 | 3300005617 | Bacteria | 2430 |
| 209 | Ga0068859_100159693 | 3300005617 | Bacteria | 2333 |
| 210 | Ga0068864_100382039 | 3300005618 | Bacteria | 1335 |
| 211 | Ga0068864_100619472 | 3300005618 | Bacteria | 1052 |
| 212 | Ga0068864_100883778 | 3300005618 | Bacteria | 882 |
| 213 | Ga0068866_10013281 | 3300005718 | Bacteria | 3610 |
| 214 | Ga0068866_10784575 | 3300005718 | Unclassified | 661 |
| 215 | Ga0068861_100327242 | 3300005719 | Bacteria | 1337 |
| 216 | Ga0068861_100393425 | 3300005719 | Unclassified | 1228 |
| 217 | Ga0068851_10151247 | 3300005834 | Unclassified | 1269 |
| 218 | Ga0068870_10499247 | 3300005840 | Bacteria | 811 |
| 219 | Ga0068870_10885118 | 3300005840 | Bacteria | 630 |
| 220 | Ga0068863_100695513 | 3300005841 | Unclassified | 1010 |
| 221 | Ga0068863_102282324 | 3300005841 | Bacteria | 551 |
| 222 | Ga0068860_100045868 | 3300005843 | Bacteria | 4168 |
| 223 | Ga0068860_100937950 | 3300005843 | Bacteria | 882 |
| 224 | Ga0081455_10000380 | 3300005937 | Bacteria | 58685 |
| 225 | Ga0081455_10115812 | 3300005937 | Bacteria | 2121 |
| 226 | Ga0081455_10124410 | 3300005937 | Bacteria | 2026 |
| 227 | Ga0081455_10791391 | 3300005937 | Bacteria | 596 |
| 228 | Ga0081538_10063940 | 3300005981 | Bacteria | 2085 |
| 229 | Ga0081539_10255656 | 3300005985 | Bacteria | 776 |
| 230 | Ga0070717_10050699 | 3300006028 | Bacteria | 3412 |
| 231 | Ga0070717_10714014 | 3300006028 | Bacteria | 911 |
| 232 | Ga0070717_11186737 | 3300006028 | Bacteria | 695 |
| 233 | Ga0075365_10103578 | 3300006038 | Bacteria | 1950 |
| 234 | Ga0075363_100073831 | 3300006048 | Bacteria | 1856 |
| 235 | Ga0070715_10102578 | 3300006163 | Bacteria | 1337 |
| 236 | Ga0070716_100186264 | 3300006173 | Bacteria | 1367 |
| 237 | Ga0070716_100933833 | 3300006173 | Bacteria | 682 |
| 238 | Ga0070716_101306115 | 3300006173 | Bacteria | 587 |
| 239 | Ga0070712_100015819 | 3300006175 | Bacteria | 4864 |
| 240 | Ga0070712_100326804 | 3300006175 | Bacteria | 1248 |
| 241 | Ga0070712_100594406 | 3300006175 | Bacteria | 936 |
| 242 | Ga0097621_100173479 | 3300006237 | Bacteria | 1860 |
| 243 | Ga0097621_100308869 | 3300006237 | Bacteria | 1398 |
| 244 | Ga0097621_100516421 | 3300006237 | Unclassified | 1084 |
| 245 | Ga0097621_101774051 | 3300006237 | Unclassified | 588 |
| 246 | Ga0097621_101830908 | 3300006237 | Bacteria | 579 |
| 247 | Ga0068871_100004038 | 3300006358 | Bacteria | 10141 |
| 248 | Ga0068871_100122770 | 3300006358 | Bacteria | 2196 |
| 249 | Ga0068871_102282319 | 3300006358 | Unclassified | 516 |
| 250 | Ga0075428_100111958 | 3300006844 | Bacteria | 2973 |
| 251 | Ga0075428_100485330 | 3300006844 | Bacteria | 1322 |
| 252 | Ga0075428_100547825 | 3300006844 | Bacteria | 1237 |
| 253 | Ga0075428_100690858 | 3300006844 | Unclassified | 1087 |
| 254 | Ga0075428_100886049 | 3300006844 | Unclassified | 947 |
| 255 | Ga0075430_100012157 | 3300006846 | Bacteria | 7329 |
| 256 | Ga0075430_100067979 | 3300006846 | Bacteria | 2990 |
| 257 | Ga0075430_100656701 | 3300006846 | Bacteria | 865 |
| 258 | Ga0075431_100004509 | 3300006847 | Bacteria | 13671 |
| 259 | Ga0075431_100122533 | 3300006847 | Bacteria | 2683 |
| 260 | Ga0075431_100290587 | 3300006847 | Unclassified | 1654 |
| 261 | Ga0075431_100573692 | 3300006847 | Bacteria | 1114 |
| 262 | Ga0075431_101205288 | 3300006847 | Bacteria | 720 |
| 263 | Ga0075433_10008315 | 3300006852 | Bacteria | 8273 |
| 264 | Ga0075433_10046004 | 3300006852 | Unclassified | 3794 |
| 265 | Ga0075433_10112589 | 3300006852 | Bacteria | 2414 |
| 266 | Ga0075433_10112682 | 3300006852 | Unclassified | 2413 |
| 267 | Ga0075433_10226423 | 3300006852 | Bacteria | 1661 |
| 268 | Ga0075433_10316724 | 3300006852 | Unclassified | 1380 |
| 269 | Ga0075433_10408907 | 3300006852 | Bacteria | 1197 |
| 270 | Ga0075433_10415244 | 3300006852 | Bacteria | 1187 |
| 271 | Ga0075433_10567591 | 3300006852 | Bacteria | 997 |
| 272 | Ga0075433_10766864 | 3300006852 | Bacteria | 843 |
| 273 | Ga0075433_10944564 | 3300006852 | Bacteria | 752 |
| 274 | Ga0075434_100000952 | 3300006871 | Bacteria | 23322 |
| 275 | Ga0075434_100023988 | 3300006871 | Bacteria | 5956 |
| 276 | Ga0075434_100054294 | 3300006871 | Unclassified | 3981 |
| 277 | Ga0075434_100167666 | 3300006871 | Bacteria | 2216 |
| 278 | Ga0075434_100340053 | 3300006871 | Bacteria | 1522 |
| 279 | Ga0075434_100387584 | 3300006871 | Bacteria | 1418 |
| 280 | Ga0075434_100875659 | 3300006871 | Bacteria | 913 |
| 281 | Ga0075434_102079265 | 3300006871 | Unclassified | 573 |
| 282 | Ga0075429_100253453 | 3300006880 | Bacteria | 1541 |
| 283 | Ga0075429_100255460 | 3300006880 | Unclassified | 1534 |
| 284 | Ga0068865_100002544 | 3300006881 | Bacteria | 10808 |
| 285 | Ga0068865_100395841 | 3300006881 | Bacteria | 1130 |
| 286 | Ga0068865_101055268 | 3300006881 | Unclassified | 714 |
| 287 | Ga0068865_101709460 | 3300006881 | Bacteria | 567 |
| 288 | Ga0075436_100027413 | 3300006914 | Bacteria | 3920 |
| 289 | Ga0075436_100087509 | 3300006914 | Bacteria | 2164 |
| 290 | Ga0075436_100211234 | 3300006914 | Bacteria | 1376 |
| 291 | Ga0075436_100462732 | 3300006914 | Bacteria | 925 |
| 292 | Ga0097620_100147261 | 3300006931 | Bacteria | 2430 |
| 293 | Ga0097620_100159695 | 3300006931 | Bacteria | 2333 |
| 294 | Ga0075435_100005736 | 3300007076 | Bacteria | 8711 |
| 295 | Ga0075435_100096103 | 3300007076 | Unclassified | 2451 |
| 296 | Ga0075435_100176127 | 3300007076 | Unclassified | 1806 |
| 297 | Ga0075435_100764130 | 3300007076 | Bacteria | 841 |
| 298 | Ga0075435_100788930 | 3300007076 | Unclassified | 827 |
| 299 | Ga0105240_11873270 | 3300009093 | Bacteria | 624 |
| 300 | Ga0111539_10120525 | 3300009094 | Unclassified | 3074 |
| 301 | Ga0111539_10617451 | 3300009094 | Bacteria | 1263 |
| 302 | Ga0111539_10971698 | 3300009094 | Unclassified | 987 |
| 303 | Ga0111539_11134294 | 3300009094 | Bacteria | 908 |
| 304 | Ga0111539_11810310 | 3300009094 | Bacteria | 708 |
| 305 | Ga0105245_10038631 | 3300009098 | Bacteria | 4247 |
| 306 | Ga0105245_10133461 | 3300009098 | Unclassified | 2331 |
| 307 | Ga0105245_10556325 | 3300009098 | Bacteria | 1169 |
| 308 | Ga0105245_10655210 | 3300009098 | Bacteria | 1080 |
| 309 | Ga0105245_11307625 | 3300009098 | Unclassified | 774 |
| 310 | Ga0105245_11312138 | 3300009098 | Bacteria | 773 |
| 311 | Ga0105247_10225374 | 3300009101 | Bacteria | 1271 |
| 312 | Ga0105247_10828864 | 3300009101 | Unclassified | 708 |
| 313 | Ga0114129_10017997 | 3300009147 | Bacteria | 10062 |
| 314 | Ga0114129_10036998 | 3300009147 | Bacteria | 6891 |
| 315 | Ga0114129_10084947 | 3300009147 | Bacteria | 4392 |
| 316 | Ga0114129_10125006 | 3300009147 | Bacteria | 3537 |
| 317 | Ga0114129_10215223 | 3300009147 | Bacteria | 2595 |
| 318 | Ga0114129_10384400 | 3300009147 | Bacteria | 1853 |
| 319 | Ga0114129_10858768 | 3300009147 | Bacteria | 1153 |
| 320 | Ga0114129_10915858 | 3300009147 | Bacteria | 1110 |
| 321 | Ga0114129_11055888 | 3300009147 | Bacteria | 1019 |
| 322 | Ga0114129_11636291 | 3300009147 | Bacteria | 787 |
| 323 | Ga0114129_12666162 | 3300009147 | Bacteria | 596 |
| 324 | Ga0114129_13196924 | 3300009147 | Unclassified | 533 |
| 325 | Ga0105243_10028603 | 3300009148 | Bacteria | 4280 |
| 326 | Ga0105243_10042188 | 3300009148 | Unclassified | 3571 |
| 327 | Ga0105243_10251139 | 3300009148 | Bacteria | 1579 |
| 328 | Ga0105243_10555925 | 3300009148 | Bacteria | 1097 |
| 329 | Ga0105243_10880820 | 3300009148 | Bacteria | 889 |
| 330 | Ga0105243_12253155 | 3300009148 | Unclassified | 582 |
| 331 | Ga0105241_10031940 | 3300009174 | Bacteria | 3943 |
| 332 | Ga0105241_10104276 | 3300009174 | Bacteria | 2259 |
| 333 | Ga0105242_10033342 | 3300009176 | Bacteria | 4123 |
| 334 | Ga0105242_10168398 | 3300009176 | Bacteria | 1923 |
| 335 | Ga0105242_10470451 | 3300009176 | Unclassified | 1189 |
| 336 | Ga0105242_11269349 | 3300009176 | Unclassified | 759 |
| 337 | Ga0105242_12499890 | 3300009176 | Bacteria | 565 |
| 338 | Ga0105242_12574333 | 3300009176 | Bacteria | 558 |
| 339 | Ga0105248_10038075 | 3300009177 | Bacteria | 5382 |
| 340 | Ga0105248_10148863 | 3300009177 | Bacteria | 2641 |
| 341 | Ga0105248_12153101 | 3300009177 | Bacteria | 634 |
| 342 | Ga0105237_10989364 | 3300009545 | Bacteria | 848 |
| 343 | Ga0105238_10130585 | 3300009551 | Bacteria | 2490 |
| 344 | Ga0105238_10944455 | 3300009551 | Bacteria | 882 |
| 345 | Ga0105249_10144561 | 3300009553 | Bacteria | 2284 |
| 346 | Ga0105249_10161606 | 3300009553 | Bacteria | 2165 |
| 347 | Ga0105239_10021863 | 3300010375 | Bacteria | 7051 |
| 348 | Ga0105239_10806330 | 3300010375 | Bacteria | 1076 |
| 349 | Ga0105239_12101654 | 3300010375 | Unclassified | 656 |
| 350 | Ga0105239_13524585 | 3300010375 | Bacteria | 509 |
| 351 | Ga0105246_10032927 | 3300011119 | Bacteria | 3440 |
| 352 | Ga0105246_10074911 | 3300011119 | Bacteria | 2394 |
| 353 | Ga0105246_10153466 | 3300011119 | Bacteria | 1746 |
| 354 | Ga0105246_10220806 | 3300011119 | Unclassified | 1485 |
| 355 | Ga0105246_10571753 | 3300011119 | Bacteria | 972 |
| 356 | Ga0157314_1006438 | 3300012500 | Bacteria | 920 |
| 357 | Ga0157371_10398773 | 3300013102 | Bacteria | 1006 |
| 358 | Ga0157371_10799652 | 3300013102 | Bacteria | 711 |
| 359 | Ga0157371_11019147 | 3300013102 | Bacteria | 632 |
| 360 | Ga0157370_11981648 | 3300013104 | Bacteria | 522 |
| 361 | Ga0157369_10409315 | 3300013105 | Bacteria | 1407 |
| 362 | Ga0157369_10851924 | 3300013105 | Unclassified | 936 |
| 363 | Ga0157374_10003624 | 3300013296 | Bacteria | 12994 |
| 364 | Ga0157374_10035114 | 3300013296 | Unclassified | 4586 |
| 365 | Ga0157374_10058576 | 3300013296 | Bacteria | 3600 |
| 366 | Ga0157374_10337487 | 3300013296 | Unclassified | 1495 |
| 367 | Ga0157378_10082685 | 3300013297 | Bacteria | 2904 |
| 368 | Ga0157378_10244342 | 3300013297 | Bacteria | 1716 |
| 369 | Ga0157378_10344708 | 3300013297 | Bacteria | 1454 |
| 370 | Ga0157378_10567261 | 3300013297 | Bacteria | 1142 |
| 371 | Ga0157378_11037074 | 3300013297 | Bacteria | 855 |
| 372 | Ga0157378_11684521 | 3300013297 | Unclassified | 681 |
| 373 | Ga0157378_12205434 | 3300013297 | Bacteria | 602 |
| 374 | Ga0157378_12409186 | 3300013297 | Bacteria | 578 |
| 375 | Ga0163162_10015451 | 3300013306 | Bacteria | 7460 |
| 376 | Ga0163162_10119829 | 3300013306 | Bacteria | 2735 |
| 377 | Ga0163162_11415164 | 3300013306 | Bacteria | 791 |
| 378 | Ga0163162_12686126 | 3300013306 | Unclassified | 573 |
| 379 | Ga0157372_10106332 | 3300013307 | Bacteria | 3210 |
| 380 | Ga0157372_10504078 | 3300013307 | Unclassified | 1411 |
| 381 | Ga0157372_11994921 | 3300013307 | Bacteria | 667 |
| 382 | Ga0157375_10004528 | 3300013308 | Bacteria | 12077 |
| 383 | Ga0157375_10188691 | 3300013308 | Bacteria | 2216 |
| 384 | Ga0157375_10202258 | 3300013308 | Unclassified | 2142 |
| 385 | Ga0157375_10497979 | 3300013308 | Bacteria | 1383 |
| 386 | Ga0157375_10555130 | 3300013308 | Bacteria | 1310 |
| 387 | Ga0163163_10153148 | 3300014325 | Bacteria | 2349 |
| 388 | Ga0163163_10317257 | 3300014325 | Bacteria | 1612 |
| 389 | Ga0163163_10579143 | 3300014325 | Bacteria | 1185 |
| 390 | Ga0163163_10693821 | 3300014325 | Bacteria | 1082 |
| 391 | Ga0157380_10106664 | 3300014326 | Bacteria | 2345 |
| 392 | Ga0157380_11272072 | 3300014326 | Bacteria | 782 |
| 393 | Ga0157380_11671359 | 3300014326 | Bacteria | 694 |
| 394 | Ga0157380_12566042 | 3300014326 | Bacteria | 576 |
| 395 | Ga0157380_12691376 | 3300014326 | Bacteria | 564 |
| 396 | Ga0157377_10003876 | 3300014745 | Bacteria | 6814 |
| 397 | Ga0157377_10436502 | 3300014745 | Bacteria | 901 |
| 398 | Ga0157377_10439370 | 3300014745 | Bacteria | 898 |
| 399 | Ga0157379_10811926 | 3300014968 | Bacteria | 883 |
| 400 | Ga0157379_10844039 | 3300014968 | Bacteria | 866 |
| 401 | Ga0157376_10007962 | 3300014969 | Bacteria | 7604 |
| 402 | Ga0157376_10042364 | 3300014969 | Bacteria | 3731 |
| 403 | Ga0157376_11400079 | 3300014969 | Unclassified | 731 |
| 404 | Ga0157376_12710327 | 3300014969 | Unclassified | 536 |
| 405 | Ga0182007_10036999 | 3300015262 | Bacteria | 1640 |
| 406 | Ga0182005_1262778 | 3300015265 | Bacteria | 537 |
| 407 | Ga0163161_10062387 | 3300017792 | Bacteria | 2715 |
| 408 | Ga0163161_10277807 | 3300017792 | Bacteria | 1313 |
| 409 | Ga0163161_11296291 | 3300017792 | Bacteria | 633 |
| 410 | Ga0206350_10706521 | 3300020080 | Unclassified | 898 |
| 411 | Ga0207697_10003782 | 3300025315 | Bacteria | 7389 |
| 412 | Ga0207653_10031353 | 3300025885 | Bacteria | 1717 |
| 413 | Ga0207682_10267574 | 3300025893 | Bacteria | 798 |
| 414 | Ga0207692_10116434 | 3300025898 | Bacteria | 1490 |
| 415 | Ga0207642_10041691 | 3300025899 | Bacteria | 2012 |
| 416 | Ga0207688_10007295 | 3300025901 | Bacteria | 6014 |
| 417 | Ga0207688_10082165 | 3300025901 | Bacteria | 1841 |
| 418 | Ga0207680_10277619 | 3300025903 | Bacteria | 1163 |
| 419 | Ga0207685_10082309 | 3300025905 | Bacteria | 1335 |
| 420 | Ga0207685_10569617 | 3300025905 | Bacteria | 604 |
| 421 | Ga0207699_10540698 | 3300025906 | Bacteria | 844 |
| 422 | Ga0207699_10579859 | 3300025906 | Bacteria | 815 |
| 423 | Ga0207699_10638913 | 3300025906 | Unclassified | 777 |
| 424 | Ga0207645_10005624 | 3300025907 | Bacteria | 9060 |
| 425 | Ga0207645_10398374 | 3300025907 | Bacteria | 925 |
| 426 | Ga0207645_10409774 | 3300025907 | Bacteria | 912 |
| 427 | Ga0207643_10072386 | 3300025908 | Bacteria | 1985 |
| 428 | Ga0207705_10202503 | 3300025909 | Bacteria | 1504 |
| 429 | Ga0207684_10031300 | 3300025910 | Bacteria | 4526 |
| 430 | Ga0207684_10188568 | 3300025910 | Bacteria | 1778 |
| 431 | Ga0207684_11143875 | 3300025910 | Unclassified | 646 |
| 432 | Ga0207654_10030702 | 3300025911 | Bacteria | 2952 |
| 433 | Ga0207654_10647457 | 3300025911 | Bacteria | 757 |
| 434 | Ga0207654_10987972 | 3300025911 | Bacteria | 612 |
| 435 | Ga0207707_10011900 | 3300025912 | Bacteria | 7570 |
| 436 | Ga0207707_10040791 | 3300025912 | Bacteria | 4054 |
| 437 | Ga0207707_10050201 | 3300025912 | Bacteria | 3635 |
| 438 | Ga0207707_10500414 | 3300025912 | Unclassified | 1036 |
| 439 | Ga0207693_10000406 | 3300025915 | Bacteria | 39259 |
| 440 | Ga0207693_10037141 | 3300025915 | Bacteria | 3839 |
| 441 | Ga0207693_10095453 | 3300025915 | Bacteria | 2331 |
| 442 | Ga0207663_10168956 | 3300025916 | Bacteria | 1551 |
| 443 | Ga0207660_10001253 | 3300025917 | Bacteria | 17006 |
| 444 | Ga0207660_10162633 | 3300025917 | Bacteria | 1723 |
| 445 | Ga0207660_10318832 | 3300025917 | Bacteria | 1241 |
| 446 | Ga0207660_10662922 | 3300025917 | Unclassified | 851 |
| 447 | Ga0207660_11575970 | 3300025917 | Bacteria | 530 |
| 448 | Ga0207662_10025152 | 3300025918 | Unclassified | 3428 |
| 449 | Ga0207662_10112777 | 3300025918 | Bacteria | 1697 |
| 450 | Ga0207657_10011355 | 3300025919 | Bacteria | 8847 |
| 451 | Ga0207657_10018755 | 3300025919 | Bacteria | 6590 |
| 452 | Ga0207657_10127884 | 3300025919 | Bacteria | 2085 |
| 453 | Ga0207649_10037277 | 3300025920 | Bacteria | 2936 |
| 454 | Ga0207649_10043667 | 3300025920 | Bacteria | 2742 |
| 455 | Ga0207652_10002068 | 3300025921 | Bacteria | 17274 |
| 456 | Ga0207652_10006890 | 3300025921 | Bacteria | 9157 |
| 457 | Ga0207652_10342097 | 3300025921 | Bacteria | 1350 |
| 458 | Ga0207646_10016601 | 3300025922 | Bacteria | 6906 |
| 459 | Ga0207646_10536157 | 3300025922 | Bacteria | 1053 |
| 460 | Ga0207646_11172979 | 3300025922 | Bacteria | 674 |
| 461 | Ga0207681_10350171 | 3300025923 | Bacteria | 1182 |
| 462 | Ga0207681_10778724 | 3300025923 | Unclassified | 798 |
| 463 | Ga0207681_10968888 | 3300025923 | Bacteria | 713 |
| 464 | Ga0207650_10001105 | 3300025925 | Bacteria | 19847 |
| 465 | Ga0207650_10125019 | 3300025925 | Unclassified | 2007 |
| 466 | Ga0207650_10649397 | 3300025925 | Unclassified | 889 |
| 467 | Ga0207659_10041333 | 3300025926 | Unclassified | 3228 |
| 468 | Ga0207659_10046872 | 3300025926 | Bacteria | 3055 |
| 469 | Ga0207659_11500368 | 3300025926 | Unclassified | 577 |
| 470 | Ga0207687_10004309 | 3300025927 | Bacteria | 9502 |
| 471 | Ga0207687_10054274 | 3300025927 | Bacteria | 2803 |
| 472 | Ga0207687_10698160 | 3300025927 | Bacteria | 861 |
| 473 | Ga0207687_11572232 | 3300025927 | Unclassified | 564 |
| 474 | Ga0207687_11921744 | 3300025927 | Unclassified | 506 |
| 475 | Ga0207700_10365287 | 3300025928 | Bacteria | 1259 |
| 476 | Ga0207700_10951756 | 3300025928 | Bacteria | 769 |
| 477 | Ga0207664_10006068 | 3300025929 | Bacteria | 8275 |
| 478 | Ga0207664_10293062 | 3300025929 | Bacteria | 1430 |
| 479 | Ga0207664_10819988 | 3300025929 | Bacteria | 837 |
| 480 | Ga0207644_10324060 | 3300025931 | Bacteria | 1246 |
| 481 | Ga0207644_10553030 | 3300025931 | Bacteria | 953 |
| 482 | Ga0207690_10149500 | 3300025932 | Bacteria | 1730 |
| 483 | Ga0207690_10165037 | 3300025932 | Bacteria | 1654 |
| 484 | Ga0207690_11323266 | 3300025932 | Unclassified | 602 |
| 485 | Ga0207706_10004096 | 3300025933 | Bacteria | 13775 |
| 486 | Ga0207706_10134372 | 3300025933 | Unclassified | 2176 |
| 487 | Ga0207706_10397329 | 3300025933 | Bacteria | 1195 |
| 488 | Ga0207706_10423444 | 3300025933 | Bacteria | 1153 |
| 489 | Ga0207706_11031607 | 3300025933 | Unclassified | 690 |
| 490 | Ga0207686_10535455 | 3300025934 | Unclassified | 914 |
| 491 | Ga0207709_10009766 | 3300025935 | Bacteria | 5289 |
| 492 | Ga0207709_10023343 | 3300025935 | Bacteria | 3520 |
| 493 | Ga0207670_10237202 | 3300025936 | Bacteria | 1403 |
| 494 | Ga0207670_10570902 | 3300025936 | Unclassified | 926 |
| 495 | Ga0207669_10021079 | 3300025937 | Bacteria | 3432 |
| 496 | Ga0207669_10050219 | 3300025937 | Bacteria | 2492 |
| 497 | Ga0207669_10426255 | 3300025937 | Bacteria | 1045 |
| 498 | Ga0207704_10170706 | 3300025938 | Bacteria | 1560 |
| 499 | Ga0207704_10233568 | 3300025938 | Bacteria | 1369 |
| 500 | Ga0207704_10241856 | 3300025938 | Bacteria | 1349 |
| 501 | Ga0207704_11051727 | 3300025938 | Bacteria | 690 |
| 502 | Ga0207665_10066334 | 3300025939 | Bacteria | 2456 |
| 503 | Ga0207665_10351731 | 3300025939 | Bacteria | 1112 |
| 504 | Ga0207665_10387471 | 3300025939 | Bacteria | 1062 |
| 505 | Ga0207665_11382218 | 3300025939 | Unclassified | 561 |
| 506 | Ga0207691_10024161 | 3300025940 | Bacteria | 5715 |
| 507 | Ga0207691_10029192 | 3300025940 | Bacteria | 5159 |
| 508 | Ga0207691_10340186 | 3300025940 | Bacteria | 1284 |
| 509 | Ga0207711_10219939 | 3300025941 | Bacteria | 1737 |
| 510 | Ga0207711_11301078 | 3300025941 | Unclassified | 669 |
| 511 | Ga0207711_12153562 | 3300025941 | Unclassified | 500 |
| 512 | Ga0207689_10119157 | 3300025942 | Bacteria | 2171 |
| 513 | Ga0207661_10001504 | 3300025944 | Bacteria | 15791 |
| 514 | Ga0207661_10716495 | 3300025944 | Bacteria | 921 |
| 515 | Ga0207661_11018262 | 3300025944 | Unclassified | 763 |
| 516 | Ga0207679_10038022 | 3300025945 | Bacteria | 3427 |
| 517 | Ga0207667_10175533 | 3300025949 | Bacteria | 2201 |
| 518 | Ga0207651_10070351 | 3300025960 | Unclassified | 2475 |
| 519 | Ga0207651_10655614 | 3300025960 | Bacteria | 922 |
| 520 | Ga0207651_10725483 | 3300025960 | Bacteria | 877 |
| 521 | Ga0207712_10390720 | 3300025961 | Bacteria | 1167 |
| 522 | Ga0207712_10440224 | 3300025961 | Bacteria | 1103 |
| 523 | Ga0207668_10262900 | 3300025972 | Unclassified | 1407 |
| 524 | Ga0207668_10356053 | 3300025972 | Bacteria | 1225 |
| 525 | Ga0207668_11760930 | 3300025972 | Unclassified | 559 |
| 526 | Ga0207640_10124217 | 3300025981 | Bacteria | 1855 |
| 527 | Ga0207640_10591224 | 3300025981 | Bacteria | 938 |
| 528 | Ga0207640_10858301 | 3300025981 | Bacteria | 790 |
| 529 | Ga0207640_11533209 | 3300025981 | Bacteria | 599 |
| 530 | Ga0207658_10448497 | 3300025986 | Bacteria | 1142 |
| 531 | Ga0207677_10086544 | 3300026023 | Bacteria | 2265 |
| 532 | Ga0207677_10140893 | 3300026023 | Bacteria | 1846 |
| 533 | Ga0207677_11245250 | 3300026023 | Bacteria | 682 |
| 534 | Ga0207703_11890608 | 3300026035 | Bacteria | 573 |
| 535 | Ga0207639_10268493 | 3300026041 | Unclassified | 1495 |
| 536 | Ga0207678_10003484 | 3300026067 | Bacteria | 14159 |
| 537 | Ga0207678_10017335 | 3300026067 | Bacteria | 6322 |
| 538 | Ga0207678_10183412 | 3300026067 | Bacteria | 1787 |
| 539 | Ga0207708_10004802 | 3300026075 | Bacteria | 9953 |
| 540 | Ga0207708_10300178 | 3300026075 | Bacteria | 1306 |
| 541 | Ga0207708_10574598 | 3300026075 | Archaea | 953 |
| 542 | Ga0207702_10007087 | 3300026078 | Bacteria | 9590 |
| 543 | Ga0207702_10082982 | 3300026078 | Bacteria | 2788 |
| 544 | Ga0207702_10435923 | 3300026078 | Bacteria | 1269 |
| 545 | Ga0207641_10423545 | 3300026088 | Bacteria | 1282 |
| 546 | Ga0207641_11006243 | 3300026088 | Unclassified | 830 |
| 547 | Ga0207648_10001155 | 3300026089 | Bacteria | 29566 |
| 548 | Ga0207648_10292297 | 3300026089 | Bacteria | 1459 |
| 549 | Ga0207648_10731419 | 3300026089 | Bacteria | 918 |
| 550 | Ga0207648_12054019 | 3300026089 | Unclassified | 533 |
| 551 | Ga0207676_10088388 | 3300026095 | Bacteria | 2537 |
| 552 | Ga0207676_10539478 | 3300026095 | Bacteria | 1113 |
| 553 | Ga0207676_11251068 | 3300026095 | Bacteria | 736 |
| 554 | Ga0207674_11222507 | 3300026116 | Bacteria | 721 |
| 555 | Ga0207675_100065036 | 3300026118 | Bacteria | 3409 |
| 556 | Ga0207675_100175058 | 3300026118 | Bacteria | 2053 |
| 557 | Ga0207675_100311620 | 3300026118 | Bacteria | 1535 |
| 558 | Ga0207675_100769095 | 3300026118 | Bacteria | 975 |
| 559 | Ga0207683_10001368 | 3300026121 | Bacteria | 22057 |
| 560 | Ga0207683_10022734 | 3300026121 | Bacteria | 5385 |
| 561 | Ga0207683_10043811 | 3300026121 | Bacteria | 3911 |
| 562 | Ga0207698_10339997 | 3300026142 | Bacteria | 1413 |
| 563 | Ga0207698_10737479 | 3300026142 | Unclassified | 983 |
| 564 | Ga0207698_12182957 | 3300026142 | Unclassified | 567 |
| 565 | Ga0209984_1027167 | 3300027424 | Unclassified | 801 |
| 566 | Ga0210000_1009531 | 3300027462 | Bacteria | 1430 |
| 567 | Ga0209968_1028095 | 3300027526 | Bacteria | 933 |
| 568 | Ga0209982_1054123 | 3300027552 | Bacteria | 649 |
| 569 | Ga0209970_1010762 | 3300027614 | Bacteria | 1499 |
| 570 | Ga0210002_1025406 | 3300027617 | Bacteria | 969 |
| 571 | Ga0209983_1010383 | 3300027665 | Bacteria | 1904 |
| 572 | Ga0209971_1002140 | 3300027682 | Bacteria | 4805 |
| 573 | Ga0209971_1025794 | 3300027682 | Bacteria | 1404 |
| 574 | Ga0209998_10002978 | 3300027717 | Bacteria | 3776 |
| 575 | Ga0209974_10000172 | 3300027876 | Bacteria | 19968 |
| 576 | Ga0207428_10335863 | 3300027907 | Bacteria | 1114 |
| 577 | Ga0207428_10796234 | 3300027907 | Unclassified | 672 |
| 578 | Ga0268266_10250841 | 3300028379 | Bacteria | 1637 |
| 579 | Ga0268266_10696775 | 3300028379 | Bacteria | 979 |
| 580 | Ga0268265_10749286 | 3300028380 | Bacteria | 948 |
| 581 | Ga0268265_12187100 | 3300028380 | Unclassified | 560 |
| 582 | Ga0268264_10516690 | 3300028381 | Bacteria | 1167 |
| 583 | Ga0268264_10674117 | 3300028381 | Bacteria | 1025 |
| 584 | Ga0268264_12510556 | 3300028381 | Bacteria | 520 |
| 585 | Ga0265326_10016113 | 3300028558 | Bacteria | 2162 |
| 586 | Ga0265319_1001334 | 3300028563 | Bacteria | 14893 |
| 587 | Ga0265319_1002094 | 3300028563 | Bacteria | 11181 |
| 588 | Ga0265319_1064540 | 3300028563 | Bacteria | 1182 |
| 589 | Ga0265319_1248877 | 3300028563 | Bacteria | 542 |
| 590 | Ga0265334_10000322 | 3300028573 | Bacteria | 26260 |
| 591 | Ga0265334_10010198 | 3300028573 | Bacteria | 3966 |
| 592 | Ga0265334_10011959 | 3300028573 | Bacteria | 3646 |
| 593 | Ga0265334_10044976 | 3300028573 | Bacteria | 1711 |
| 594 | Ga0265318_10001871 | 3300028577 | Bacteria | 11838 |
| 595 | Ga0265318_10005443 | 3300028577 | Bacteria | 5979 |
| 596 | Ga0265323_10108406 | 3300028653 | Bacteria | 913 |
| 597 | Ga0265322_10002108 | 3300028654 | Bacteria | 6229 |
| 598 | Ga0265322_10199678 | 3300028654 | Bacteria | 572 |
| 599 | Ga0265336_10018293 | 3300028666 | Bacteria | 2271 |
| 600 | Ga0265336_10184334 | 3300028666 | Bacteria | 620 |
| 601 | Ga0265338_10003330 | 3300028800 | Bacteria | 22715 |
| 602 | Ga0265338_10006995 | 3300028800 | Bacteria | 14168 |
| 603 | Ga0265338_10022905 | 3300028800 | Bacteria | 6445 |
| 604 | Ga0265338_10090464 | 3300028800 | Bacteria | 2532 |
| 605 | Ga0265338_10097530 | 3300028800 | Bacteria | 2408 |
| 606 | Ga0265338_10520521 | 3300028800 | Bacteria | 835 |
| 607 | Ga0265324_10055753 | 3300029957 | Bacteria | 1355 |
| 608 | Ga0265330_10003034 | 3300031235 | Bacteria | 8912 |
| 609 | Ga0265330_10031370 | 3300031235 | Unclassified | 2382 |
| 610 | Ga0265332_10027056 | 3300031238 | Bacteria | 2513 |
| 611 | Ga0265332_10047516 | 3300031238 | Unclassified | 1847 |
| 612 | Ga0265328_10004790 | 3300031239 | Bacteria | 5842 |
| 613 | Ga0265320_10028343 | 3300031240 | Bacteria | 2908 |
| 614 | Ga0265320_10054006 | 3300031240 | Bacteria | 1940 |
| 615 | Ga0265320_10067175 | 3300031240 | Unclassified | 1697 |
| 616 | Ga0265320_10128489 | 3300031240 | Bacteria | 1152 |
| 617 | Ga0265325_10011495 | 3300031241 | Bacteria | 5084 |
| 618 | Ga0265325_10063780 | 3300031241 | Unclassified | 1864 |
| 619 | Ga0265329_10019276 | 3300031242 | Bacteria | 2318 |
| 620 | Ga0265340_10008992 | 3300031247 | Bacteria | 5379 |
| 621 | Ga0265340_10012083 | 3300031247 | Bacteria | 4567 |
| 622 | Ga0265339_10007646 | 3300031249 | Bacteria | 6959 |
| 623 | Ga0265339_10047116 | 3300031249 | Bacteria | 2367 |
| 624 | Ga0265339_10143175 | 3300031249 | Bacteria | 1214 |
| 625 | Ga0265331_10002581 | 3300031250 | Bacteria | 12179 |
| 626 | Ga0265327_10004211 | 3300031251 | Bacteria | 12930 |
| 627 | Ga0265327_10044043 | 3300031251 | Bacteria | 2382 |
| 628 | Ga0265316_10017801 | 3300031344 | Bacteria | 6125 |
| 629 | Ga0265316_10021439 | 3300031344 | Bacteria | 5471 |
| 630 | Ga0307408_100034320 | 3300031548 | Bacteria | 3553 |
| 631 | Ga0265313_10006244 | 3300031595 | Bacteria | 8506 |
| 632 | Ga0265313_10014033 | 3300031595 | Bacteria | 4768 |
| 633 | Ga0265313_10037004 | 3300031595 | Bacteria | 2446 |
| 634 | Ga0316575_10270804 | 3300031665 | Bacteria | 715 |
| 635 | Ga0316579_10001025 | 3300031691 | Bacteria | 9840 |
| 636 | Ga0265314_10002715 | 3300031711 | Bacteria | 17709 |
| 637 | Ga0265314_10105890 | 3300031711 | Bacteria | 1797 |
| 638 | Ga0265342_10041110 | 3300031712 | Bacteria | 2801 |
| 639 | Ga0265342_10075846 | 3300031712 | Bacteria | 1949 |
| 640 | Ga0316578_10298545 | 3300031728 | Bacteria | 963 |
| 641 | Ga0307405_10069030 | 3300031731 | Bacteria | 2264 |
| 642 | Ga0316577_10044611 | 3300031733 | Bacteria | 2480 |
| 643 | Ga0307410_10810593 | 3300031852 | Bacteria | 797 |
| 644 | Ga0307406_10039612 | 3300031901 | Bacteria | 2925 |
| 645 | Ga0307412_10015147 | 3300031911 | Bacteria | 4563 |
| 646 | Ga0307409_100082546 | 3300031995 | Bacteria | 2602 |
| 647 | Ga0307416_100507537 | 3300032002 | Bacteria | 1271 |
| 648 | Ga0316593_10001140 | 3300032168 | Bacteria | 5632 |
| 649 | Ga0373944_0108474 | 3300035089 | Unclassified | 945 |
| 650 | Ga0373944_0364219 | 3300035089 | Bacteria | 552 |
| 651 | Ga0373952_0049961 | 3300035092 | Unclassified | 994 |
| 652 | Ga0373923_0257598 | 3300035111 | Bacteria | 818 |
| 653 | Ga0373923_0313069 | 3300035111 | Bacteria | 745 |
| 654 | Ga0373932_0051433 | 3300035112 | Bacteria | 1224 |
| 655 | Ga0373932_0340694 | 3300035112 | Unclassified | 568 |
| 656 | Ga0373936_0462244 | 3300035113 | Bacteria | 588 |
| 657 | Ga0373939_0240948 | 3300035114 | Bacteria | 700 |
| 658 | Ga0373945_0074096 | 3300035116 | Bacteria | 1294 |
| 659 | Ga0373956_0199189 | 3300035119 | Bacteria | 949 |
| 660 | Ga0373946_0139395 | 3300035171 | Bacteria | 1123 |
| 661 | Ga0373961_0246874 | 3300035241 | Unclassified | 645 |
| 662 | Ga0373962_0109860 | 3300035242 | Bacteria | 869 |
| 663 | Ga0373962_0148032 | 3300035242 | Bacteria | 767 |
| 664 | Ga0373931_0009347 | 3300035691 | Unclassified | 4685 |
| 665 | Ga0373931_0105006 | 3300035691 | Bacteria | 1594 |
| 666 | Ga0373931_0287847 | 3300035691 | Bacteria | 1011 |
| 667 | Ga0373935_0070171 | 3300035692 | Bacteria | 2258 |
| 668 | Ga0373935_0208180 | 3300035692 | Bacteria | 1354 |
| 669 | Ga0373935_0546524 | 3300035692 | Unclassified | 844 |
| 670 | Ga0373927_0116197 | 3300035695 | Bacteria | 1745 |
| 671 | Ga0373937_0063777 | 3300036401 | Bacteria | 3389 |
| 672 | Ga0316582_0000662 | 3300036647 | Bacteria | 13499 |
| 673 | Ga0316584_0010521 | 3300036712 | Bacteria | 6470 |
| 674 | Ga0373925_0298362 | 3300037068 | Bacteria | 1301 |
| 675 | Ga0373925_0893000 | 3300037068 | Bacteria | 732 |
| 676 | Ga0395899_0003270 | 3300037312 | Bacteria | 12847 |
| 677 | Ga0395899_0033443 | 3300037312 | Bacteria | 3861 |
| 678 | Ga0395899_0414557 | 3300037312 | Bacteria | 888 |
| 679 | Ga0395900_0022252 | 3300037418 | Bacteria | 6486 |
| 680 | Ga0395900_0024871 | 3300037418 | Bacteria | 6128 |
| 681 | Ga0395900_0126297 | 3300037418 | Bacteria | 2623 |
| 682 | Ga0395900_0501942 | 3300037418 | Bacteria | 1163 |
| 683 | Ga0395900_0631020 | 3300037418 | Bacteria | 1010 |
| 684 | Ga0395900_0917298 | 3300037418 | Bacteria | 799 |
| 685 | Ga0395898_0003471 | 3300037466 | Bacteria | 17603 |
| 686 | Ga0395898_0009931 | 3300037466 | Bacteria | 9969 |
| 687 | Ga0395898_0161150 | 3300037466 | Bacteria | 2145 |
| 688 | Ga0395898_0578424 | 3300037466 | Bacteria | 1065 |
| 689 | Ga0395898_1053946 | 3300037466 | Bacteria | 748 |
| 690 | Ga0395905_0052710 | 3300037471 | Bacteria | 3808 |
| 691 | Ga0395905_0066323 | 3300037471 | Bacteria | 3380 |
| 692 | Ga0395905_0256517 | 3300037471 | Bacteria | 1633 |
| 693 | Ga0395905_0345425 | 3300037471 | Bacteria | 1379 |
| 694 | Ga0316581_0001886 | 3300037588 | Bacteria | 4884 |
| 695 | Ga0395901_0024550 | 3300038443 | Bacteria | 6189 |
| 696 | Ga0395901_0172907 | 3300038443 | Bacteria | 2266 |
| 697 | Ga0395901_0182269 | 3300038443 | Bacteria | 2202 |
| 698 | Ga0395901_0283990 | 3300038443 | Bacteria | 1719 |
| 699 | Ga0395901_0626734 | 3300038443 | Bacteria | 1081 |
| 700 | Ga0242420_055523 | 3300038996 | Bacteria | 782 |
| 701 | Ga0436360_0959266 | 3300039438 | Bacteria | 1673 |
| 702 | Ga0451798_0326687 | 3300041458 | Bacteria | 893 |
| 703 | Ga0451802_0368654 | 3300041460 | Bacteria | 628 |
| 704 | Ga0451853_2372324 | 3300041512 | Bacteria | 536 |
| 705 | Ga0451853_2728074 | 3300041512 | Bacteria | 782 |
| 706 | Ga0450905_021693 | 3300042142 | Bacteria | 951 |
| 707 | Ga0466963_0120056 | 3300044694 | Bacteria | 1808 |
| 708 | Ga0453684_0159451 | 3300044712 | Unclassified | 2670 |
| 709 | Ga0466968_0297620 | 3300044735 | Archaea | 775 |
| 710 | Ga0466957_0053182 | 3300044842 | Bacteria | 2468 |
| 711 | Ga0466957_0349182 | 3300044842 | Bacteria | 1003 |
| 712 | Ga0466957_0751448 | 3300044842 | Bacteria | 691 |
| 713 | Ga0466960_0898405 | 3300044901 | Bacteria | 540 |
| 714 | Ga0451576_0080051 | 3300045051 | Bacteria | 3399 |
| 715 | Ga0451576_0458790 | 3300045051 | Unclassified | 1338 |
| 716 | Ga0451576_0914256 | 3300045051 | Unclassified | 920 |
| 717 | Ga0466958_0035946 | 3300045836 | Bacteria | 2962 |
| 718 | Ga0466958_0461954 | 3300045836 | Bacteria | 822 |
| 719 | Ga0466967_0485790 | 3300045976 | Unclassified | 1210 |
| 720 | Ga0466967_0618600 | 3300045976 | Bacteria | 1070 |
| 721 | Ga0466967_2178838 | 3300045976 | Bacteria | 550 |
| 722 | Ga0495603_0076715 | 3300046455 | Bacteria | 1961 |
| 723 | Ga0495603_0195120 | 3300046455 | Bacteria | 1170 |
| 724 | Ga0495629_0053496 | 3300046459 | Bacteria | 2824 |
| 725 | Ga0495629_0921436 | 3300046459 | Bacteria | 572 |
| 726 | Ga0495629_0993267 | 3300046459 | Unclassified | 547 |
| 727 | Ga0495641_0128025 | 3300046461 | Bacteria | 1133 |
| 728 | Ga0495641_0143319 | 3300046461 | Bacteria | 1067 |
| 729 | Ga0495641_0183396 | 3300046461 | Bacteria | 937 |
| 730 | Ga0495641_0290946 | 3300046461 | Bacteria | 736 |
| 731 | Ga0495653_0506740 | 3300046463 | Bacteria | 752 |
| 732 | Ga0495580_0128707 | 3300046472 | Bacteria | 1757 |
| 733 | Ga0495580_0459923 | 3300046472 | Unclassified | 853 |
| 734 | Ga0495582_0055327 | 3300046473 | Bacteria | 2187 |
| 735 | Ga0495582_0067352 | 3300046473 | Bacteria | 1978 |
| 736 | Ga0495582_0237333 | 3300046473 | Bacteria | 1045 |
| 737 | Ga0495605_0156860 | 3300046474 | Unclassified | 1012 |
| 738 | Ga0495605_0226456 | 3300046474 | Bacteria | 806 |
| 739 | Ga0495605_0278895 | 3300046474 | Bacteria | 711 |
| 740 | Ga0495639_0053402 | 3300046475 | Bacteria | 1841 |
| 741 | Ga0495584_0081020 | 3300046491 | Bacteria | 1634 |
| 742 | Ga0495584_0096017 | 3300046491 | Bacteria | 1497 |
| 743 | Ga0495584_0184057 | 3300046491 | Bacteria | 1061 |
| 744 | Ga0495585_0125181 | 3300046492 | Bacteria | 1357 |
| 745 | Ga0495594_0232371 | 3300046499 | Bacteria | 1051 |
| 746 | Ga0495594_0437822 | 3300046499 | Bacteria | 743 |
| 747 | Ga0495594_0602332 | 3300046499 | Bacteria | 623 |
| 748 | Ga0495596_0133685 | 3300046500 | Bacteria | 963 |
| 749 | Ga0495618_0404144 | 3300046514 | Bacteria | 835 |
| 750 | Ga0495630_0490291 | 3300046517 | Unclassified | 942 |
| 751 | Ga0495630_1125567 | 3300046517 | Bacteria | 595 |
| 752 | Ga0495632_0436902 | 3300046519 | Bacteria | 569 |
| 753 | Ga0495644_0130386 | 3300046523 | Bacteria | 958 |
| 754 | Ga0495644_0215673 | 3300046523 | Bacteria | 741 |
| 755 | Ga0495644_0447391 | 3300046523 | Unclassified | 514 |
| 756 | Ga0495663_0131090 | 3300046525 | Bacteria | 845 |
| 757 | Ga0495663_0343527 | 3300046525 | Bacteria | 543 |
| 758 | Ga0495642_0040762 | 3300046528 | Bacteria | 1887 |
| 759 | Ga0495642_0183693 | 3300046528 | Bacteria | 910 |
| 760 | Ga0495665_0154227 | 3300046531 | Bacteria | 1198 |
| 761 | Ga0495586_0283847 | 3300046535 | Bacteria | 948 |
| 762 | Ga0495598_0353795 | 3300046537 | Bacteria | 566 |
| 763 | Ga0495609_0090509 | 3300046538 | Bacteria | 1331 |
| 764 | Ga0495609_0188628 | 3300046538 | Bacteria | 866 |
| 765 | Ga0495609_0224261 | 3300046538 | Unclassified | 780 |
| 766 | Ga0495633_0196479 | 3300046558 | Bacteria | 927 |
| 767 | Ga0495633_0322686 | 3300046558 | Bacteria | 701 |
| 768 | Ga0495656_0046893 | 3300046615 | Bacteria | 1830 |
| 769 | Ga0495656_0329901 | 3300046615 | Bacteria | 787 |
| 770 | Ga0495634_0339551 | 3300046642 | Bacteria | 901 |
| 771 | Ga0495634_0507867 | 3300046642 | Unclassified | 706 |
| 772 | Ga0495635_0291771 | 3300046663 | Bacteria | 1094 |
| 773 | Ga0495635_0943897 | 3300046663 | Bacteria | 551 |
| 774 | Ga0495659_0008068 | 3300046664 | Bacteria | 3344 |
| 775 | Ga0495661_0370088 | 3300046665 | Unclassified | 702 |
| 776 | Ga0495588_0129807 | 3300046674 | Bacteria | 1329 |
| 777 | Ga0495588_0371867 | 3300046674 | Bacteria | 751 |
| 778 | Ga0495657_0500747 | 3300046675 | Bacteria | 708 |
| 779 | Ga0495647_0008542 | 3300046681 | Bacteria | 3445 |
| 780 | Ga0495647_0040462 | 3300046681 | Bacteria | 1771 |
| 781 | Ga0495658_0314091 | 3300046683 | Bacteria | 992 |
| 782 | Ga0495658_0513795 | 3300046683 | Bacteria | 767 |
| 783 | Ga0495613_0342085 | 3300046689 | Bacteria | 1029 |
| 784 | Ga0495613_0418582 | 3300046689 | Bacteria | 912 |
| 785 | Ga0495613_0458627 | 3300046689 | Bacteria | 863 |
| 786 | Ga0495613_1015565 | 3300046689 | Bacteria | 532 |
| 787 | Ga0495670_0125502 | 3300046691 | Bacteria | 1336 |
| 788 | Ga0495671_0123217 | 3300046692 | Bacteria | 1264 |
| 789 | Ga0495589_0162387 | 3300046794 | Bacteria | 1064 |
| 790 | Ga0495581_0001339 | 3300047315 | Bacteria | 13606 |
| 791 | Ga0495581_0026920 | 3300047315 | Bacteria | 3334 |
| 792 | Ga0495636_0232906 | 3300047318 | Bacteria | 848 |
| 793 | Ga0495674_0932136 | 3300047319 | Bacteria | 669 |
| 794 | Ga0495676_0112220 | 3300047321 | Bacteria | 1998 |
| 795 | Ga0495680_0196753 | 3300047322 | Unclassified | 1448 |
| 796 | Ga0495680_0305903 | 3300047322 | Bacteria | 1115 |
| 797 | Ga0495683_0416222 | 3300047323 | Bacteria | 556 |
| 798 | Ga0495677_0033528 | 3300047445 | Bacteria | 1872 |
| 799 | Ga0495677_0243218 | 3300047445 | Bacteria | 703 |
| 800 | Ga0495685_303962 | 3300047447 | Unclassified | 501 |
| 801 | Ga0495684_0881134 | 3300047471 | Bacteria | 578 |
| 802 | Ga0495684_1060006 | 3300047471 | Bacteria | 511 |
| 803 | Ga0495614_0083571 | 3300048089 | Bacteria | 1385 |
| 804 | Ga0495614_0259594 | 3300048089 | Bacteria | 796 |
| 805 | Ga0496100_0064483 | 3300048903 | Bacteria | 2424 |
| 806 | Ga0496100_0346477 | 3300048903 | Unclassified | 1121 |
| 807 | Ga0496100_1099190 | 3300048903 | Bacteria | 626 |
| 808 | Ga0496101_0012096 | 3300048904 | Bacteria | 5752 |
| 809 | Ga0496101_0064414 | 3300048904 | Bacteria | 2670 |
| 810 | Ga0496101_0084510 | 3300048904 | Bacteria | 2350 |
| 811 | Ga0496101_0675783 | 3300048904 | Unclassified | 816 |
| 812 | Ga0496102_0001619 | 3300048905 | Bacteria | 19836 |
| 813 | Ga0496102_0003519 | 3300048905 | Bacteria | 13271 |
| 814 | Ga0496102_0270062 | 3300048905 | Bacteria | 1603 |
| 815 | Ga0496102_0305497 | 3300048905 | Bacteria | 1499 |
| 816 | Ga0496102_0457413 | 3300048905 | Bacteria | 1197 |
| 817 | Ga0496102_1278023 | 3300048905 | Bacteria | 653 |
| 818 | Ga0496103_0003260 | 3300048906 | Bacteria | 9944 |
| 819 | Ga0496103_0029954 | 3300048906 | Bacteria | 3309 |
| 820 | Ga0496103_0043372 | 3300048906 | Bacteria | 2769 |
| 821 | Ga0496103_0536027 | 3300048906 | Unclassified | 748 |
| 822 | Ga0496104_0000698 | 3300048907 | Bacteria | 28892 |
| 823 | Ga0496104_0001046 | 3300048907 | Bacteria | 23659 |
| 824 | Ga0496104_0009894 | 3300048907 | Bacteria | 8513 |
| 825 | Ga0496104_0356211 | 3300048907 | Unclassified | 1376 |
| 826 | Ga0496104_0588316 | 3300048907 | Bacteria | 1023 |
| 827 | Ga0496105_0000377 | 3300048908 | Bacteria | 29481 |
| 828 | Ga0496105_0048769 | 3300048908 | Bacteria | 3495 |
| 829 | Ga0496105_0129487 | 3300048908 | Bacteria | 2081 |
| 830 | Ga0496105_0232354 | 3300048908 | Bacteria | 1498 |
| 831 | Ga0496105_1421653 | 3300048908 | Unclassified | 502 |
| 832 | Ga0496106_0124286 | 3300048909 | Bacteria | 2019 |
| 833 | Ga0496106_0218534 | 3300048909 | Bacteria | 1519 |
| 834 | Ga0496106_1110412 | 3300048909 | Bacteria | 619 |
| 835 | Ga0496106_1399612 | 3300048909 | Unclassified | 540 |
| 836 | Ga0496107_0011180 | 3300048910 | Bacteria | 6249 |
| 837 | Ga0496107_0116854 | 3300048910 | Bacteria | 1964 |
| 838 | Ga0496107_0355417 | 3300048910 | Bacteria | 1090 |
| 839 | Ga0496107_0777274 | 3300048910 | Bacteria | 702 |
| 840 | Ga0496108_0022580 | 3300048911 | Bacteria | 5174 |
| 841 | Ga0496108_0058653 | 3300048911 | Bacteria | 3236 |
| 842 | Ga0496108_0079904 | 3300048911 | Bacteria | 2769 |
| 843 | Ga0496108_0138930 | 3300048911 | Bacteria | 2092 |
| 844 | Ga0496108_1162091 | 3300048911 | Unclassified | 654 |
| 845 | Ga0496109_0000283 | 3300048912 | Bacteria | 48503 |
| 846 | Ga0496109_0008233 | 3300048912 | Bacteria | 8851 |
| 847 | Ga0496109_0018123 | 3300048912 | Bacteria | 6182 |
| 848 | Ga0496109_0030646 | 3300048912 | Bacteria | 4821 |
| 849 | Ga0496109_0297884 | 3300048912 | Bacteria | 1521 |
| 850 | Ga0496109_0336530 | 3300048912 | Bacteria | 1425 |
| 851 | Ga0496109_0781339 | 3300048912 | Bacteria | 893 |
| 852 | Ga0496110_0000421 | 3300048913 | Bacteria | 28725 |
| 853 | Ga0496110_0053942 | 3300048913 | Unclassified | 3536 |
| 854 | Ga0496110_0074374 | 3300048913 | Unclassified | 3017 |
| 855 | Ga0496110_0131141 | 3300048913 | Bacteria | 2263 |
| 856 | Ga0496110_0988482 | 3300048913 | Bacteria | 749 |
| 857 | Ga0496110_1365033 | 3300048913 | Bacteria | 618 |
| 858 | Ga0496111_0010483 | 3300048914 | Bacteria | 6222 |
| 859 | Ga0496111_0011174 | 3300048914 | Bacteria | 6042 |
| 860 | Ga0496111_0094587 | 3300048914 | Bacteria | 2192 |
| 861 | Ga0496111_0248317 | 3300048914 | Bacteria | 1321 |
| 862 | Ga0496112_0020222 | 3300048915 | Bacteria | 6304 |
| 863 | Ga0496112_0028386 | 3300048915 | Bacteria | 5400 |
| 864 | Ga0496112_0031596 | 3300048915 | Bacteria | 5137 |
| 865 | Ga0496112_0164841 | 3300048915 | Bacteria | 2182 |
| 866 | Ga0496112_0966738 | 3300048915 | Bacteria | 772 |
| 867 | Ga0496112_1010401 | 3300048915 | Bacteria | 751 |
| 868 | Ga0496113_0020678 | 3300048916 | Bacteria | 4633 |
| 869 | Ga0496113_0049095 | 3300048916 | Bacteria | 3142 |
| 870 | Ga0496113_0076488 | 3300048916 | Bacteria | 2557 |
| 871 | Ga0496113_0476916 | 3300048916 | Bacteria | 1002 |
| 872 | Ga0496113_0591410 | 3300048916 | Bacteria | 889 |
| 873 | Ga0496113_0617693 | 3300048916 | Unclassified | 868 |
| 874 | Ga0496114_0000356 | 3300048917 | Bacteria | 33554 |
| 875 | Ga0496114_0000404 | 3300048917 | Bacteria | 31906 |
| 876 | Ga0496114_0028777 | 3300048917 | Bacteria | 4562 |
| 877 | Ga0496114_0556489 | 3300048917 | Bacteria | 1013 |
| 878 | Ga0496114_0625826 | 3300048917 | Bacteria | 948 |
| 879 | Ga0496115_0005787 | 3300048918 | Bacteria | 9000 |
| 880 | Ga0496115_0022227 | 3300048918 | Bacteria | 4912 |
| 881 | Ga0496115_0212232 | 3300048918 | Bacteria | 1599 |
| 882 | Ga0496115_0904930 | 3300048918 | Bacteria | 680 |
| 883 | Ga0501031_0027243 | 3300049568 | Bacteria | 3726 |
| 884 | Ga0501031_0191614 | 3300049568 | Bacteria | 1335 |
| 885 | Ga0501032_0013942 | 3300049569 | Bacteria | 5702 |
| 886 | Ga0501033_0183667 | 3300049570 | Bacteria | 1498 |
| 887 | Ga0501033_0581643 | 3300049570 | Bacteria | 769 |
| 888 | Ga0501034_0150771 | 3300049571 | Bacteria | 2301 |
| 889 | Ga0501036_0058101 | 3300049572 | Bacteria | 3277 |
| 890 | Ga0501036_0590150 | 3300049572 | Bacteria | 922 |
| 891 | Ga0501036_1040599 | 3300049572 | Bacteria | 669 |
| 892 | Ga0501037_0088672 | 3300049573 | Bacteria | 2239 |
| 893 | Ga0501038_0001813 | 3300049574 | Bacteria | 19780 |
| 894 | Ga0501038_0401415 | 3300049574 | Bacteria | 1060 |
| 895 | Ga0501038_0466079 | 3300049574 | Bacteria | 970 |
| 896 | Ga0501039_0002116 | 3300049575 | Bacteria | 14703 |
| 897 | Ga0501039_0130202 | 3300049575 | Bacteria | 1974 |
| 898 | Ga0501039_0418098 | 3300049575 | Bacteria | 1053 |
| 899 | Ga0501039_0746954 | 3300049575 | Bacteria | 764 |
| 900 | Ga0501039_1205342 | 3300049575 | Unclassified | 585 |
| 901 | Ga0501040_0001107 | 3300049576 | Bacteria | 17068 |
| 902 | Ga0501040_0040991 | 3300049576 | Bacteria | 3153 |
| 903 | Ga0501040_0101146 | 3300049576 | Bacteria | 2011 |
| 904 | Ga0501040_0333393 | 3300049576 | Bacteria | 1086 |
| 905 | Ga0501040_0511618 | 3300049576 | Bacteria | 865 |
| 906 | Ga0501040_0611108 | 3300049576 | Unclassified | 788 |
| 907 | Ga0501040_0662039 | 3300049576 | Bacteria | 755 |
| 908 | Ga0501041_0000320 | 3300049577 | Bacteria | 23433 |
| 909 | Ga0501041_0611755 | 3300049577 | Bacteria | 696 |
| 910 | Ga0501041_0807828 | 3300049577 | Bacteria | 601 |
| 911 | Ga0501042_0000344 | 3300049578 | Bacteria | 23309 |
| 912 | Ga0501042_0029779 | 3300049578 | Bacteria | 3850 |
| 913 | Ga0501042_0808880 | 3300049578 | Bacteria | 682 |
| 914 | Ga0501043_0033912 | 3300049579 | Bacteria | 4016 |
| 915 | Ga0501043_0297292 | 3300049579 | Bacteria | 1235 |
| 916 | Ga0501043_0660542 | 3300049579 | Unclassified | 767 |
| 917 | Ga0501046_0015331 | 3300049580 | Bacteria | 6443 |
| 918 | Ga0501046_0016773 | 3300049580 | Bacteria | 6123 |
| 919 | Ga0501046_0377149 | 3300049580 | Bacteria | 1027 |
| 920 | Ga0501047_0992199 | 3300049581 | Bacteria | 653 |
| 921 | Ga0501048_0019818 | 3300049582 | Bacteria | 4932 |
| 922 | Ga0501048_0178823 | 3300049582 | Bacteria | 1503 |
| 923 | Ga0501048_0962286 | 3300049582 | Bacteria | 614 |
| 924 | Ga0501048_1138155 | 3300049582 | Bacteria | 561 |
| 925 | Ga0501068_0050250 | 3300049584 | Bacteria | 2520 |
| 926 | Ga0501068_0073902 | 3300049584 | Unclassified | 2083 |
| 927 | Ga0501068_0126473 | 3300049584 | Bacteria | 1596 |
| 928 | Ga0501069_0039979 | 3300049585 | Bacteria | 2592 |
| 929 | Ga0501070_0522428 | 3300049586 | Unclassified | 952 |
| 930 | Ga0501070_0615991 | 3300049586 | Bacteria | 864 |
| 931 | Ga0501071_0000317 | 3300049587 | Bacteria | 23301 |
| 932 | Ga0501071_0240978 | 3300049587 | Unclassified | 1363 |
| 933 | Ga0501071_0514503 | 3300049587 | Bacteria | 918 |
| 934 | Ga0501072_0000574 | 3300049588 | Bacteria | 26476 |
| 935 | Ga0501072_0121134 | 3300049588 | Bacteria | 2084 |
| 936 | Ga0501072_0256662 | 3300049588 | Bacteria | 1392 |
| 937 | Ga0501072_0355110 | 3300049588 | Bacteria | 1163 |
| 938 | Ga0501072_0426560 | 3300049588 | Bacteria | 1051 |
| 939 | Ga0501072_0778764 | 3300049588 | Bacteria | 750 |
| 940 | Ga0501073_0059639 | 3300049589 | Bacteria | 2664 |
| 941 | Ga0501073_0381498 | 3300049589 | Viruses | 974 |
| 942 | Ga0501073_0638563 | 3300049589 | Bacteria | 735 |
| 943 | Ga0501074_0056267 | 3300049590 | Bacteria | 2835 |
| 944 | Ga0501074_0364277 | 3300049590 | Bacteria | 1025 |
| 945 | Ga0501074_0965866 | 3300049590 | Unclassified | 599 |
| 946 | Ga0501075_0000513 | 3300049591 | Bacteria | 23373 |
| 947 | Ga0501075_0018980 | 3300049591 | Bacteria | 4986 |
| 948 | Ga0501075_0043348 | 3300049591 | Bacteria | 3375 |
| 949 | Ga0501075_0177238 | 3300049591 | Bacteria | 1627 |
| 950 | Ga0501075_0223316 | 3300049591 | Bacteria | 1437 |
| 951 | Ga0501075_0281321 | 3300049591 | Bacteria | 1267 |
| 952 | Ga0501075_1372668 | 3300049591 | Bacteria | 535 |
| 953 | Ga0501076_0000576 | 3300049592 | Bacteria | 23425 |
| 954 | Ga0501076_0156952 | 3300049592 | Bacteria | 1852 |
| 955 | Ga0501076_0199587 | 3300049592 | Bacteria | 1633 |
| 956 | Ga0501077_0003494 | 3300049593 | Bacteria | 9436 |
| 957 | Ga0501077_0050431 | 3300049593 | Bacteria | 2645 |
| 958 | Ga0501077_0103335 | 3300049593 | Bacteria | 1805 |
| 959 | Ga0501077_0128955 | 3300049593 | Bacteria | 1603 |
| 960 | Ga0501077_0245896 | 3300049593 | Bacteria | 1137 |
| 961 | Ga0501077_0815335 | 3300049593 | Bacteria | 600 |
| 962 | Ga0501077_0925627 | 3300049593 | Unclassified | 561 |
| 963 | Ga0501077_1091832 | 3300049593 | Unclassified | 513 |
| 964 | Ga0501249_024466 | 3300049679 | Bacteria | 1331 |
| 965 | Ga0501079_0016181 | 3300049741 | Bacteria | 5700 |
| 966 | Ga0501079_0016305 | 3300049741 | Bacteria | 5678 |
| 967 | Ga0501079_0040025 | 3300049741 | Bacteria | 3616 |
| 968 | Ga0501079_0503392 | 3300049741 | Bacteria | 952 |
| 969 | Ga0501079_1044947 | 3300049741 | Bacteria | 643 |
| 970 | Ga0501080_0004673 | 3300049742 | Bacteria | 12216 |
| 971 | Ga0501080_0041786 | 3300049742 | Bacteria | 4270 |
| 972 | Ga0501080_0110860 | 3300049742 | Unclassified | 2543 |
| 973 | Ga0501080_0958930 | 3300049742 | Bacteria | 743 |
| 974 | Ga0501081_0000423 | 3300049743 | Bacteria | 23363 |
| 975 | Ga0501081_0039647 | 3300049743 | Unclassified | 3224 |
| 976 | Ga0501081_0119550 | 3300049743 | Bacteria | 1875 |
| 977 | Ga0501081_0299821 | 3300049743 | Bacteria | 1179 |
| 978 | Ga0501081_0384583 | 3300049743 | Bacteria | 1037 |
| 979 | Ga0501081_1059822 | 3300049743 | Bacteria | 613 |
| 980 | Ga0501083_0248335 | 3300049744 | Unclassified | 1158 |
| 981 | Ga0501083_1060623 | 3300049744 | Bacteria | 527 |
| 982 | Ga0501262_015981 | 3300049759 | Bacteria | 990 |
| 983 | Ga0501035_0025060 | 3300049822 | Bacteria | 5469 |
| 984 | Ga0501035_1074868 | 3300049822 | Bacteria | 629 |
| 985 | Ga0501044_0178695 | 3300049823 | Bacteria | 2090 |
| 986 | Ga0501045_0031588 | 3300049824 | Bacteria | 3835 |
| 987 | Ga0501045_0115338 | 3300049824 | Bacteria | 1992 |
| 988 | nmdc:mga03n38_460771_c1 | 3300050490 | Unclassified | 708 |
| 989 | nmdc:mga05p37_1846538_c1 | 3300050507 | Bacteria | 580 |
| 990 | nmdc:mga05p37_19422_c1 | 3300050507 | Bacteria | 8221 |
| 991 | nmdc:mga05p37_259977_c1 | 3300050507 | Bacteria | 2078 |
| 992 | nmdc:mga05p37_34025_c1 | 3300050507 | Bacteria | 6242 |
| 993 | nmdc:mga05p37_35873_c1 | 3300050507 | Bacteria | 6084 |
| 994 | nmdc:mga05p37_491785_c1 | 3300050507 | Unclassified | 1410 |
| 995 | nmdc:mga05p37_560548_c1 | 3300050507 | Bacteria | 1298 |
| 996 | nmdc:mga05p37_60335_c1 | 3300050507 | Bacteria | 4671 |
| 997 | nmdc:mga05p37_693176_c1 | 3300050507 | Bacteria | 1133 |
| 998 | nmdc:mga05p37_74032_c1 | 3300050507 | Unclassified | 4192 |
| 999 | nmdc:mga09592_1678241_c1 | 3300050508 | Unclassified | 513 |
| 1000 | nmdc:mga09592_240494_c1 | 3300050508 | Unclassified | 1569 |
| 1001 | nmdc:mga09592_409898_c1 | 3300050508 | Bacteria | 1171 |
| 1002 | nmdc:mga09592_611705_c1 | 3300050508 | Unclassified | 933 |
| 1003 | nmdc:mga0qj67_138991_c1 | 3300050509 | Unclassified | 1969 |
| 1004 | nmdc:mga0qj67_462539_c1 | 3300050509 | Bacteria | 1021 |
| 1005 | nmdc:mga0qj67_69933_c1 | 3300050509 | Bacteria | 2799 |
| 1006 | nmdc:mga06r32_1065853_c1 | 3300050510 | Bacteria | 758 |
| 1007 | nmdc:mga06r32_1695926_c1 | 3300050510 | Unclassified | 569 |
| 1008 | nmdc:mga06r32_214866_c1 | 3300050510 | Unclassified | 1911 |
| 1009 | nmdc:mga06r32_334682_c1 | 3300050510 | Bacteria | 1499 |
| 1010 | nmdc:mga06r32_663715_c1 | 3300050510 | Unclassified | 1010 |
| 1011 | nmdc:mga06r32_682196_c1 | 3300050510 | Bacteria | 994 |
| 1012 | nmdc:mga08y16_1259750_c1 | 3300050511 | Unclassified | 708 |
| 1013 | nmdc:mga08y16_1417291_c1 | 3300050511 | Bacteria | 657 |
| 1014 | nmdc:mga08y16_1623738_c1 | 3300050511 | Archaea | 604 |
| 1015 | nmdc:mga08y16_637842_c1 | 3300050511 | Bacteria | 1071 |
| 1016 | nmdc:mga0n895_108971_c1 | 3300050512 | Bacteria | 2785 |
| 1017 | nmdc:mga0n895_1254366_c1 | 3300050512 | Bacteria | 713 |
| 1018 | nmdc:mga0n895_141967_c1 | 3300050512 | Bacteria | 2430 |
| 1019 | nmdc:mga0n895_1677431_c1 | 3300050512 | Bacteria | 598 |
| 1020 | nmdc:mga0n895_1865749_c1 | 3300050512 | Unclassified | 561 |
| 1021 | nmdc:mga0n895_21024_c1 | 3300050512 | Bacteria | 6098 |
| 1022 | nmdc:mga0n895_2319_c1 | 3300050512 | Bacteria | 14822 |
| 1023 | nmdc:mga0n895_255871_c1 | 3300050512 | Unclassified | 1777 |
| 1024 | nmdc:mga0n895_729112_c1 | 3300050512 | Bacteria | 985 |
| 1025 | nmdc:mga0n895_880082_c1 | 3300050512 | Bacteria | 882 |
| 1026 | nmdc:mga0rr50_1237780_c1 | 3300050513 | Unclassified | 634 |
| 1027 | nmdc:mga0rr50_1325911_c1 | 3300050513 | Bacteria | 610 |
| 1028 | nmdc:mga0rr50_205196_c1 | 3300050513 | Unclassified | 1622 |
| 1029 | nmdc:mga0rr50_323791_c1 | 3300050513 | Unclassified | 1293 |
| 1030 | nmdc:mga0rr50_355271_c1 | 3300050513 | Unclassified | 1233 |
| 1031 | nmdc:mga0rr50_5398_c1 | 3300050513 | Bacteria | 7619 |
| 1032 | nmdc:mga0rr50_615625_c1 | 3300050513 | Bacteria | 926 |
| 1033 | nmdc:mga0rr50_746733_c1 | 3300050513 | Unclassified | 835 |
| 1034 | nmdc:mga08x19_159186_c1 | 3300050514 | Bacteria | 1533 |
| 1035 | nmdc:mga08x19_288102_c1 | 3300050514 | Bacteria | 1139 |
| 1036 | nmdc:mga08x19_293667_c1 | 3300050514 | Bacteria | 1128 |
| 1037 | nmdc:mga08x19_6320_c1 | 3300050514 | Bacteria | 7012 |
| 1038 | nmdc:mga0a205_1185041_c1 | 3300050515 | Unclassified | 612 |
| 1039 | nmdc:mga0a205_268924_c1 | 3300050515 | Bacteria | 1582 |
| 1040 | nmdc:mga0a205_28114_c1 | 3300050515 | Bacteria | 5374 |
| 1041 | nmdc:mga0a205_355823_c1 | 3300050515 | Bacteria | 1331 |
| 1042 | nmdc:mga0a205_399499_c1 | 3300050515 | Unclassified | 1238 |
| 1043 | nmdc:mga0a205_416967_c1 | 3300050515 | Bacteria | 1205 |
| 1044 | nmdc:mga0a205_46191_c2 | 3300050515 | Unclassified | 3884 |
| 1045 | nmdc:mga0a205_580247_c1 | 3300050515 | Bacteria | 975 |
| 1046 | Ga0495619_0010339 | 3300053085 | Bacteria | 5872 |
| 1047 | Ga0495619_0103711 | 3300053085 | Bacteria | 1938 |
| 1048 | Ga0501084_0001468 | 3300054114 | Bacteria | 18724 |
| 1049 | Ga0501084_0060273 | 3300054114 | Bacteria | 3177 |
| 1050 | Ga0501084_0432140 | 3300054114 | Bacteria | 1113 |
| 1051 | Ga0501084_0494567 | 3300054114 | Unclassified | 1033 |
| 1052 | Ga0590077_005279 | 3300059426 | Unclassified | 2647 |
| 1053 | Ga0590077_145514 | 3300059426 | Unclassified | 566 |
| 1054 | Ga0587107_113151 | 3300059652 | Unclassified | 551 |
| 1055 | Ga0501082_0018437 | 3300060353 | Bacteria | 6011 |
| 1056 | Ga0501082_0035809 | 3300060353 | Bacteria | 4278 |
| 1057 | Ga0501082_0102827 | 3300060353 | Unclassified | 2471 |
| 1058 | Ga0501082_0104813 | 3300060353 | Bacteria | 2446 |
| 1059 | Ga0501082_0165948 | 3300060353 | Bacteria | 1919 |
| 1060 | Ga0466962_0059781 | 3300061719 | Bacteria | 1819 |
| 1061 | Ga0530510_0076114 | 3300061734 | Bacteria | 2438 |
| 1062 | Ga0530510_0202512 | 3300061734 | Bacteria | 1474 |
| 1063 | Ga0530510_0236698 | 3300061734 | Bacteria | 1359 |
| 1064 | Ga0530510_0258442 | 3300061734 | Bacteria | 1298 |
| 1065 | Ga0065704_10126472 | |||
| 1066 | SwRhRL3b_contig_1296379 | |||
| 1067 | ARSoilOldRDRAFT_c007671 | |||
| 1068 | JGI24744J21845_10050039 | |||
| 1069 | JGI24742J22300_10027238 | |||
| 1070 | JGI26129J50193_1005351 | |||
| 1071 | JGI26141J51220_1016473 | |||
| 1072 | JGI25405J52794_10000972 | |||
| 1073 | Ga0058859_11814659 | |||
| 1074 | Ga0058861_11337636 | |||
| 1075 | Ga0058862_10108325 | |||
| 1076 | Ga0065704_10247922 | |||
| 1077 | Ga0065704_10250528 | |||
| 1078 | Ga0065712_10005198 | |||
| 1079 | Ga0065712_10083595 | |||
| 1080 | Ga0065715_10001245 | |||
| 1081 | Ga0065715_10009782 | |||
| 1082 | Ga0065715_11191938 | |||
| 1083 | Ga0065707_10002967 | |||
| 1084 | Ga0065707_10015515 | |||
| 1085 | Ga0065707_10428092 | |||
| 1086 | Ga0065707_10732491 | |||
| 1087 | Ga0070676_10399610 | |||
| 1088 | Ga0070683_100001708 | |||
| 1089 | Ga0070690_100341121 | |||
| 1090 | Ga0070670_100002504 | |||
| 1091 | Ga0070670_100153305 | |||
| 1092 | Ga0070670_101104771 | |||
| 1093 | Ga0068869_100445125 | |||
| 1094 | Ga0070666_10061309 | |||
| 1095 | Ga0070666_10063655 | |||
| 1096 | Ga0070666_10250905 | |||
| 1097 | Ga0070680_100086954 | |||
| 1098 | Ga0070680_100192827 | |||
| 1099 | Ga0070680_100218396 | |||
| 1100 | Ga0070680_100387419 | |||
| 1101 | Ga0070680_101033560 | |||
| 1102 | Ga0070680_101564153 | |||
| 1103 | Ga0070680_101749608 | |||
| 1104 | Ga0070682_100002331 | |||
| 1105 | Ga0070682_100019799 | |||
| 1106 | Ga0070682_100873408 | |||
| 1107 | Ga0068868_100015257 | |||
| 1108 | Ga0068868_100124128 | |||
| 1109 | Ga0068868_100190192 | |||
| 1110 | Ga0070660_100004253 | |||
| 1111 | Ga0070660_100034848 | |||
| 1112 | Ga0070660_100074301 | |||
| 1113 | Ga0070660_100896560 | |||
| 1114 | Ga0070689_100011564 | |||
| 1115 | Ga0070691_10044381 | |||
| 1116 | Ga0070691_10208129 | |||
| 1117 | Ga0070687_100146086 | |||
| 1118 | Ga0070687_101108211 | |||
| 1119 | Ga0070661_100060435 | |||
| 1120 | Ga0070661_100524184 | |||
| 1121 | Ga0070692_10003563 | |||
| 1122 | Ga0070668_100013432 | |||
| 1123 | Ga0070668_100059870 | |||
| 1124 | Ga0070669_100012929 | |||
| 1125 | Ga0070669_101241397 | |||
| 1126 | Ga0070675_100008011 | |||
| 1127 | Ga0070675_100065803 | |||
| 1128 | Ga0070675_102061908 | |||
| 1129 | Ga0070671_100043036 | |||
| 1130 | Ga0070671_100231357 | |||
| 1131 | Ga0070671_101353339 | |||
| 1132 | Ga0070674_100086678 | |||
| 1133 | Ga0070674_100290390 | |||
| 1134 | Ga0070674_100681818 | |||
| 1135 | Ga0070674_101528736 | |||
| 1136 | Ga0070674_101734986 | |||
| 1137 | Ga0070673_100075688 | |||
| 1138 | Ga0070673_101113435 | |||
| 1139 | Ga0070688_100040381 | |||
| 1140 | Ga0070688_100807044 | |||
| 1141 | Ga0070688_101077616 | |||
| 1142 | Ga0070688_101220076 | |||
| 1143 | Ga0070659_100047318 | |||
| 1144 | Ga0070659_100188912 | |||
| 1145 | Ga0070659_101292078 | |||
| 1146 | Ga0070703_10032462 | |||
| 1147 | Ga0070709_10076295 | |||
| 1148 | Ga0070709_10679171 | |||
| 1149 | Ga0070709_11313779 | |||
| 1150 | Ga0070714_100041626 | |||
| 1151 | Ga0070714_100183372 | |||
| 1152 | Ga0070713_100045171 | |||
| 1153 | Ga0070713_101244707 | |||
| 1154 | Ga0070710_10471467 | |||
| 1155 | Ga0070701_10521768 | |||
| 1156 | Ga0070701_10586011 | |||
| 1157 | Ga0070711_100163024 | |||
| 1158 | Ga0070711_100824316 | |||
| 1159 | Ga0070711_101360597 | |||
| 1160 | Ga0070705_100027122 | |||
| 1161 | Ga0070705_100244979 | |||
| 1162 | Ga0070705_101172981 | |||
| 1163 | Ga0070705_101243250 | |||
| 1164 | Ga0070705_101471926 | |||
| 1165 | Ga0070705_101814950 | |||
| 1166 | Ga0070700_100167547 | |||
| 1167 | Ga0070700_100807438 | |||
| 1168 | Ga0070694_100013842 | |||
| 1169 | Ga0070694_100322877 | |||
| 1170 | Ga0070694_100867243 | |||
| 1171 | Ga0070694_101750504 | |||
| 1172 | Ga0070708_100033833 | |||
| 1173 | Ga0070708_100165815 | |||
| 1174 | Ga0070708_100182640 | |||
| 1175 | Ga0070708_100852899 | |||
| 1176 | Ga0070708_101458860 | |||
| 1177 | Ga0070663_100024320 | |||
| 1178 | Ga0070663_100118302 | |||
| 1179 | Ga0070678_100023683 | |||
| 1180 | Ga0070678_100749113 | |||
| 1181 | Ga0070678_101030470 | |||
| 1182 | Ga0070678_101269382 | |||
| 1183 | Ga0070662_100058636 | |||
| 1184 | Ga0070662_100085694 | |||
| 1185 | Ga0070662_100590736 | |||
| 1186 | Ga0070662_101067310 | |||
| 1187 | Ga0070681_10003379 | |||
| 1188 | Ga0070681_10013046 | |||
| 1189 | Ga0070681_10026142 | |||
| 1190 | Ga0070681_10371403 | |||
| 1191 | Ga0070681_10741291 | |||
| 1192 | Ga0068867_100028830 | |||
| 1193 | Ga0068867_101189124 | |||
| 1194 | Ga0070685_10007842 | |||
| 1195 | Ga0070685_11256882 | |||
| 1196 | Ga0070706_100004764 | |||
| 1197 | Ga0070706_100043493 | |||
| 1198 | Ga0070706_100284698 | |||
| 1199 | Ga0070706_100672156 | |||
| 1200 | Ga0070707_100002038 | |||
| 1201 | Ga0070698_100010227 | |||
| 1202 | Ga0070698_100068315 | |||
| 1203 | Ga0070698_100133341 | |||
| 1204 | Ga0070698_100331131 | |||
| 1205 | Ga0070698_100341116 | |||
| 1206 | Ga0070698_100386996 | |||
| 1207 | Ga0070698_100902779 | |||
| 1208 | Ga0070699_100003507 | |||
| 1209 | Ga0070699_100070518 | |||
| 1210 | Ga0070699_100331423 | |||
| 1211 | Ga0070699_100653334 | |||
| 1212 | Ga0070699_100899185 | |||
| 1213 | Ga0070699_100942130 | |||
| 1214 | Ga0070699_101394799 | |||
| 1215 | Ga0070699_101457280 | |||
| 1216 | Ga0070679_100003063 | |||
| 1217 | Ga0070679_100233674 | |||
| 1218 | Ga0070684_100000634 | |||
| 1219 | Ga0070684_101370312 | |||
| 1220 | Ga0070684_101666289 | |||
| 1221 | Ga0070697_100241836 | |||
| 1222 | Ga0070697_100284423 | |||
| 1223 | Ga0070697_100328056 | |||
| 1224 | Ga0070697_100356625 | |||
| 1225 | Ga0070697_100940073 | |||
| 1226 | Ga0068853_100069721 | |||
| 1227 | Ga0068853_100114904 | |||
| 1228 | Ga0070672_100174911 | |||
| 1229 | Ga0070672_100504614 | |||
| 1230 | Ga0070686_100006796 | |||
| 1231 | Ga0070686_100122399 | |||
| 1232 | Ga0070686_101839624 | |||
| 1233 | Ga0070686_101900156 | |||
| 1234 | Ga0070695_100083596 | |||
| 1235 | Ga0070695_100224967 | |||
| 1236 | Ga0070695_100431987 | |||
| 1237 | Ga0070695_101281045 | |||
| 1238 | Ga0070696_100152824 | |||
| 1239 | Ga0070696_100195626 | |||
| 1240 | Ga0070696_100355183 | |||
| 1241 | Ga0070696_100587896 | |||
| 1242 | Ga0070696_101110469 | |||
| 1243 | Ga0070693_100095920 | |||
| 1244 | Ga0070693_100131372 | |||
| 1245 | Ga0070693_100219174 | |||
| 1246 | Ga0070693_100705496 | |||
| 1247 | Ga0070665_100184545 | |||
| 1248 | Ga0070665_100739652 | |||
| 1249 | Ga0070704_100015880 | |||
| 1250 | Ga0070704_100364269 | |||
| 1251 | Ga0070704_100505297 | |||
| 1252 | Ga0070704_101577188 | |||
| 1253 | Ga0070704_101677895 | |||
| 1254 | Ga0068855_100497248 | |||
| 1255 | Ga0068855_101089611 | |||
| 1256 | Ga0068855_101351068 | |||
| 1257 | Ga0068855_101849575 | |||
| 1258 | Ga0070664_100001324 | |||
| 1259 | Ga0070664_100026787 | |||
| 1260 | Ga0068857_100993146 | |||
| 1261 | Ga0068857_101830660 | |||
| 1262 | Ga0068854_100730842 | |||
| 1263 | Ga0068854_101565407 | |||
| 1264 | Ga0068854_101885263 | |||
| 1265 | Ga0068856_100005850 | |||
| 1266 | Ga0068856_100029736 | |||
| 1267 | Ga0068856_100106040 | |||
| 1268 | Ga0070702_100038046 | |||
| 1269 | Ga0070702_100133455 | |||
| 1270 | Ga0068852_100070992 | |||
| 1271 | Ga0068852_100934740 | |||
| 1272 | Ga0068859_100147263 | |||
| 1273 | Ga0068859_100159693 | |||
| 1274 | Ga0068864_100382039 | |||
| 1275 | Ga0068864_100619472 | |||
| 1276 | Ga0068864_100883778 | |||
| 1277 | Ga0068866_10013281 | |||
| 1278 | Ga0068866_10784575 | |||
| 1279 | Ga0068861_100327242 | |||
| 1280 | Ga0068861_100393425 | |||
| 1281 | Ga0068851_10151247 | |||
| 1282 | Ga0068870_10499247 | |||
| 1283 | Ga0068870_10885118 | |||
| 1284 | Ga0068863_100695513 | |||
| 1285 | Ga0068863_102282324 | |||
| 1286 | Ga0068860_100045868 | |||
| 1287 | Ga0068860_100937950 | |||
| 1288 | Ga0081455_10000380 | |||
| 1289 | Ga0081455_10115812 | |||
| 1290 | Ga0081455_10124410 | |||
| 1291 | Ga0081455_10791391 | |||
| 1292 | Ga0081538_10063940 | |||
| 1293 | Ga0081539_10255656 | |||
| 1294 | Ga0070717_10050699 | |||
| 1295 | Ga0070717_10714014 | |||
| 1296 | Ga0070717_11186737 | |||
| 1297 | Ga0075365_10103578 | |||
| 1298 | Ga0075363_100073831 | |||
| 1299 | Ga0070715_10102578 | |||
| 1300 | Ga0070716_100186264 | |||
| 1301 | Ga0070716_100933833 | |||
| 1302 | Ga0070716_101306115 | |||
| 1303 | Ga0070712_100015819 | |||
| 1304 | Ga0070712_100326804 | |||
| 1305 | Ga0070712_100594406 | |||
| 1306 | Ga0097621_100173479 | |||
| 1307 | Ga0097621_100308869 | |||
| 1308 | Ga0097621_100516421 | |||
| 1309 | Ga0097621_101774051 | |||
| 1310 | Ga0097621_101830908 | |||
| 1311 | Ga0068871_100004038 | |||
| 1312 | Ga0068871_100122770 | |||
| 1313 | Ga0068871_102282319 | |||
| 1314 | Ga0075428_100111958 | |||
| 1315 | Ga0075428_100485330 | |||
| 1316 | Ga0075428_100547825 | |||
| 1317 | Ga0075428_100690858 | |||
| 1318 | Ga0075428_100886049 | |||
| 1319 | Ga0075430_100012157 | |||
| 1320 | Ga0075430_100067979 | |||
| 1321 | Ga0075430_100656701 | |||
| 1322 | Ga0075431_100004509 | |||
| 1323 | Ga0075431_100122533 | |||
| 1324 | Ga0075431_100290587 | |||
| 1325 | Ga0075431_100573692 | |||
| 1326 | Ga0075431_101205288 | |||
| 1327 | Ga0075433_10008315 | |||
| 1328 | Ga0075433_10046004 | |||
| 1329 | Ga0075433_10112589 | |||
| 1330 | Ga0075433_10112682 | |||
| 1331 | Ga0075433_10226423 | |||
| 1332 | Ga0075433_10316724 | |||
| 1333 | Ga0075433_10408907 | |||
| 1334 | Ga0075433_10415244 | |||
| 1335 | Ga0075433_10567591 | |||
| 1336 | Ga0075433_10766864 | |||
| 1337 | Ga0075433_10944564 | |||
| 1338 | Ga0075434_100000952 | |||
| 1339 | Ga0075434_100023988 | |||
| 1340 | Ga0075434_100054294 | |||
| 1341 | Ga0075434_100167666 | |||
| 1342 | Ga0075434_100340053 | |||
| 1343 | Ga0075434_100387584 | |||
| 1344 | Ga0075434_100875659 | |||
| 1345 | Ga0075434_102079265 | |||
| 1346 | Ga0075429_100253453 | |||
| 1347 | Ga0075429_100255460 | |||
| 1348 | Ga0068865_100002544 | |||
| 1349 | Ga0068865_100395841 | |||
| 1350 | Ga0068865_101055268 | |||
| 1351 | Ga0068865_101709460 | |||
| 1352 | Ga0075436_100027413 | |||
| 1353 | Ga0075436_100087509 | |||
| 1354 | Ga0075436_100211234 | |||
| 1355 | Ga0075436_100462732 | |||
| 1356 | Ga0097620_100147261 | |||
| 1357 | Ga0097620_100159695 | |||
| 1358 | Ga0075435_100005736 | |||
| 1359 | Ga0075435_100096103 | |||
| 1360 | Ga0075435_100176127 | |||
| 1361 | Ga0075435_100764130 | |||
| 1362 | Ga0075435_100788930 | |||
| 1363 | Ga0105240_11873270 | |||
| 1364 | Ga0111539_10120525 | |||
| 1365 | Ga0111539_10617451 | |||
| 1366 | Ga0111539_10971698 | |||
| 1367 | Ga0111539_11134294 | |||
| 1368 | Ga0111539_11810310 | |||
| 1369 | Ga0105245_10038631 | |||
| 1370 | Ga0105245_10133461 | |||
| 1371 | Ga0105245_10556325 | |||
| 1372 | Ga0105245_10655210 | |||
| 1373 | Ga0105245_11307625 | |||
| 1374 | Ga0105245_11312138 | |||
| 1375 | Ga0105247_10225374 | |||
| 1376 | Ga0105247_10828864 | |||
| 1377 | Ga0114129_10017997 | |||
| 1378 | Ga0114129_10036998 | |||
| 1379 | Ga0114129_10084947 | |||
| 1380 | Ga0114129_10125006 | |||
| 1381 | Ga0114129_10215223 | |||
| 1382 | Ga0114129_10384400 | |||
| 1383 | Ga0114129_10858768 | |||
| 1384 | Ga0114129_10915858 | |||
| 1385 | Ga0114129_11055888 | |||
| 1386 | Ga0114129_11636291 | |||
| 1387 | Ga0114129_12666162 | |||
| 1388 | Ga0114129_13196924 | |||
| 1389 | Ga0105243_10028603 | |||
| 1390 | Ga0105243_10042188 | |||
| 1391 | Ga0105243_10251139 | |||
| 1392 | Ga0105243_10555925 | |||
| 1393 | Ga0105243_10880820 | |||
| 1394 | Ga0105243_12253155 | |||
| 1395 | Ga0105241_10031940 | |||
| 1396 | Ga0105241_10104276 | |||
| 1397 | Ga0105242_10033342 | |||
| 1398 | Ga0105242_10168398 | |||
| 1399 | Ga0105242_10470451 | |||
| 1400 | Ga0105242_11269349 | |||
| 1401 | Ga0105242_12499890 | |||
| 1402 | Ga0105242_12574333 | |||
| 1403 | Ga0105248_10038075 | |||
| 1404 | Ga0105248_10148863 | |||
| 1405 | Ga0105248_12153101 | |||
| 1406 | Ga0105237_10989364 | |||
| 1407 | Ga0105238_10130585 | |||
| 1408 | Ga0105238_10944455 | |||
| 1409 | Ga0105249_10144561 | |||
| 1410 | Ga0105249_10161606 | |||
| 1411 | Ga0105239_10021863 | |||
| 1412 | Ga0105239_10806330 | |||
| 1413 | Ga0105239_12101654 | |||
| 1414 | Ga0105239_13524585 | |||
| 1415 | Ga0105246_10032927 | |||
| 1416 | Ga0105246_10074911 | |||
| 1417 | Ga0105246_10153466 | |||
| 1418 | Ga0105246_10220806 | |||
| 1419 | Ga0105246_10571753 | |||
| 1420 | Ga0157314_1006438 | |||
| 1421 | Ga0157371_10398773 | |||
| 1422 | Ga0157371_10799652 | |||
| 1423 | Ga0157371_11019147 | |||
| 1424 | Ga0157370_11981648 | |||
| 1425 | Ga0157369_10409315 | |||
| 1426 | Ga0157369_10851924 | |||
| 1427 | Ga0157374_10003624 | |||
| 1428 | Ga0157374_10035114 | |||
| 1429 | Ga0157374_10058576 | |||
| 1430 | Ga0157374_10337487 | |||
| 1431 | Ga0157378_10082685 | |||
| 1432 | Ga0157378_10244342 | |||
| 1433 | Ga0157378_10344708 | |||
| 1434 | Ga0157378_10567261 | |||
| 1435 | Ga0157378_11037074 | |||
| 1436 | Ga0157378_11684521 | |||
| 1437 | Ga0157378_12205434 | |||
| 1438 | Ga0157378_12409186 | |||
| 1439 | Ga0163162_10015451 | |||
| 1440 | Ga0163162_10119829 | |||
| 1441 | Ga0163162_11415164 | |||
| 1442 | Ga0163162_12686126 | |||
| 1443 | Ga0157372_10106332 | |||
| 1444 | Ga0157372_10504078 | |||
| 1445 | Ga0157372_11994921 | |||
| 1446 | Ga0157375_10004528 | |||
| 1447 | Ga0157375_10188691 | |||
| 1448 | Ga0157375_10202258 | |||
| 1449 | Ga0157375_10497979 | |||
| 1450 | Ga0157375_10555130 | |||
| 1451 | Ga0163163_10153148 | |||
| 1452 | Ga0163163_10317257 | |||
| 1453 | Ga0163163_10579143 | |||
| 1454 | Ga0163163_10693821 | |||
| 1455 | Ga0157380_10106664 | |||
| 1456 | Ga0157380_11272072 | |||
| 1457 | Ga0157380_11671359 | |||
| 1458 | Ga0157380_12566042 | |||
| 1459 | Ga0157380_12691376 | |||
| 1460 | Ga0157377_10003876 | |||
| 1461 | Ga0157377_10436502 | |||
| 1462 | Ga0157377_10439370 | |||
| 1463 | Ga0157379_10811926 | |||
| 1464 | Ga0157379_10844039 | |||
| 1465 | Ga0157376_10007962 | |||
| 1466 | Ga0157376_10042364 | |||
| 1467 | Ga0157376_11400079 | |||
| 1468 | Ga0157376_12710327 | |||
| 1469 | Ga0182007_10036999 | |||
| 1470 | Ga0182005_1262778 | |||
| 1471 | Ga0163161_10062387 | |||
| 1472 | Ga0163161_10277807 | |||
| 1473 | Ga0163161_11296291 | |||
| 1474 | Ga0206350_10706521 | |||
| 1475 | Ga0207697_10003782 | |||
| 1476 | Ga0207653_10031353 | |||
| 1477 | Ga0207682_10267574 | |||
| 1478 | Ga0207692_10116434 | |||
| 1479 | Ga0207642_10041691 | |||
| 1480 | Ga0207688_10007295 | |||
| 1481 | Ga0207688_10082165 | |||
| 1482 | Ga0207680_10277619 | |||
| 1483 | Ga0207685_10082309 | |||
| 1484 | Ga0207685_10569617 | |||
| 1485 | Ga0207699_10540698 | |||
| 1486 | Ga0207699_10579859 | |||
| 1487 | Ga0207699_10638913 | |||
| 1488 | Ga0207645_10005624 | |||
| 1489 | Ga0207645_10398374 | |||
| 1490 | Ga0207645_10409774 | |||
| 1491 | Ga0207643_10072386 | |||
| 1492 | Ga0207705_10202503 | |||
| 1493 | Ga0207684_10031300 | |||
| 1494 | Ga0207684_10188568 | |||
| 1495 | Ga0207684_11143875 | |||
| 1496 | Ga0207654_10030702 | |||
| 1497 | Ga0207654_10647457 | |||
| 1498 | Ga0207654_10987972 | |||
| 1499 | Ga0207707_10011900 | |||
| 1500 | Ga0207707_10040791 | |||
| 1501 | Ga0207707_10050201 | |||
| 1502 | Ga0207707_10500414 | |||
| 1503 | Ga0207693_10000406 | |||
| 1504 | Ga0207693_10037141 | |||
| 1505 | Ga0207693_10095453 | |||
| 1506 | Ga0207663_10168956 | |||
| 1507 | Ga0207660_10001253 | |||
| 1508 | Ga0207660_10162633 | |||
| 1509 | Ga0207660_10318832 | |||
| 1510 | Ga0207660_10662922 | |||
| 1511 | Ga0207660_11575970 | |||
| 1512 | Ga0207662_10025152 | |||
| 1513 | Ga0207662_10112777 | |||
| 1514 | Ga0207657_10011355 | |||
| 1515 | Ga0207657_10018755 | |||
| 1516 | Ga0207657_10127884 | |||
| 1517 | Ga0207649_10037277 | |||
| 1518 | Ga0207649_10043667 | |||
| 1519 | Ga0207652_10002068 | |||
| 1520 | Ga0207652_10006890 | |||
| 1521 | Ga0207652_10342097 | |||
| 1522 | Ga0207646_10016601 | |||
| 1523 | Ga0207646_10536157 | |||
| 1524 | Ga0207646_11172979 | |||
| 1525 | Ga0207681_10350171 | |||
| 1526 | Ga0207681_10778724 | |||
| 1527 | Ga0207681_10968888 | |||
| 1528 | Ga0207650_10001105 | |||
| 1529 | Ga0207650_10125019 | |||
| 1530 | Ga0207650_10649397 | |||
| 1531 | Ga0207659_10041333 | |||
| 1532 | Ga0207659_10046872 | |||
| 1533 | Ga0207659_11500368 | |||
| 1534 | Ga0207687_10004309 | |||
| 1535 | Ga0207687_10054274 | |||
| 1536 | Ga0207687_10698160 | |||
| 1537 | Ga0207687_11572232 | |||
| 1538 | Ga0207687_11921744 | |||
| 1539 | Ga0207700_10365287 | |||
| 1540 | Ga0207700_10951756 | |||
| 1541 | Ga0207664_10006068 | |||
| 1542 | Ga0207664_10293062 | |||
| 1543 | Ga0207664_10819988 | |||
| 1544 | Ga0207644_10324060 | |||
| 1545 | Ga0207644_10553030 | |||
| 1546 | Ga0207690_10149500 | |||
| 1547 | Ga0207690_10165037 | |||
| 1548 | Ga0207690_11323266 | |||
| 1549 | Ga0207706_10004096 | |||
| 1550 | Ga0207706_10134372 | |||
| 1551 | Ga0207706_10397329 | |||
| 1552 | Ga0207706_10423444 | |||
| 1553 | Ga0207706_11031607 | |||
| 1554 | Ga0207686_10535455 | |||
| 1555 | Ga0207709_10009766 | |||
| 1556 | Ga0207709_10023343 | |||
| 1557 | Ga0207670_10237202 | |||
| 1558 | Ga0207670_10570902 | |||
| 1559 | Ga0207669_10021079 | |||
| 1560 | Ga0207669_10050219 | |||
| 1561 | Ga0207669_10426255 | |||
| 1562 | Ga0207704_10170706 | |||
| 1563 | Ga0207704_10233568 | |||
| 1564 | Ga0207704_10241856 | |||
| 1565 | Ga0207704_11051727 | |||
| 1566 | Ga0207665_10066334 | |||
| 1567 | Ga0207665_10351731 | |||
| 1568 | Ga0207665_10387471 | |||
| 1569 | Ga0207665_11382218 | |||
| 1570 | Ga0207691_10024161 | |||
| 1571 | Ga0207691_10029192 | |||
| 1572 | Ga0207691_10340186 | |||
| 1573 | Ga0207711_10219939 | |||
| 1574 | Ga0207711_11301078 | |||
| 1575 | Ga0207711_12153562 | |||
| 1576 | Ga0207689_10119157 | |||
| 1577 | Ga0207661_10001504 | |||
| 1578 | Ga0207661_10716495 | |||
| 1579 | Ga0207661_11018262 | |||
| 1580 | Ga0207679_10038022 | |||
| 1581 | Ga0207667_10175533 | |||
| 1582 | Ga0207651_10070351 | |||
| 1583 | Ga0207651_10655614 | |||
| 1584 | Ga0207651_10725483 | |||
| 1585 | Ga0207712_10390720 | |||
| 1586 | Ga0207712_10440224 | |||
| 1587 | Ga0207668_10262900 | |||
| 1588 | Ga0207668_10356053 | |||
| 1589 | Ga0207668_11760930 | |||
| 1590 | Ga0207640_10124217 | |||
| 1591 | Ga0207640_10591224 | |||
| 1592 | Ga0207640_10858301 | |||
| 1593 | Ga0207640_11533209 | |||
| 1594 | Ga0207658_10448497 | |||
| 1595 | Ga0207677_10086544 | |||
| 1596 | Ga0207677_10140893 | |||
| 1597 | Ga0207677_11245250 | |||
| 1598 | Ga0207703_11890608 | |||
| 1599 | Ga0207639_10268493 | |||
| 1600 | Ga0207678_10003484 | |||
| 1601 | Ga0207678_10017335 | |||
| 1602 | Ga0207678_10183412 | |||
| 1603 | Ga0207708_10004802 | |||
| 1604 | Ga0207708_10300178 | |||
| 1605 | Ga0207708_10574598 | |||
| 1606 | Ga0207702_10007087 | |||
| 1607 | Ga0207702_10082982 | |||
| 1608 | Ga0207702_10435923 | |||
| 1609 | Ga0207641_10423545 | |||
| 1610 | Ga0207641_11006243 | |||
| 1611 | Ga0207648_10001155 | |||
| 1612 | Ga0207648_10292297 | |||
| 1613 | Ga0207648_10731419 | |||
| 1614 | Ga0207648_12054019 | |||
| 1615 | Ga0207676_10088388 | |||
| 1616 | Ga0207676_10539478 | |||
| 1617 | Ga0207676_11251068 | |||
| 1618 | Ga0207674_11222507 | |||
| 1619 | Ga0207675_100065036 | |||
| 1620 | Ga0207675_100175058 | |||
| 1621 | Ga0207675_100311620 | |||
| 1622 | Ga0207675_100769095 | |||
| 1623 | Ga0207683_10001368 | |||
| 1624 | Ga0207683_10022734 | |||
| 1625 | Ga0207683_10043811 | |||
| 1626 | Ga0207698_10339997 | |||
| 1627 | Ga0207698_10737479 | |||
| 1628 | Ga0207698_12182957 | |||
| 1629 | Ga0209984_1027167 | |||
| 1630 | Ga0210000_1009531 | |||
| 1631 | Ga0209968_1028095 | |||
| 1632 | Ga0209982_1054123 | |||
| 1633 | Ga0209970_1010762 | |||
| 1634 | Ga0210002_1025406 | |||
| 1635 | Ga0209983_1010383 | |||
| 1636 | Ga0209971_1002140 | |||
| 1637 | Ga0209971_1025794 | |||
| 1638 | Ga0209998_10002978 | |||
| 1639 | Ga0209974_10000172 | |||
| 1640 | Ga0207428_10335863 | |||
| 1641 | Ga0207428_10796234 | |||
| 1642 | Ga0268266_10250841 | |||
| 1643 | Ga0268266_10696775 | |||
| 1644 | Ga0268265_10749286 | |||
| 1645 | Ga0268265_12187100 | |||
| 1646 | Ga0268264_10516690 | |||
| 1647 | Ga0268264_10674117 | |||
| 1648 | Ga0268264_12510556 | |||
| 1649 | Ga0265326_10016113 | |||
| 1650 | Ga0265319_1001334 | |||
| 1651 | Ga0265319_1002094 | |||
| 1652 | Ga0265319_1064540 | |||
| 1653 | Ga0265319_1248877 | |||
| 1654 | Ga0265334_10000322 | |||
| 1655 | Ga0265334_10010198 | |||
| 1656 | Ga0265334_10011959 | |||
| 1657 | Ga0265334_10044976 | |||
| 1658 | Ga0265318_10001871 | |||
| 1659 | Ga0265318_10005443 | |||
| 1660 | Ga0265323_10108406 | |||
| 1661 | Ga0265322_10002108 | |||
| 1662 | Ga0265322_10199678 | |||
| 1663 | Ga0265336_10018293 | |||
| 1664 | Ga0265336_10184334 | |||
| 1665 | Ga0265338_10003330 | |||
| 1666 | Ga0265338_10006995 | |||
| 1667 | Ga0265338_10022905 | |||
| 1668 | Ga0265338_10090464 | |||
| 1669 | Ga0265338_10097530 | |||
| 1670 | Ga0265338_10520521 | |||
| 1671 | Ga0265324_10055753 | |||
| 1672 | Ga0265330_10003034 | |||
| 1673 | Ga0265330_10031370 | |||
| 1674 | Ga0265332_10027056 | |||
| 1675 | Ga0265332_10047516 | |||
| 1676 | Ga0265328_10004790 | |||
| 1677 | Ga0265320_10028343 | |||
| 1678 | Ga0265320_10054006 | |||
| 1679 | Ga0265320_10067175 | |||
| 1680 | Ga0265320_10128489 | |||
| 1681 | Ga0265325_10011495 | |||
| 1682 | Ga0265325_10063780 | |||
| 1683 | Ga0265329_10019276 | |||
| 1684 | Ga0265340_10008992 | |||
| 1685 | Ga0265340_10012083 | |||
| 1686 | Ga0265339_10007646 | |||
| 1687 | Ga0265339_10047116 | |||
| 1688 | Ga0265339_10143175 | |||
| 1689 | Ga0265331_10002581 | |||
| 1690 | Ga0265327_10004211 | |||
| 1691 | Ga0265327_10044043 | |||
| 1692 | Ga0265316_10017801 | |||
| 1693 | Ga0265316_10021439 | |||
| 1694 | Ga0307408_100034320 | |||
| 1695 | Ga0265313_10006244 | |||
| 1696 | Ga0265313_10014033 | |||
| 1697 | Ga0265313_10037004 | |||
| 1698 | Ga0316575_10270804 | |||
| 1699 | Ga0316579_10001025 | |||
| 1700 | Ga0265314_10002715 | |||
| 1701 | Ga0265314_10105890 | |||
| 1702 | Ga0265342_10041110 | |||
| 1703 | Ga0265342_10075846 | |||
| 1704 | Ga0316578_10298545 | |||
| 1705 | Ga0307405_10069030 | |||
| 1706 | Ga0316577_10044611 | |||
| 1707 | Ga0307410_10810593 | |||
| 1708 | Ga0307406_10039612 | |||
| 1709 | Ga0307412_10015147 | |||
| 1710 | Ga0307409_100082546 | |||
| 1711 | Ga0307416_100507537 | |||
| 1712 | Ga0316593_10001140 | |||
| 1713 | Ga0373944_0108474 | |||
| 1714 | Ga0373944_0364219 | |||
| 1715 | Ga0373952_0049961 | |||
| 1716 | Ga0373923_0257598 | |||
| 1717 | Ga0373923_0313069 | |||
| 1718 | Ga0373932_0051433 | |||
| 1719 | Ga0373932_0340694 | |||
| 1720 | Ga0373936_0462244 | |||
| 1721 | Ga0373939_0240948 | |||
| 1722 | Ga0373945_0074096 | |||
| 1723 | Ga0373956_0199189 | |||
| 1724 | Ga0373946_0139395 | |||
| 1725 | Ga0373961_0246874 | |||
| 1726 | Ga0373962_0109860 | |||
| 1727 | Ga0373962_0148032 | |||
| 1728 | Ga0373931_0009347 | |||
| 1729 | Ga0373931_0105006 | |||
| 1730 | Ga0373931_0287847 | |||
| 1731 | Ga0373935_0070171 | |||
| 1732 | Ga0373935_0208180 | |||
| 1733 | Ga0373935_0546524 | |||
| 1734 | Ga0373927_0116197 | |||
| 1735 | Ga0373937_0063777 | |||
| 1736 | Ga0316582_0000662 | |||
| 1737 | Ga0316584_0010521 | |||
| 1738 | Ga0373925_0298362 | |||
| 1739 | Ga0373925_0893000 | |||
| 1740 | Ga0395899_0003270 | |||
| 1741 | Ga0395899_0033443 | |||
| 1742 | Ga0395899_0414557 | |||
| 1743 | Ga0395900_0022252 | |||
| 1744 | Ga0395900_0024871 | |||
| 1745 | Ga0395900_0126297 | |||
| 1746 | Ga0395900_0501942 | |||
| 1747 | Ga0395900_0631020 | |||
| 1748 | Ga0395900_0917298 | |||
| 1749 | Ga0395898_0003471 | |||
| 1750 | Ga0395898_0009931 | |||
| 1751 | Ga0395898_0161150 | |||
| 1752 | Ga0395898_0578424 | |||
| 1753 | Ga0395898_1053946 | |||
| 1754 | Ga0395905_0052710 | |||
| 1755 | Ga0395905_0066323 | |||
| 1756 | Ga0395905_0256517 | |||
| 1757 | Ga0395905_0345425 | |||
| 1758 | Ga0316581_0001886 | |||
| 1759 | Ga0395901_0024550 | |||
| 1760 | Ga0395901_0172907 | |||
| 1761 | Ga0395901_0182269 | |||
| 1762 | Ga0395901_0283990 | |||
| 1763 | Ga0395901_0626734 | |||
| 1764 | Ga0242420_055523 | |||
| 1765 | Ga0436360_0959266 | |||
| 1766 | Ga0451798_0326687 | |||
| 1767 | Ga0451802_0368654 | |||
| 1768 | Ga0451853_2372324 | |||
| 1769 | Ga0451853_2728074 | |||
| 1770 | Ga0450905_021693 | |||
| 1771 | Ga0466963_0120056 | |||
| 1772 | Ga0453684_0159451 | |||
| 1773 | Ga0466968_0297620 | |||
| 1774 | Ga0466957_0053182 | |||
| 1775 | Ga0466957_0349182 | |||
| 1776 | Ga0466957_0751448 | |||
| 1777 | Ga0466960_0898405 | |||
| 1778 | Ga0451576_0080051 | |||
| 1779 | Ga0451576_0458790 | |||
| 1780 | Ga0451576_0914256 | |||
| 1781 | Ga0466958_0035946 | |||
| 1782 | Ga0466958_0461954 | |||
| 1783 | Ga0466967_0485790 | |||
| 1784 | Ga0466967_0618600 | |||
| 1785 | Ga0466967_2178838 | |||
| 1786 | Ga0495603_0076715 | |||
| 1787 | Ga0495603_0195120 | |||
| 1788 | Ga0495629_0053496 | |||
| 1789 | Ga0495629_0921436 | |||
| 1790 | Ga0495629_0993267 | |||
| 1791 | Ga0495641_0128025 | |||
| 1792 | Ga0495641_0143319 | |||
| 1793 | Ga0495641_0183396 | |||
| 1794 | Ga0495641_0290946 | |||
| 1795 | Ga0495653_0506740 | |||
| 1796 | Ga0495580_0128707 | |||
| 1797 | Ga0495580_0459923 | |||
| 1798 | Ga0495582_0055327 | |||
| 1799 | Ga0495582_0067352 | |||
| 1800 | Ga0495582_0237333 | |||
| 1801 | Ga0495605_0156860 | |||
| 1802 | Ga0495605_0226456 | |||
| 1803 | Ga0495605_0278895 | |||
| 1804 | Ga0495639_0053402 | |||
| 1805 | Ga0495584_0081020 | |||
| 1806 | Ga0495584_0096017 | |||
| 1807 | Ga0495584_0184057 | |||
| 1808 | Ga0495585_0125181 | |||
| 1809 | Ga0495594_0232371 | |||
| 1810 | Ga0495594_0437822 | |||
| 1811 | Ga0495594_0602332 | |||
| 1812 | Ga0495596_0133685 | |||
| 1813 | Ga0495618_0404144 | |||
| 1814 | Ga0495630_0490291 | |||
| 1815 | Ga0495630_1125567 | |||
| 1816 | Ga0495632_0436902 | |||
| 1817 | Ga0495644_0130386 | |||
| 1818 | Ga0495644_0215673 | |||
| 1819 | Ga0495644_0447391 | |||
| 1820 | Ga0495663_0131090 | |||
| 1821 | Ga0495663_0343527 | |||
| 1822 | Ga0495642_0040762 | |||
| 1823 | Ga0495642_0183693 | |||
| 1824 | Ga0495665_0154227 | |||
| 1825 | Ga0495586_0283847 | |||
| 1826 | Ga0495598_0353795 | |||
| 1827 | Ga0495609_0090509 | |||
| 1828 | Ga0495609_0188628 | |||
| 1829 | Ga0495609_0224261 | |||
| 1830 | Ga0495633_0196479 | |||
| 1831 | Ga0495633_0322686 | |||
| 1832 | Ga0495656_0046893 | |||
| 1833 | Ga0495656_0329901 | |||
| 1834 | Ga0495634_0339551 | |||
| 1835 | Ga0495634_0507867 | |||
| 1836 | Ga0495635_0291771 | |||
| 1837 | Ga0495635_0943897 | |||
| 1838 | Ga0495659_0008068 | |||
| 1839 | Ga0495661_0370088 | |||
| 1840 | Ga0495588_0129807 | |||
| 1841 | Ga0495588_0371867 | |||
| 1842 | Ga0495657_0500747 | |||
| 1843 | Ga0495647_0008542 | |||
| 1844 | Ga0495647_0040462 | |||
| 1845 | Ga0495658_0314091 | |||
| 1846 | Ga0495658_0513795 | |||
| 1847 | Ga0495613_0342085 | |||
| 1848 | Ga0495613_0418582 | |||
| 1849 | Ga0495613_0458627 | |||
| 1850 | Ga0495613_1015565 | |||
| 1851 | Ga0495670_0125502 | |||
| 1852 | Ga0495671_0123217 | |||
| 1853 | Ga0495589_0162387 | |||
| 1854 | Ga0495581_0001339 | |||
| 1855 | Ga0495581_0026920 | |||
| 1856 | Ga0495636_0232906 | |||
| 1857 | Ga0495674_0932136 | |||
| 1858 | Ga0495676_0112220 | |||
| 1859 | Ga0495680_0196753 | |||
| 1860 | Ga0495680_0305903 | |||
| 1861 | Ga0495683_0416222 | |||
| 1862 | Ga0495677_0033528 | |||
| 1863 | Ga0495677_0243218 | |||
| 1864 | Ga0495685_303962 | |||
| 1865 | Ga0495684_0881134 | |||
| 1866 | Ga0495684_1060006 | |||
| 1867 | Ga0495614_0083571 | |||
| 1868 | Ga0495614_0259594 | |||
| 1869 | Ga0496100_0064483 | |||
| 1870 | Ga0496100_0346477 | |||
| 1871 | Ga0496100_1099190 | |||
| 1872 | Ga0496101_0012096 | |||
| 1873 | Ga0496101_0064414 | |||
| 1874 | Ga0496101_0084510 | |||
| 1875 | Ga0496101_0675783 | |||
| 1876 | Ga0496102_0001619 | |||
| 1877 | Ga0496102_0003519 | |||
| 1878 | Ga0496102_0270062 | |||
| 1879 | Ga0496102_0305497 | |||
| 1880 | Ga0496102_0457413 | |||
| 1881 | Ga0496102_1278023 | |||
| 1882 | Ga0496103_0003260 | |||
| 1883 | Ga0496103_0029954 | |||
| 1884 | Ga0496103_0043372 | |||
| 1885 | Ga0496103_0536027 | |||
| 1886 | Ga0496104_0000698 | |||
| 1887 | Ga0496104_0001046 | |||
| 1888 | Ga0496104_0009894 | |||
| 1889 | Ga0496104_0356211 | |||
| 1890 | Ga0496104_0588316 | |||
| 1891 | Ga0496105_0000377 | |||
| 1892 | Ga0496105_0048769 | |||
| 1893 | Ga0496105_0129487 | |||
| 1894 | Ga0496105_0232354 | |||
| 1895 | Ga0496105_1421653 | |||
| 1896 | Ga0496106_0124286 | |||
| 1897 | Ga0496106_0218534 | |||
| 1898 | Ga0496106_1110412 | |||
| 1899 | Ga0496106_1399612 | |||
| 1900 | Ga0496107_0011180 | |||
| 1901 | Ga0496107_0116854 | |||
| 1902 | Ga0496107_0355417 | |||
| 1903 | Ga0496107_0777274 | |||
| 1904 | Ga0496108_0022580 | |||
| 1905 | Ga0496108_0058653 | |||
| 1906 | Ga0496108_0079904 | |||
| 1907 | Ga0496108_0138930 | |||
| 1908 | Ga0496108_1162091 | |||
| 1909 | Ga0496109_0000283 | |||
| 1910 | Ga0496109_0008233 | |||
| 1911 | Ga0496109_0018123 | |||
| 1912 | Ga0496109_0030646 | |||
| 1913 | Ga0496109_0297884 | |||
| 1914 | Ga0496109_0336530 | |||
| 1915 | Ga0496109_0781339 | |||
| 1916 | Ga0496110_0000421 | |||
| 1917 | Ga0496110_0053942 | |||
| 1918 | Ga0496110_0074374 | |||
| 1919 | Ga0496110_0131141 | |||
| 1920 | Ga0496110_0988482 | |||
| 1921 | Ga0496110_1365033 | |||
| 1922 | Ga0496111_0010483 | |||
| 1923 | Ga0496111_0011174 | |||
| 1924 | Ga0496111_0094587 | |||
| 1925 | Ga0496111_0248317 | |||
| 1926 | Ga0496112_0020222 | |||
| 1927 | Ga0496112_0028386 | |||
| 1928 | Ga0496112_0031596 | |||
| 1929 | Ga0496112_0164841 | |||
| 1930 | Ga0496112_0966738 | |||
| 1931 | Ga0496112_1010401 | |||
| 1932 | Ga0496113_0020678 | |||
| 1933 | Ga0496113_0049095 | |||
| 1934 | Ga0496113_0076488 | |||
| 1935 | Ga0496113_0476916 | |||
| 1936 | Ga0496113_0591410 | |||
| 1937 | Ga0496113_0617693 | |||
| 1938 | Ga0496114_0000356 | |||
| 1939 | Ga0496114_0000404 | |||
| 1940 | Ga0496114_0028777 | |||
| 1941 | Ga0496114_0556489 | |||
| 1942 | Ga0496114_0625826 | |||
| 1943 | Ga0496115_0005787 | |||
| 1944 | Ga0496115_0022227 | |||
| 1945 | Ga0496115_0212232 | |||
| 1946 | Ga0496115_0904930 | |||
| 1947 | Ga0501031_0027243 | |||
| 1948 | Ga0501031_0191614 | |||
| 1949 | Ga0501032_0013942 | |||
| 1950 | Ga0501033_0183667 | |||
| 1951 | Ga0501033_0581643 | |||
| 1952 | Ga0501034_0150771 | |||
| 1953 | Ga0501036_0058101 | |||
| 1954 | Ga0501036_0590150 | |||
| 1955 | Ga0501036_1040599 | |||
| 1956 | Ga0501037_0088672 | |||
| 1957 | Ga0501038_0001813 | |||
| 1958 | Ga0501038_0401415 | |||
| 1959 | Ga0501038_0466079 | |||
| 1960 | Ga0501039_0002116 | |||
| 1961 | Ga0501039_0130202 | |||
| 1962 | Ga0501039_0418098 | |||
| 1963 | Ga0501039_0746954 | |||
| 1964 | Ga0501039_1205342 | |||
| 1965 | Ga0501040_0001107 | |||
| 1966 | Ga0501040_0040991 | |||
| 1967 | Ga0501040_0101146 | |||
| 1968 | Ga0501040_0333393 | |||
| 1969 | Ga0501040_0511618 | |||
| 1970 | Ga0501040_0611108 | |||
| 1971 | Ga0501040_0662039 | |||
| 1972 | Ga0501041_0000320 | |||
| 1973 | Ga0501041_0611755 | |||
| 1974 | Ga0501041_0807828 | |||
| 1975 | Ga0501042_0000344 | |||
| 1976 | Ga0501042_0029779 | |||
| 1977 | Ga0501042_0808880 | |||
| 1978 | Ga0501043_0033912 | |||
| 1979 | Ga0501043_0297292 | |||
| 1980 | Ga0501043_0660542 | |||
| 1981 | Ga0501046_0015331 | |||
| 1982 | Ga0501046_0016773 | |||
| 1983 | Ga0501046_0377149 | |||
| 1984 | Ga0501047_0992199 | |||
| 1985 | Ga0501048_0019818 | |||
| 1986 | Ga0501048_0178823 | |||
| 1987 | Ga0501048_0962286 | |||
| 1988 | Ga0501048_1138155 | |||
| 1989 | Ga0501068_0050250 | |||
| 1990 | Ga0501068_0073902 | |||
| 1991 | Ga0501068_0126473 | |||
| 1992 | Ga0501069_0039979 | |||
| 1993 | Ga0501070_0522428 | |||
| 1994 | Ga0501070_0615991 | |||
| 1995 | Ga0501071_0000317 | |||
| 1996 | Ga0501071_0240978 | |||
| 1997 | Ga0501071_0514503 | |||
| 1998 | Ga0501072_0000574 | |||
| 1999 | Ga0501072_0121134 | |||
| 2000 | Ga0501072_0256662 | |||
| 2001 | Ga0501072_0355110 | |||
| 2002 | Ga0501072_0426560 | |||
| 2003 | Ga0501072_0778764 | |||
| 2004 | Ga0501073_0059639 | |||
| 2005 | Ga0501073_0381498 | |||
| 2006 | Ga0501073_0638563 | |||
| 2007 | Ga0501074_0056267 | |||
| 2008 | Ga0501074_0364277 | |||
| 2009 | Ga0501074_0965866 | |||
| 2010 | Ga0501075_0000513 | |||
| 2011 | Ga0501075_0018980 | |||
| 2012 | Ga0501075_0043348 | |||
| 2013 | Ga0501075_0177238 | |||
| 2014 | Ga0501075_0223316 | |||
| 2015 | Ga0501075_0281321 | |||
| 2016 | Ga0501075_1372668 | |||
| 2017 | Ga0501076_0000576 | |||
| 2018 | Ga0501076_0156952 | |||
| 2019 | Ga0501076_0199587 | |||
| 2020 | Ga0501077_0003494 | |||
| 2021 | Ga0501077_0050431 | |||
| 2022 | Ga0501077_0103335 | |||
| 2023 | Ga0501077_0128955 | |||
| 2024 | Ga0501077_0245896 | |||
| 2025 | Ga0501077_0815335 | |||
| 2026 | Ga0501077_0925627 | |||
| 2027 | Ga0501077_1091832 | |||
| 2028 | Ga0501249_024466 | |||
| 2029 | Ga0501079_0016181 | |||
| 2030 | Ga0501079_0016305 | |||
| 2031 | Ga0501079_0040025 | |||
| 2032 | Ga0501079_0503392 | |||
| 2033 | Ga0501079_1044947 | |||
| 2034 | Ga0501080_0004673 | |||
| 2035 | Ga0501080_0041786 | |||
| 2036 | Ga0501080_0110860 | |||
| 2037 | Ga0501080_0958930 | |||
| 2038 | Ga0501081_0000423 | |||
| 2039 | Ga0501081_0039647 | |||
| 2040 | Ga0501081_0119550 | |||
| 2041 | Ga0501081_0299821 | |||
| 2042 | Ga0501081_0384583 | |||
| 2043 | Ga0501081_1059822 | |||
| 2044 | Ga0501083_0248335 | |||
| 2045 | Ga0501083_1060623 | |||
| 2046 | Ga0501262_015981 | |||
| 2047 | Ga0501035_0025060 | |||
| 2048 | Ga0501035_1074868 | |||
| 2049 | Ga0501044_0178695 | |||
| 2050 | Ga0501045_0031588 | |||
| 2051 | Ga0501045_0115338 | |||
| 2052 | nmdc:mga03n38_460771_c1 | |||
| 2053 | nmdc:mga05p37_1846538_c1 | |||
| 2054 | nmdc:mga05p37_19422_c1 | |||
| 2055 | nmdc:mga05p37_259977_c1 | |||
| 2056 | nmdc:mga05p37_34025_c1 | |||
| 2057 | nmdc:mga05p37_35873_c1 | |||
| 2058 | nmdc:mga05p37_491785_c1 | |||
| 2059 | nmdc:mga05p37_560548_c1 | |||
| 2060 | nmdc:mga05p37_60335_c1 | |||
| 2061 | nmdc:mga05p37_693176_c1 | |||
| 2062 | nmdc:mga05p37_74032_c1 | |||
| 2063 | nmdc:mga09592_1678241_c1 | |||
| 2064 | nmdc:mga09592_240494_c1 | |||
| 2065 | nmdc:mga09592_409898_c1 | |||
| 2066 | nmdc:mga09592_611705_c1 | |||
| 2067 | nmdc:mga0qj67_138991_c1 | |||
| 2068 | nmdc:mga0qj67_462539_c1 | |||
| 2069 | nmdc:mga0qj67_69933_c1 | |||
| 2070 | nmdc:mga06r32_1065853_c1 | |||
| 2071 | nmdc:mga06r32_1695926_c1 | |||
| 2072 | nmdc:mga06r32_214866_c1 | |||
| 2073 | nmdc:mga06r32_334682_c1 | |||
| 2074 | nmdc:mga06r32_663715_c1 | |||
| 2075 | nmdc:mga06r32_682196_c1 | |||
| 2076 | nmdc:mga08y16_1259750_c1 | |||
| 2077 | nmdc:mga08y16_1417291_c1 | |||
| 2078 | nmdc:mga08y16_1623738_c1 | |||
| 2079 | nmdc:mga08y16_637842_c1 | |||
| 2080 | nmdc:mga0n895_108971_c1 | |||
| 2081 | nmdc:mga0n895_1254366_c1 | |||
| 2082 | nmdc:mga0n895_141967_c1 | |||
| 2083 | nmdc:mga0n895_1677431_c1 | |||
| 2084 | nmdc:mga0n895_1865749_c1 | |||
| 2085 | nmdc:mga0n895_21024_c1 | |||
| 2086 | nmdc:mga0n895_2319_c1 | |||
| 2087 | nmdc:mga0n895_255871_c1 | |||
| 2088 | nmdc:mga0n895_729112_c1 | |||
| 2089 | nmdc:mga0n895_880082_c1 | |||
| 2090 | nmdc:mga0rr50_1237780_c1 | |||
| 2091 | nmdc:mga0rr50_1325911_c1 | |||
| 2092 | nmdc:mga0rr50_205196_c1 | |||
| 2093 | nmdc:mga0rr50_323791_c1 | |||
| 2094 | nmdc:mga0rr50_355271_c1 | |||
| 2095 | nmdc:mga0rr50_5398_c1 | |||
| 2096 | nmdc:mga0rr50_615625_c1 | |||
| 2097 | nmdc:mga0rr50_746733_c1 | |||
| 2098 | nmdc:mga08x19_159186_c1 | |||
| 2099 | nmdc:mga08x19_288102_c1 | |||
| 2100 | nmdc:mga08x19_293667_c1 | |||
| 2101 | nmdc:mga08x19_6320_c1 | |||
| 2102 | nmdc:mga0a205_1185041_c1 | |||
| 2103 | nmdc:mga0a205_268924_c1 | |||
| 2104 | nmdc:mga0a205_28114_c1 | |||
| 2105 | nmdc:mga0a205_355823_c1 | |||
| 2106 | nmdc:mga0a205_399499_c1 | |||
| 2107 | nmdc:mga0a205_416967_c1 | |||
| 2108 | nmdc:mga0a205_46191_c2 | |||
| 2109 | nmdc:mga0a205_580247_c1 | |||
| 2110 | Ga0495619_0010339 | |||
| 2111 | Ga0495619_0103711 | |||
| 2112 | Ga0501084_0001468 | |||
| 2113 | Ga0501084_0060273 | |||
| 2114 | Ga0501084_0432140 | |||
| 2115 | Ga0501084_0494567 | |||
| 2116 | Ga0590077_005279 | |||
| 2117 | Ga0590077_145514 | |||
| 2118 | Ga0587107_113151 | |||
| 2119 | Ga0501082_0018437 | |||
| 2120 | Ga0501082_0035809 | |||
| 2121 | Ga0501082_0102827 | |||
| 2122 | Ga0501082_0104813 | |||
| 2123 | Ga0501082_0165948 | |||
| 2124 | Ga0466962_0059781 | |||
| 2125 | Ga0530510_0076114 | |||
| 2126 | Ga0530510_0202512 | |||
| 2127 | Ga0530510_0236698 | |||
| 2128 | Ga0530510_0258442 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2mma-assembly1.cif.gz_B | nmr-based docking model of grxs14-bola2 apo-heterodimer from arabidopsis thaliana | 0.8975 | 2 | 79 |
| 3o2e-assembly1.cif.gz_A | crystal structure of a bol-like protein from babesia bovis | 0.8746 | 1 | 84 |
| 5nfl-assembly1.cif.gz_A | crystal structure of yrba from sinorhizobium meliloti in complex with cobalt. | 0.8742 | 3 | 76 |
| 2mma-assembly1.cif.gz_B | nmr-based docking model of grxs14-bola2 apo-heterodimer from arabidopsis thaliana | 0.8666 | 2 | 79 |
| 4pui-assembly1.cif.gz_A | bola domain of sufe1 from arabidopsis thaliana | 0.8655 | 1 | 77 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P0A9W6_1_84_3.30.300.90 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;BolA-like | 0.9436 | 2 | 81 | 3.30.300.90 |
| af_O14280_1_84_3.30.300.90 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;BolA-like | 0.9391 | 1 | 82 | 3.30.300.90 |
| af_Q67VQ4_70_166_3.10.20.90 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 | 0.9381 | 4 | 82 | 3.10.20.90 |
| af_P53082_9_118_3.10.20.90 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 | 0.9266 | 2 | 81 | 3.10.20.90 |
| af_Q8I3V0_1_83_3.10.20.90 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 | 0.9139 | 4 | 84 | 3.10.20.90 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7V9M9E2-F1-model_v4 | BolA family transcriptional regulator | 0.9922 | 18 | 76 |
|
| AF-A0A7V9M9E2-F1-model_v4 | BolA family transcriptional regulator | 0.9758 | 18 | 76 |
|
| AF-A0A2W7B6Y1-F1-model_v4 | BolA family transcriptional regulator | 0.9686 | 1 | 76 |
|
| AF-A0A0R0MGN0-F1-model_v4 | BolA family transcriptional regulator | 0.9618 | 1 | 76 |
|
| AF-A0A845K3G4-F1-model_v4 | BolA family transcriptional regulator | 0.9561 | 1 | 76 |
|