F488910

General Info

Members Datasets Scaffolds Average Seq Length
1044 460 1038 211

Family's Representative Sequence

Representative Sequence 3300031344|Ga0265316_10006492|Ga0265316_100064925
Length 250
Sequence LGHIAARLKPCPFKAPGALAQSTGGHWPYILNGSMSERILAFVVQFVTHVIDLGGYAGIVALMGIESACIPLPSEVIMPFAGYLVYMGHFNLFWVATMGALGCNLGSVVAYAIGARGGRPLVERYGKWVLMSHHDLDRMTWFFQRYGSIAVLLGRLLPVVRTFIAFPAGIAKMPQIRFHLYTFAGSWPWCFGLAYVGMKLGEKWHTDPRFYQAFHRFHLGVEIALVAGIVWFVWSHIKRGRRNEAALDPQ

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2884215851 Edaphobacter sp. 12200R-103 Isolate Rhizosphere
3 2895395659 Rhodanobacter sp. T12-5 Isolate Unclassified
4 2928027323 Sphingomonas sp. 1185 Isolate Unclassified
5 2984555340 Sphingomonas sp. SORGH_AS789 Isolate Aerial Root
6 2984564862 Sphingomonas sp. SORGH_AS870 Isolate Aerial Root
7 2993356040 Sphingomonas sp. SORGH_AS742 Isolate Aerial Root
8 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
9 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
10 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
11 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
12 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
13 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
14 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
15 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
16 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
17 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
18 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
19 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
20 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
21 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
22 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
23 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
24 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
25 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
26 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
27 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
28 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
29 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
30 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
31 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
32 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
33 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
34 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
35 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
36 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
37 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
38 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
39 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
40 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
41 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
42 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
43 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
44 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
45 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
46 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
47 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
48 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
49 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
50 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
51 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
52 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
53 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
54 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
55 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
56 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
57 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
58 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
59 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
60 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
61 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
62 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
63 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
64 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
65 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
66 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
67 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
68 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
69 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
70 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
71 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
72 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
73 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
74 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
75 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
76 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
77 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
78 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
79 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
80 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
81 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
82 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
83 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
84 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
85 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
86 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
87 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
88 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
89 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
90 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
91 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
92 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
93 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
94 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
95 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
96 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
97 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
98 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
99 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
100 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
101 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
102 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
103 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
104 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
105 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
106 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
107 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
108 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
109 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
110 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
111 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
112 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
113 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
114 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
115 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
116 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
117 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
118 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
119 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
120 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
121 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
122 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
123 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
124 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
125 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
126 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
127 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
128 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
129 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
130 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
131 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
132 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
133 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
134 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
135 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
136 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
137 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
138 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
139 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
140 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
141 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
142 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
143 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
208 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
209 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
210 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
211 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
212 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
213 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
214 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
215 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
216 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
217 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
218 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
219 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
220 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
221 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
222 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
223 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
224 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
228 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
229 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
230 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
231 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
232 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
233 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
234 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
235 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
236 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
237 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
238 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
239 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
240 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
241 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
242 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
243 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
244 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
245 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
246 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
247 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
248 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
249 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
250 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
251 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
252 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
253 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
254 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
255 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
256 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
257 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
258 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
259 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
260 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
261 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
262 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
263 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
264 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
265 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
266 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
267 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
268 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
269 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
270 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
271 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
272 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
273 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
274 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
275 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
276 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
277 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
278 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
279 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
280 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
281 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
282 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
283 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
284 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
285 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
286 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
287 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
288 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
289 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
290 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
291 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
292 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
293 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
294 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
295 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
296 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
297 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
298 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
299 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
300 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
301 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
302 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
303 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
304 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
305 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
306 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
307 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
308 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
309 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
310 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
311 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
312 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
313 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
314 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
315 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
316 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
317 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
318 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
319 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
320 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
321 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
322 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
323 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
324 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
325 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
326 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
327 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
328 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
329 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
330 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
331 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
332 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
333 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
334 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
335 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
336 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
337 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
338 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
339 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
340 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
341 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
342 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
343 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
344 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
345 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
346 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
347 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
348 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
349 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
350 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
351 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
352 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
353 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
354 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
355 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
356 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
357 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
358 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
359 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
360 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
361 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
362 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
363 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
364 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
365 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
366 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
367 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
368 3300049516 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought Metagenome Rhizosphere
369 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
370 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
371 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
372 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
373 3300049524 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H21_B_7_control Metagenome Rhizosphere
374 3300049525 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F21_B_7_control Metagenome Rhizosphere
375 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
376 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
377 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
378 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
379 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
380 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
381 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
382 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
383 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
384 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
385 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
386 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
387 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
388 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
389 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
390 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
391 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
392 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
393 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
394 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
395 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
396 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
397 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
398 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
399 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
400 3300049666 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control Metagenome Rhizosphere
401 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
402 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
403 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
404 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
405 3300049676 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control Metagenome Rhizosphere
406 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
407 3300049678 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought Metagenome Rhizosphere
408 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
409 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
410 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
411 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
412 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
413 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
414 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
415 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
416 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
417 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
418 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
419 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
420 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
421 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
422 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
423 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
424 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
425 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
426 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
427 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
428 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
429 3300049771 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control Metagenome Rhizosphere
430 3300049773 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control Metagenome Rhizosphere
431 3300049774 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought Metagenome Rhizosphere
432 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
433 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
434 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
435 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
436 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
437 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
438 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
439 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
440 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
441 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
442 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
443 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
444 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
445 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
446 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
447 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
448 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
449 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
450 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
451 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
452 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
453 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
454 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
455 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
456 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
457 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
458 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
459 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
460 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.14
Metatranscriptomes 0.29
Isolates 0.57

Biome Distribution

Category Percentage (%)
Aerial Root 0.29
Bulb 0
Endosphere 1.44
Nodule 0
Rhizoplane 1.05
Rhizosphere 93.87
Stem 0
Stem Tuber 0
Unclassified 3.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_301344 2162886007 Bacteria 1454
2 JGI24737J22298_10035281 3300001990 Bacteria 1548
3 JGI24735J21928_10011016 3300002067 Bacteria 2873
4 JGI24738J21930_10024866 3300002075 Bacteria 1231
5 JGI25165J46597_1000023 3300003214 Bacteria 338873
6 rootH2_10059427 3300003320 Bacteria 3381
7 Ga0058862_10201493 3300004803 Bacteria 3907
8 Ga0065704_10082883 3300005289 Bacteria 3539
9 Ga0065715_10018369 3300005293 Bacteria 1755
10 Ga0065715_10093602 3300005293 Bacteria 4626
11 Ga0065707_10083298 3300005295 Bacteria 9610
12 Ga0065707_10178805 3300005295 Bacteria 1432
13 Ga0070658_10000010 3300005327 Bacteria 297212
14 Ga0070658_10001110 3300005327 Bacteria 22978
15 Ga0070658_10011417 3300005327 Bacteria 7124
16 Ga0070658_10017036 3300005327 Bacteria 5815
17 Ga0070658_10058839 3300005327 Unclassified 3129
18 Ga0070658_10061244 3300005327 Bacteria 3066
19 Ga0070658_10267601 3300005327 Bacteria 1453
20 Ga0070658_10472471 3300005327 Bacteria 1082
21 Ga0070658_10644503 3300005327 Bacteria 919
22 Ga0070676_10000104 3300005328 Bacteria 30258
23 Ga0070676_10005496 3300005328 Bacteria 6748
24 Ga0070683_100055157 3300005329 Unclassified 3687
25 Ga0070683_100081574 3300005329 Bacteria 3028
26 Ga0070683_100122814 3300005329 Bacteria 2453
27 Ga0070683_100201881 3300005329 Bacteria 1888
28 Ga0070683_100593170 3300005329 Archaea 1060
29 Ga0070690_100000347 3300005330 Bacteria 23886
30 Ga0070690_100002465 3300005330 Bacteria 9950
31 Ga0070690_100019596 3300005330 Bacteria 4109
32 Ga0070670_100001702 3300005331 Bacteria 17907
33 Ga0070670_100094759 3300005331 Bacteria 2567
34 Ga0070670_100288284 3300005331 Bacteria 1434
35 Ga0070677_10003087 3300005333 Bacteria 5348
36 Ga0068869_100001148 3300005334 Bacteria 15451
37 Ga0068869_100012828 3300005334 Bacteria 5546
38 Ga0068869_100027201 3300005334 Bacteria 3985
39 Ga0068869_100206486 3300005334 Bacteria 1551
40 Ga0070666_10368401 3300005335 Bacteria 1030
41 Ga0070680_100001484 3300005336 Bacteria 17049
42 Ga0070680_100003506 3300005336 Bacteria 11708
43 Ga0070680_100010569 3300005336 Bacteria 7121
44 Ga0070680_100417852 3300005336 Bacteria 1144
45 Ga0070680_100473280 3300005336 Bacteria 1071
46 Ga0070682_100109549 3300005337 Bacteria 1838
47 Ga0070682_100299018 3300005337 Bacteria 1180
48 Ga0070682_100578953 3300005337 Bacteria 883
49 Ga0068868_100000073 3300005338 Bacteria 58910
50 Ga0070660_100001591 3300005339 Bacteria 15602
51 Ga0070660_100008686 3300005339 Bacteria 7113
52 Ga0070660_100533940 3300005339 Bacteria 978
53 Ga0070689_100000037 3300005340 Bacteria 82373
54 Ga0070689_100001740 3300005340 Bacteria 13940
55 Ga0070689_100656150 3300005340 Bacteria 913
56 Ga0070691_10004779 3300005341 Bacteria 6163
57 Ga0070687_100004347 3300005343 Bacteria 5642
58 Ga0070661_100139136 3300005344 Bacteria 1828
59 Ga0070661_100223159 3300005344 Bacteria 1446
60 Ga0070661_100405893 3300005344 Bacteria 1078
61 Ga0070692_10002936 3300005345 Bacteria 6771
62 Ga0070692_10136461 3300005345 Bacteria 1384
63 Ga0070668_100114637 3300005347 Bacteria 2147
64 Ga0070669_100011872 3300005353 Bacteria 6180
65 Ga0070669_100062644 3300005353 Bacteria 2735
66 Ga0070675_100101571 3300005354 Bacteria 2423
67 Ga0070671_100003495 3300005355 Bacteria 12264
68 Ga0070674_100003796 3300005356 Bacteria 8536
69 Ga0070673_100000047 3300005364 Bacteria 50070
70 Ga0070673_100006972 3300005364 Bacteria 7399
71 Ga0070673_100666738 3300005364 Bacteria 953
72 Ga0070688_100000176 3300005365 Bacteria 34332
73 Ga0070688_100107882 3300005365 Bacteria 1847
74 Ga0070688_100380416 3300005365 Bacteria 1040
75 Ga0070688_100758418 3300005365 Bacteria 756
76 Ga0070659_100000313 3300005366 Bacteria 37870
77 Ga0070659_100339597 3300005366 Bacteria 1258
78 Ga0070659_100410270 3300005366 Bacteria 1144
79 Ga0070667_100056577 3300005367 Bacteria 3314
80 Ga0070709_10184785 3300005434 Unclassified 1466
81 Ga0070709_10324365 3300005434 Bacteria 1131
82 Ga0070714_100226102 3300005435 Bacteria 1722
83 Ga0070714_100345453 3300005435 Bacteria 1396
84 Ga0070714_100971284 3300005435 Bacteria 826
85 Ga0070713_100036322 3300005436 Bacteria 3975
86 Ga0070713_100038385 3300005436 Bacteria 3880
87 Ga0070710_10069362 3300005437 Bacteria 2028
88 Ga0070710_10518414 3300005437 Bacteria 818
89 Ga0070701_10000079 3300005438 Bacteria 26864
90 Ga0070711_100038261 3300005439 Bacteria 3225
91 Ga0070705_100011424 3300005440 Bacteria 4480
92 Ga0070705_100059492 3300005440 Bacteria 2263
93 Ga0070705_100394558 3300005440 Bacteria 1023
94 Ga0070705_100714401 3300005440 Bacteria 789
95 Ga0070700_100000334 3300005441 Bacteria 24482
96 Ga0070700_100103673 3300005441 Bacteria 1878
97 Ga0070694_100022341 3300005444 Bacteria 4052
98 Ga0070694_100175669 3300005444 Bacteria 1581
99 Ga0070694_100181065 3300005444 Bacteria 1559
100 Ga0070694_100574632 3300005444 Bacteria 905
101 Ga0070708_100053670 3300005445 Bacteria 3577
102 Ga0070708_100179160 3300005445 Bacteria 1980
103 Ga0070708_100873390 3300005445 Bacteria 845
104 Ga0070663_100005903 3300005455 Bacteria 7326
105 Ga0070663_100010199 3300005455 Bacteria 5850
106 Ga0070663_100013623 3300005455 Bacteria 5191
107 Ga0070663_100076604 3300005455 Bacteria 2446
108 Ga0070663_100222644 3300005455 Archaea 1482
109 Ga0070678_100000915 3300005456 Bacteria 15149
110 Ga0070662_100001269 3300005457 Bacteria 15505
111 Ga0070681_10006757 3300005458 Bacteria 11165
112 Ga0070681_10012093 3300005458 Bacteria 8558
113 Ga0070681_10022448 3300005458 Bacteria 6336
114 Ga0070681_10023191 3300005458 Bacteria 6242
115 Ga0070681_10067584 3300005458 Bacteria 3542
116 Ga0070681_10074256 3300005458 Bacteria 3361
117 Ga0070681_10103061 3300005458 Bacteria 2798
118 Ga0070681_10104289 3300005458 Bacteria 2778
119 Ga0070681_10136893 3300005458 Bacteria 2379
120 Ga0070681_10212113 3300005458 Bacteria 1852
121 Ga0070681_10401611 3300005458 Bacteria 1282
122 Ga0068867_100000119 3300005459 Bacteria 50149
123 Ga0068867_100000402 3300005459 Bacteria 29031
124 Ga0068867_100003137 3300005459 Bacteria 11660
125 Ga0068867_100610739 3300005459 Bacteria 952
126 Ga0070685_10000066 3300005466 Bacteria 61531
127 Ga0070706_100035985 3300005467 Unclassified 4572
128 Ga0070706_100141818 3300005467 Bacteria 2243
129 Ga0070706_100162916 3300005467 Bacteria 2082
130 Ga0070707_100000072 3300005468 Bacteria 91592
131 Ga0070707_100006340 3300005468 Bacteria 10997
132 Ga0070707_100235707 3300005468 Bacteria 1781
133 Ga0070707_100265752 3300005468 Bacteria 1669
134 Ga0070707_100791006 3300005468 Bacteria 912
135 Ga0070698_100000654 3300005471 Bacteria 37064
136 Ga0070698_100001679 3300005471 Bacteria 24687
137 Ga0070698_100005990 3300005471 Bacteria 13256
138 Ga0070698_100041365 3300005471 Bacteria 4731
139 Ga0070698_100078675 3300005471 Bacteria 3295
140 Ga0070698_100097602 3300005471 Bacteria 2914
141 Ga0070698_100124329 3300005471 Bacteria 2537
142 Ga0070699_100000005 3300005518 Bacteria 384287
143 Ga0070699_100007860 3300005518 Bacteria 9265
144 Ga0070699_100159013 3300005518 Bacteria 1999
145 Ga0070699_100167110 3300005518 Bacteria 1949
146 Ga0070699_100227953 3300005518 Bacteria 1661
147 Ga0070699_100300786 3300005518 Bacteria 1439
148 Ga0070679_100024432 3300005530 Bacteria 5921
149 Ga0070679_100029563 3300005530 Bacteria 5406
150 Ga0070679_100034244 3300005530 Bacteria 5033
151 Ga0070679_100162689 3300005530 Bacteria 2206
152 Ga0070679_100337399 3300005530 Bacteria 1455
153 Ga0070679_100387941 3300005530 Bacteria 1343
154 Ga0070679_100452016 3300005530 Archaea 1229
155 Ga0070679_100520102 3300005530 Bacteria 1134
156 Ga0070684_100156619 3300005535 Bacteria 2066
157 Ga0070684_100360872 3300005535 Archaea 1337
158 Ga0070697_100000185 3300005536 Bacteria 51425
159 Ga0070697_100005515 3300005536 Bacteria 9752
160 Ga0070697_100010394 3300005536 Bacteria 7262
161 Ga0070697_100022623 3300005536 Bacteria 4992
162 Ga0070697_100113279 3300005536 Bacteria 2263
163 Ga0068853_100000014 3300005539 Bacteria 227023
164 Ga0068853_100014923 3300005539 Bacteria 6381
165 Ga0068853_100018832 3300005539 Bacteria 5717
166 Ga0068853_100183011 3300005539 Bacteria 1901
167 Ga0070672_100028473 3300005543 Bacteria 4180
168 Ga0070672_100144460 3300005543 Bacteria 1965
169 Ga0070686_100000072 3300005544 Bacteria 75694
170 Ga0070686_100001120 3300005544 Bacteria 15412
171 Ga0070686_100052555 3300005544 Bacteria 2599
172 Ga0070686_100153962 3300005544 Unclassified 1612
173 Ga0070695_100001295 3300005545 Bacteria 13806
174 Ga0070695_100117864 3300005545 Bacteria 1812
175 Ga0070695_100430563 3300005545 Bacteria 1007
176 Ga0070695_100515902 3300005545 Bacteria 927
177 Ga0070696_100004259 3300005546 Bacteria 9541
178 Ga0070696_100004964 3300005546 Bacteria 8882
179 Ga0070696_100082144 3300005546 Bacteria 2284
180 Ga0070696_100121612 3300005546 Bacteria 1890
181 Ga0070696_100189408 3300005546 Bacteria 1530
182 Ga0070693_100007294 3300005547 Bacteria 5400
183 Ga0070693_100025282 3300005547 Bacteria 3195
184 Ga0070693_100079033 3300005547 Bacteria 1956
185 Ga0070693_100148917 3300005547 Unclassified 1480
186 Ga0070665_100080652 3300005548 Bacteria 3260
187 Ga0070704_100057938 3300005549 Bacteria 2757
188 Ga0070704_100063948 3300005549 Bacteria 2642
189 Ga0068855_100005375 3300005563 Bacteria 15622
190 Ga0068855_100088628 3300005563 Bacteria 3574
191 Ga0068855_100313116 3300005563 Bacteria 1736
192 Ga0068855_100401908 3300005563 Unclassified 1501
193 Ga0068855_100454905 3300005563 Bacteria 1396
194 Ga0068855_100501393 3300005563 Bacteria 1319
195 Ga0068855_100533080 3300005563 Bacteria 1273
196 Ga0070664_100000873 3300005564 Bacteria 23360
197 Ga0070664_100003255 3300005564 Bacteria 13118
198 Ga0068857_100053911 3300005577 Bacteria 3567
199 Ga0068857_100113923 3300005577 Bacteria 2432
200 Ga0068857_100240030 3300005577 Bacteria 1659
201 Ga0068857_100664463 3300005577 Bacteria 988
202 Ga0068854_100000014 3300005578 Bacteria 163231
203 Ga0068854_100000874 3300005578 Bacteria 18073
204 Ga0068854_100011675 3300005578 Bacteria 5729
205 Ga0068854_100079955 3300005578 Bacteria 2412
206 Ga0068854_100112690 3300005578 Bacteria 2054
207 Ga0068856_100161800 3300005614 Bacteria 2249
208 Ga0068856_100200125 3300005614 Bacteria 2012
209 Ga0068856_100257262 3300005614 Bacteria 1761
210 Ga0070702_100004518 3300005615 Bacteria 6364
211 Ga0070702_100033964 3300005615 Bacteria 2808
212 Ga0068852_100051406 3300005616 Bacteria 3536
213 Ga0068859_100587780 3300005617 Bacteria 1207
214 Ga0068864_100000111 3300005618 Bacteria 79723
215 Ga0068864_100097668 3300005618 Bacteria 2601
216 Ga0068861_100011968 3300005719 Bacteria 6042
217 Ga0068861_100017480 3300005719 Bacteria 5094
218 Ga0068861_100089507 3300005719 Bacteria 2426
219 Ga0068863_100138935 3300005841 Bacteria 2322
220 Ga0068858_100000022 3300005842 Bacteria 169718
221 Ga0068860_100011193 3300005843 Bacteria 8841
222 Ga0068860_100013042 3300005843 Bacteria 8157
223 Ga0068862_100000095 3300005844 Bacteria 105957
224 Ga0068862_100110279 3300005844 Bacteria 2415
225 Ga0068862_100466318 3300005844 Bacteria 1193
226 Ga0081539_10001185 3300005985 Bacteria 47102
227 Ga0070717_10240298 3300006028 Bacteria 1597
228 Ga0075432_10000146 3300006058 Bacteria 16762
229 Ga0070715_10130521 3300006163 Bacteria 1209
230 Ga0070715_10131828 3300006163 Unclassified 1204
231 Ga0070716_100019973 3300006173 Bacteria 3511
232 Ga0070716_100207092 3300006173 Bacteria 1308
233 Ga0070716_100235405 3300006173 Unclassified 1239
234 Ga0070716_100322906 3300006173 Bacteria 1082
235 Ga0070712_100001112 3300006175 Bacteria 16199
236 Ga0070712_100134018 3300006175 Bacteria 1881
237 Ga0070712_100236338 3300006175 Bacteria 1454
238 Ga0075366_10136273 3300006195 Unclassified 1483
239 Ga0097621_100020509 3300006237 Bacteria 5093
240 Ga0097621_100089216 3300006237 Bacteria 2577
241 Ga0097621_100122288 3300006237 Bacteria 2209
242 Ga0097621_100291482 3300006237 Bacteria 1439
243 Ga0097621_100506732 3300006237 Bacteria 1094
244 Ga0068871_100044823 3300006358 Bacteria 3558
245 Ga0068871_100099478 3300006358 Bacteria 2435
246 Ga0075428_100824092 3300006844 Bacteria 986
247 Ga0075430_100006526 3300006846 Bacteria 9838
248 Ga0075430_100008729 3300006846 Bacteria 8554
249 Ga0075430_100017031 3300006846 Bacteria 6190
250 Ga0075431_100011189 3300006847 Bacteria 9036
251 Ga0075433_10005027 3300006852 Bacteria 10365
252 Ga0075433_10008862 3300006852 Bacteria 8026
253 Ga0075433_10018091 3300006852 Bacteria 5850
254 Ga0075433_10109987 3300006852 Bacteria 2445
255 Ga0075433_10115992 3300006852 Bacteria 2376
256 Ga0075433_10166511 3300006852 Bacteria 1962
257 Ga0075434_100097005 3300006871 Unclassified 2952
258 Ga0075434_100442007 3300006871 Bacteria 1322
259 Ga0075429_100011609 3300006880 Bacteria 7640
260 Ga0075429_100050521 3300006880 Bacteria 3617
261 Ga0068865_100000005 3300006881 Bacteria 213248
262 Ga0068865_100001245 3300006881 Bacteria 14819
263 Ga0068865_100567845 3300006881 Bacteria 955
264 Ga0075436_100074038 3300006914 Bacteria 2358
265 Ga0075436_100114555 3300006914 Bacteria 1883
266 Ga0075436_100138760 3300006914 Bacteria 1708
267 Ga0075436_100359196 3300006914 Unclassified 1051
268 Ga0075436_100452430 3300006914 Bacteria 935
269 Ga0097620_100033113 3300006931 Bacteria 5191
270 Ga0097620_100587815 3300006931 Bacteria 1207
271 Ga0075435_100068984 3300007076 Bacteria 2881
272 Ga0075435_100286224 3300007076 Archaea 1407
273 Ga0099794_10146149 3300007265 Bacteria 1199
274 Ga0099795_10221620 3300007788 Bacteria 805
275 Ga0105240_10029355 3300009093 Bacteria 7167
276 Ga0105240_10034089 3300009093 Bacteria 6571
277 Ga0105240_10039411 3300009093 Bacteria 6050
278 Ga0105240_10071968 3300009093 Bacteria 4274
279 Ga0105240_10102207 3300009093 Bacteria 3484
280 Ga0105240_10182979 3300009093 Bacteria 2471
281 Ga0105240_10448481 3300009093 Bacteria 1444
282 Ga0105240_10735317 3300009093 Bacteria 1074
283 Ga0105240_11066389 3300009093 Unclassified 861
284 Ga0105240_11393867 3300009093 Bacteria 737
285 Ga0105245_10000281 3300009098 Bacteria 48386
286 Ga0105245_10001545 3300009098 Bacteria 20877
287 Ga0105245_10020460 3300009098 Bacteria 5804
288 Ga0105245_11412302 3300009098 Bacteria 746
289 Ga0105247_10003191 3300009101 Bacteria 10807
290 Ga0114129_10007246 3300009147 Bacteria 15788
291 Ga0114129_10012148 3300009147 Bacteria 12260
292 Ga0114129_10297553 3300009147 Bacteria 2152
293 Ga0114129_10830192 3300009147 Bacteria 1177
294 Ga0105243_10000411 3300009148 Bacteria 44928
295 Ga0105243_10016408 3300009148 Bacteria 5602
296 Ga0105243_10096541 3300009148 Bacteria 2445
297 Ga0105243_10247019 3300009148 Bacteria 1591
298 Ga0105243_10574657 3300009148 Bacteria 1081
299 Ga0105241_10020096 3300009174 Bacteria 4933
300 Ga0105241_10125412 3300009174 Bacteria 2073
301 Ga0105241_10183356 3300009174 Bacteria 1738
302 Ga0105242_10001969 3300009176 Bacteria 16156
303 Ga0105242_10005679 3300009176 Bacteria 9628
304 Ga0105242_10080013 3300009176 Bacteria 2730
305 Ga0105242_10152312 3300009176 Bacteria 2017
306 Ga0105242_10160971 3300009176 Bacteria 1965
307 Ga0105248_10002568 3300009177 Bacteria 20184
308 Ga0105248_10006274 3300009177 Bacteria 13040
309 Ga0105248_10081810 3300009177 Bacteria 3630
310 Ga0105248_10157103 3300009177 Unclassified 2566
311 Ga0105248_10718204 3300009177 Archaea 1127
312 Ga0105237_10002288 3300009545 Bacteria 23796
313 Ga0105237_10319578 3300009545 Bacteria 1556
314 Ga0105237_10378438 3300009545 Bacteria 1420
315 Ga0105237_10431142 3300009545 Bacteria 1324
316 Ga0105237_10705893 3300009545 Unclassified 1015
317 Ga0105238_10117902 3300009551 Bacteria 2635
318 Ga0105249_10000079 3300009553 Bacteria 139904
319 Ga0105249_10063181 3300009553 Bacteria 3401
320 Ga0105249_11034441 3300009553 Unclassified 890
321 Ga0105249_11037219 3300009553 Unclassified 889
322 Ga0105239_10000025 3300010375 Bacteria 254049
323 Ga0105239_10020412 3300010375 Bacteria 7309
324 Ga0105239_10058747 3300010375 Unclassified 4221
325 Ga0105239_10303359 3300010375 Bacteria 1798
326 Ga0105239_10935765 3300010375 Unclassified 995
327 Ga0105246_10007739 3300011119 Bacteria 6593
328 Ga0105246_10067482 3300011119 Bacteria 2506
329 Ga0105246_10080107 3300011119 Bacteria 2324
330 Ga0105246_10983706 3300011119 Bacteria 763
331 Ga0157373_10032985 3300013100 Bacteria 3727
332 Ga0157373_10042767 3300013100 Bacteria 3237
333 Ga0157371_10064577 3300013102 Bacteria 2593
334 Ga0157371_10065655 3300013102 Bacteria 2570
335 Ga0157370_10000611 3300013104 Bacteria 44454
336 Ga0157370_10009337 3300013104 Bacteria 10496
337 Ga0157370_10022338 3300013104 Bacteria 6296
338 Ga0157370_10039339 3300013104 Bacteria 4570
339 Ga0157370_10051887 3300013104 Bacteria 3916
340 Ga0157370_10054949 3300013104 Bacteria 3795
341 Ga0157370_10101703 3300013104 Bacteria 2692
342 Ga0157370_10165738 3300013104 Bacteria 2055
343 Ga0157369_10035178 3300013105 Bacteria 5494
344 Ga0157369_10068459 3300013105 Bacteria 3814
345 Ga0157369_10086664 3300013105 Bacteria 3344
346 Ga0157369_10168943 3300013105 Bacteria 2305
347 Ga0157369_10680569 3300013105 Bacteria 1060
348 Ga0157369_10749327 3300013105 Bacteria 1005
349 Ga0157374_10001017 3300013296 Bacteria 24339
350 Ga0157374_10010625 3300013296 Bacteria 7927
351 Ga0157374_10074484 3300013296 Unclassified 3206
352 Ga0157374_10088416 3300013296 Bacteria 2951
353 Ga0157374_10437316 3300013296 Bacteria 1308
354 Ga0157378_10001127 3300013297 Bacteria 24339
355 Ga0157378_10036078 3300013297 Bacteria 4376
356 Ga0157378_10118500 3300013297 Bacteria 2437
357 Ga0157378_10897357 3300013297 Bacteria 917
358 Ga0163162_10099988 3300013306 Bacteria 2991
359 Ga0163162_10147414 3300013306 Bacteria 2470
360 Ga0157372_10048563 3300013307 Bacteria 4718
361 Ga0157372_10083280 3300013307 Bacteria 3623
362 Ga0157372_10091083 3300013307 Bacteria 3468
363 Ga0157372_10102985 3300013307 Bacteria 3261
364 Ga0157372_10180790 3300013307 Bacteria 2441
365 Ga0157372_10185877 3300013307 Bacteria 2406
366 Ga0157375_10002160 3300013308 Bacteria 17001
367 Ga0157375_10159424 3300013308 Bacteria 2397
368 Ga0157375_10870902 3300013308 Bacteria 1046
369 Ga0163163_10244126 3300014325 Bacteria 1846
370 Ga0163163_11510263 3300014325 Unclassified 733
371 Ga0157380_10003770 3300014326 Bacteria 10422
372 Ga0157380_10005347 3300014326 Bacteria 8972
373 Ga0157380_10037236 3300014326 Bacteria 3768
374 Ga0157380_10065144 3300014326 Bacteria 2927
375 Ga0157380_10106604 3300014326 Bacteria 2345
376 Ga0157380_10834339 3300014326 Bacteria 942
377 Ga0157377_10003125 3300014745 Bacteria 7449
378 Ga0157377_10030512 3300014745 Bacteria 2921
379 Ga0157379_10081801 3300014968 Bacteria 2893
380 Ga0157379_10213557 3300014968 Bacteria 1747
381 Ga0157376_10001880 3300014969 Bacteria 14007
382 Ga0157376_10002783 3300014969 Bacteria 11944
383 Ga0157376_10028395 3300014969 Bacteria 4446
384 Ga0157376_10222773 3300014969 Unclassified 1748
385 Ga0182006_1020670 3300015261 Bacteria 2755
386 Ga0163161_10180539 3300017792 Bacteria 1618
387 Ga0213875_10004572 3300021388 Bacteria 7555
388 Ga0213875_10018387 3300021388 Bacteria 3369
389 Ga0213875_10032108 3300021388 Bacteria 2482
390 Ga0207427_101709 3300025231 Bacteria 7280
391 Ga0209148_1002133 3300025254 Bacteria 7386
392 Ga0209233_1000003 3300025261 Bacteria 1607366
393 Ga0209455_1000467 3300025272 Bacteria 30363
394 Ga0207653_10019781 3300025885 Bacteria 2125
395 Ga0207682_10058329 3300025893 Bacteria 1611
396 Ga0207692_10167004 3300025898 Bacteria 1273
397 Ga0207710_10040359 3300025900 Bacteria 2068
398 Ga0207688_10060783 3300025901 Bacteria 2129
399 Ga0207680_10067310 3300025903 Bacteria 2206
400 Ga0207685_10004793 3300025905 Bacteria 3488
401 Ga0207685_10098322 3300025905 Bacteria 1246
402 Ga0207699_10260142 3300025906 Bacteria 1199
403 Ga0207699_10487896 3300025906 Bacteria 888
404 Ga0207645_10000106 3300025907 Bacteria 62240
405 Ga0207645_10001707 3300025907 Bacteria 17826
406 Ga0207643_10074006 3300025908 Bacteria 1964
407 Ga0207705_10000016 3300025909 Bacteria 377359
408 Ga0207705_10000046 3300025909 Bacteria 177574
409 Ga0207705_10001249 3300025909 Bacteria 20440
410 Ga0207705_10004105 3300025909 Bacteria 11042
411 Ga0207705_10015092 3300025909 Bacteria 5554
412 Ga0207705_10030685 3300025909 Bacteria 3836
413 Ga0207705_10457421 3300025909 Bacteria 990
414 Ga0207684_10008569 3300025910 Bacteria 9093
415 Ga0207684_10041105 3300025910 Bacteria 3921
416 Ga0207684_10118130 3300025910 Bacteria 2272
417 Ga0207684_10756118 3300025910 Bacteria 823
418 Ga0207654_10077432 3300025911 Bacteria 1993
419 Ga0207707_10004769 3300025912 Bacteria 11891
420 Ga0207707_10014069 3300025912 Bacteria 6974
421 Ga0207707_10016769 3300025912 Bacteria 6381
422 Ga0207707_10021217 3300025912 Bacteria 5678
423 Ga0207707_10027639 3300025912 Bacteria 4960
424 Ga0207707_10057911 3300025912 Bacteria 3372
425 Ga0207707_10058144 3300025912 Bacteria 3365
426 Ga0207707_10063990 3300025912 Bacteria 3201
427 Ga0207707_10256389 3300025912 Bacteria 1518
428 Ga0207707_10292243 3300025912 Bacteria 1410
429 Ga0207695_10005655 3300025913 Bacteria 16500
430 Ga0207695_10030170 3300025913 Bacteria 5973
431 Ga0207695_10053761 3300025913 Bacteria 4209
432 Ga0207695_10093976 3300025913 Bacteria 3007
433 Ga0207695_10121442 3300025913 Bacteria 2580
434 Ga0207695_10123346 3300025913 Bacteria 2556
435 Ga0207671_10083288 3300025914 Bacteria 2401
436 Ga0207671_10124374 3300025914 Bacteria 1974
437 Ga0207693_10028969 3300025915 Bacteria 4377
438 Ga0207693_10070547 3300025915 Unclassified 2734
439 Ga0207693_10333456 3300025915 Unclassified 1188
440 Ga0207663_10064719 3300025916 Bacteria 2334
441 Ga0207663_10603064 3300025916 Bacteria 863
442 Ga0207660_10005550 3300025917 Bacteria 8193
443 Ga0207660_10009791 3300025917 Bacteria 6206
444 Ga0207660_10039228 3300025917 Bacteria 3310
445 Ga0207660_10105156 3300025917 Bacteria 2115
446 Ga0207660_10127553 3300025917 Bacteria 1933
447 Ga0207660_10278545 3300025917 Bacteria 1327
448 Ga0207660_10314164 3300025917 Bacteria 1250
449 Ga0207660_10435524 3300025917 Bacteria 1059
450 Ga0207662_10031065 3300025918 Bacteria 3102
451 Ga0207657_10001750 3300025919 Bacteria 23423
452 Ga0207657_10002404 3300025919 Bacteria 20242
453 Ga0207657_10014426 3300025919 Bacteria 7718
454 Ga0207657_10091025 3300025919 Bacteria 2545
455 Ga0207657_10233401 3300025919 Bacteria 1471
456 Ga0207657_10470177 3300025919 Bacteria 986
457 Ga0207649_10058357 3300025920 Bacteria 2416
458 Ga0207652_10016969 3300025921 Bacteria 5955
459 Ga0207652_10025526 3300025921 Bacteria 4914
460 Ga0207652_10032239 3300025921 Bacteria 4402
461 Ga0207652_10119929 3300025921 Bacteria 2339
462 Ga0207652_10154919 3300025921 Bacteria 2052
463 Ga0207652_10158898 3300025921 Bacteria 2025
464 Ga0207652_10361168 3300025921 Bacteria 1311
465 Ga0207646_10000002 3300025922 Bacteria 550880
466 Ga0207646_10069925 3300025922 Bacteria 3135
467 Ga0207646_10827406 3300025922 Bacteria 824
468 Ga0207681_10003295 3300025923 Bacteria 10116
469 Ga0207681_10006532 3300025923 Bacteria 7154
470 Ga0207694_10179118 3300025924 Bacteria 1718
471 Ga0207650_10018098 3300025925 Bacteria 4940
472 Ga0207650_10095734 3300025925 Bacteria 2276
473 Ga0207650_10234257 3300025925 Bacteria 1482
474 Ga0207659_10257686 3300025926 Bacteria 1418
475 Ga0207687_10001504 3300025927 Bacteria 15964
476 Ga0207687_10003874 3300025927 Bacteria 10050
477 Ga0207687_10020033 3300025927 Bacteria 4436
478 Ga0207700_10003248 3300025928 Bacteria 9397
479 Ga0207700_10024352 3300025928 Bacteria 4189
480 Ga0207700_10194295 3300025928 Bacteria 1707
481 Ga0207664_10037680 3300025929 Bacteria 3744
482 Ga0207664_10151806 3300025929 Bacteria 1968
483 Ga0207664_10516174 3300025929 Bacteria 1071
484 Ga0207644_10000772 3300025931 Bacteria 20265
485 Ga0207690_10000642 3300025932 Bacteria 22399
486 Ga0207690_10003524 3300025932 Bacteria 9326
487 Ga0207690_10010111 3300025932 Bacteria 5604
488 Ga0207690_10225916 3300025932 Bacteria 1435
489 Ga0207706_10003580 3300025933 Bacteria 14831
490 Ga0207706_10152131 3300025933 Bacteria 2035
491 Ga0207706_10188168 3300025933 Bacteria 1812
492 Ga0207686_10007878 3300025934 Bacteria 5743
493 Ga0207686_10066765 3300025934 Bacteria 2298
494 Ga0207686_10075812 3300025934 Bacteria 2178
495 Ga0207686_10173842 3300025934 Bacteria 1521
496 Ga0207686_10470987 3300025934 Unclassified 970
497 Ga0207709_10000051 3300025935 Bacteria 227968
498 Ga0207709_10010716 3300025935 Bacteria 5049
499 Ga0207670_10000048 3300025936 Bacteria 90133
500 Ga0207670_10006030 3300025936 Bacteria 6699
501 Ga0207669_10026342 3300025937 Bacteria 3160
502 Ga0207704_10000001 3300025938 Bacteria 716296
503 Ga0207665_10095338 3300025939 Bacteria 2068
504 Ga0207665_10096437 3300025939 Unclassified 2057
505 Ga0207665_10234380 3300025939 Bacteria 1350
506 Ga0207665_10343655 3300025939 Bacteria 1125
507 Ga0207665_10631508 3300025939 Bacteria 838
508 Ga0207691_10003100 3300025940 Bacteria 16230
509 Ga0207691_10042650 3300025940 Bacteria 4182
510 Ga0207691_10406462 3300025940 Bacteria 1161
511 Ga0207711_10004553 3300025941 Bacteria 11796
512 Ga0207711_10007869 3300025941 Bacteria 8915
513 Ga0207711_10010970 3300025941 Bacteria 7527
514 Ga0207711_10018382 3300025941 Bacteria 5811
515 Ga0207711_10134897 3300025941 Unclassified 2216
516 Ga0207711_10210061 3300025941 Bacteria 1778
517 Ga0207689_10001171 3300025942 Bacteria 25256
518 Ga0207689_10003301 3300025942 Bacteria 14767
519 Ga0207689_10005831 3300025942 Bacteria 10925
520 Ga0207689_10021640 3300025942 Bacteria 5408
521 Ga0207689_10609065 3300025942 Bacteria 919
522 Ga0207661_10007995 3300025944 Bacteria 7541
523 Ga0207661_10096868 3300025944 Bacteria 2469
524 Ga0207661_10160717 3300025944 Bacteria 1949
525 Ga0207661_10257157 3300025944 Bacteria 1554
526 Ga0207679_10529645 3300025945 Bacteria 1055
527 Ga0207667_10000670 3300025949 Bacteria 44352
528 Ga0207667_10016129 3300025949 Bacteria 8449
529 Ga0207667_10071697 3300025949 Bacteria 3601
530 Ga0207667_10116036 3300025949 Bacteria 2759
531 Ga0207667_10174449 3300025949 Bacteria 2209
532 Ga0207667_10189347 3300025949 Bacteria 2111
533 Ga0207667_10763691 3300025949 Archaea 965
534 Ga0207651_10000006 3300025960 Bacteria 227893
535 Ga0207651_10031297 3300025960 Bacteria 3399
536 Ga0207651_10080253 3300025960 Bacteria 2347
537 Ga0207651_10276692 3300025960 Bacteria 1385
538 Ga0207712_10000030 3300025961 Bacteria 216514
539 Ga0207712_10022826 3300025961 Bacteria 4124
540 Ga0207712_10227561 3300025961 Archaea 1495
541 Ga0207712_10691653 3300025961 Bacteria 889
542 Ga0207668_10000842 3300025972 Bacteria 18543
543 Ga0207640_10000010 3300025981 Bacteria 275745
544 Ga0207640_10007482 3300025981 Bacteria 6033
545 Ga0207658_10059219 3300025986 Bacteria 2853
546 Ga0207677_10000156 3300026023 Bacteria 54081
547 Ga0207677_10010386 3300026023 Bacteria 5266
548 Ga0207703_10000048 3300026035 Bacteria 151143
549 Ga0207639_10000033 3300026041 Bacteria 157588
550 Ga0207639_10083620 3300026041 Bacteria 2534
551 Ga0207639_10098449 3300026041 Bacteria 2357
552 Ga0207639_10377459 3300026041 Bacteria 1272
553 Ga0207639_10863330 3300026041 Unclassified 845
554 Ga0207678_10001977 3300026067 Bacteria 18680
555 Ga0207678_10003120 3300026067 Bacteria 15000
556 Ga0207678_10014128 3300026067 Bacteria 7022
557 Ga0207678_10030569 3300026067 Bacteria 4701
558 Ga0207678_10043107 3300026067 Bacteria 3906
559 Ga0207678_10212996 3300026067 Unclassified 1653
560 Ga0207708_10000285 3300026075 Bacteria 39702
561 Ga0207708_10001695 3300026075 Bacteria 16315
562 Ga0207708_10535621 3300026075 Bacteria 986
563 Ga0207702_10017599 3300026078 Bacteria 5913
564 Ga0207702_10091648 3300026078 Bacteria 2661
565 Ga0207702_10617630 3300026078 Bacteria 1064
566 Ga0207702_10894447 3300026078 Bacteria 880
567 Ga0207641_10054302 3300026088 Bacteria 3399
568 Ga0207641_10120388 3300026088 Bacteria 2341
569 Ga0207641_10914630 3300026088 Bacteria 872
570 Ga0207648_10000363 3300026089 Bacteria 50049
571 Ga0207648_10000578 3300026089 Bacteria 41060
572 Ga0207648_10053460 3300026089 Bacteria 3530
573 Ga0207648_10247146 3300026089 Unclassified 1590
574 Ga0207648_10458938 3300026089 Bacteria 1161
575 Ga0207676_10000151 3300026095 Bacteria 60274
576 Ga0207674_10018739 3300026116 Bacteria 7513
577 Ga0207674_10023980 3300026116 Bacteria 6525
578 Ga0207674_10270278 3300026116 Bacteria 1647
579 Ga0207674_10297320 3300026116 Bacteria 1563
580 Ga0207674_10540119 3300026116 Bacteria 1126
581 Ga0207674_10730268 3300026116 Bacteria 956
582 Ga0207674_10888322 3300026116 Bacteria 859
583 Ga0207675_100021047 3300026118 Bacteria 6080
584 Ga0207675_100182317 3300026118 Bacteria 2011
585 Ga0207675_100688550 3300026118 Archaea 1030
586 Ga0207683_10001101 3300026121 Bacteria 24602
587 Ga0207683_10142336 3300026121 Bacteria 2161
588 Ga0207698_10038066 3300026142 Bacteria 3550
589 Ga0207698_10226721 3300026142 Unclassified 1693
590 Ga0209967_1000003 3300027364 Bacteria 32175
591 Ga0209981_1000058 3300027378 Bacteria 11739
592 Ga0209996_1000094 3300027395 Bacteria 11768
593 Ga0209996_1006207 3300027395 Bacteria 1540
594 Ga0209984_1000587 3300027424 Bacteria 3961
595 Ga0209995_1000234 3300027471 Bacteria 8760
596 Ga0209968_1001470 3300027526 Bacteria 3578
597 Ga0209999_1000320 3300027543 Bacteria 7192
598 Ga0209982_1000017 3300027552 Bacteria 15324
599 Ga0209970_1003145 3300027614 Bacteria 2788
600 Ga0210002_1001187 3300027617 Bacteria 3632
601 Ga0210002_1007107 3300027617 Bacteria 1696
602 Ga0209983_1001997 3300027665 Bacteria 4516
603 Ga0209971_1000718 3300027682 Bacteria 8538
604 Ga0209966_1000115 3300027695 Bacteria 35332
605 Ga0209998_10000074 3300027717 Bacteria 40240
606 Ga0209974_10000017 3300027876 Bacteria 39244
607 Ga0207428_10000760 3300027907 Bacteria 36731
608 Ga0265356_1006515 3300028017 Bacteria 1362
609 Ga0268266_10030855 3300028379 Bacteria 4552
610 Ga0268266_10042398 3300028379 Bacteria 3887
611 Ga0268265_10000132 3300028380 Bacteria 95410
612 Ga0268265_10004280 3300028380 Bacteria 9961
613 Ga0268265_10489093 3300028380 Bacteria 1157
614 Ga0268264_10000779 3300028381 Bacteria 35038
615 Ga0268264_10039724 3300028381 Bacteria 3888
616 Ga0265338_10010001 3300028800 Bacteria 11215
617 Ga0265338_10113490 3300028800 Unclassified 2176
618 Ga0265338_10441430 3300028800 Bacteria 922
619 Ga0265338_10486397 3300028800 Bacteria 870
620 Ga0265760_10057064 3300031090 Bacteria 1182
621 Ga0265330_10008443 3300031235 Bacteria 4956
622 Ga0265330_10009351 3300031235 Bacteria 4660
623 Ga0265330_10050263 3300031235 Bacteria 1829
624 Ga0265330_10076756 3300031235 Bacteria 1442
625 Ga0265332_10056629 3300031238 Bacteria 1680
626 Ga0265328_10000002 3300031239 Bacteria 275819
627 Ga0265328_10017261 3300031239 Bacteria 2796
628 Ga0265320_10252766 3300031240 Bacteria 782
629 Ga0265325_10016951 3300031241 Bacteria 4061
630 Ga0265325_10018497 3300031241 Bacteria 3864
631 Ga0265325_10023255 3300031241 Bacteria 3387
632 Ga0265340_10009415 3300031247 Bacteria 5243
633 Ga0265340_10021003 3300031247 Bacteria 3349
634 Ga0265340_10026809 3300031247 Bacteria 2910
635 Ga0265340_10051438 3300031247 Bacteria 1995
636 Ga0265340_10114174 3300031247 Bacteria 1246
637 Ga0265340_10144543 3300031247 Bacteria 1087
638 Ga0265339_10000041 3300031249 Bacteria 119820
639 Ga0265339_10008146 3300031249 Bacteria 6690
640 Ga0265339_10013760 3300031249 Bacteria 4897
641 Ga0265339_10019346 3300031249 Bacteria 4000
642 Ga0265339_10075185 3300031249 Bacteria 1794
643 Ga0265339_10140922 3300031249 Unclassified 1227
644 Ga0265331_10005230 3300031250 Bacteria 7867
645 Ga0265331_10021149 3300031250 Bacteria 3332
646 Ga0265327_10002507 3300031251 Bacteria 19190
647 Ga0265327_10014068 3300031251 Bacteria 5264
648 Ga0265327_10039801 3300031251 Bacteria 2550
649 Ga0265327_10097074 3300031251 Bacteria 1428
650 Ga0265316_10002381 3300031344 Bacteria 19567
651 Ga0265316_10006492 3300031344 Bacteria 11166
652 Ga0265316_10013220 3300031344 Bacteria 7352
653 Ga0265316_10154517 3300031344 Bacteria 1717
654 Ga0265316_10175048 3300031344 Bacteria 1600
655 Ga0265316_10255882 3300031344 Bacteria 1284
656 Ga0265316_10313457 3300031344 Unclassified 1141
657 Ga0307513_10032360 3300031456 Bacteria 5899
658 Ga0307509_10183477 3300031507 Bacteria 1954
659 Ga0265313_10000295 3300031595 Bacteria 54290
660 Ga0265313_10168513 3300031595 Bacteria 927
661 Ga0316575_10042091 3300031665 Bacteria 1808
662 Ga0265314_10015714 3300031711 Bacteria 5998
663 Ga0265314_10049612 3300031711 Bacteria 2937
664 Ga0265314_10114606 3300031711 Bacteria 1707
665 Ga0265342_10008298 3300031712 Bacteria 7473
666 Ga0265342_10020393 3300031712 Bacteria 4252
667 Ga0265342_10051354 3300031712 Bacteria 2460
668 Ga0265342_10128427 3300031712 Bacteria 1422
669 Ga0307405_10019461 3300031731 Bacteria 3772
670 Ga0307405_10196094 3300031731 Bacteria 1462
671 Ga0307410_10051262 3300031852 Bacteria 2780
672 Ga0307406_10076490 3300031901 Bacteria 2211
673 Ga0307412_10036252 3300031911 Bacteria 3158
674 Ga0307412_10069114 3300031911 Bacteria 2403
675 Ga0307416_100204854 3300032002 Bacteria 1875
676 Ga0307414_10035292 3300032004 Bacteria 3327
677 Ga0307411_10105380 3300032005 Bacteria 2005
678 Ga0307510_10001934 3300033180 Bacteria 23277
679 Ga0373959_0061410 3300034820 Bacteria 832
680 Ga0373926_0006990 3300035083 Bacteria 3753
681 Ga0373926_0020718 3300035083 Bacteria 2272
682 Ga0373923_0069382 3300035111 Bacteria 1511
683 Ga0373923_0098605 3300035111 Bacteria 1286
684 Ga0373936_0011513 3300035113 Bacteria 3349
685 Ga0373936_0050621 3300035113 Bacteria 1680
686 Ga0373945_0006150 3300035116 Bacteria 3861
687 Ga0373945_0013358 3300035116 Bacteria 2738
688 Ga0373960_0120889 3300035121 Archaea 869
689 Ga0373943_0000343 3300035170 Bacteria 19547
690 Ga0373943_0008884 3300035170 Bacteria 4501
691 Ga0373943_0060351 3300035170 Bacteria 1893
692 Ga0373946_0001335 3300035171 Bacteria 8521
693 Ga0373946_0089478 3300035171 Bacteria 1362
694 Ga0373946_0102077 3300035171 Bacteria 1287
695 Ga0373924_0212762 3300035410 Unclassified 854
696 Ga0373935_0009490 3300035692 Bacteria 5822
697 Ga0373935_0039504 3300035692 Bacteria 2959
698 Ga0373935_0135376 3300035692 Bacteria 1659
699 Ga0373927_0001986 3300035695 Bacteria 15072
700 Ga0373927_0122333 3300035695 Bacteria 1698
701 Ga0373927_0169301 3300035695 Bacteria 1432
702 Ga0373933_0086789 3300035724 Bacteria 1926
703 Ga0373947_0000156 3300035725 Bacteria 36048
704 Ga0373947_0009196 3300035725 Bacteria 5678
705 Ga0373947_0049742 3300035725 Bacteria 2518
706 Ga0373937_0026783 3300036401 Bacteria 5211
707 Ga0373937_0488410 3300036401 Bacteria 1170
708 Ga0373937_0580775 3300036401 Bacteria 1064
709 Ga0373925_0000628 3300037068 Bacteria 33530
710 Ga0373925_0004286 3300037068 Bacteria 10809
711 Ga0373925_0038072 3300037068 Bacteria 3553
712 Ga0373925_0044359 3300037068 Bacteria 3302
713 Ga0373925_0068568 3300037068 Bacteria 2678
714 Ga0373925_0261445 3300037068 Bacteria 1390
715 Ga0373925_0509873 3300037068 Bacteria 988
716 Ga0373925_0778592 3300037068 Bacteria 789
717 Ga0395899_0005273 3300037312 Bacteria 10039
718 Ga0395899_0007715 3300037312 Bacteria 8297
719 Ga0395899_0058990 3300037312 Bacteria 2829
720 Ga0395900_0003899 3300037418 Bacteria 15936
721 Ga0395900_0004815 3300037418 Bacteria 14222
722 Ga0395900_0144526 3300037418 Bacteria 2433
723 Ga0395900_0163403 3300037418 Bacteria 2270
724 Ga0395900_0183595 3300037418 Bacteria 2124
725 Ga0395900_0205490 3300037418 Bacteria 1991
726 Ga0395900_0316700 3300037418 Bacteria 1541
727 Ga0395900_0472647 3300037418 Bacteria 1207
728 Ga0395900_0637162 3300037418 Bacteria 1003
729 Ga0395900_0769407 3300037418 Bacteria 892
730 Ga0395898_0006201 3300037466 Bacteria 12811
731 Ga0395898_0035276 3300037466 Bacteria 4976
732 Ga0395898_0071760 3300037466 Bacteria 3345
733 Ga0395898_0078853 3300037466 Bacteria 3177
734 Ga0395898_0631359 3300037466 Bacteria 1014
735 Ga0395905_0044827 3300037471 Bacteria 4149
736 Ga0436364_0012403 3300037853 Bacteria 2028
737 Ga0436364_0023814 3300037853 Bacteria 1922
738 Ga0436364_1049814 3300037853 Bacteria 6319
739 Ga0436364_1290526 3300037853 Bacteria 21813
740 Ga0436364_1505222 3300037853 Bacteria 5008
741 Ga0395901_0000594 3300038443 Bacteria 42185
742 Ga0395901_0104521 3300038443 Bacteria 2972
743 Ga0395901_0137933 3300038443 Bacteria 2563
744 Ga0395901_0241516 3300038443 Bacteria 1884
745 Ga0395901_0628258 3300038443 Bacteria 1080
746 Ga0395901_0946633 3300038443 Unclassified 840
747 Ga0436365_0049975 3300039437 Bacteria 1148
748 Ga0436365_0311528 3300039437 Unclassified 1051
749 Ga0436365_0870553 3300039437 Bacteria 3040
750 Ga0436365_1548123 3300039437 Bacteria 1455
751 Ga0436360_0989526 3300039438 Bacteria 1386
752 Ga0436360_1310211 3300039438 Unclassified 1809
753 Ga0436361_0090086 3300039447 Bacteria 1948
754 Ga0436363_0661182 3300039450 Bacteria 1730
755 Ga0436363_1151103 3300039450 Bacteria 794
756 Ga0436363_1471237 3300039450 Bacteria 4133
757 Ga0436362_0141115 3300039453 Bacteria 1939
758 Ga0436362_0591404 3300039453 Bacteria 2816
759 Ga0439461_0092762 3300041410 Bacteria 726
760 Ga0439466_0033219 3300041411 Bacteria 1754
761 Ga0439431_0028292 3300041997 Bacteria 1381
762 Ga0439441_010838 3300042001 Bacteria 1537
763 Ga0439448_0086740 3300042005 Archaea 1055
764 Ga0439432_013411 3300042006 Bacteria 2788
765 Ga0450909_005249 3300042185 Bacteria 1864
766 Ga0439434_0004960 3300042435 Bacteria 3890
767 Ga0439435_0035039 3300042436 Bacteria 1382
768 Ga0439460_0026455 3300042461 Bacteria 1623
769 Ga0451577_0000003 3300042876 Bacteria 921850
770 Ga0451577_0000051 3300042876 Bacteria 297831
771 Ga0451577_0019556 3300042876 Bacteria 6225
772 Ga0451577_0035562 3300042876 Bacteria 4487
773 Ga0451577_0107254 3300042876 Bacteria 2496
774 Ga0451577_0206920 3300042876 Bacteria 1772
775 Ga0451577_0279404 3300042876 Bacteria 1513
776 Ga0439440_0154462 3300042993 Bacteria 659
777 Ga0453683_0006913 3300044673 Bacteria 7737
778 Ga0453683_0015820 3300044673 Bacteria 4877
779 Ga0453683_0050864 3300044673 Bacteria 2596
780 Ga0453683_0210673 3300044673 Bacteria 1235
781 Ga0453683_0275321 3300044673 Bacteria 1074
782 Ga0453683_0623103 3300044673 Bacteria 704
783 Ga0466966_0212518 3300044684 Bacteria 1169
784 Ga0466961_0038286 3300044693 Bacteria 3076
785 Ga0466963_0000249 3300044694 Bacteria 23560
786 Ga0466963_0010330 3300044694 Bacteria 5651
787 Ga0453684_0000042 3300044712 Bacteria 682980
788 Ga0453684_0015307 3300044712 Bacteria 12159
789 Ga0453684_0057131 3300044712 Bacteria 5054
790 Ga0453684_0068319 3300044712 Bacteria 4513
791 Ga0453684_0115585 3300044712 Bacteria 3251
792 Ga0453684_0453084 3300044712 Bacteria 1428
793 Ga0453684_0826714 3300044712 Bacteria 997
794 Ga0453684_1051636 3300044712 Bacteria 863
795 Ga0466971_0005591 3300044719 Bacteria 5464
796 Ga0466971_0210930 3300044719 Bacteria 919
797 Ga0466968_0074808 3300044735 Bacteria 1479
798 Ga0466957_0018836 3300044842 Bacteria 4058
799 Ga0466957_0032113 3300044842 Bacteria 3142
800 Ga0466957_0089965 3300044842 Bacteria 1922
801 Ga0466959_0005151 3300045049 Bacteria 8908
802 Ga0466959_0394446 3300045049 Bacteria 941
803 Ga0451576_0005563 3300045051 Bacteria 15746
804 Ga0451576_0014134 3300045051 Bacteria 8895
805 Ga0451576_0089836 3300045051 Bacteria 3195
806 Ga0451576_0133154 3300045051 Bacteria 2591
807 Ga0451576_0136809 3300045051 Unclassified 2555
808 Ga0451576_0197868 3300045051 Bacteria 2099
809 Ga0451576_0234010 3300045051 Bacteria 1918
810 Ga0451576_0295492 3300045051 Bacteria 1694
811 Ga0451576_0405312 3300045051 Bacteria 1430
812 Ga0451576_0981182 3300045051 Bacteria 886
813 Ga0451576_1313476 3300045051 Unclassified 754
814 Ga0466958_0147698 3300045836 Bacteria 1482
815 Ga0466967_0004012 3300045976 Bacteria 9814
816 Ga0466967_0066862 3300045976 Bacteria 3204
817 Ga0466967_0194008 3300045976 Bacteria 1921
818 Ga0466967_0292381 3300045976 Bacteria 1566
819 Ga0466967_1300924 3300045976 Bacteria 724
820 Ga0495592_0020241 3300046454 Bacteria 5063
821 Ga0495592_0354454 3300046454 Bacteria 940
822 Ga0495629_0094572 3300046459 Bacteria 2085
823 Ga0495638_0020748 3300046460 Bacteria 4338
824 Ga0495651_0344850 3300046462 Bacteria 986
825 Ga0495650_0000029 3300046471 Bacteria 453466
826 Ga0495650_0046340 3300046471 Bacteria 1825
827 Ga0495580_0049804 3300046472 Bacteria 2963
828 Ga0495662_0000558 3300046476 Bacteria 17109
829 Ga0495664_0000393 3300046477 Bacteria 21384
830 Ga0495584_0197059 3300046491 Bacteria 1024
831 Ga0495585_0052689 3300046492 Bacteria 2253
832 Ga0495594_0122254 3300046499 Bacteria 1472
833 Ga0495583_0004795 3300046506 Bacteria 9484
834 Ga0495583_0026841 3300046506 Bacteria 2849
835 Ga0495618_0011586 3300046514 Bacteria 5349
836 Ga0495618_0536385 3300046514 Unclassified 702
837 Ga0495630_0005525 3300046517 Bacteria 8920
838 Ga0495630_0322750 3300046517 Bacteria 1180
839 Ga0495630_0839610 3300046517 Bacteria 701
840 Ga0495648_0255744 3300046524 Bacteria 843
841 Ga0495666_0020887 3300046526 Bacteria 3242
842 Ga0495652_0018394 3300046529 Bacteria 6232
843 Ga0495665_0039805 3300046531 Bacteria 2503
844 Ga0495665_0051775 3300046531 Bacteria 2174
845 Ga0495640_0001485 3300046533 Bacteria 18461
846 Ga0495640_0014441 3300046533 Bacteria 5977
847 Ga0495640_0029192 3300046533 Bacteria 3963
848 Ga0495621_0000338 3300046539 Bacteria 11428
849 Ga0495645_0003126 3300046543 Bacteria 11213
850 Ga0495622_0057169 3300046557 Bacteria 1809
851 Ga0495633_0042449 3300046558 Bacteria 2160
852 Ga0495668_0397965 3300046616 Bacteria 757
853 Ga0495634_0001637 3300046642 Bacteria 19490
854 Ga0495634_0024760 3300046642 Bacteria 4207
855 Ga0495634_0029021 3300046642 Bacteria 3834
856 Ga0495625_0006253 3300046660 Bacteria 10665
857 Ga0495635_0002416 3300046663 Bacteria 12732
858 Ga0495659_0052266 3300046664 Bacteria 1491
859 Ga0495588_0050508 3300046674 Bacteria 2140
860 Ga0495657_0008879 3300046675 Bacteria 7651
861 Ga0495657_0298977 3300046675 Bacteria 960
862 Ga0495623_0014264 3300046679 Bacteria 5148
863 Ga0495613_0006144 3300046689 Bacteria 8988
864 Ga0495613_0050039 3300046689 Bacteria 3083
865 Ga0495624_0003130 3300046690 Bacteria 12351
866 Ga0495624_0017004 3300046690 Bacteria 4888
867 Ga0495581_0113672 3300047315 Bacteria 1574
868 Ga0495581_0139900 3300047315 Unclassified 1412
869 Ga0495636_0259836 3300047318 Unclassified 805
870 Ga0495674_0002951 3300047319 Bacteria 16537
871 Ga0495674_0129785 3300047319 Bacteria 2124
872 Ga0495672_0035055 3300047320 Bacteria 3093
873 Ga0495676_0073566 3300047321 Bacteria 2620
874 Ga0495680_0101483 3300047322 Bacteria 2143
875 Ga0495683_0121315 3300047323 Bacteria 1240
876 Ga0495677_0011648 3300047445 Bacteria 3213
877 Ga0495684_0001554 3300047471 Bacteria 18387
878 Ga0495684_0028817 3300047471 Bacteria 4262
879 Ga0495684_0696552 3300047471 Bacteria 674
880 Ga0495686_0000147 3300047472 Bacteria 139008
881 Ga0495686_0001655 3300047472 Bacteria 23210
882 Ga0495686_0005626 3300047472 Bacteria 9833
883 Ga0495593_0142960 3300047673 Bacteria 1212
884 Ga0495593_0229689 3300047673 Bacteria 930
885 Ga0495602_0173812 3300048088 Bacteria 1669
886 Ga0495614_0208027 3300048089 Bacteria 887
887 Ga0496101_0242460 3300048904 Bacteria 1403
888 Ga0496104_0078128 3300048907 Bacteria 3154
889 Ga0496104_0132754 3300048907 Bacteria 2392
890 Ga0496104_0802887 3300048907 Bacteria 847
891 Ga0496105_0145579 3300048908 Bacteria 1948
892 Ga0496106_0153406 3300048909 Bacteria 1818
893 Ga0496109_0338427 3300048912 Bacteria 1421
894 Ga0496110_0165894 3300048913 Bacteria 2003
895 Ga0496110_1032687 3300048913 Unclassified 730
896 Ga0496112_0223885 3300048915 Unclassified 1837
897 Ga0496115_0262424 3300048918 Bacteria 1420
898 Ga0496118_0047204 3300048921 Bacteria 3341
899 Ga0496118_0073618 3300048921 Bacteria 2446
900 Ga0496118_0088640 3300048921 Bacteria 2139
901 Ga0496118_0379262 3300048921 Bacteria 742
902 Ga0496120_0275317 3300048923 Bacteria 780
903 Ga0496120_0361089 3300048923 Bacteria 650
904 Ga0496121_0000671 3300048924 Bacteria 63867
905 Ga0496121_0058623 3300048924 Bacteria 3181
906 Ga0496122_0007143 3300048925 Bacteria 12523
907 Ga0496123_0023691 3300048926 Bacteria 4691
908 Ga0496125_0030934 3300048928 Bacteria 4779
909 Ga0496125_0262713 3300048928 Bacteria 1081
910 Ga0496126_0013389 3300048929 Bacteria 8347
911 Ga0496126_0035580 3300048929 Bacteria 4666
912 Ga0495682_0012097 3300049460 Bacteria 3317
913 Ga0501290_000127 3300049513 Bacteria 11762
914 Ga0501291_000073 3300049514 Bacteria 11763
915 Ga0501292_000656 3300049515 Bacteria 4224
916 Ga0501293_000116 3300049516 Bacteria 5265
917 Ga0501295_000033 3300049518 Bacteria 13877
918 Ga0501296_001586 3300049519 Bacteria 2312
919 Ga0501297_000231 3300049520 Bacteria 5734
920 Ga0501299_007248 3300049522 Bacteria 1764
921 Ga0501301_000531 3300049524 Bacteria 2343
922 Ga0501302_000131 3300049525 Bacteria 3710
923 Ga0501303_000304 3300049526 Bacteria 4009
924 Ga0501031_0050714 3300049568 Bacteria 2703
925 Ga0501031_0064981 3300049568 Bacteria 2377
926 Ga0501032_0010146 3300049569 Bacteria 6798
927 Ga0501033_0002717 3300049570 Bacteria 14842
928 Ga0501033_0115002 3300049570 Bacteria 1955
929 Ga0501033_0123441 3300049570 Bacteria 1878
930 Ga0501034_0013551 3300049571 Bacteria 8392
931 Ga0501034_0013990 3300049571 Bacteria 8259
932 Ga0501036_0057816 3300049572 Bacteria 3285
933 Ga0501037_0048585 3300049573 Bacteria 3108
934 Ga0501038_0000648 3300049574 Bacteria 30905
935 Ga0501038_0430862 3300049574 Bacteria 1016
936 Ga0501039_0139968 3300049575 Bacteria 1901
937 Ga0501040_0119641 3300049576 Bacteria 1847
938 Ga0501042_0254784 3300049578 Bacteria 1266
939 Ga0501043_0044299 3300049579 Bacteria 3498
940 Ga0501046_0000498 3300049580 Bacteria 39183
941 Ga0501046_0267232 3300049580 Bacteria 1255
942 Ga0501047_0002363 3300049581 Bacteria 18041
943 Ga0501048_0025839 3300049582 Bacteria 4278
944 Ga0501068_0074176 3300049584 Bacteria 2079
945 Ga0501068_0241653 3300049584 Bacteria 1149
946 Ga0501072_0177584 3300049588 Bacteria 1698
947 Ga0501073_0009955 3300049589 Bacteria 6994
948 Ga0501075_0296176 3300049591 Unclassified 1232
949 Ga0501077_0440421 3300049593 Bacteria 834
950 Ga0501201_000711 3300049651 Bacteria 3114
951 Ga0501206_000679 3300049653 Bacteria 4134
952 Ga0501209_007531 3300049656 Bacteria 2094
953 Ga0501217_003614 3300049661 Bacteria 3133
954 Ga0501223_011372 3300049663 Bacteria 1786
955 Ga0501228_000754 3300049666 Bacteria 2163
956 Ga0501230_000458 3300049667 Bacteria 4033
957 Ga0501233_000630 3300049668 Bacteria 5752
958 Ga0501239_000120 3300049672 Bacteria 5245
959 Ga0501243_008412 3300049675 Bacteria 1589
960 Ga0501246_001039 3300049676 Bacteria 2084
961 Ga0501247_000206 3300049677 Bacteria 3929
962 Ga0501248_000294 3300049678 Bacteria 2570
963 Ga0501249_001011 3300049679 Bacteria 6041
964 Ga0501251_000884 3300049681 Bacteria 2753
965 Ga0501257_000648 3300049686 Bacteria 6930
966 Ga0501258_000554 3300049687 Bacteria 2595
967 Ga0501260_004679 3300049689 Bacteria 1270
968 Ga0501261_001701 3300049690 Bacteria 2700
969 Ga0501219_000199 3300049703 Bacteria 11152
970 Ga0501225_0041548 3300049705 Bacteria 1268
971 Ga0501229_000227 3300049706 Bacteria 6262
972 Ga0501234_000041 3300049707 Bacteria 14565
973 Ga0501245_001648 3300049708 Bacteria 2911
974 Ga0501079_0048518 3300049741 Bacteria 3276
975 Ga0501080_0004889 3300049742 Bacteria 11944
976 Ga0501080_0168729 3300049742 Bacteria 2019
977 Ga0501083_0362976 3300049744 Unclassified 942
978 Ga0501264_003294 3300049761 Bacteria 1470
979 Ga0501265_000322 3300049762 Bacteria 4981
980 Ga0501266_000188 3300049763 Bacteria 7865
981 Ga0501267_025178 3300049764 Bacteria 676
982 Ga0501271_009200 3300049768 Bacteria 1025
983 Ga0501272_000011 3300049769 Bacteria 12072
984 Ga0501273_001280 3300049770 Bacteria 2357
985 Ga0501274_000050 3300049771 Bacteria 6776
986 Ga0501276_000206 3300049773 Bacteria 3273
987 Ga0501278_001024 3300049774 Bacteria 2025
988 Ga0501279_001327 3300049775 Bacteria 3252
989 Ga0501283_000138 3300049779 Bacteria 9191
990 Ga0501035_0003773 3300049822 Bacteria 14438
991 Ga0501035_0197667 3300049822 Bacteria 1726
992 Ga0501044_0015480 3300049823 Bacteria 8214
993 Ga0501044_0044484 3300049823 Bacteria 4607
994 Ga0501044_0642057 3300049823 Bacteria 951
995 Ga0501045_0169436 3300049824 Bacteria 1626
996 Ga0501212_000330 3300049851 Bacteria 4412
997 nmdc:mga0k408_244614_c1 3300050493 Unclassified 1071
998 nmdc:mga05p37_104050_c1 3300050507 Bacteria 3493
999 nmdc:mga05p37_12082_c1 3300050507 Bacteria 10307
1000 nmdc:mga05p37_9949_c1 3300050507 Bacteria 11293
1001 nmdc:mga09592_192642_c1 3300050508 Bacteria 1765
1002 nmdc:mga09592_51000_c1 3300050508 Bacteria 3491
1003 nmdc:mga0qj67_32357_c1 3300050509 Bacteria 4078
1004 nmdc:mga0qj67_8496_c1 3300050509 Bacteria 7621
1005 nmdc:mga06r32_141730_c1 3300050510 Bacteria 2380
1006 nmdc:mga06r32_2306_c1 3300050510 Bacteria 17073
1007 nmdc:mga08y16_27834_c1 3300050511 Bacteria 5958
1008 nmdc:mga0n895_13540_c1 3300050512 Bacteria 7366
1009 nmdc:mga0n895_97777_c1 3300050512 Bacteria 1487
1010 nmdc:mga0rr50_109047_c1 3300050513 Bacteria 2188
1011 nmdc:mga0rr50_840255_c1 3300050513 Unclassified 783
1012 nmdc:mga08x19_109179_c1 3300050514 Bacteria 1844
1013 nmdc:mga08x19_120691_c1 3300050514 Bacteria 1757
1014 nmdc:mga08x19_75755_c1 3300050514 Bacteria 2200
1015 nmdc:mga08x19_96045_c1 3300050514 Bacteria 1961
1016 nmdc:mga0a205_11730_c1 3300050515 Bacteria 8085
1017 nmdc:mga0a205_201295_c1 3300050515 Bacteria 1882
1018 nmdc:mga0a205_70062_c1 3300050515 Bacteria 3385
1019 nmdc:mga0a205_777_c1 3300050515 Bacteria 25858
1020 nmdc:mga0a205_9958_c1 3300050515 Bacteria 8721
1021 Ga0495601_0001800 3300053077 Bacteria 11897
1022 Ga0495601_0073634 3300053077 Bacteria 2184
1023 Ga0495601_0314731 3300053077 Bacteria 1019
1024 Ga0495612_0000118 3300053078 Bacteria 33388
1025 Ga0495619_0002839 3300053085 Bacteria 11284
1026 Ga0500643_004736 3300053087 Bacteria 6044
1027 Ga0500643_010897 3300053087 Bacteria 3354
1028 Ga0500643_016789 3300053087 Bacteria 2470
1029 Ga0500651_0000008 3300053093 Bacteria 287738
1030 Ga0500559_0133033 3300053136 Bacteria 1162
1031 Ga0500559_0144777 3300053136 Bacteria 1114
1032 Ga0500573_0261208 3300053140 Bacteria 887
1033 Ga0500616_0000008 3300053153 Bacteria 785239
1034 Ga0501084_0036726 3300054114 Bacteria 4093
1035 Ga0587111_0049596 3300060346 Bacteria 922
1036 Ga0501082_0473075 3300060353 Unclassified 1095
1037 Ga0466962_0003999 3300061719 Bacteria 7057
1038 Ga0530510_0068874 3300061734 Bacteria 2567

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300034820 Ga0373959_0061410 Ga0373959_0061410_59_646 165
2 3300045051 Ga0451576_0136809 Ga0451576_0136809_22_588 169
3 3300042993 Ga0439440_0154462 Ga0439440_0154462_129_647 171
4 3300028381 Ga0268264_10039724 Ga0268264_100397245 177
5 3300045976 Ga0466967_1300924 Ga0466967_1300924_22_567 180
6 3300049764 Ga0501267_025178 Ga0501267_025178_117_662 180
7 3300026078 Ga0207702_10894447 Ga0207702_108944471 181
8 3300048913 Ga0496110_0165894 Ga0496110_0165894_1148_1702 182
9 3300005440 Ga0070705_100714401 Ga0070705_1007144011 184
10 3300046514 Ga0495618_0536385 Ga0495618_0536385_101_682 184
11 3300009176 Ga0105242_10152312 Ga0105242_101523122 185
12 3300009545 Ga0105237_10705893 Ga0105237_107058931 185
13 3300009174 Ga0105241_10183356 Ga0105241_101833562 187
14 3300048923 Ga0496120_0361089 Ga0496120_0361089_12_584 190
15 3300005530 Ga0070679_100029563 Ga0070679_1000295635 191
16 3300005563 Ga0068855_100501393 Ga0068855_1005013931 191
17 3300013104 Ga0157370_10009337 Ga0157370_1000933711 191
18 3300025912 Ga0207707_10014069 Ga0207707_100140699 191
19 3300025917 Ga0207660_10039228 Ga0207660_100392284 191
20 3300046517 Ga0495630_0839610 Ga0495630_0839610_17_601 192
21 3300005467 Ga0070706_100141818 Ga0070706_1001418182 193
22 3300025885 Ga0207653_10019781 Ga0207653_100197812 193
23 3300002075 JGI24738J21930_10024866 JGI24738J21930_100248662 194
24 3300005339 Ga0070660_100533940 Ga0070660_1005339401 194
25 3300005455 Ga0070663_100005903 Ga0070663_1000059035 194
26 3300005539 Ga0068853_100183011 Ga0068853_1001830112 194
27 3300005578 Ga0068854_100000874 Ga0068854_10000087417 194
28 3300006237 Ga0097621_100291482 Ga0097621_1002914822 194
29 3300006358 Ga0068871_100099478 Ga0068871_1000994783 194
30 3300009174 Ga0105241_10125412 Ga0105241_101254122 194
31 3300009177 Ga0105248_10157103 Ga0105248_101571033 194
32 3300009551 Ga0105238_10117902 Ga0105238_101179023 194
33 3300010375 Ga0105239_10020412 Ga0105239_100204126 194
34 3300013100 Ga0157373_10032985 Ga0157373_100329853 194
35 3300013296 Ga0157374_10088416 Ga0157374_100884162 194
36 3300025911 Ga0207654_10077432 Ga0207654_100774321 194
37 3300025919 Ga0207657_10470177 Ga0207657_104701771 194
38 3300025924 Ga0207694_10179118 Ga0207694_101791182 194
39 3300025941 Ga0207711_10134897 Ga0207711_101348973 194
40 3300025981 Ga0207640_10007482 Ga0207640_100074824 194
41 3300026041 Ga0207639_10377459 Ga0207639_103774592 194
42 3300026067 Ga0207678_10003120 Ga0207678_1000312013 194
43 3300031249 Ga0265339_10075185 Ga0265339_100751852 194
44 3300031712 Ga0265342_10128427 Ga0265342_101284272 194
45 3300037471 Ga0395905_0044827 Ga0395905_0044827_3254_3883 194
46 3300044673 Ga0453683_0623103 Ga0453683_0623103_67_687 194
47 3300005328 Ga0070676_10000104 Ga0070676_1000010419 195
48 3300005334 Ga0068869_100001148 Ga0068869_10000114812 195
49 3300005338 Ga0068868_100000073 Ga0068868_10000007342 195
50 3300005364 Ga0070673_100000047 Ga0070673_10000004719 195
51 3300005459 Ga0068867_100000119 Ga0068867_10000011933 195
52 3300005543 Ga0070672_100144460 Ga0070672_1001444602 195
53 3300006881 Ga0068865_100000005 Ga0068865_100000005206 195
54 3300009098 Ga0105245_10000281 Ga0105245_1000028116 195
55 3300009148 Ga0105243_10000411 Ga0105243_1000041125 195
56 3300009176 Ga0105242_10001969 Ga0105242_1000196916 195
57 3300011119 Ga0105246_10067482 Ga0105246_100674822 195
58 3300013105 Ga0157369_10068459 Ga0157369_100684593 195
59 3300013296 Ga0157374_10001017 Ga0157374_1000101713 195
60 3300013297 Ga0157378_10001127 Ga0157378_1000112713 195
61 3300013308 Ga0157375_10002160 Ga0157375_100021602 195
62 3300014745 Ga0157377_10030512 Ga0157377_100305122 195
63 3300014969 Ga0157376_10002783 Ga0157376_100027838 195
64 3300025907 Ga0207645_10001707 Ga0207645_100017073 195
65 3300025927 Ga0207687_10001504 Ga0207687_100015042 195
66 3300025934 Ga0207686_10007878 Ga0207686_100078784 195
67 3300025935 Ga0207709_10000051 Ga0207709_1000005119 195
68 3300025938 Ga0207704_10000001 Ga0207704_10000001221 195
69 3300025940 Ga0207691_10406462 Ga0207691_104064621 195
70 3300025942 Ga0207689_10001171 Ga0207689_100011712 195
71 3300025960 Ga0207651_10000006 Ga0207651_1000000618 195
72 3300025961 Ga0207712_10022826 Ga0207712_100228263 195
73 3300026023 Ga0207677_10000156 Ga0207677_1000015618 195
74 3300026089 Ga0207648_10000363 Ga0207648_1000036333 195
75 3300005327 Ga0070658_10061244 Ga0070658_100612444 196
76 3300005336 Ga0070680_100417852 Ga0070680_1004178522 196
77 3300005366 Ga0070659_100339597 Ga0070659_1003395972 196
78 3300025917 Ga0207660_10278545 Ga0207660_102785452 196
79 3300025919 Ga0207657_10002404 Ga0207657_100024043 196
80 3300025932 Ga0207690_10225916 Ga0207690_102259162 196
81 3300044673 Ga0453683_0050864 Ga0453683_0050864_1381_2028 196
82 3300044712 Ga0453684_0453084 Ga0453684_0453084_295_942 196
83 3300048921 Ga0496118_0088640 Ga0496118_0088640_222_854 196
84 3300048925 Ga0496122_0007143 Ga0496122_0007143_11843_12475 196
85 3300048926 Ga0496123_0023691 Ga0496123_0023691_3535_4167 196
86 3300048928 Ga0496125_0262713 Ga0496125_0262713_104_736 196
87 3300050507 nmdc:mga05p37_104050_c1 nmdc:mga05p37_104050_c1_1815_2480 196
88 3300039437 Ga0436365_0049975 Ga0436365_0049975_79_690 198
89 3300005327 Ga0070658_10000010 Ga0070658_10000010191 199
90 3300005518 Ga0070699_100300786 Ga0070699_1003007862 199
91 3300005546 Ga0070696_100121612 Ga0070696_1001216122 199
92 3300006914 Ga0075436_100138760 Ga0075436_1001387602 199
93 3300025909 Ga0207705_10000016 Ga0207705_10000016257 199
94 3300046471 Ga0495650_0000029 Ga0495650_0000029_215540_216178 199
95 3300050514 nmdc:mga08x19_120691_c1 nmdc:mga08x19_120691_c1_866_1492 199
96 3300053087 Ga0500643_016789 Ga0500643_016789_1161_1799 199
97 3300053136 Ga0500559_0144777 Ga0500559_0144777_329_964 199
98 3300005327 Ga0070658_10644503 Ga0070658_106445031 200
99 3300005455 Ga0070663_100013623 Ga0070663_1000136235 200
100 3300005563 Ga0068855_100005375 Ga0068855_10000537511 200
101 3300025254 Ga0209148_1002133 Ga0209148_10021334 200
102 3300025272 Ga0209455_1000467 Ga0209455_100046722 200
103 3300025949 Ga0207667_10016129 Ga0207667_100161295 200
104 3300026067 Ga0207678_10030569 Ga0207678_100305694 200
105 3300031456 Ga0307513_10032360 Ga0307513_100323603 200
106 3300033180 Ga0307510_10001934 Ga0307510_1000193417 200
107 3300038443 Ga0395901_0946633 Ga0395901_0946633_54_695 200
108 3300046460 Ga0495638_0020748 Ga0495638_0020748_2448_3074 200
109 3300046506 Ga0495583_0004795 Ga0495583_0004795_4839_5465 200
110 3300046524 Ga0495648_0255744 Ga0495648_0255744_104_730 200
111 3300046660 Ga0495625_0006253 Ga0495625_0006253_4827_5453 200
112 3300047445 Ga0495677_0011648 Ga0495677_0011648_1676_2302 200
113 3300048923 Ga0496120_0275317 Ga0496120_0275317_80_715 200
114 3300053087 Ga0500643_004736 Ga0500643_004736_5203_5829 200
115 3300053136 Ga0500559_0133033 Ga0500559_0133033_379_1005 200
116 3300003214 JGI25165J46597_1000023 JGI25165J46597_1000023257 201
117 3300005327 Ga0070658_10011417 Ga0070658_100114175 201
118 3300005468 Ga0070707_100265752 Ga0070707_1002657522 201
119 3300005471 Ga0070698_100005990 Ga0070698_1000059909 201
120 3300005614 Ga0068856_100161800 Ga0068856_1001618001 201
121 3300011119 Ga0105246_10080107 Ga0105246_100801071 201
122 3300013104 Ga0157370_10000611 Ga0157370_1000061121 201
123 3300013105 Ga0157369_10680569 Ga0157369_106805692 201
124 3300013307 Ga0157372_10185877 Ga0157372_101858774 201
125 3300025231 Ga0207427_101709 Ga0207427_1017095 201
126 3300025261 Ga0209233_1000003 Ga0209233_10000031094 201
127 3300025909 Ga0207705_10000046 Ga0207705_10000046144 201
128 3300025913 Ga0207695_10030170 Ga0207695_100301702 201
129 3300026078 Ga0207702_10017599 Ga0207702_100175993 201
130 3300037312 Ga0395899_0005273 Ga0395899_0005273_3332_3964 201
131 3300037418 Ga0395900_0144526 Ga0395900_0144526_1368_2000 201
132 3300044693 Ga0466961_0038286 Ga0466961_0038286_2160_2801 201
133 3300046616 Ga0495668_0397965 Ga0495668_0397965_106_744 201
134 3300049568 Ga0501031_0064981 Ga0501031_0064981_99_737 201
135 3300049569 Ga0501032_0010146 Ga0501032_0010146_3992_4630 201
136 3300049570 Ga0501033_0002717 Ga0501033_0002717_9698_10336 201
137 3300049571 Ga0501034_0013551 Ga0501034_0013551_2334_2972 201
138 3300049572 Ga0501036_0057816 Ga0501036_0057816_1254_1892 201
139 3300049573 Ga0501037_0048585 Ga0501037_0048585_1902_2540 201
140 3300049574 Ga0501038_0000648 Ga0501038_0000648_7503_8141 201
141 3300049579 Ga0501043_0044299 Ga0501043_0044299_1503_2141 201
142 3300049580 Ga0501046_0000498 Ga0501046_0000498_1255_1893 201
143 3300049581 Ga0501047_0002363 Ga0501047_0002363_16217_16855 201
144 3300049584 Ga0501068_0241653 Ga0501068_0241653_47_685 201
145 3300049589 Ga0501073_0009955 Ga0501073_0009955_4442_5080 201
146 3300049742 Ga0501080_0168729 Ga0501080_0168729_582_1220 201
147 3300049822 Ga0501035_0003773 Ga0501035_0003773_4103_4741 201
148 3300049823 Ga0501044_0015480 Ga0501044_0015480_778_1416 201
149 3300005468 Ga0070707_100791006 Ga0070707_1007910062 202
150 3300025941 Ga0207711_10010970 Ga0207711_100109708 202
151 3300045051 Ga0451576_0089836 Ga0451576_0089836_645_1268 202
152 iso_pu_bacteria 2895395659 2895398484 202
153 3300005471 Ga0070698_100000654 Ga0070698_10000065421 203
154 3300005518 Ga0070699_100007860 Ga0070699_1000078602 203
155 3300014325 Ga0163163_11510263 Ga0163163_115102631 203
156 3300025910 Ga0207684_10756118 Ga0207684_107561181 203
157 3300031250 Ga0265331_10021149 Ga0265331_100211492 203
158 3300031251 Ga0265327_10014068 Ga0265327_100140682 203
159 3300032005 Ga0307411_10105380 Ga0307411_101053802 203
160 3300045049 Ga0466959_0005151 Ga0466959_0005151_3675_4313 203
161 3300045051 Ga0451576_0981182 Ga0451576_0981182_222_845 203
162 3300005327 Ga0070658_10001110 Ga0070658_100011102 204
163 3300005329 Ga0070683_100122814 Ga0070683_1001228142 204
164 3300005337 Ga0070682_100299018 Ga0070682_1002990181 204
165 3300005354 Ga0070675_100101571 Ga0070675_1001015712 204
166 3300005365 Ga0070688_100380416 Ga0070688_1003804162 204
167 3300005458 Ga0070681_10022448 Ga0070681_100224484 204
168 3300005458 Ga0070681_10067584 Ga0070681_100675842 204
169 3300005458 Ga0070681_10136893 Ga0070681_101368931 204
170 3300005530 Ga0070679_100034244 Ga0070679_1000342444 204
171 3300005530 Ga0070679_100162689 Ga0070679_1001626892 204
172 3300005563 Ga0068855_100088628 Ga0068855_1000886284 204
173 3300005577 Ga0068857_100240030 Ga0068857_1002400302 204
174 3300005614 Ga0068856_100200125 Ga0068856_1002001253 204
175 3300006237 Ga0097621_100506732 Ga0097621_1005067322 204
176 3300009093 Ga0105240_11393867 Ga0105240_113938671 204
177 3300010375 Ga0105239_10058747 Ga0105239_100587472 204
178 3300013296 Ga0157374_10074484 Ga0157374_100744842 204
179 3300013307 Ga0157372_10091083 Ga0157372_100910832 204
180 3300021388 Ga0213875_10004572 Ga0213875_100045725 204
181 3300025909 Ga0207705_10001249 Ga0207705_1000124919 204
182 3300025912 Ga0207707_10057911 Ga0207707_100579112 204
183 3300025912 Ga0207707_10058144 Ga0207707_100581442 204
184 3300025912 Ga0207707_10063990 Ga0207707_100639902 204
185 3300025921 Ga0207652_10025526 Ga0207652_100255262 204
186 3300025921 Ga0207652_10032239 Ga0207652_100322393 204
187 3300025921 Ga0207652_10154919 Ga0207652_101549193 204
188 3300025926 Ga0207659_10257686 Ga0207659_102576862 204
189 3300025944 Ga0207661_10096868 Ga0207661_100968683 204
190 3300025949 Ga0207667_10071697 Ga0207667_100716971 204
191 3300026041 Ga0207639_10863330 Ga0207639_108633301 204
192 3300026088 Ga0207641_10914630 Ga0207641_109146302 204
193 3300026116 Ga0207674_10270278 Ga0207674_102702782 204
194 3300026116 Ga0207674_10297320 Ga0207674_102973202 204
195 3300026121 Ga0207683_10142336 Ga0207683_101423362 204
196 3300031239 Ga0265328_10000002 Ga0265328_10000002206 204
197 3300031507 Ga0307509_10183477 Ga0307509_101834772 204
198 3300031665 Ga0316575_10042091 Ga0316575_100420912 204
199 3300031711 Ga0265314_10114606 Ga0265314_101146062 204
200 3300037853 Ga0436364_1290526 Ga0436364_1290526_3960_4574 204
201 3300039447 Ga0436361_0090086 Ga0436361_0090086_593_1252 204
202 3300039450 Ga0436363_0661182 Ga0436363_0661182_636_1292 204
203 3300045049 Ga0466959_0394446 Ga0466959_0394446_141_797 204
204 3300046454 Ga0495592_0354454 Ga0495592_0354454_85_732 204
205 3300046462 Ga0495651_0344850 Ga0495651_0344850_152_799 204
206 3300046675 Ga0495657_0298977 Ga0495657_0298977_277_924 204
207 3300046679 Ga0495623_0014264 Ga0495623_0014264_3168_3815 204
208 3300046689 Ga0495613_0050039 Ga0495613_0050039_2399_3061 204
209 3300048918 Ga0496115_0262424 Ga0496115_0262424_463_1128 204
210 3300005335 Ga0070666_10368401 Ga0070666_103684011 205
211 3300005355 Ga0070671_100003495 Ga0070671_1000034957 205
212 3300005444 Ga0070694_100181065 Ga0070694_1001810652 205
213 3300005458 Ga0070681_10401611 Ga0070681_104016112 205
214 3300006173 Ga0070716_100235405 Ga0070716_1002354052 205
215 3300006914 Ga0075436_100452430 Ga0075436_1004524301 205
216 3300013307 Ga0157372_10180790 Ga0157372_101807903 205
217 3300014326 Ga0157380_10037236 Ga0157380_100372365 205
218 3300021388 Ga0213875_10018387 Ga0213875_100183873 205
219 3300025931 Ga0207644_10000772 Ga0207644_100007727 205
220 3300025939 Ga0207665_10234380 Ga0207665_102343802 205
221 3300026088 Ga0207641_10054302 Ga0207641_100543024 205
222 3300037312 Ga0395899_0007715 Ga0395899_0007715_4109_4729 205
223 3300037312 Ga0395899_0058990 Ga0395899_0058990_987_1607 205
224 3300037418 Ga0395900_0003899 Ga0395900_0003899_11776_12396 205
225 3300037418 Ga0395900_0004815 Ga0395900_0004815_1847_2467 205
226 3300037418 Ga0395900_0163403 Ga0395900_0163403_445_1065 205
227 3300037418 Ga0395900_0769407 Ga0395900_0769407_124_744 205
228 3300037466 Ga0395898_0035276 Ga0395898_0035276_2561_3181 205
229 3300037466 Ga0395898_0078853 Ga0395898_0078853_2117_2737 205
230 3300037853 Ga0436364_1505222 Ga0436364_1505222_2310_2936 205
231 3300038443 Ga0395901_0104521 Ga0395901_0104521_446_1066 205
232 3300039450 Ga0436363_1471237 Ga0436363_1471237_2381_3007 205
233 3300039453 Ga0436362_0591404 Ga0436362_0591404_921_1547 205
234 3300042876 Ga0451577_0000051 Ga0451577_0000051_34030_34683 205
235 3300044712 Ga0453684_0015307 Ga0453684_0015307_6603_7277 205
236 3300044712 Ga0453684_0057131 Ga0453684_0057131_2957_3610 205
237 3300044712 Ga0453684_1051636 Ga0453684_1051636_143_769 205
238 3300044842 Ga0466957_0089965 Ga0466957_0089965_85_702 205
239 3300045976 Ga0466967_0292381 Ga0466967_0292381_773_1399 205
240 iso_pu_bacteria 2884215851 2884216688 205
241 iso_pu_bacteria 2928027323 2928030697 205
242 iso_pu_bacteria 2984555340 2984557175 205
243 iso_pu_bacteria 2984564862 2984568458 205
244 iso_pu_bacteria 2993356040 2993359509 205
245 3300005295 Ga0065707_10178805 Ga0065707_101788052 206
246 3300005366 Ga0070659_100410270 Ga0070659_1004102701 206
247 3300005471 Ga0070698_100041365 Ga0070698_1000413652 206
248 3300005518 Ga0070699_100000005 Ga0070699_100000005222 206
249 3300005539 Ga0068853_100014923 Ga0068853_1000149233 206
250 3300006844 Ga0075428_100824092 Ga0075428_1008240922 206
251 3300006846 Ga0075430_100006526 Ga0075430_10000652610 206
252 3300006852 Ga0075433_10008862 Ga0075433_100088623 206
253 3300006852 Ga0075433_10115992 Ga0075433_101159922 206
254 3300006871 Ga0075434_100097005 Ga0075434_1000970051 206
255 3300009147 Ga0114129_10012148 Ga0114129_100121482 206
256 3300009147 Ga0114129_10830192 Ga0114129_108301922 206
257 3300013100 Ga0157373_10042767 Ga0157373_100427675 206
258 3300015261 Ga0182006_1020670 Ga0182006_10206705 206
259 3300025919 Ga0207657_10233401 Ga0207657_102334012 206
260 3300025932 Ga0207690_10010111 Ga0207690_100101118 206
261 3300026041 Ga0207639_10098449 Ga0207639_100984494 206
262 3300026116 Ga0207674_10540119 Ga0207674_105401192 206
263 3300031251 Ga0265327_10002507 Ga0265327_1000250717 206
264 3300031251 Ga0265327_10039801 Ga0265327_100398011 206
265 3300031344 Ga0265316_10175048 Ga0265316_101750482 206
266 3300035170 Ga0373943_0060351 Ga0373943_0060351_453_1076 206
267 3300035724 Ga0373933_0086789 Ga0373933_0086789_1083_1703 206
268 3300036401 Ga0373937_0488410 Ga0373937_0488410_185_805 206
269 3300036401 Ga0373937_0580775 Ga0373937_0580775_121_744 206
270 3300037068 Ga0373925_0509873 Ga0373925_0509873_106_729 206
271 3300037418 Ga0395900_0183595 Ga0395900_0183595_205_825 206
272 3300038443 Ga0395901_0000594 Ga0395901_0000594_39756_40376 206
273 3300042876 Ga0451577_0000003 Ga0451577_0000003_383557_384195 206
274 3300042876 Ga0451577_0019556 Ga0451577_0019556_388_1044 206
275 3300042876 Ga0451577_0107254 Ga0451577_0107254_1145_1801 206
276 3300042876 Ga0451577_0279404 Ga0451577_0279404_861_1499 206
277 3300044673 Ga0453683_0006913 Ga0453683_0006913_4913_5533 206
278 3300044673 Ga0453683_0015820 Ga0453683_0015820_2664_3320 206
279 3300044673 Ga0453683_0210673 Ga0453683_0210673_165_821 206
280 3300044673 Ga0453683_0275321 Ga0453683_0275321_86_742 206
281 3300044712 Ga0453684_0000042 Ga0453684_0000042_257146_257772 206
282 3300044712 Ga0453684_0068319 Ga0453684_0068319_554_1210 206
283 3300045051 Ga0451576_0014134 Ga0451576_0014134_6917_7573 206
284 3300045051 Ga0451576_0133154 Ga0451576_0133154_49_705 206
285 3300045051 Ga0451576_0197868 Ga0451576_0197868_986_1642 206
286 3300045051 Ga0451576_0295492 Ga0451576_0295492_114_746 206
287 3300049574 Ga0501038_0430862 Ga0501038_0430862_367_1002 206
288 3300050513 nmdc:mga0rr50_840255_c1 nmdc:mga0rr50_840255_c1_70_708 206
289 3300050515 nmdc:mga0a205_9958_c1 nmdc:mga0a205_9958_c1_4937_5557 206
290 3300053153 Ga0500616_0000008 Ga0500616_0000008_643155_643787 206
291 3300005440 Ga0070705_100394558 Ga0070705_1003945582 207
292 3300005445 Ga0070708_100053670 Ga0070708_1000536703 207
293 3300005467 Ga0070706_100162916 Ga0070706_1001629163 207
294 3300005536 Ga0070697_100005515 Ga0070697_1000055156 207
295 3300005546 Ga0070696_100004259 Ga0070696_1000042591 207
296 3300025929 Ga0207664_10516174 Ga0207664_105161742 207
297 3300025937 Ga0207669_10026342 Ga0207669_100263422 207
298 3300025941 Ga0207711_10007869 Ga0207711_100078692 207
299 3300031251 Ga0265327_10097074 Ga0265327_100970741 207
300 3300037068 Ga0373925_0261445 Ga0373925_0261445_591_1229 207
301 3300039437 Ga0436365_1548123 Ga0436365_1548123_269_892 207
302 3300039453 Ga0436362_0141115 Ga0436362_0141115_1217_1840 207
303 3300046675 Ga0495657_0008879 Ga0495657_0008879_6551_7189 207
304 3300047322 Ga0495680_0101483 Ga0495680_0101483_762_1400 207
305 3300048089 Ga0495614_0208027 Ga0495614_0208027_221_859 207
306 3300048928 Ga0496125_0030934 Ga0496125_0030934_4088_4753 207
307 3300053087 Ga0500643_010897 Ga0500643_010897_1246_1869 207
308 3300053140 Ga0500573_0261208 Ga0500573_0261208_28_654 207
309 3300001990 JGI24737J22298_10035281 JGI24737J22298_100352811 208
310 3300002067 JGI24735J21928_10011016 JGI24735J21928_100110163 208
311 3300005289 Ga0065704_10082883 Ga0065704_100828832 208
312 3300005293 Ga0065715_10018369 Ga0065715_100183692 208
313 3300005295 Ga0065707_10083298 Ga0065707_100832988 208
314 3300005327 Ga0070658_10017036 Ga0070658_100170362 208
315 3300005327 Ga0070658_10058839 Ga0070658_100588392 208
316 3300005327 Ga0070658_10472471 Ga0070658_104724711 208
317 3300005328 Ga0070676_10005496 Ga0070676_100054967 208
318 3300005329 Ga0070683_100081574 Ga0070683_1000815743 208
319 3300005329 Ga0070683_100593170 Ga0070683_1005931702 208
320 3300005330 Ga0070690_100000347 Ga0070690_10000034714 208
321 3300005330 Ga0070690_100002465 Ga0070690_10000246510 208
322 3300005330 Ga0070690_100019596 Ga0070690_1000195962 208
323 3300005331 Ga0070670_100094759 Ga0070670_1000947592 208
324 3300005331 Ga0070670_100288284 Ga0070670_1002882842 208
325 3300005333 Ga0070677_10003087 Ga0070677_100030877 208
326 3300005334 Ga0068869_100027201 Ga0068869_1000272012 208
327 3300005334 Ga0068869_100206486 Ga0068869_1002064862 208
328 3300005336 Ga0070680_100001484 Ga0070680_1000014842 208
329 3300005336 Ga0070680_100010569 Ga0070680_1000105692 208
330 3300005336 Ga0070680_100473280 Ga0070680_1004732801 208
331 3300005337 Ga0070682_100109549 Ga0070682_1001095492 208
332 3300005337 Ga0070682_100578953 Ga0070682_1005789531 208
333 3300005339 Ga0070660_100001591 Ga0070660_1000015912 208
334 3300005339 Ga0070660_100008686 Ga0070660_1000086862 208
335 3300005340 Ga0070689_100000037 Ga0070689_10000003725 208
336 3300005340 Ga0070689_100001740 Ga0070689_1000017402 208
337 3300005340 Ga0070689_100656150 Ga0070689_1006561501 208
338 3300005341 Ga0070691_10004779 Ga0070691_100047792 208
339 3300005343 Ga0070687_100004347 Ga0070687_1000043477 208
340 3300005344 Ga0070661_100139136 Ga0070661_1001391362 208
341 3300005344 Ga0070661_100223159 Ga0070661_1002231592 208
342 3300005345 Ga0070692_10002936 Ga0070692_100029366 208
343 3300005345 Ga0070692_10136461 Ga0070692_101364612 208
344 3300005347 Ga0070668_100114637 Ga0070668_1001146372 208
345 3300005353 Ga0070669_100011872 Ga0070669_1000118722 208
346 3300005356 Ga0070674_100003796 Ga0070674_1000037962 208
347 3300005364 Ga0070673_100006972 Ga0070673_1000069728 208
348 3300005364 Ga0070673_100666738 Ga0070673_1006667381 208
349 3300005365 Ga0070688_100000176 Ga0070688_10000017616 208
350 3300005365 Ga0070688_100107882 Ga0070688_1001078821 208
351 3300005365 Ga0070688_100758418 Ga0070688_1007584181 208
352 3300005367 Ga0070667_100056577 Ga0070667_1000565775 208
353 3300005434 Ga0070709_10324365 Ga0070709_103243652 208
354 3300005437 Ga0070710_10069362 Ga0070710_100693622 208
355 3300005438 Ga0070701_10000079 Ga0070701_1000007914 208
356 3300005440 Ga0070705_100011424 Ga0070705_1000114246 208
357 3300005440 Ga0070705_100059492 Ga0070705_1000594922 208
358 3300005441 Ga0070700_100000334 Ga0070700_10000033421 208
359 3300005441 Ga0070700_100103673 Ga0070700_1001036732 208
360 3300005444 Ga0070694_100022341 Ga0070694_1000223416 208
361 3300005444 Ga0070694_100175669 Ga0070694_1001756692 208
362 3300005444 Ga0070694_100574632 Ga0070694_1005746321 208
363 3300005445 Ga0070708_100873390 Ga0070708_1008733901 208
364 3300005455 Ga0070663_100010199 Ga0070663_1000101997 208
365 3300005455 Ga0070663_100076604 Ga0070663_1000766042 208
366 3300005455 Ga0070663_100222644 Ga0070663_1002226442 208
367 3300005456 Ga0070678_100000915 Ga0070678_10000091516 208
368 3300005457 Ga0070662_100001269 Ga0070662_1000012692 208
369 3300005458 Ga0070681_10023191 Ga0070681_100231912 208
370 3300005458 Ga0070681_10074256 Ga0070681_100742562 208
371 3300005459 Ga0068867_100000402 Ga0068867_1000004022 208
372 3300005459 Ga0068867_100003137 Ga0068867_10000313711 208
373 3300005459 Ga0068867_100610739 Ga0068867_1006107392 208
374 3300005466 Ga0070685_10000066 Ga0070685_100000667 208
375 3300005468 Ga0070707_100000072 Ga0070707_10000007288 208
376 3300005468 Ga0070707_100235707 Ga0070707_1002357072 208
377 3300005471 Ga0070698_100124329 Ga0070698_1001243292 208
378 3300005518 Ga0070699_100167110 Ga0070699_1001671103 208
379 3300005518 Ga0070699_100227953 Ga0070699_1002279532 208
380 3300005530 Ga0070679_100452016 Ga0070679_1004520162 208
381 3300005530 Ga0070679_100520102 Ga0070679_1005201021 208
382 3300005535 Ga0070684_100156619 Ga0070684_1001566192 208
383 3300005535 Ga0070684_100360872 Ga0070684_1003608722 208
384 3300005536 Ga0070697_100010394 Ga0070697_1000103941 208
385 3300005543 Ga0070672_100028473 Ga0070672_1000284733 208
386 3300005544 Ga0070686_100000072 Ga0070686_10000007253 208
387 3300005544 Ga0070686_100001120 Ga0070686_10000112013 208
388 3300005544 Ga0070686_100052555 Ga0070686_1000525552 208
389 3300005544 Ga0070686_100153962 Ga0070686_1001539622 208
390 3300005545 Ga0070695_100001295 Ga0070695_10000129515 208
391 3300005545 Ga0070695_100117864 Ga0070695_1001178642 208
392 3300005545 Ga0070695_100515902 Ga0070695_1005159022 208
393 3300005546 Ga0070696_100004964 Ga0070696_1000049649 208
394 3300005546 Ga0070696_100082144 Ga0070696_1000821442 208
395 3300005547 Ga0070693_100007294 Ga0070693_1000072942 208
396 3300005547 Ga0070693_100079033 Ga0070693_1000790332 208
397 3300005548 Ga0070665_100080652 Ga0070665_1000806522 208
398 3300005549 Ga0070704_100057938 Ga0070704_1000579385 208
399 3300005549 Ga0070704_100063948 Ga0070704_1000639481 208
400 3300005563 Ga0068855_100454905 Ga0068855_1004549052 208
401 3300005563 Ga0068855_100533080 Ga0068855_1005330802 208
402 3300005564 Ga0070664_100000873 Ga0070664_1000008733 208
403 3300005564 Ga0070664_100003255 Ga0070664_1000032559 208
404 3300005577 Ga0068857_100053911 Ga0068857_1000539113 208
405 3300005577 Ga0068857_100113923 Ga0068857_1001139232 208
406 3300005578 Ga0068854_100011675 Ga0068854_1000116752 208
407 3300005615 Ga0070702_100004518 Ga0070702_1000045183 208
408 3300005615 Ga0070702_100033964 Ga0070702_1000339643 208
409 3300005617 Ga0068859_100587780 Ga0068859_1005877802 208
410 3300005618 Ga0068864_100000111 Ga0068864_10000011132 208
411 3300005618 Ga0068864_100097668 Ga0068864_1000976686 208
412 3300005719 Ga0068861_100017480 Ga0068861_1000174802 208
413 3300005719 Ga0068861_100089507 Ga0068861_1000895072 208
414 3300005842 Ga0068858_100000022 Ga0068858_100000022185 208
415 3300005843 Ga0068860_100013042 Ga0068860_1000130422 208
416 3300005844 Ga0068862_100110279 Ga0068862_1001102793 208
417 3300006058 Ga0075432_10000146 Ga0075432_1000014616 208
418 3300006163 Ga0070715_10130521 Ga0070715_101305212 208
419 3300006163 Ga0070715_10131828 Ga0070715_101318282 208
420 3300006173 Ga0070716_100322906 Ga0070716_1003229062 208
421 3300006237 Ga0097621_100020509 Ga0097621_1000205093 208
422 3300006237 Ga0097621_100089216 Ga0097621_1000892164 208
423 3300006237 Ga0097621_100122288 Ga0097621_1001222882 208
424 3300006358 Ga0068871_100044823 Ga0068871_1000448232 208
425 3300006846 Ga0075430_100008729 Ga0075430_1000087292 208
426 3300006846 Ga0075430_100017031 Ga0075430_1000170317 208
427 3300006847 Ga0075431_100011189 Ga0075431_1000111897 208
428 3300006852 Ga0075433_10005027 Ga0075433_100050279 208
429 3300006852 Ga0075433_10018091 Ga0075433_100180917 208
430 3300006852 Ga0075433_10109987 Ga0075433_101099871 208
431 3300006880 Ga0075429_100011609 Ga0075429_1000116097 208
432 3300006880 Ga0075429_100050521 Ga0075429_1000505212 208
433 3300006881 Ga0068865_100001245 Ga0068865_10000124516 208
434 3300006881 Ga0068865_100567845 Ga0068865_1005678452 208
435 3300006914 Ga0075436_100074038 Ga0075436_1000740382 208
436 3300006914 Ga0075436_100114555 Ga0075436_1001145552 208
437 3300006931 Ga0097620_100587815 Ga0097620_1005878151 208
438 3300007076 Ga0075435_100068984 Ga0075435_1000689845 208
439 3300007076 Ga0075435_100286224 Ga0075435_1002862242 208
440 3300009093 Ga0105240_10102207 Ga0105240_101022073 208
441 3300009093 Ga0105240_10182979 Ga0105240_101829792 208
442 3300009098 Ga0105245_10020460 Ga0105245_100204607 208
443 3300009147 Ga0114129_10007246 Ga0114129_100072462 208
444 3300009147 Ga0114129_10297553 Ga0114129_102975532 208
445 3300009148 Ga0105243_10016408 Ga0105243_100164087 208
446 3300009174 Ga0105241_10020096 Ga0105241_100200966 208
447 3300009176 Ga0105242_10005679 Ga0105242_1000567910 208
448 3300009176 Ga0105242_10080013 Ga0105242_100800132 208
449 3300009176 Ga0105242_10160971 Ga0105242_101609712 208
450 3300009177 Ga0105248_10002568 Ga0105248_1000256817 208
451 3300009177 Ga0105248_10006274 Ga0105248_100062743 208
452 3300009177 Ga0105248_10718204 Ga0105248_107182041 208
453 3300009545 Ga0105237_10002288 Ga0105237_100022887 208
454 3300009553 Ga0105249_10063181 Ga0105249_100631812 208
455 3300009553 Ga0105249_11037219 Ga0105249_110372192 208
456 3300011119 Ga0105246_10007739 Ga0105246_100077392 208
457 3300013102 Ga0157371_10065655 Ga0157371_100656552 208
458 3300013104 Ga0157370_10039339 Ga0157370_100393393 208
459 3300013104 Ga0157370_10101703 Ga0157370_101017032 208
460 3300013105 Ga0157369_10035178 Ga0157369_100351784 208
461 3300013296 Ga0157374_10010625 Ga0157374_100106252 208
462 3300013297 Ga0157378_10036078 Ga0157378_100360783 208
463 3300013297 Ga0157378_10118500 Ga0157378_101185003 208
464 3300013306 Ga0163162_10099988 Ga0163162_100999882 208
465 3300013307 Ga0157372_10048563 Ga0157372_100485635 208
466 3300013307 Ga0157372_10102985 Ga0157372_101029853 208
467 3300013308 Ga0157375_10159424 Ga0157375_101594241 208
468 3300014325 Ga0163163_10244126 Ga0163163_102441261 208
469 3300014326 Ga0157380_10003770 Ga0157380_100037703 208
470 3300014326 Ga0157380_10005347 Ga0157380_1000534711 208
471 3300014326 Ga0157380_10106604 Ga0157380_101066042 208
472 3300014745 Ga0157377_10003125 Ga0157377_100031259 208
473 3300014969 Ga0157376_10001880 Ga0157376_1000188013 208
474 3300014969 Ga0157376_10028395 Ga0157376_100283954 208
475 3300017792 Ga0163161_10180539 Ga0163161_101805392 208
476 3300025893 Ga0207682_10058329 Ga0207682_100583292 208
477 3300025898 Ga0207692_10167004 Ga0207692_101670042 208
478 3300025901 Ga0207688_10060783 Ga0207688_100607832 208
479 3300025903 Ga0207680_10067310 Ga0207680_100673102 208
480 3300025905 Ga0207685_10004793 Ga0207685_100047933 208
481 3300025905 Ga0207685_10098322 Ga0207685_100983222 208
482 3300025906 Ga0207699_10487896 Ga0207699_104878961 208
483 3300025907 Ga0207645_10000106 Ga0207645_1000010663 208
484 3300025908 Ga0207643_10074006 Ga0207643_100740062 208
485 3300025909 Ga0207705_10004105 Ga0207705_100041051 208
486 3300025909 Ga0207705_10457421 Ga0207705_104574211 208
487 3300025910 Ga0207684_10118130 Ga0207684_101181302 208
488 3300025912 Ga0207707_10021217 Ga0207707_100212172 208
489 3300025912 Ga0207707_10256389 Ga0207707_102563892 208
490 3300025913 Ga0207695_10093976 Ga0207695_100939762 208
491 3300025913 Ga0207695_10123346 Ga0207695_101233462 208
492 3300025917 Ga0207660_10009791 Ga0207660_100097912 208
493 3300025917 Ga0207660_10105156 Ga0207660_101051561 208
494 3300025917 Ga0207660_10127553 Ga0207660_101275532 208
495 3300025918 Ga0207662_10031065 Ga0207662_100310652 208
496 3300025919 Ga0207657_10001750 Ga0207657_1000175022 208
497 3300025919 Ga0207657_10014426 Ga0207657_100144264 208
498 3300025920 Ga0207649_10058357 Ga0207649_100583573 208
499 3300025922 Ga0207646_10000002 Ga0207646_10000002369 208
500 3300025922 Ga0207646_10827406 Ga0207646_108274061 208
501 3300025923 Ga0207681_10006532 Ga0207681_100065328 208
502 3300025925 Ga0207650_10095734 Ga0207650_100957342 208
503 3300025925 Ga0207650_10234257 Ga0207650_102342572 208
504 3300025927 Ga0207687_10020033 Ga0207687_100200332 208
505 3300025932 Ga0207690_10003524 Ga0207690_1000352410 208
506 3300025933 Ga0207706_10003580 Ga0207706_1000358016 208
507 3300025934 Ga0207686_10066765 Ga0207686_100667651 208
508 3300025934 Ga0207686_10075812 Ga0207686_100758121 208
509 3300025934 Ga0207686_10173842 Ga0207686_101738422 208
510 3300025935 Ga0207709_10010716 Ga0207709_100107162 208
511 3300025936 Ga0207670_10000048 Ga0207670_1000004852 208
512 3300025936 Ga0207670_10006030 Ga0207670_100060308 208
513 3300025939 Ga0207665_10095338 Ga0207665_100953382 208
514 3300025939 Ga0207665_10343655 Ga0207665_103436552 208
515 3300025940 Ga0207691_10003100 Ga0207691_1000310016 208
516 3300025940 Ga0207691_10042650 Ga0207691_100426504 208
517 3300025941 Ga0207711_10004553 Ga0207711_100045537 208
518 3300025941 Ga0207711_10018382 Ga0207711_100183822 208
519 3300025941 Ga0207711_10210061 Ga0207711_102100612 208
520 3300025942 Ga0207689_10003301 Ga0207689_1000330112 208
521 3300025942 Ga0207689_10021640 Ga0207689_100216403 208
522 3300025942 Ga0207689_10609065 Ga0207689_106090652 208
523 3300025944 Ga0207661_10160717 Ga0207661_101607172 208
524 3300025944 Ga0207661_10257157 Ga0207661_102571571 208
525 3300025949 Ga0207667_10189347 Ga0207667_101893472 208
526 3300025949 Ga0207667_10763691 Ga0207667_107636911 208
527 3300025960 Ga0207651_10031297 Ga0207651_100312974 208
528 3300025960 Ga0207651_10080253 Ga0207651_100802532 208
529 3300025960 Ga0207651_10276692 Ga0207651_102766922 208
530 3300025961 Ga0207712_10227561 Ga0207712_102275612 208
531 3300025961 Ga0207712_10691653 Ga0207712_106916532 208
532 3300025986 Ga0207658_10059219 Ga0207658_100592195 208
533 3300026023 Ga0207677_10010386 Ga0207677_100103865 208
534 3300026035 Ga0207703_10000048 Ga0207703_1000004828 208
535 3300026067 Ga0207678_10001977 Ga0207678_100019777 208
536 3300026067 Ga0207678_10014128 Ga0207678_100141287 208
537 3300026067 Ga0207678_10212996 Ga0207678_102129962 208
538 3300026075 Ga0207708_10000285 Ga0207708_100002853 208
539 3300026075 Ga0207708_10001695 Ga0207708_100016952 208
540 3300026075 Ga0207708_10535621 Ga0207708_105356212 208
541 3300026089 Ga0207648_10000578 Ga0207648_100005783 208
542 3300026089 Ga0207648_10053460 Ga0207648_100534604 208
543 3300026089 Ga0207648_10458938 Ga0207648_104589381 208
544 3300026095 Ga0207676_10000151 Ga0207676_1000015155 208
545 3300026116 Ga0207674_10018739 Ga0207674_100187394 208
546 3300026116 Ga0207674_10023980 Ga0207674_100239803 208
547 3300026118 Ga0207675_100182317 Ga0207675_1001823172 208
548 3300026118 Ga0207675_100688550 Ga0207675_1006885501 208
549 3300026121 Ga0207683_10001101 Ga0207683_1000110111 208
550 3300026142 Ga0207698_10226721 Ga0207698_102267212 208
551 3300027364 Ga0209967_1000003 Ga0209967_100000333 208
552 3300027378 Ga0209981_1000058 Ga0209981_10000582 208
553 3300027395 Ga0209996_1000094 Ga0209996_100009411 208
554 3300027395 Ga0209996_1006207 Ga0209996_10062072 208
555 3300027424 Ga0209984_1000587 Ga0209984_10005872 208
556 3300027471 Ga0209995_1000234 Ga0209995_10002349 208
557 3300027526 Ga0209968_1001470 Ga0209968_10014703 208
558 3300027543 Ga0209999_1000320 Ga0209999_10003207 208
559 3300027552 Ga0209982_1000017 Ga0209982_100001716 208
560 3300027614 Ga0209970_1003145 Ga0209970_10031452 208
561 3300027617 Ga0210002_1001187 Ga0210002_10011875 208
562 3300027617 Ga0210002_1007107 Ga0210002_10071072 208
563 3300027665 Ga0209983_1001997 Ga0209983_10019976 208
564 3300027682 Ga0209971_1000718 Ga0209971_10007182 208
565 3300027695 Ga0209966_1000115 Ga0209966_100011522 208
566 3300027717 Ga0209998_10000074 Ga0209998_1000007441 208
567 3300027876 Ga0209974_10000017 Ga0209974_1000001740 208
568 3300027907 Ga0207428_10000760 Ga0207428_1000076037 208
569 3300028379 Ga0268266_10042398 Ga0268266_100423985 208
570 3300028380 Ga0268265_10004280 Ga0268265_1000428011 208
571 3300031731 Ga0307405_10196094 Ga0307405_101960942 208
572 3300031852 Ga0307410_10051262 Ga0307410_100512622 208
573 3300031901 Ga0307406_10076490 Ga0307406_100764903 208
574 3300031911 Ga0307412_10069114 Ga0307412_100691142 208
575 3300032002 Ga0307416_100204854 Ga0307416_1002048542 208
576 3300032004 Ga0307414_10035292 Ga0307414_100352924 208
577 3300035083 Ga0373926_0006990 Ga0373926_0006990_2363_3001 208
578 3300035083 Ga0373926_0020718 Ga0373926_0020718_1534_2175 208
579 3300035111 Ga0373923_0069382 Ga0373923_0069382_138_779 208
580 3300035111 Ga0373923_0098605 Ga0373923_0098605_282_923 208
581 3300035113 Ga0373936_0011513 Ga0373936_0011513_510_1151 208
582 3300035113 Ga0373936_0050621 Ga0373936_0050621_725_1360 208
583 3300035116 Ga0373945_0006150 Ga0373945_0006150_2492_3133 208
584 3300035116 Ga0373945_0013358 Ga0373945_0013358_1369_2010 208
585 3300035121 Ga0373960_0120889 Ga0373960_0120889_119_757 208
586 3300035170 Ga0373943_0000343 Ga0373943_0000343_685_1326 208
587 3300035170 Ga0373943_0008884 Ga0373943_0008884_2007_2648 208
588 3300035171 Ga0373946_0001335 Ga0373946_0001335_2695_3336 208
589 3300035171 Ga0373946_0089478 Ga0373946_0089478_536_1174 208
590 3300035171 Ga0373946_0102077 Ga0373946_0102077_460_1095 208
591 3300035692 Ga0373935_0009490 Ga0373935_0009490_5049_5690 208
592 3300035692 Ga0373935_0039504 Ga0373935_0039504_672_1313 208
593 3300035692 Ga0373935_0135376 Ga0373935_0135376_621_1259 208
594 3300035695 Ga0373927_0001986 Ga0373927_0001986_2598_3239 208
595 3300035695 Ga0373927_0122333 Ga0373927_0122333_761_1402 208
596 3300035695 Ga0373927_0169301 Ga0373927_0169301_264_902 208
597 3300035725 Ga0373947_0000156 Ga0373947_0000156_17205_17846 208
598 3300035725 Ga0373947_0009196 Ga0373947_0009196_4860_5495 208
599 3300035725 Ga0373947_0049742 Ga0373947_0049742_937_1575 208
600 3300037068 Ga0373925_0000628 Ga0373925_0000628_27160_27801 208
601 3300037068 Ga0373925_0004286 Ga0373925_0004286_6725_7366 208
602 3300037068 Ga0373925_0068568 Ga0373925_0068568_1213_1851 208
603 3300037418 Ga0395900_0637162 Ga0395900_0637162_122_760 208
604 3300037466 Ga0395898_0071760 Ga0395898_0071760_68_706 208
605 3300038443 Ga0395901_0137933 Ga0395901_0137933_196_834 208
606 3300039437 Ga0436365_0311528 Ga0436365_0311528_174_800 208
607 3300041410 Ga0439461_0092762 Ga0439461_0092762_42_680 208
608 3300041411 Ga0439466_0033219 Ga0439466_0033219_407_1042 208
609 3300041997 Ga0439431_0028292 Ga0439431_0028292_414_1049 208
610 3300042001 Ga0439441_010838 Ga0439441_010838_83_721 208
611 3300042005 Ga0439448_0086740 Ga0439448_0086740_150_788 208
612 3300042006 Ga0439432_013411 Ga0439432_013411_1049_1684 208
613 3300042185 Ga0450909_005249 Ga0450909_005249_903_1538 208
614 3300042435 Ga0439434_0004960 Ga0439434_0004960_2358_2993 208
615 3300042436 Ga0439435_0035039 Ga0439435_0035039_518_1156 208
616 3300042461 Ga0439460_0026455 Ga0439460_0026455_651_1286 208
617 3300042876 Ga0451577_0035562 Ga0451577_0035562_3399_4031 208
618 3300042876 Ga0451577_0206920 Ga0451577_0206920_259_897 208
619 3300044694 Ga0466963_0010330 Ga0466963_0010330_4314_4946 208
620 3300044712 Ga0453684_0826714 Ga0453684_0826714_323_955 208
621 3300044719 Ga0466971_0005591 Ga0466971_0005591_1000_1632 208
622 3300044719 Ga0466971_0210930 Ga0466971_0210930_181_813 208
623 3300044842 Ga0466957_0018836 Ga0466957_0018836_3032_3664 208
624 3300045051 Ga0451576_0005563 Ga0451576_0005563_13419_14057 208
625 3300045051 Ga0451576_0234010 Ga0451576_0234010_542_1180 208
626 3300045051 Ga0451576_0405312 Ga0451576_0405312_608_1246 208
627 3300045051 Ga0451576_1313476 Ga0451576_1313476_51_689 208
628 3300045976 Ga0466967_0066862 Ga0466967_0066862_1522_2154 208
629 3300046454 Ga0495592_0020241 Ga0495592_0020241_4134_4775 208
630 3300046459 Ga0495629_0094572 Ga0495629_0094572_938_1579 208
631 3300046472 Ga0495580_0049804 Ga0495580_0049804_1657_2298 208
632 3300046476 Ga0495662_0000558 Ga0495662_0000558_9824_10465 208
633 3300046477 Ga0495664_0000393 Ga0495664_0000393_17506_18147 208
634 3300046491 Ga0495584_0197059 Ga0495584_0197059_135_773 208
635 3300046499 Ga0495594_0122254 Ga0495594_0122254_88_726 208
636 3300046514 Ga0495618_0011586 Ga0495618_0011586_2293_2934 208
637 3300046517 Ga0495630_0005525 Ga0495630_0005525_2489_3130 208
638 3300046517 Ga0495630_0322750 Ga0495630_0322750_406_1047 208
639 3300046526 Ga0495666_0020887 Ga0495666_0020887_2390_3031 208
640 3300046529 Ga0495652_0018394 Ga0495652_0018394_1323_1964 208
641 3300046531 Ga0495665_0039805 Ga0495665_0039805_1128_1769 208
642 3300046531 Ga0495665_0051775 Ga0495665_0051775_308_949 208
643 3300046533 Ga0495640_0001485 Ga0495640_0001485_9900_10541 208
644 3300046533 Ga0495640_0029192 Ga0495640_0029192_182_823 208
645 3300046543 Ga0495645_0003126 Ga0495645_0003126_7490_8131 208
646 3300046557 Ga0495622_0057169 Ga0495622_0057169_1094_1732 208
647 3300046642 Ga0495634_0001637 Ga0495634_0001637_1461_2102 208
648 3300046642 Ga0495634_0024760 Ga0495634_0024760_3403_4044 208
649 3300046642 Ga0495634_0029021 Ga0495634_0029021_2486_3127 208
650 3300046663 Ga0495635_0002416 Ga0495635_0002416_9675_10316 208
651 3300046664 Ga0495659_0052266 Ga0495659_0052266_331_969 208
652 3300046689 Ga0495613_0006144 Ga0495613_0006144_7143_7784 208
653 3300046690 Ga0495624_0003130 Ga0495624_0003130_2119_2760 208
654 3300046690 Ga0495624_0017004 Ga0495624_0017004_2615_3256 208
655 3300047315 Ga0495581_0113672 Ga0495581_0113672_410_1051 208
656 3300047319 Ga0495674_0002951 Ga0495674_0002951_8551_9192 208
657 3300047319 Ga0495674_0129785 Ga0495674_0129785_455_1096 208
658 3300047321 Ga0495676_0073566 Ga0495676_0073566_1235_1876 208
659 3300047471 Ga0495684_0001554 Ga0495684_0001554_11937_12578 208
660 3300047471 Ga0495684_0028817 Ga0495684_0028817_2583_3224 208
661 3300047471 Ga0495684_0696552 Ga0495684_0696552_20_652 208
662 3300047673 Ga0495593_0229689 Ga0495593_0229689_66_707 208
663 3300048909 Ga0496106_0153406 Ga0496106_0153406_497_1135 208
664 3300048921 Ga0496118_0047204 Ga0496118_0047204_2533_3159 208
665 3300048921 Ga0496118_0379262 Ga0496118_0379262_26_652 208
666 3300049513 Ga0501290_000127 Ga0501290_000127_1876_2511 208
667 3300049514 Ga0501291_000073 Ga0501291_000073_8584_9219 208
668 3300049515 Ga0501292_000656 Ga0501292_000656_2545_3180 208
669 3300049516 Ga0501293_000116 Ga0501293_000116_4331_4966 208
670 3300049518 Ga0501295_000033 Ga0501295_000033_8559_9194 208
671 3300049519 Ga0501296_001586 Ga0501296_001586_1050_1685 208
672 3300049520 Ga0501297_000231 Ga0501297_000231_4650_5285 208
673 3300049522 Ga0501299_007248 Ga0501299_007248_450_1085 208
674 3300049524 Ga0501301_000531 Ga0501301_000531_679_1314 208
675 3300049525 Ga0501302_000131 Ga0501302_000131_2033_2668 208
676 3300049526 Ga0501303_000304 Ga0501303_000304_973_1608 208
677 3300049568 Ga0501031_0050714 Ga0501031_0050714_811_1449 208
678 3300049570 Ga0501033_0123441 Ga0501033_0123441_257_895 208
679 3300049571 Ga0501034_0013990 Ga0501034_0013990_5634_6260 208
680 3300049576 Ga0501040_0119641 Ga0501040_0119641_941_1579 208
681 3300049578 Ga0501042_0254784 Ga0501042_0254784_317_955 208
682 3300049580 Ga0501046_0267232 Ga0501046_0267232_398_1036 208
683 3300049582 Ga0501048_0025839 Ga0501048_0025839_3079_3717 208
684 3300049584 Ga0501068_0074176 Ga0501068_0074176_169_807 208
685 3300049588 Ga0501072_0177584 Ga0501072_0177584_543_1181 208
686 3300049591 Ga0501075_0296176 Ga0501075_0296176_497_1135 208
687 3300049593 Ga0501077_0440421 Ga0501077_0440421_193_819 208
688 3300049651 Ga0501201_000711 Ga0501201_000711_583_1218 208
689 3300049653 Ga0501206_000679 Ga0501206_000679_3004_3639 208
690 3300049656 Ga0501209_007531 Ga0501209_007531_711_1346 208
691 3300049661 Ga0501217_003614 Ga0501217_003614_1177_1812 208
692 3300049663 Ga0501223_011372 Ga0501223_011372_679_1314 208
693 3300049666 Ga0501228_000754 Ga0501228_000754_1389_2024 208
694 3300049667 Ga0501230_000458 Ga0501230_000458_2090_2725 208
695 3300049668 Ga0501233_000630 Ga0501233_000630_4541_5176 208
696 3300049672 Ga0501239_000120 Ga0501239_000120_2836_3471 208
697 3300049675 Ga0501243_008412 Ga0501243_008412_378_1013 208
698 3300049676 Ga0501246_001039 Ga0501246_001039_375_1010 208
699 3300049677 Ga0501247_000206 Ga0501247_000206_536_1171 208
700 3300049678 Ga0501248_000294 Ga0501248_000294_913_1548 208
701 3300049679 Ga0501249_001011 Ga0501249_001011_2236_2871 208
702 3300049681 Ga0501251_000884 Ga0501251_000884_997_1632 208
703 3300049686 Ga0501257_000648 Ga0501257_000648_2269_2904 208
704 3300049687 Ga0501258_000554 Ga0501258_000554_1469_2104 208
705 3300049689 Ga0501260_004679 Ga0501260_004679_268_903 208
706 3300049690 Ga0501261_001701 Ga0501261_001701_405_1040 208
707 3300049703 Ga0501219_000199 Ga0501219_000199_9347_9982 208
708 3300049705 Ga0501225_0041548 Ga0501225_0041548_493_1128 208
709 3300049706 Ga0501229_000227 Ga0501229_000227_4939_5574 208
710 3300049707 Ga0501234_000041 Ga0501234_000041_10229_10864 208
711 3300049708 Ga0501245_001648 Ga0501245_001648_256_891 208
712 3300049741 Ga0501079_0048518 Ga0501079_0048518_266_904 208
713 3300049742 Ga0501080_0004889 Ga0501080_0004889_8187_8825 208
714 3300049744 Ga0501083_0362976 Ga0501083_0362976_288_926 208
715 3300049761 Ga0501264_003294 Ga0501264_003294_334_969 208
716 3300049762 Ga0501265_000322 Ga0501265_000322_3043_3678 208
717 3300049763 Ga0501266_000188 Ga0501266_000188_1885_2520 208
718 3300049768 Ga0501271_009200 Ga0501271_009200_17_652 208
719 3300049769 Ga0501272_000011 Ga0501272_000011_7145_7780 208
720 3300049770 Ga0501273_001280 Ga0501273_001280_897_1532 208
721 3300049771 Ga0501274_000050 Ga0501274_000050_598_1233 208
722 3300049773 Ga0501276_000206 Ga0501276_000206_812_1447 208
723 3300049774 Ga0501278_001024 Ga0501278_001024_482_1117 208
724 3300049775 Ga0501279_001327 Ga0501279_001327_1571_2206 208
725 3300049779 Ga0501283_000138 Ga0501283_000138_2242_2877 208
726 3300049824 Ga0501045_0169436 Ga0501045_0169436_948_1586 208
727 3300049851 Ga0501212_000330 Ga0501212_000330_1119_1754 208
728 3300050507 nmdc:mga05p37_12082_c1 nmdc:mga05p37_12082_c1_8938_9576 208
729 3300050507 nmdc:mga05p37_9949_c1 nmdc:mga05p37_9949_c1_7472_8110 208
730 3300050508 nmdc:mga09592_192642_c1 nmdc:mga09592_192642_c1_1031_1666 208
731 3300050508 nmdc:mga09592_51000_c1 nmdc:mga09592_51000_c1_534_1172 208
732 3300050509 nmdc:mga0qj67_32357_c1 nmdc:mga0qj67_32357_c1_3250_3885 208
733 3300050509 nmdc:mga0qj67_8496_c1 nmdc:mga0qj67_8496_c1_1016_1654 208
734 3300050510 nmdc:mga06r32_141730_c1 nmdc:mga06r32_141730_c1_509_1144 208
735 3300050510 nmdc:mga06r32_2306_c1 nmdc:mga06r32_2306_c1_188_826 208
736 3300050511 nmdc:mga08y16_27834_c1 nmdc:mga08y16_27834_c1_720_1358 208
737 3300050512 nmdc:mga0n895_13540_c1 nmdc:mga0n895_13540_c1_3938_4582 208
738 3300050513 nmdc:mga0rr50_109047_c1 nmdc:mga0rr50_109047_c1_1054_1698 208
739 3300050514 nmdc:mga08x19_96045_c1 nmdc:mga08x19_96045_c1_1137_1781 208
740 3300050515 nmdc:mga0a205_11730_c1 nmdc:mga0a205_11730_c1_5482_6120 208
741 3300050515 nmdc:mga0a205_201295_c1 nmdc:mga0a205_201295_c1_49_687 208
742 3300050515 nmdc:mga0a205_70062_c1 nmdc:mga0a205_70062_c1_685_1329 208
743 3300050515 nmdc:mga0a205_777_c1 nmdc:mga0a205_777_c1_20613_21251 208
744 3300053077 Ga0495601_0001800 Ga0495601_0001800_3532_4173 208
745 3300053078 Ga0495612_0000118 Ga0495612_0000118_18201_18842 208
746 3300053085 Ga0495619_0002839 Ga0495619_0002839_2437_3078 208
747 3300054114 Ga0501084_0036726 Ga0501084_0036726_794_1432 208
748 3300060353 Ga0501082_0473075 Ga0501082_0473075_231_869 208
749 3300061719 Ga0466962_0003999 Ga0466962_0003999_5928_6560 208
750 3300061734 Ga0530510_0068874 Ga0530510_0068874_1836_2474 208
751 3300003320 rootH2_10059427 rootH2_100594274 209
752 3300004803 Ga0058862_10201493 Ga0058862_102014932 209
753 3300005327 Ga0070658_10267601 Ga0070658_102676012 209
754 3300005329 Ga0070683_100055157 Ga0070683_1000551573 209
755 3300005329 Ga0070683_100201881 Ga0070683_1002018813 209
756 3300005336 Ga0070680_100003506 Ga0070680_1000035063 209
757 3300005344 Ga0070661_100405893 Ga0070661_1004058932 209
758 3300005366 Ga0070659_100000313 Ga0070659_1000003133 209
759 3300005434 Ga0070709_10184785 Ga0070709_101847851 209
760 3300005435 Ga0070714_100345453 Ga0070714_1003454532 209
761 3300005435 Ga0070714_100971284 Ga0070714_1009712841 209
762 3300005436 Ga0070713_100038385 Ga0070713_1000383853 209
763 3300005437 Ga0070710_10518414 Ga0070710_105184141 209
764 3300005439 Ga0070711_100038261 Ga0070711_1000382613 209
765 3300005458 Ga0070681_10006757 Ga0070681_100067573 209
766 3300005458 Ga0070681_10012093 Ga0070681_100120933 209
767 3300005458 Ga0070681_10103061 Ga0070681_101030612 209
768 3300005458 Ga0070681_10212113 Ga0070681_102121133 209
769 3300005530 Ga0070679_100024432 Ga0070679_1000244324 209
770 3300005530 Ga0070679_100337399 Ga0070679_1003373992 209
771 3300005530 Ga0070679_100387941 Ga0070679_1003879412 209
772 3300005539 Ga0068853_100000014 Ga0068853_10000001451 209
773 3300005539 Ga0068853_100018832 Ga0068853_1000188323 209
774 3300005547 Ga0070693_100148917 Ga0070693_1001489171 209
775 3300005563 Ga0068855_100313116 Ga0068855_1003131162 209
776 3300005563 Ga0068855_100401908 Ga0068855_1004019082 209
777 3300005577 Ga0068857_100664463 Ga0068857_1006644631 209
778 3300005578 Ga0068854_100000014 Ga0068854_10000001411 209
779 3300005578 Ga0068854_100079955 Ga0068854_1000799552 209
780 3300005578 Ga0068854_100112690 Ga0068854_1001126903 209
781 3300005614 Ga0068856_100257262 Ga0068856_1002572622 209
782 3300005616 Ga0068852_100051406 Ga0068852_1000514064 209
783 3300005843 Ga0068860_100011193 Ga0068860_1000111935 209
784 3300005844 Ga0068862_100000095 Ga0068862_10000009516 209
785 3300005844 Ga0068862_100466318 Ga0068862_1004663182 209
786 3300006028 Ga0070717_10240298 Ga0070717_102402982 209
787 3300006173 Ga0070716_100207092 Ga0070716_1002070922 209
788 3300006175 Ga0070712_100001112 Ga0070712_10000111211 209
789 3300006175 Ga0070712_100236338 Ga0070712_1002363382 209
790 3300006195 Ga0075366_10136273 Ga0075366_101362732 209
791 3300006871 Ga0075434_100442007 Ga0075434_1004420072 209
792 3300006931 Ga0097620_100033113 Ga0097620_1000331134 209
793 3300009093 Ga0105240_10029355 Ga0105240_100293556 209
794 3300009093 Ga0105240_10039411 Ga0105240_100394115 209
795 3300009093 Ga0105240_10071968 Ga0105240_100719682 209
796 3300009093 Ga0105240_10448481 Ga0105240_104484813 209
797 3300009093 Ga0105240_11066389 Ga0105240_110663891 209
798 3300009098 Ga0105245_10001545 Ga0105245_1000154511 209
799 3300009101 Ga0105247_10003191 Ga0105247_100031918 209
800 3300009148 Ga0105243_10247019 Ga0105243_102470192 209
801 3300009177 Ga0105248_10081810 Ga0105248_100818102 209
802 3300009545 Ga0105237_10319578 Ga0105237_103195783 209
803 3300009545 Ga0105237_10378438 Ga0105237_103784383 209
804 3300009553 Ga0105249_10000079 Ga0105249_1000007928 209
805 3300010375 Ga0105239_10000025 Ga0105239_1000002522 209
806 3300010375 Ga0105239_10303359 Ga0105239_103033593 209
807 3300010375 Ga0105239_10935765 Ga0105239_109357651 209
808 3300013102 Ga0157371_10064577 Ga0157371_100645772 209
809 3300013104 Ga0157370_10022338 Ga0157370_100223385 209
810 3300013104 Ga0157370_10051887 Ga0157370_100518874 209
811 3300013104 Ga0157370_10054949 Ga0157370_100549492 209
812 3300013104 Ga0157370_10165738 Ga0157370_101657383 209
813 3300013105 Ga0157369_10086664 Ga0157369_100866644 209
814 3300013105 Ga0157369_10168943 Ga0157369_101689432 209
815 3300013105 Ga0157369_10749327 Ga0157369_107493272 209
816 3300013296 Ga0157374_10437316 Ga0157374_104373161 209
817 3300013306 Ga0163162_10147414 Ga0163162_101474143 209
818 3300013307 Ga0157372_10083280 Ga0157372_100832804 209
819 3300013308 Ga0157375_10870902 Ga0157375_108709022 209
820 3300014968 Ga0157379_10081801 Ga0157379_100818012 209
821 3300014968 Ga0157379_10213557 Ga0157379_102135573 209
822 3300014969 Ga0157376_10222773 Ga0157376_102227732 209
823 3300025900 Ga0207710_10040359 Ga0207710_100403592 209
824 3300025906 Ga0207699_10260142 Ga0207699_102601423 209
825 3300025909 Ga0207705_10015092 Ga0207705_100150923 209
826 3300025909 Ga0207705_10030685 Ga0207705_100306854 209
827 3300025912 Ga0207707_10004769 Ga0207707_1000476911 209
828 3300025912 Ga0207707_10016769 Ga0207707_100167693 209
829 3300025912 Ga0207707_10292243 Ga0207707_102922432 209
830 3300025913 Ga0207695_10005655 Ga0207695_100056552 209
831 3300025913 Ga0207695_10053761 Ga0207695_100537612 209
832 3300025913 Ga0207695_10121442 Ga0207695_101214422 209
833 3300025914 Ga0207671_10083288 Ga0207671_100832882 209
834 3300025914 Ga0207671_10124374 Ga0207671_101243743 209
835 3300025915 Ga0207693_10070547 Ga0207693_100705471 209
836 3300025915 Ga0207693_10333456 Ga0207693_103334561 209
837 3300025916 Ga0207663_10064719 Ga0207663_100647192 209
838 3300025917 Ga0207660_10005550 Ga0207660_100055502 209
839 3300025917 Ga0207660_10314164 Ga0207660_103141642 209
840 3300025917 Ga0207660_10435524 Ga0207660_104355242 209
841 3300025919 Ga0207657_10091025 Ga0207657_100910251 209
842 3300025921 Ga0207652_10016969 Ga0207652_100169692 209
843 3300025921 Ga0207652_10119929 Ga0207652_101199292 209
844 3300025921 Ga0207652_10158898 Ga0207652_101588982 209
845 3300025921 Ga0207652_10361168 Ga0207652_103611682 209
846 3300025927 Ga0207687_10003874 Ga0207687_100038749 209
847 3300025928 Ga0207700_10003248 Ga0207700_100032484 209
848 3300025928 Ga0207700_10194295 Ga0207700_101942952 209
849 3300025929 Ga0207664_10151806 Ga0207664_101518061 209
850 3300025932 Ga0207690_10000642 Ga0207690_1000064217 209
851 3300025933 Ga0207706_10188168 Ga0207706_101881683 209
852 3300025944 Ga0207661_10007995 Ga0207661_100079956 209
853 3300025949 Ga0207667_10000670 Ga0207667_100006708 209
854 3300025949 Ga0207667_10116036 Ga0207667_101160363 209
855 3300025949 Ga0207667_10174449 Ga0207667_101744492 209
856 3300025961 Ga0207712_10000030 Ga0207712_1000003097 209
857 3300025972 Ga0207668_10000842 Ga0207668_1000084213 209
858 3300025981 Ga0207640_10000010 Ga0207640_10000010110 209
859 3300026041 Ga0207639_10000033 Ga0207639_1000003355 209
860 3300026041 Ga0207639_10083620 Ga0207639_100836202 209
861 3300026067 Ga0207678_10043107 Ga0207678_100431072 209
862 3300026078 Ga0207702_10091648 Ga0207702_100916481 209
863 3300026078 Ga0207702_10617630 Ga0207702_106176302 209
864 3300026089 Ga0207648_10247146 Ga0207648_102471462 209
865 3300026116 Ga0207674_10730268 Ga0207674_107302682 209
866 3300026116 Ga0207674_10888322 Ga0207674_108883221 209
867 3300026142 Ga0207698_10038066 Ga0207698_100380662 209
868 3300028017 Ga0265356_1006515 Ga0265356_10065152 209
869 3300028379 Ga0268266_10030855 Ga0268266_100308551 209
870 3300028380 Ga0268265_10000132 Ga0268265_1000013285 209
871 3300028380 Ga0268265_10489093 Ga0268265_104890931 209
872 3300028381 Ga0268264_10000779 Ga0268264_100007793 209
873 3300028800 Ga0265338_10010001 Ga0265338_100100013 209
874 3300028800 Ga0265338_10441430 Ga0265338_104414301 209
875 3300028800 Ga0265338_10486397 Ga0265338_104863971 209
876 3300031235 Ga0265330_10008443 Ga0265330_100084436 209
877 3300031235 Ga0265330_10009351 Ga0265330_100093512 209
878 3300031235 Ga0265330_10050263 Ga0265330_100502632 209
879 3300031235 Ga0265330_10076756 Ga0265330_100767561 209
880 3300031238 Ga0265332_10056629 Ga0265332_100566292 209
881 3300031239 Ga0265328_10017261 Ga0265328_100172612 209
882 3300031240 Ga0265320_10252766 Ga0265320_102527661 209
883 3300031241 Ga0265325_10016951 Ga0265325_100169514 209
884 3300031247 Ga0265340_10026809 Ga0265340_100268092 209
885 3300031247 Ga0265340_10051438 Ga0265340_100514382 209
886 3300031247 Ga0265340_10114174 Ga0265340_101141742 209
887 3300031249 Ga0265339_10013760 Ga0265339_100137602 209
888 3300031249 Ga0265339_10019346 Ga0265339_100193462 209
889 3300031344 Ga0265316_10002381 Ga0265316_100023816 209
890 3300031344 Ga0265316_10013220 Ga0265316_100132203 209
891 3300031344 Ga0265316_10154517 Ga0265316_101545172 209
892 3300031344 Ga0265316_10255882 Ga0265316_102558821 209
893 3300031595 Ga0265313_10168513 Ga0265313_101685131 209
894 3300031711 Ga0265314_10049612 Ga0265314_100496122 209
895 3300031712 Ga0265342_10008298 Ga0265342_100082982 209
896 3300031731 Ga0307405_10019461 Ga0307405_100194612 209
897 3300031911 Ga0307412_10036252 Ga0307412_100362522 209
898 3300035410 Ga0373924_0212762 Ga0373924_0212762_143_781 209
899 3300036401 Ga0373937_0026783 Ga0373937_0026783_3084_3719 209
900 3300037068 Ga0373925_0038072 Ga0373925_0038072_1233_1868 209
901 3300037068 Ga0373925_0778592 Ga0373925_0778592_85_762 209
902 3300037418 Ga0395900_0205490 Ga0395900_0205490_1317_1952 209
903 3300037418 Ga0395900_0316700 Ga0395900_0316700_648_1280 209
904 3300037466 Ga0395898_0006201 Ga0395898_0006201_2739_3398 209
905 3300037466 Ga0395898_0631359 Ga0395898_0631359_30_665 209
906 3300037853 Ga0436364_0012403 Ga0436364_0012403_59_697 209
907 3300038443 Ga0395901_0241516 Ga0395901_0241516_269_901 209
908 3300038443 Ga0395901_0628258 Ga0395901_0628258_51_710 209
909 3300039438 Ga0436360_0989526 Ga0436360_0989526_661_1290 209
910 3300039450 Ga0436363_1151103 Ga0436363_1151103_137_781 209
911 3300044684 Ga0466966_0212518 Ga0466966_0212518_375_1019 209
912 3300044694 Ga0466963_0000249 Ga0466963_0000249_9408_10049 209
913 3300044735 Ga0466968_0074808 Ga0466968_0074808_230_859 209
914 3300044842 Ga0466957_0032113 Ga0466957_0032113_2350_2985 209
915 3300045836 Ga0466958_0147698 Ga0466958_0147698_334_969 209
916 3300045976 Ga0466967_0004012 Ga0466967_0004012_4565_5206 209
917 3300046471 Ga0495650_0046340 Ga0495650_0046340_839_1468 209
918 3300046492 Ga0495585_0052689 Ga0495585_0052689_1032_1670 209
919 3300046506 Ga0495583_0026841 Ga0495583_0026841_309_947 209
920 3300046558 Ga0495633_0042449 Ga0495633_0042449_499_1137 209
921 3300046674 Ga0495588_0050508 Ga0495588_0050508_130_768 209
922 3300047315 Ga0495581_0139900 Ga0495581_0139900_75_710 209
923 3300047323 Ga0495683_0121315 Ga0495683_0121315_373_1011 209
924 3300047472 Ga0495686_0000147 Ga0495686_0000147_117713_118354 209
925 3300047472 Ga0495686_0001655 Ga0495686_0001655_1939_2568 209
926 3300047472 Ga0495686_0005626 Ga0495686_0005626_5108_5743 209
927 3300047673 Ga0495593_0142960 Ga0495593_0142960_414_1052 209
928 3300048088 Ga0495602_0173812 Ga0495602_0173812_700_1335 209
929 3300048904 Ga0496101_0242460 Ga0496101_0242460_178_807 209
930 3300048907 Ga0496104_0078128 Ga0496104_0078128_835_1473 209
931 3300048907 Ga0496104_0132754 Ga0496104_0132754_598_1233 209
932 3300048907 Ga0496104_0802887 Ga0496104_0802887_71_706 209
933 3300048908 Ga0496105_0145579 Ga0496105_0145579_835_1470 209
934 3300048912 Ga0496109_0338427 Ga0496109_0338427_716_1357 209
935 3300048921 Ga0496118_0073618 Ga0496118_0073618_568_1251 209
936 3300048924 Ga0496121_0000671 Ga0496121_0000671_17296_17979 209
937 3300048924 Ga0496121_0058623 Ga0496121_0058623_2278_2970 209
938 3300048929 Ga0496126_0013389 Ga0496126_0013389_4294_4929 209
939 3300048929 Ga0496126_0035580 Ga0496126_0035580_2955_3638 209
940 3300049460 Ga0495682_0012097 Ga0495682_0012097_2612_3250 209
941 3300049570 Ga0501033_0115002 Ga0501033_0115002_1209_1838 209
942 3300049575 Ga0501039_0139968 Ga0501039_0139968_1000_1638 209
943 3300049822 Ga0501035_0197667 Ga0501035_0197667_749_1387 209
944 3300049823 Ga0501044_0044484 Ga0501044_0044484_2737_3366 209
945 3300049823 Ga0501044_0642057 Ga0501044_0642057_226_864 209
946 3300050493 nmdc:mga0k408_244614_c1 nmdc:mga0k408_244614_c1_389_1021 209
947 3300050512 nmdc:mga0n895_97777_c1 nmdc:mga0n895_97777_c1_761_1396 209
948 3300050514 nmdc:mga08x19_109179_c1 nmdc:mga08x19_109179_c1_961_1596 209
949 3300050514 nmdc:mga08x19_75755_c1 nmdc:mga08x19_75755_c1_1335_1979 209
950 3300053077 Ga0495601_0073634 Ga0495601_0073634_1066_1755 209
951 3300053093 Ga0500651_0000008 Ga0500651_0000008_43306_43944 209
952 3300060346 Ga0587111_0049596 Ga0587111_0049596_166_801 209
953 3300005536 Ga0070697_100113279 Ga0070697_1001132794 210
954 3300005719 Ga0068861_100011968 Ga0068861_1000119686 210
955 3300006173 Ga0070716_100019973 Ga0070716_1000199734 210
956 3300009545 Ga0105237_10431142 Ga0105237_104311421 210
957 3300025915 Ga0207693_10028969 Ga0207693_100289693 210
958 3300025916 Ga0207663_10603064 Ga0207663_106030641 210
959 3300025939 Ga0207665_10096437 Ga0207665_100964372 210
960 3300025939 Ga0207665_10631508 Ga0207665_106315082 210
961 3300026118 Ga0207675_100021047 Ga0207675_1000210473 210
962 3300047320 Ga0495672_0035055 Ga0495672_0035055_2269_2910 210
963 3300005458 Ga0070681_10104289 Ga0070681_101042893 211
964 3300005547 Ga0070693_100025282 Ga0070693_1000252824 211
965 3300005985 Ga0081539_10001185 Ga0081539_1000118535 211
966 3300007788 Ga0099795_10221620 Ga0099795_102216201 211
967 3300021388 Ga0213875_10032108 Ga0213875_100321082 211
968 3300025912 Ga0207707_10027639 Ga0207707_100276396 211
969 3300025945 Ga0207679_10529645 Ga0207679_105296452 211
970 3300031344 Ga0265316_10006492 Ga0265316_100064925 211
971 3300037418 Ga0395900_0472647 Ga0395900_0472647_396_1067 211
972 3300037853 Ga0436364_0023814 Ga0436364_0023814_338_988 211
973 3300037853 Ga0436364_1049814 Ga0436364_1049814_5022_5672 211
974 3300039437 Ga0436365_0870553 Ga0436365_0870553_134_784 211
975 3300044712 Ga0453684_0115585 Ga0453684_0115585_1115_1762 211
976 3300048915 Ga0496112_0223885 Ga0496112_0223885_327_977 211
977 2162886007 SwRhRL2b_contig_301344 SwRhRL2b_0178.00003920 212
978 3300005293 Ga0065715_10093602 Ga0065715_100936023 212
979 3300005331 Ga0070670_100001702 Ga0070670_1000017024 212
980 3300005334 Ga0068869_100012828 Ga0068869_1000128283 212
981 3300005353 Ga0070669_100062644 Ga0070669_1000626441 212
982 3300005435 Ga0070714_100226102 Ga0070714_1002261023 212
983 3300005436 Ga0070713_100036322 Ga0070713_1000363225 212
984 3300005445 Ga0070708_100179160 Ga0070708_1001791603 212
985 3300005467 Ga0070706_100035985 Ga0070706_1000359853 212
986 3300005468 Ga0070707_100006340 Ga0070707_1000063404 212
987 3300005471 Ga0070698_100001679 Ga0070698_10000167914 212
988 3300005471 Ga0070698_100078675 Ga0070698_1000786754 212
989 3300005471 Ga0070698_100097602 Ga0070698_1000976022 212
990 3300005518 Ga0070699_100159013 Ga0070699_1001590132 212
991 3300005536 Ga0070697_100000185 Ga0070697_10000018515 212
992 3300005536 Ga0070697_100022623 Ga0070697_1000226234 212
993 3300005545 Ga0070695_100430563 Ga0070695_1004305631 212
994 3300005546 Ga0070696_100189408 Ga0070696_1001894082 212
995 3300005841 Ga0068863_100138935 Ga0068863_1001389353 212
996 3300006175 Ga0070712_100134018 Ga0070712_1001340182 212
997 3300006852 Ga0075433_10166511 Ga0075433_101665112 212
998 3300006914 Ga0075436_100359196 Ga0075436_1003591961 212
999 3300007265 Ga0099794_10146149 Ga0099794_101461492 212
1000 3300009093 Ga0105240_10034089 Ga0105240_100340893 212
1001 3300009093 Ga0105240_10735317 Ga0105240_107353171 212
1002 3300009098 Ga0105245_11412302 Ga0105245_114123021 212
1003 3300009148 Ga0105243_10096541 Ga0105243_100965412 212
1004 3300009148 Ga0105243_10574657 Ga0105243_105746571 212
1005 3300009553 Ga0105249_11034441 Ga0105249_110344411 212
1006 3300011119 Ga0105246_10983706 Ga0105246_109837061 212
1007 3300013297 Ga0157378_10897357 Ga0157378_108973571 212
1008 3300014326 Ga0157380_10065144 Ga0157380_100651443 212
1009 3300014326 Ga0157380_10834339 Ga0157380_108343391 212
1010 3300025910 Ga0207684_10008569 Ga0207684_100085694 212
1011 3300025910 Ga0207684_10041105 Ga0207684_100411052 212
1012 3300025922 Ga0207646_10069925 Ga0207646_100699253 212
1013 3300025923 Ga0207681_10003295 Ga0207681_100032956 212
1014 3300025925 Ga0207650_10018098 Ga0207650_100180984 212
1015 3300025928 Ga0207700_10024352 Ga0207700_100243524 212
1016 3300025929 Ga0207664_10037680 Ga0207664_100376805 212
1017 3300025933 Ga0207706_10152131 Ga0207706_101521312 212
1018 3300025934 Ga0207686_10470987 Ga0207686_104709872 212
1019 3300025942 Ga0207689_10005831 Ga0207689_100058313 212
1020 3300026088 Ga0207641_10120388 Ga0207641_101203882 212
1021 3300028800 Ga0265338_10113490 Ga0265338_101134902 212
1022 3300031090 Ga0265760_10057064 Ga0265760_100570641 212
1023 3300031241 Ga0265325_10018497 Ga0265325_100184972 212
1024 3300031241 Ga0265325_10023255 Ga0265325_100232553 212
1025 3300031247 Ga0265340_10009415 Ga0265340_100094153 212
1026 3300031247 Ga0265340_10021003 Ga0265340_100210034 212
1027 3300031247 Ga0265340_10144543 Ga0265340_101445432 212
1028 3300031249 Ga0265339_10000041 Ga0265339_1000004137 212
1029 3300031249 Ga0265339_10008146 Ga0265339_100081467 212
1030 3300031249 Ga0265339_10140922 Ga0265339_101409221 212
1031 3300031250 Ga0265331_10005230 Ga0265331_100052309 212
1032 3300031344 Ga0265316_10313457 Ga0265316_103134571 212
1033 3300031595 Ga0265313_10000295 Ga0265313_1000029529 212
1034 3300031711 Ga0265314_10015714 Ga0265314_100157147 212
1035 3300031712 Ga0265342_10020393 Ga0265342_100203933 212
1036 3300031712 Ga0265342_10051354 Ga0265342_100513542 212
1037 3300037068 Ga0373925_0044359 Ga0373925_0044359_604_1296 212
1038 3300039438 Ga0436360_1310211 Ga0436360_1310211_288_944 212
1039 3300045976 Ga0466967_0194008 Ga0466967_0194008_529_1185 212
1040 3300046533 Ga0495640_0014441 Ga0495640_0014441_3061_3753 212
1041 3300046539 Ga0495621_0000338 Ga0495621_0000338_5177_5842 212
1042 3300047318 Ga0495636_0259836 Ga0495636_0259836_131_769 212
1043 3300048913 Ga0496110_1032687 Ga0496110_1032687_53_691 212
1044 3300053077 Ga0495601_0314731 Ga0495601_0314731_256_948 212

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09335

VTT_dom

VTT domain

72

199

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
8giw-assembly2.cif.gz_D c143k variant of citrate synthase (cita) in mycobacterium tuberculosis 0.3877 30 167
8s9d-assembly1.cif.gz_A-2 c143s variant of citrate synthase (cita) in mycobacterium tuberculosis 0.3588 24 167
8gm9-assembly2.cif.gz_C structure of citrate synthase(cita) in mycobacterium tuberculosis 0.3455 24 167
3tdx-assembly1.cif.gz_E crystal structure of hsc l82v 0.2949 4 167
3tds-assembly1.cif.gz_E crystal structure of hsc f194i 0.2938 4 167
ID Description Score Start End Superfamily
af_P0ADR0_21_135_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.8127 41 163 1.10.1760.20
af_P0ADR0_21_135_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.77 41 163 1.10.1760.20
af_Q2FUT1_1_180_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.3189 6 161 1.10.1760.20
af_Q8BG39_106_432_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.3185 26 195 1.20.1250.20
af_A0A1D6N1F2_8_207_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.3073 25 190 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A7V4DCA7-F1-model_v4 DedA family protein 0.937 2 162 GO:0005886
AF-A0A431JC60-F1-model_v4 deleted 0.935 2 156
AF-A0A4P5WPZ3-F1-model_v4 Alkaline phosphatase 0.9344 2 202 GO:0005886
AF-A0A381U777-F1-model_v4 VTT domain-containing protein 0.9332 20 171 GO:0005886
AF-A0A7V3RDZ0-F1-model_v4 DedA family protein 0.9322 1 169 GO:0005886

Feature Viewer

pLDDT pTM Quality
71.26 0.65 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map