F488910
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1044 | 460 | 1038 | 211 |
Family's Representative Sequence
| Representative Sequence | 3300031344|Ga0265316_10006492|Ga0265316_100064925 |
| Length | 250 |
| Sequence | LGHIAARLKPCPFKAPGALAQSTGGHWPYILNGSMSERILAFVVQFVTHVIDLGGYAGIVALMGIESACIPLPSEVIMPFAGYLVYMGHFNLFWVATMGALGCNLGSVVAYAIGARGGRPLVERYGKWVLMSHHDLDRMTWFFQRYGSIAVLLGRLLPVVRTFIAFPAGIAKMPQIRFHLYTFAGSWPWCFGLAYVGMKLGEKWHTDPRFYQAFHRFHLGVEIALVAGIVWFVWSHIKRGRRNEAALDPQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2884215851 | Edaphobacter sp. 12200R-103 | Isolate | Rhizosphere |
| 3 | 2895395659 | Rhodanobacter sp. T12-5 | Isolate | Unclassified |
| 4 | 2928027323 | Sphingomonas sp. 1185 | Isolate | Unclassified |
| 5 | 2984555340 | Sphingomonas sp. SORGH_AS789 | Isolate | Aerial Root |
| 6 | 2984564862 | Sphingomonas sp. SORGH_AS870 | Isolate | Aerial Root |
| 7 | 2993356040 | Sphingomonas sp. SORGH_AS742 | Isolate | Aerial Root |
| 8 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 9 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 10 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 11 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 12 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 13 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 14 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 15 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 16 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 17 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 24 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 26 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 28 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 30 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 41 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 57 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 58 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 59 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 60 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 62 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 64 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 65 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 66 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 67 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 69 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 70 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 74 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 75 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 77 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 78 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 79 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 81 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 82 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 83 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 84 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 85 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 86 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 87 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 88 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 89 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 91 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 92 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 93 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 94 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 95 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 97 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 98 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 99 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 100 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 101 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 102 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 103 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 104 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 105 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 107 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 108 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 109 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 137 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 139 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 140 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 141 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 142 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 143 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300027424 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 223 | 3300028017 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 | Metagenome | Rhizosphere |
| 224 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 228 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 229 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 230 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 231 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 232 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 233 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 234 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 235 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 236 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 237 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 238 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 239 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 240 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 241 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 242 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 243 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 244 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 245 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 246 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 247 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 248 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 249 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 250 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 251 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 252 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 253 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 254 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 255 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 256 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 257 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 258 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 259 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 260 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 261 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 262 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 263 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 264 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 265 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 266 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 267 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 268 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 269 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 270 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 271 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 272 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 273 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 274 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 275 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 276 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 277 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 278 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 279 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 280 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 281 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 282 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 283 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 284 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 285 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 286 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 287 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 288 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 289 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 290 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 291 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 292 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 293 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 294 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 295 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 296 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 297 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 298 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 299 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 300 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 301 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 302 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 303 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 350 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 351 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 352 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 353 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 354 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 355 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 356 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 357 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 358 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 359 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 360 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 361 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 362 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 363 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 364 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 366 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 367 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 368 | 3300049516 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought | Metagenome | Rhizosphere |
| 369 | 3300049518 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control | Metagenome | Rhizosphere |
| 370 | 3300049519 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought | Metagenome | Rhizosphere |
| 371 | 3300049520 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought | Metagenome | Rhizosphere |
| 372 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 373 | 3300049524 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H21_B_7_control | Metagenome | Rhizosphere |
| 374 | 3300049525 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F21_B_7_control | Metagenome | Rhizosphere |
| 375 | 3300049526 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control | Metagenome | Rhizosphere |
| 376 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 377 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 378 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 379 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 380 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 381 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 382 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 383 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 384 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 385 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 386 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 387 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 388 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 389 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 390 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 391 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 392 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 393 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 394 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 395 | 3300049651 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought | Metagenome | Rhizosphere |
| 396 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 397 | 3300049656 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought | Metagenome | Rhizosphere |
| 398 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 399 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 400 | 3300049666 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control | Metagenome | Rhizosphere |
| 401 | 3300049667 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control | Metagenome | Rhizosphere |
| 402 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 403 | 3300049672 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought | Metagenome | Rhizosphere |
| 404 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 405 | 3300049676 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control | Metagenome | Rhizosphere |
| 406 | 3300049677 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control | Metagenome | Rhizosphere |
| 407 | 3300049678 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought | Metagenome | Rhizosphere |
| 408 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 409 | 3300049681 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought | Metagenome | Rhizosphere |
| 410 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 411 | 3300049687 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought | Metagenome | Rhizosphere |
| 412 | 3300049689 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought | Metagenome | Rhizosphere |
| 413 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 414 | 3300049703 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control | Metagenome | Rhizosphere |
| 415 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 416 | 3300049706 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control | Metagenome | Rhizosphere |
| 417 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 418 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 419 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 420 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 421 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 422 | 3300049761 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control | Metagenome | Rhizosphere |
| 423 | 3300049762 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control | Metagenome | Rhizosphere |
| 424 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 425 | 3300049764 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control | Metagenome | Rhizosphere |
| 426 | 3300049768 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought | Metagenome | Rhizosphere |
| 427 | 3300049769 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought | Metagenome | Rhizosphere |
| 428 | 3300049770 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control | Metagenome | Rhizosphere |
| 429 | 3300049771 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control | Metagenome | Rhizosphere |
| 430 | 3300049773 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control | Metagenome | Rhizosphere |
| 431 | 3300049774 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought | Metagenome | Rhizosphere |
| 432 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 433 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 434 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 435 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 436 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 437 | 3300049851 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought | Metagenome | Rhizosphere |
| 438 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 439 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 440 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 441 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 442 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 443 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 444 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 445 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 446 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 447 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 448 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 449 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 450 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 451 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 452 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 453 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 454 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 455 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 456 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 457 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 458 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 459 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 460 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.14 |
| Metatranscriptomes | 0.29 |
| Isolates | 0.57 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.29 |
| Bulb | 0 |
| Endosphere | 1.44 |
| Nodule | 0 |
| Rhizoplane | 1.05 |
| Rhizosphere | 93.87 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.35 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_301344 | 2162886007 | Bacteria | 1454 |
| 2 | JGI24737J22298_10035281 | 3300001990 | Bacteria | 1548 |
| 3 | JGI24735J21928_10011016 | 3300002067 | Bacteria | 2873 |
| 4 | JGI24738J21930_10024866 | 3300002075 | Bacteria | 1231 |
| 5 | JGI25165J46597_1000023 | 3300003214 | Bacteria | 338873 |
| 6 | rootH2_10059427 | 3300003320 | Bacteria | 3381 |
| 7 | Ga0058862_10201493 | 3300004803 | Bacteria | 3907 |
| 8 | Ga0065704_10082883 | 3300005289 | Bacteria | 3539 |
| 9 | Ga0065715_10018369 | 3300005293 | Bacteria | 1755 |
| 10 | Ga0065715_10093602 | 3300005293 | Bacteria | 4626 |
| 11 | Ga0065707_10083298 | 3300005295 | Bacteria | 9610 |
| 12 | Ga0065707_10178805 | 3300005295 | Bacteria | 1432 |
| 13 | Ga0070658_10000010 | 3300005327 | Bacteria | 297212 |
| 14 | Ga0070658_10001110 | 3300005327 | Bacteria | 22978 |
| 15 | Ga0070658_10011417 | 3300005327 | Bacteria | 7124 |
| 16 | Ga0070658_10017036 | 3300005327 | Bacteria | 5815 |
| 17 | Ga0070658_10058839 | 3300005327 | Unclassified | 3129 |
| 18 | Ga0070658_10061244 | 3300005327 | Bacteria | 3066 |
| 19 | Ga0070658_10267601 | 3300005327 | Bacteria | 1453 |
| 20 | Ga0070658_10472471 | 3300005327 | Bacteria | 1082 |
| 21 | Ga0070658_10644503 | 3300005327 | Bacteria | 919 |
| 22 | Ga0070676_10000104 | 3300005328 | Bacteria | 30258 |
| 23 | Ga0070676_10005496 | 3300005328 | Bacteria | 6748 |
| 24 | Ga0070683_100055157 | 3300005329 | Unclassified | 3687 |
| 25 | Ga0070683_100081574 | 3300005329 | Bacteria | 3028 |
| 26 | Ga0070683_100122814 | 3300005329 | Bacteria | 2453 |
| 27 | Ga0070683_100201881 | 3300005329 | Bacteria | 1888 |
| 28 | Ga0070683_100593170 | 3300005329 | Archaea | 1060 |
| 29 | Ga0070690_100000347 | 3300005330 | Bacteria | 23886 |
| 30 | Ga0070690_100002465 | 3300005330 | Bacteria | 9950 |
| 31 | Ga0070690_100019596 | 3300005330 | Bacteria | 4109 |
| 32 | Ga0070670_100001702 | 3300005331 | Bacteria | 17907 |
| 33 | Ga0070670_100094759 | 3300005331 | Bacteria | 2567 |
| 34 | Ga0070670_100288284 | 3300005331 | Bacteria | 1434 |
| 35 | Ga0070677_10003087 | 3300005333 | Bacteria | 5348 |
| 36 | Ga0068869_100001148 | 3300005334 | Bacteria | 15451 |
| 37 | Ga0068869_100012828 | 3300005334 | Bacteria | 5546 |
| 38 | Ga0068869_100027201 | 3300005334 | Bacteria | 3985 |
| 39 | Ga0068869_100206486 | 3300005334 | Bacteria | 1551 |
| 40 | Ga0070666_10368401 | 3300005335 | Bacteria | 1030 |
| 41 | Ga0070680_100001484 | 3300005336 | Bacteria | 17049 |
| 42 | Ga0070680_100003506 | 3300005336 | Bacteria | 11708 |
| 43 | Ga0070680_100010569 | 3300005336 | Bacteria | 7121 |
| 44 | Ga0070680_100417852 | 3300005336 | Bacteria | 1144 |
| 45 | Ga0070680_100473280 | 3300005336 | Bacteria | 1071 |
| 46 | Ga0070682_100109549 | 3300005337 | Bacteria | 1838 |
| 47 | Ga0070682_100299018 | 3300005337 | Bacteria | 1180 |
| 48 | Ga0070682_100578953 | 3300005337 | Bacteria | 883 |
| 49 | Ga0068868_100000073 | 3300005338 | Bacteria | 58910 |
| 50 | Ga0070660_100001591 | 3300005339 | Bacteria | 15602 |
| 51 | Ga0070660_100008686 | 3300005339 | Bacteria | 7113 |
| 52 | Ga0070660_100533940 | 3300005339 | Bacteria | 978 |
| 53 | Ga0070689_100000037 | 3300005340 | Bacteria | 82373 |
| 54 | Ga0070689_100001740 | 3300005340 | Bacteria | 13940 |
| 55 | Ga0070689_100656150 | 3300005340 | Bacteria | 913 |
| 56 | Ga0070691_10004779 | 3300005341 | Bacteria | 6163 |
| 57 | Ga0070687_100004347 | 3300005343 | Bacteria | 5642 |
| 58 | Ga0070661_100139136 | 3300005344 | Bacteria | 1828 |
| 59 | Ga0070661_100223159 | 3300005344 | Bacteria | 1446 |
| 60 | Ga0070661_100405893 | 3300005344 | Bacteria | 1078 |
| 61 | Ga0070692_10002936 | 3300005345 | Bacteria | 6771 |
| 62 | Ga0070692_10136461 | 3300005345 | Bacteria | 1384 |
| 63 | Ga0070668_100114637 | 3300005347 | Bacteria | 2147 |
| 64 | Ga0070669_100011872 | 3300005353 | Bacteria | 6180 |
| 65 | Ga0070669_100062644 | 3300005353 | Bacteria | 2735 |
| 66 | Ga0070675_100101571 | 3300005354 | Bacteria | 2423 |
| 67 | Ga0070671_100003495 | 3300005355 | Bacteria | 12264 |
| 68 | Ga0070674_100003796 | 3300005356 | Bacteria | 8536 |
| 69 | Ga0070673_100000047 | 3300005364 | Bacteria | 50070 |
| 70 | Ga0070673_100006972 | 3300005364 | Bacteria | 7399 |
| 71 | Ga0070673_100666738 | 3300005364 | Bacteria | 953 |
| 72 | Ga0070688_100000176 | 3300005365 | Bacteria | 34332 |
| 73 | Ga0070688_100107882 | 3300005365 | Bacteria | 1847 |
| 74 | Ga0070688_100380416 | 3300005365 | Bacteria | 1040 |
| 75 | Ga0070688_100758418 | 3300005365 | Bacteria | 756 |
| 76 | Ga0070659_100000313 | 3300005366 | Bacteria | 37870 |
| 77 | Ga0070659_100339597 | 3300005366 | Bacteria | 1258 |
| 78 | Ga0070659_100410270 | 3300005366 | Bacteria | 1144 |
| 79 | Ga0070667_100056577 | 3300005367 | Bacteria | 3314 |
| 80 | Ga0070709_10184785 | 3300005434 | Unclassified | 1466 |
| 81 | Ga0070709_10324365 | 3300005434 | Bacteria | 1131 |
| 82 | Ga0070714_100226102 | 3300005435 | Bacteria | 1722 |
| 83 | Ga0070714_100345453 | 3300005435 | Bacteria | 1396 |
| 84 | Ga0070714_100971284 | 3300005435 | Bacteria | 826 |
| 85 | Ga0070713_100036322 | 3300005436 | Bacteria | 3975 |
| 86 | Ga0070713_100038385 | 3300005436 | Bacteria | 3880 |
| 87 | Ga0070710_10069362 | 3300005437 | Bacteria | 2028 |
| 88 | Ga0070710_10518414 | 3300005437 | Bacteria | 818 |
| 89 | Ga0070701_10000079 | 3300005438 | Bacteria | 26864 |
| 90 | Ga0070711_100038261 | 3300005439 | Bacteria | 3225 |
| 91 | Ga0070705_100011424 | 3300005440 | Bacteria | 4480 |
| 92 | Ga0070705_100059492 | 3300005440 | Bacteria | 2263 |
| 93 | Ga0070705_100394558 | 3300005440 | Bacteria | 1023 |
| 94 | Ga0070705_100714401 | 3300005440 | Bacteria | 789 |
| 95 | Ga0070700_100000334 | 3300005441 | Bacteria | 24482 |
| 96 | Ga0070700_100103673 | 3300005441 | Bacteria | 1878 |
| 97 | Ga0070694_100022341 | 3300005444 | Bacteria | 4052 |
| 98 | Ga0070694_100175669 | 3300005444 | Bacteria | 1581 |
| 99 | Ga0070694_100181065 | 3300005444 | Bacteria | 1559 |
| 100 | Ga0070694_100574632 | 3300005444 | Bacteria | 905 |
| 101 | Ga0070708_100053670 | 3300005445 | Bacteria | 3577 |
| 102 | Ga0070708_100179160 | 3300005445 | Bacteria | 1980 |
| 103 | Ga0070708_100873390 | 3300005445 | Bacteria | 845 |
| 104 | Ga0070663_100005903 | 3300005455 | Bacteria | 7326 |
| 105 | Ga0070663_100010199 | 3300005455 | Bacteria | 5850 |
| 106 | Ga0070663_100013623 | 3300005455 | Bacteria | 5191 |
| 107 | Ga0070663_100076604 | 3300005455 | Bacteria | 2446 |
| 108 | Ga0070663_100222644 | 3300005455 | Archaea | 1482 |
| 109 | Ga0070678_100000915 | 3300005456 | Bacteria | 15149 |
| 110 | Ga0070662_100001269 | 3300005457 | Bacteria | 15505 |
| 111 | Ga0070681_10006757 | 3300005458 | Bacteria | 11165 |
| 112 | Ga0070681_10012093 | 3300005458 | Bacteria | 8558 |
| 113 | Ga0070681_10022448 | 3300005458 | Bacteria | 6336 |
| 114 | Ga0070681_10023191 | 3300005458 | Bacteria | 6242 |
| 115 | Ga0070681_10067584 | 3300005458 | Bacteria | 3542 |
| 116 | Ga0070681_10074256 | 3300005458 | Bacteria | 3361 |
| 117 | Ga0070681_10103061 | 3300005458 | Bacteria | 2798 |
| 118 | Ga0070681_10104289 | 3300005458 | Bacteria | 2778 |
| 119 | Ga0070681_10136893 | 3300005458 | Bacteria | 2379 |
| 120 | Ga0070681_10212113 | 3300005458 | Bacteria | 1852 |
| 121 | Ga0070681_10401611 | 3300005458 | Bacteria | 1282 |
| 122 | Ga0068867_100000119 | 3300005459 | Bacteria | 50149 |
| 123 | Ga0068867_100000402 | 3300005459 | Bacteria | 29031 |
| 124 | Ga0068867_100003137 | 3300005459 | Bacteria | 11660 |
| 125 | Ga0068867_100610739 | 3300005459 | Bacteria | 952 |
| 126 | Ga0070685_10000066 | 3300005466 | Bacteria | 61531 |
| 127 | Ga0070706_100035985 | 3300005467 | Unclassified | 4572 |
| 128 | Ga0070706_100141818 | 3300005467 | Bacteria | 2243 |
| 129 | Ga0070706_100162916 | 3300005467 | Bacteria | 2082 |
| 130 | Ga0070707_100000072 | 3300005468 | Bacteria | 91592 |
| 131 | Ga0070707_100006340 | 3300005468 | Bacteria | 10997 |
| 132 | Ga0070707_100235707 | 3300005468 | Bacteria | 1781 |
| 133 | Ga0070707_100265752 | 3300005468 | Bacteria | 1669 |
| 134 | Ga0070707_100791006 | 3300005468 | Bacteria | 912 |
| 135 | Ga0070698_100000654 | 3300005471 | Bacteria | 37064 |
| 136 | Ga0070698_100001679 | 3300005471 | Bacteria | 24687 |
| 137 | Ga0070698_100005990 | 3300005471 | Bacteria | 13256 |
| 138 | Ga0070698_100041365 | 3300005471 | Bacteria | 4731 |
| 139 | Ga0070698_100078675 | 3300005471 | Bacteria | 3295 |
| 140 | Ga0070698_100097602 | 3300005471 | Bacteria | 2914 |
| 141 | Ga0070698_100124329 | 3300005471 | Bacteria | 2537 |
| 142 | Ga0070699_100000005 | 3300005518 | Bacteria | 384287 |
| 143 | Ga0070699_100007860 | 3300005518 | Bacteria | 9265 |
| 144 | Ga0070699_100159013 | 3300005518 | Bacteria | 1999 |
| 145 | Ga0070699_100167110 | 3300005518 | Bacteria | 1949 |
| 146 | Ga0070699_100227953 | 3300005518 | Bacteria | 1661 |
| 147 | Ga0070699_100300786 | 3300005518 | Bacteria | 1439 |
| 148 | Ga0070679_100024432 | 3300005530 | Bacteria | 5921 |
| 149 | Ga0070679_100029563 | 3300005530 | Bacteria | 5406 |
| 150 | Ga0070679_100034244 | 3300005530 | Bacteria | 5033 |
| 151 | Ga0070679_100162689 | 3300005530 | Bacteria | 2206 |
| 152 | Ga0070679_100337399 | 3300005530 | Bacteria | 1455 |
| 153 | Ga0070679_100387941 | 3300005530 | Bacteria | 1343 |
| 154 | Ga0070679_100452016 | 3300005530 | Archaea | 1229 |
| 155 | Ga0070679_100520102 | 3300005530 | Bacteria | 1134 |
| 156 | Ga0070684_100156619 | 3300005535 | Bacteria | 2066 |
| 157 | Ga0070684_100360872 | 3300005535 | Archaea | 1337 |
| 158 | Ga0070697_100000185 | 3300005536 | Bacteria | 51425 |
| 159 | Ga0070697_100005515 | 3300005536 | Bacteria | 9752 |
| 160 | Ga0070697_100010394 | 3300005536 | Bacteria | 7262 |
| 161 | Ga0070697_100022623 | 3300005536 | Bacteria | 4992 |
| 162 | Ga0070697_100113279 | 3300005536 | Bacteria | 2263 |
| 163 | Ga0068853_100000014 | 3300005539 | Bacteria | 227023 |
| 164 | Ga0068853_100014923 | 3300005539 | Bacteria | 6381 |
| 165 | Ga0068853_100018832 | 3300005539 | Bacteria | 5717 |
| 166 | Ga0068853_100183011 | 3300005539 | Bacteria | 1901 |
| 167 | Ga0070672_100028473 | 3300005543 | Bacteria | 4180 |
| 168 | Ga0070672_100144460 | 3300005543 | Bacteria | 1965 |
| 169 | Ga0070686_100000072 | 3300005544 | Bacteria | 75694 |
| 170 | Ga0070686_100001120 | 3300005544 | Bacteria | 15412 |
| 171 | Ga0070686_100052555 | 3300005544 | Bacteria | 2599 |
| 172 | Ga0070686_100153962 | 3300005544 | Unclassified | 1612 |
| 173 | Ga0070695_100001295 | 3300005545 | Bacteria | 13806 |
| 174 | Ga0070695_100117864 | 3300005545 | Bacteria | 1812 |
| 175 | Ga0070695_100430563 | 3300005545 | Bacteria | 1007 |
| 176 | Ga0070695_100515902 | 3300005545 | Bacteria | 927 |
| 177 | Ga0070696_100004259 | 3300005546 | Bacteria | 9541 |
| 178 | Ga0070696_100004964 | 3300005546 | Bacteria | 8882 |
| 179 | Ga0070696_100082144 | 3300005546 | Bacteria | 2284 |
| 180 | Ga0070696_100121612 | 3300005546 | Bacteria | 1890 |
| 181 | Ga0070696_100189408 | 3300005546 | Bacteria | 1530 |
| 182 | Ga0070693_100007294 | 3300005547 | Bacteria | 5400 |
| 183 | Ga0070693_100025282 | 3300005547 | Bacteria | 3195 |
| 184 | Ga0070693_100079033 | 3300005547 | Bacteria | 1956 |
| 185 | Ga0070693_100148917 | 3300005547 | Unclassified | 1480 |
| 186 | Ga0070665_100080652 | 3300005548 | Bacteria | 3260 |
| 187 | Ga0070704_100057938 | 3300005549 | Bacteria | 2757 |
| 188 | Ga0070704_100063948 | 3300005549 | Bacteria | 2642 |
| 189 | Ga0068855_100005375 | 3300005563 | Bacteria | 15622 |
| 190 | Ga0068855_100088628 | 3300005563 | Bacteria | 3574 |
| 191 | Ga0068855_100313116 | 3300005563 | Bacteria | 1736 |
| 192 | Ga0068855_100401908 | 3300005563 | Unclassified | 1501 |
| 193 | Ga0068855_100454905 | 3300005563 | Bacteria | 1396 |
| 194 | Ga0068855_100501393 | 3300005563 | Bacteria | 1319 |
| 195 | Ga0068855_100533080 | 3300005563 | Bacteria | 1273 |
| 196 | Ga0070664_100000873 | 3300005564 | Bacteria | 23360 |
| 197 | Ga0070664_100003255 | 3300005564 | Bacteria | 13118 |
| 198 | Ga0068857_100053911 | 3300005577 | Bacteria | 3567 |
| 199 | Ga0068857_100113923 | 3300005577 | Bacteria | 2432 |
| 200 | Ga0068857_100240030 | 3300005577 | Bacteria | 1659 |
| 201 | Ga0068857_100664463 | 3300005577 | Bacteria | 988 |
| 202 | Ga0068854_100000014 | 3300005578 | Bacteria | 163231 |
| 203 | Ga0068854_100000874 | 3300005578 | Bacteria | 18073 |
| 204 | Ga0068854_100011675 | 3300005578 | Bacteria | 5729 |
| 205 | Ga0068854_100079955 | 3300005578 | Bacteria | 2412 |
| 206 | Ga0068854_100112690 | 3300005578 | Bacteria | 2054 |
| 207 | Ga0068856_100161800 | 3300005614 | Bacteria | 2249 |
| 208 | Ga0068856_100200125 | 3300005614 | Bacteria | 2012 |
| 209 | Ga0068856_100257262 | 3300005614 | Bacteria | 1761 |
| 210 | Ga0070702_100004518 | 3300005615 | Bacteria | 6364 |
| 211 | Ga0070702_100033964 | 3300005615 | Bacteria | 2808 |
| 212 | Ga0068852_100051406 | 3300005616 | Bacteria | 3536 |
| 213 | Ga0068859_100587780 | 3300005617 | Bacteria | 1207 |
| 214 | Ga0068864_100000111 | 3300005618 | Bacteria | 79723 |
| 215 | Ga0068864_100097668 | 3300005618 | Bacteria | 2601 |
| 216 | Ga0068861_100011968 | 3300005719 | Bacteria | 6042 |
| 217 | Ga0068861_100017480 | 3300005719 | Bacteria | 5094 |
| 218 | Ga0068861_100089507 | 3300005719 | Bacteria | 2426 |
| 219 | Ga0068863_100138935 | 3300005841 | Bacteria | 2322 |
| 220 | Ga0068858_100000022 | 3300005842 | Bacteria | 169718 |
| 221 | Ga0068860_100011193 | 3300005843 | Bacteria | 8841 |
| 222 | Ga0068860_100013042 | 3300005843 | Bacteria | 8157 |
| 223 | Ga0068862_100000095 | 3300005844 | Bacteria | 105957 |
| 224 | Ga0068862_100110279 | 3300005844 | Bacteria | 2415 |
| 225 | Ga0068862_100466318 | 3300005844 | Bacteria | 1193 |
| 226 | Ga0081539_10001185 | 3300005985 | Bacteria | 47102 |
| 227 | Ga0070717_10240298 | 3300006028 | Bacteria | 1597 |
| 228 | Ga0075432_10000146 | 3300006058 | Bacteria | 16762 |
| 229 | Ga0070715_10130521 | 3300006163 | Bacteria | 1209 |
| 230 | Ga0070715_10131828 | 3300006163 | Unclassified | 1204 |
| 231 | Ga0070716_100019973 | 3300006173 | Bacteria | 3511 |
| 232 | Ga0070716_100207092 | 3300006173 | Bacteria | 1308 |
| 233 | Ga0070716_100235405 | 3300006173 | Unclassified | 1239 |
| 234 | Ga0070716_100322906 | 3300006173 | Bacteria | 1082 |
| 235 | Ga0070712_100001112 | 3300006175 | Bacteria | 16199 |
| 236 | Ga0070712_100134018 | 3300006175 | Bacteria | 1881 |
| 237 | Ga0070712_100236338 | 3300006175 | Bacteria | 1454 |
| 238 | Ga0075366_10136273 | 3300006195 | Unclassified | 1483 |
| 239 | Ga0097621_100020509 | 3300006237 | Bacteria | 5093 |
| 240 | Ga0097621_100089216 | 3300006237 | Bacteria | 2577 |
| 241 | Ga0097621_100122288 | 3300006237 | Bacteria | 2209 |
| 242 | Ga0097621_100291482 | 3300006237 | Bacteria | 1439 |
| 243 | Ga0097621_100506732 | 3300006237 | Bacteria | 1094 |
| 244 | Ga0068871_100044823 | 3300006358 | Bacteria | 3558 |
| 245 | Ga0068871_100099478 | 3300006358 | Bacteria | 2435 |
| 246 | Ga0075428_100824092 | 3300006844 | Bacteria | 986 |
| 247 | Ga0075430_100006526 | 3300006846 | Bacteria | 9838 |
| 248 | Ga0075430_100008729 | 3300006846 | Bacteria | 8554 |
| 249 | Ga0075430_100017031 | 3300006846 | Bacteria | 6190 |
| 250 | Ga0075431_100011189 | 3300006847 | Bacteria | 9036 |
| 251 | Ga0075433_10005027 | 3300006852 | Bacteria | 10365 |
| 252 | Ga0075433_10008862 | 3300006852 | Bacteria | 8026 |
| 253 | Ga0075433_10018091 | 3300006852 | Bacteria | 5850 |
| 254 | Ga0075433_10109987 | 3300006852 | Bacteria | 2445 |
| 255 | Ga0075433_10115992 | 3300006852 | Bacteria | 2376 |
| 256 | Ga0075433_10166511 | 3300006852 | Bacteria | 1962 |
| 257 | Ga0075434_100097005 | 3300006871 | Unclassified | 2952 |
| 258 | Ga0075434_100442007 | 3300006871 | Bacteria | 1322 |
| 259 | Ga0075429_100011609 | 3300006880 | Bacteria | 7640 |
| 260 | Ga0075429_100050521 | 3300006880 | Bacteria | 3617 |
| 261 | Ga0068865_100000005 | 3300006881 | Bacteria | 213248 |
| 262 | Ga0068865_100001245 | 3300006881 | Bacteria | 14819 |
| 263 | Ga0068865_100567845 | 3300006881 | Bacteria | 955 |
| 264 | Ga0075436_100074038 | 3300006914 | Bacteria | 2358 |
| 265 | Ga0075436_100114555 | 3300006914 | Bacteria | 1883 |
| 266 | Ga0075436_100138760 | 3300006914 | Bacteria | 1708 |
| 267 | Ga0075436_100359196 | 3300006914 | Unclassified | 1051 |
| 268 | Ga0075436_100452430 | 3300006914 | Bacteria | 935 |
| 269 | Ga0097620_100033113 | 3300006931 | Bacteria | 5191 |
| 270 | Ga0097620_100587815 | 3300006931 | Bacteria | 1207 |
| 271 | Ga0075435_100068984 | 3300007076 | Bacteria | 2881 |
| 272 | Ga0075435_100286224 | 3300007076 | Archaea | 1407 |
| 273 | Ga0099794_10146149 | 3300007265 | Bacteria | 1199 |
| 274 | Ga0099795_10221620 | 3300007788 | Bacteria | 805 |
| 275 | Ga0105240_10029355 | 3300009093 | Bacteria | 7167 |
| 276 | Ga0105240_10034089 | 3300009093 | Bacteria | 6571 |
| 277 | Ga0105240_10039411 | 3300009093 | Bacteria | 6050 |
| 278 | Ga0105240_10071968 | 3300009093 | Bacteria | 4274 |
| 279 | Ga0105240_10102207 | 3300009093 | Bacteria | 3484 |
| 280 | Ga0105240_10182979 | 3300009093 | Bacteria | 2471 |
| 281 | Ga0105240_10448481 | 3300009093 | Bacteria | 1444 |
| 282 | Ga0105240_10735317 | 3300009093 | Bacteria | 1074 |
| 283 | Ga0105240_11066389 | 3300009093 | Unclassified | 861 |
| 284 | Ga0105240_11393867 | 3300009093 | Bacteria | 737 |
| 285 | Ga0105245_10000281 | 3300009098 | Bacteria | 48386 |
| 286 | Ga0105245_10001545 | 3300009098 | Bacteria | 20877 |
| 287 | Ga0105245_10020460 | 3300009098 | Bacteria | 5804 |
| 288 | Ga0105245_11412302 | 3300009098 | Bacteria | 746 |
| 289 | Ga0105247_10003191 | 3300009101 | Bacteria | 10807 |
| 290 | Ga0114129_10007246 | 3300009147 | Bacteria | 15788 |
| 291 | Ga0114129_10012148 | 3300009147 | Bacteria | 12260 |
| 292 | Ga0114129_10297553 | 3300009147 | Bacteria | 2152 |
| 293 | Ga0114129_10830192 | 3300009147 | Bacteria | 1177 |
| 294 | Ga0105243_10000411 | 3300009148 | Bacteria | 44928 |
| 295 | Ga0105243_10016408 | 3300009148 | Bacteria | 5602 |
| 296 | Ga0105243_10096541 | 3300009148 | Bacteria | 2445 |
| 297 | Ga0105243_10247019 | 3300009148 | Bacteria | 1591 |
| 298 | Ga0105243_10574657 | 3300009148 | Bacteria | 1081 |
| 299 | Ga0105241_10020096 | 3300009174 | Bacteria | 4933 |
| 300 | Ga0105241_10125412 | 3300009174 | Bacteria | 2073 |
| 301 | Ga0105241_10183356 | 3300009174 | Bacteria | 1738 |
| 302 | Ga0105242_10001969 | 3300009176 | Bacteria | 16156 |
| 303 | Ga0105242_10005679 | 3300009176 | Bacteria | 9628 |
| 304 | Ga0105242_10080013 | 3300009176 | Bacteria | 2730 |
| 305 | Ga0105242_10152312 | 3300009176 | Bacteria | 2017 |
| 306 | Ga0105242_10160971 | 3300009176 | Bacteria | 1965 |
| 307 | Ga0105248_10002568 | 3300009177 | Bacteria | 20184 |
| 308 | Ga0105248_10006274 | 3300009177 | Bacteria | 13040 |
| 309 | Ga0105248_10081810 | 3300009177 | Bacteria | 3630 |
| 310 | Ga0105248_10157103 | 3300009177 | Unclassified | 2566 |
| 311 | Ga0105248_10718204 | 3300009177 | Archaea | 1127 |
| 312 | Ga0105237_10002288 | 3300009545 | Bacteria | 23796 |
| 313 | Ga0105237_10319578 | 3300009545 | Bacteria | 1556 |
| 314 | Ga0105237_10378438 | 3300009545 | Bacteria | 1420 |
| 315 | Ga0105237_10431142 | 3300009545 | Bacteria | 1324 |
| 316 | Ga0105237_10705893 | 3300009545 | Unclassified | 1015 |
| 317 | Ga0105238_10117902 | 3300009551 | Bacteria | 2635 |
| 318 | Ga0105249_10000079 | 3300009553 | Bacteria | 139904 |
| 319 | Ga0105249_10063181 | 3300009553 | Bacteria | 3401 |
| 320 | Ga0105249_11034441 | 3300009553 | Unclassified | 890 |
| 321 | Ga0105249_11037219 | 3300009553 | Unclassified | 889 |
| 322 | Ga0105239_10000025 | 3300010375 | Bacteria | 254049 |
| 323 | Ga0105239_10020412 | 3300010375 | Bacteria | 7309 |
| 324 | Ga0105239_10058747 | 3300010375 | Unclassified | 4221 |
| 325 | Ga0105239_10303359 | 3300010375 | Bacteria | 1798 |
| 326 | Ga0105239_10935765 | 3300010375 | Unclassified | 995 |
| 327 | Ga0105246_10007739 | 3300011119 | Bacteria | 6593 |
| 328 | Ga0105246_10067482 | 3300011119 | Bacteria | 2506 |
| 329 | Ga0105246_10080107 | 3300011119 | Bacteria | 2324 |
| 330 | Ga0105246_10983706 | 3300011119 | Bacteria | 763 |
| 331 | Ga0157373_10032985 | 3300013100 | Bacteria | 3727 |
| 332 | Ga0157373_10042767 | 3300013100 | Bacteria | 3237 |
| 333 | Ga0157371_10064577 | 3300013102 | Bacteria | 2593 |
| 334 | Ga0157371_10065655 | 3300013102 | Bacteria | 2570 |
| 335 | Ga0157370_10000611 | 3300013104 | Bacteria | 44454 |
| 336 | Ga0157370_10009337 | 3300013104 | Bacteria | 10496 |
| 337 | Ga0157370_10022338 | 3300013104 | Bacteria | 6296 |
| 338 | Ga0157370_10039339 | 3300013104 | Bacteria | 4570 |
| 339 | Ga0157370_10051887 | 3300013104 | Bacteria | 3916 |
| 340 | Ga0157370_10054949 | 3300013104 | Bacteria | 3795 |
| 341 | Ga0157370_10101703 | 3300013104 | Bacteria | 2692 |
| 342 | Ga0157370_10165738 | 3300013104 | Bacteria | 2055 |
| 343 | Ga0157369_10035178 | 3300013105 | Bacteria | 5494 |
| 344 | Ga0157369_10068459 | 3300013105 | Bacteria | 3814 |
| 345 | Ga0157369_10086664 | 3300013105 | Bacteria | 3344 |
| 346 | Ga0157369_10168943 | 3300013105 | Bacteria | 2305 |
| 347 | Ga0157369_10680569 | 3300013105 | Bacteria | 1060 |
| 348 | Ga0157369_10749327 | 3300013105 | Bacteria | 1005 |
| 349 | Ga0157374_10001017 | 3300013296 | Bacteria | 24339 |
| 350 | Ga0157374_10010625 | 3300013296 | Bacteria | 7927 |
| 351 | Ga0157374_10074484 | 3300013296 | Unclassified | 3206 |
| 352 | Ga0157374_10088416 | 3300013296 | Bacteria | 2951 |
| 353 | Ga0157374_10437316 | 3300013296 | Bacteria | 1308 |
| 354 | Ga0157378_10001127 | 3300013297 | Bacteria | 24339 |
| 355 | Ga0157378_10036078 | 3300013297 | Bacteria | 4376 |
| 356 | Ga0157378_10118500 | 3300013297 | Bacteria | 2437 |
| 357 | Ga0157378_10897357 | 3300013297 | Bacteria | 917 |
| 358 | Ga0163162_10099988 | 3300013306 | Bacteria | 2991 |
| 359 | Ga0163162_10147414 | 3300013306 | Bacteria | 2470 |
| 360 | Ga0157372_10048563 | 3300013307 | Bacteria | 4718 |
| 361 | Ga0157372_10083280 | 3300013307 | Bacteria | 3623 |
| 362 | Ga0157372_10091083 | 3300013307 | Bacteria | 3468 |
| 363 | Ga0157372_10102985 | 3300013307 | Bacteria | 3261 |
| 364 | Ga0157372_10180790 | 3300013307 | Bacteria | 2441 |
| 365 | Ga0157372_10185877 | 3300013307 | Bacteria | 2406 |
| 366 | Ga0157375_10002160 | 3300013308 | Bacteria | 17001 |
| 367 | Ga0157375_10159424 | 3300013308 | Bacteria | 2397 |
| 368 | Ga0157375_10870902 | 3300013308 | Bacteria | 1046 |
| 369 | Ga0163163_10244126 | 3300014325 | Bacteria | 1846 |
| 370 | Ga0163163_11510263 | 3300014325 | Unclassified | 733 |
| 371 | Ga0157380_10003770 | 3300014326 | Bacteria | 10422 |
| 372 | Ga0157380_10005347 | 3300014326 | Bacteria | 8972 |
| 373 | Ga0157380_10037236 | 3300014326 | Bacteria | 3768 |
| 374 | Ga0157380_10065144 | 3300014326 | Bacteria | 2927 |
| 375 | Ga0157380_10106604 | 3300014326 | Bacteria | 2345 |
| 376 | Ga0157380_10834339 | 3300014326 | Bacteria | 942 |
| 377 | Ga0157377_10003125 | 3300014745 | Bacteria | 7449 |
| 378 | Ga0157377_10030512 | 3300014745 | Bacteria | 2921 |
| 379 | Ga0157379_10081801 | 3300014968 | Bacteria | 2893 |
| 380 | Ga0157379_10213557 | 3300014968 | Bacteria | 1747 |
| 381 | Ga0157376_10001880 | 3300014969 | Bacteria | 14007 |
| 382 | Ga0157376_10002783 | 3300014969 | Bacteria | 11944 |
| 383 | Ga0157376_10028395 | 3300014969 | Bacteria | 4446 |
| 384 | Ga0157376_10222773 | 3300014969 | Unclassified | 1748 |
| 385 | Ga0182006_1020670 | 3300015261 | Bacteria | 2755 |
| 386 | Ga0163161_10180539 | 3300017792 | Bacteria | 1618 |
| 387 | Ga0213875_10004572 | 3300021388 | Bacteria | 7555 |
| 388 | Ga0213875_10018387 | 3300021388 | Bacteria | 3369 |
| 389 | Ga0213875_10032108 | 3300021388 | Bacteria | 2482 |
| 390 | Ga0207427_101709 | 3300025231 | Bacteria | 7280 |
| 391 | Ga0209148_1002133 | 3300025254 | Bacteria | 7386 |
| 392 | Ga0209233_1000003 | 3300025261 | Bacteria | 1607366 |
| 393 | Ga0209455_1000467 | 3300025272 | Bacteria | 30363 |
| 394 | Ga0207653_10019781 | 3300025885 | Bacteria | 2125 |
| 395 | Ga0207682_10058329 | 3300025893 | Bacteria | 1611 |
| 396 | Ga0207692_10167004 | 3300025898 | Bacteria | 1273 |
| 397 | Ga0207710_10040359 | 3300025900 | Bacteria | 2068 |
| 398 | Ga0207688_10060783 | 3300025901 | Bacteria | 2129 |
| 399 | Ga0207680_10067310 | 3300025903 | Bacteria | 2206 |
| 400 | Ga0207685_10004793 | 3300025905 | Bacteria | 3488 |
| 401 | Ga0207685_10098322 | 3300025905 | Bacteria | 1246 |
| 402 | Ga0207699_10260142 | 3300025906 | Bacteria | 1199 |
| 403 | Ga0207699_10487896 | 3300025906 | Bacteria | 888 |
| 404 | Ga0207645_10000106 | 3300025907 | Bacteria | 62240 |
| 405 | Ga0207645_10001707 | 3300025907 | Bacteria | 17826 |
| 406 | Ga0207643_10074006 | 3300025908 | Bacteria | 1964 |
| 407 | Ga0207705_10000016 | 3300025909 | Bacteria | 377359 |
| 408 | Ga0207705_10000046 | 3300025909 | Bacteria | 177574 |
| 409 | Ga0207705_10001249 | 3300025909 | Bacteria | 20440 |
| 410 | Ga0207705_10004105 | 3300025909 | Bacteria | 11042 |
| 411 | Ga0207705_10015092 | 3300025909 | Bacteria | 5554 |
| 412 | Ga0207705_10030685 | 3300025909 | Bacteria | 3836 |
| 413 | Ga0207705_10457421 | 3300025909 | Bacteria | 990 |
| 414 | Ga0207684_10008569 | 3300025910 | Bacteria | 9093 |
| 415 | Ga0207684_10041105 | 3300025910 | Bacteria | 3921 |
| 416 | Ga0207684_10118130 | 3300025910 | Bacteria | 2272 |
| 417 | Ga0207684_10756118 | 3300025910 | Bacteria | 823 |
| 418 | Ga0207654_10077432 | 3300025911 | Bacteria | 1993 |
| 419 | Ga0207707_10004769 | 3300025912 | Bacteria | 11891 |
| 420 | Ga0207707_10014069 | 3300025912 | Bacteria | 6974 |
| 421 | Ga0207707_10016769 | 3300025912 | Bacteria | 6381 |
| 422 | Ga0207707_10021217 | 3300025912 | Bacteria | 5678 |
| 423 | Ga0207707_10027639 | 3300025912 | Bacteria | 4960 |
| 424 | Ga0207707_10057911 | 3300025912 | Bacteria | 3372 |
| 425 | Ga0207707_10058144 | 3300025912 | Bacteria | 3365 |
| 426 | Ga0207707_10063990 | 3300025912 | Bacteria | 3201 |
| 427 | Ga0207707_10256389 | 3300025912 | Bacteria | 1518 |
| 428 | Ga0207707_10292243 | 3300025912 | Bacteria | 1410 |
| 429 | Ga0207695_10005655 | 3300025913 | Bacteria | 16500 |
| 430 | Ga0207695_10030170 | 3300025913 | Bacteria | 5973 |
| 431 | Ga0207695_10053761 | 3300025913 | Bacteria | 4209 |
| 432 | Ga0207695_10093976 | 3300025913 | Bacteria | 3007 |
| 433 | Ga0207695_10121442 | 3300025913 | Bacteria | 2580 |
| 434 | Ga0207695_10123346 | 3300025913 | Bacteria | 2556 |
| 435 | Ga0207671_10083288 | 3300025914 | Bacteria | 2401 |
| 436 | Ga0207671_10124374 | 3300025914 | Bacteria | 1974 |
| 437 | Ga0207693_10028969 | 3300025915 | Bacteria | 4377 |
| 438 | Ga0207693_10070547 | 3300025915 | Unclassified | 2734 |
| 439 | Ga0207693_10333456 | 3300025915 | Unclassified | 1188 |
| 440 | Ga0207663_10064719 | 3300025916 | Bacteria | 2334 |
| 441 | Ga0207663_10603064 | 3300025916 | Bacteria | 863 |
| 442 | Ga0207660_10005550 | 3300025917 | Bacteria | 8193 |
| 443 | Ga0207660_10009791 | 3300025917 | Bacteria | 6206 |
| 444 | Ga0207660_10039228 | 3300025917 | Bacteria | 3310 |
| 445 | Ga0207660_10105156 | 3300025917 | Bacteria | 2115 |
| 446 | Ga0207660_10127553 | 3300025917 | Bacteria | 1933 |
| 447 | Ga0207660_10278545 | 3300025917 | Bacteria | 1327 |
| 448 | Ga0207660_10314164 | 3300025917 | Bacteria | 1250 |
| 449 | Ga0207660_10435524 | 3300025917 | Bacteria | 1059 |
| 450 | Ga0207662_10031065 | 3300025918 | Bacteria | 3102 |
| 451 | Ga0207657_10001750 | 3300025919 | Bacteria | 23423 |
| 452 | Ga0207657_10002404 | 3300025919 | Bacteria | 20242 |
| 453 | Ga0207657_10014426 | 3300025919 | Bacteria | 7718 |
| 454 | Ga0207657_10091025 | 3300025919 | Bacteria | 2545 |
| 455 | Ga0207657_10233401 | 3300025919 | Bacteria | 1471 |
| 456 | Ga0207657_10470177 | 3300025919 | Bacteria | 986 |
| 457 | Ga0207649_10058357 | 3300025920 | Bacteria | 2416 |
| 458 | Ga0207652_10016969 | 3300025921 | Bacteria | 5955 |
| 459 | Ga0207652_10025526 | 3300025921 | Bacteria | 4914 |
| 460 | Ga0207652_10032239 | 3300025921 | Bacteria | 4402 |
| 461 | Ga0207652_10119929 | 3300025921 | Bacteria | 2339 |
| 462 | Ga0207652_10154919 | 3300025921 | Bacteria | 2052 |
| 463 | Ga0207652_10158898 | 3300025921 | Bacteria | 2025 |
| 464 | Ga0207652_10361168 | 3300025921 | Bacteria | 1311 |
| 465 | Ga0207646_10000002 | 3300025922 | Bacteria | 550880 |
| 466 | Ga0207646_10069925 | 3300025922 | Bacteria | 3135 |
| 467 | Ga0207646_10827406 | 3300025922 | Bacteria | 824 |
| 468 | Ga0207681_10003295 | 3300025923 | Bacteria | 10116 |
| 469 | Ga0207681_10006532 | 3300025923 | Bacteria | 7154 |
| 470 | Ga0207694_10179118 | 3300025924 | Bacteria | 1718 |
| 471 | Ga0207650_10018098 | 3300025925 | Bacteria | 4940 |
| 472 | Ga0207650_10095734 | 3300025925 | Bacteria | 2276 |
| 473 | Ga0207650_10234257 | 3300025925 | Bacteria | 1482 |
| 474 | Ga0207659_10257686 | 3300025926 | Bacteria | 1418 |
| 475 | Ga0207687_10001504 | 3300025927 | Bacteria | 15964 |
| 476 | Ga0207687_10003874 | 3300025927 | Bacteria | 10050 |
| 477 | Ga0207687_10020033 | 3300025927 | Bacteria | 4436 |
| 478 | Ga0207700_10003248 | 3300025928 | Bacteria | 9397 |
| 479 | Ga0207700_10024352 | 3300025928 | Bacteria | 4189 |
| 480 | Ga0207700_10194295 | 3300025928 | Bacteria | 1707 |
| 481 | Ga0207664_10037680 | 3300025929 | Bacteria | 3744 |
| 482 | Ga0207664_10151806 | 3300025929 | Bacteria | 1968 |
| 483 | Ga0207664_10516174 | 3300025929 | Bacteria | 1071 |
| 484 | Ga0207644_10000772 | 3300025931 | Bacteria | 20265 |
| 485 | Ga0207690_10000642 | 3300025932 | Bacteria | 22399 |
| 486 | Ga0207690_10003524 | 3300025932 | Bacteria | 9326 |
| 487 | Ga0207690_10010111 | 3300025932 | Bacteria | 5604 |
| 488 | Ga0207690_10225916 | 3300025932 | Bacteria | 1435 |
| 489 | Ga0207706_10003580 | 3300025933 | Bacteria | 14831 |
| 490 | Ga0207706_10152131 | 3300025933 | Bacteria | 2035 |
| 491 | Ga0207706_10188168 | 3300025933 | Bacteria | 1812 |
| 492 | Ga0207686_10007878 | 3300025934 | Bacteria | 5743 |
| 493 | Ga0207686_10066765 | 3300025934 | Bacteria | 2298 |
| 494 | Ga0207686_10075812 | 3300025934 | Bacteria | 2178 |
| 495 | Ga0207686_10173842 | 3300025934 | Bacteria | 1521 |
| 496 | Ga0207686_10470987 | 3300025934 | Unclassified | 970 |
| 497 | Ga0207709_10000051 | 3300025935 | Bacteria | 227968 |
| 498 | Ga0207709_10010716 | 3300025935 | Bacteria | 5049 |
| 499 | Ga0207670_10000048 | 3300025936 | Bacteria | 90133 |
| 500 | Ga0207670_10006030 | 3300025936 | Bacteria | 6699 |
| 501 | Ga0207669_10026342 | 3300025937 | Bacteria | 3160 |
| 502 | Ga0207704_10000001 | 3300025938 | Bacteria | 716296 |
| 503 | Ga0207665_10095338 | 3300025939 | Bacteria | 2068 |
| 504 | Ga0207665_10096437 | 3300025939 | Unclassified | 2057 |
| 505 | Ga0207665_10234380 | 3300025939 | Bacteria | 1350 |
| 506 | Ga0207665_10343655 | 3300025939 | Bacteria | 1125 |
| 507 | Ga0207665_10631508 | 3300025939 | Bacteria | 838 |
| 508 | Ga0207691_10003100 | 3300025940 | Bacteria | 16230 |
| 509 | Ga0207691_10042650 | 3300025940 | Bacteria | 4182 |
| 510 | Ga0207691_10406462 | 3300025940 | Bacteria | 1161 |
| 511 | Ga0207711_10004553 | 3300025941 | Bacteria | 11796 |
| 512 | Ga0207711_10007869 | 3300025941 | Bacteria | 8915 |
| 513 | Ga0207711_10010970 | 3300025941 | Bacteria | 7527 |
| 514 | Ga0207711_10018382 | 3300025941 | Bacteria | 5811 |
| 515 | Ga0207711_10134897 | 3300025941 | Unclassified | 2216 |
| 516 | Ga0207711_10210061 | 3300025941 | Bacteria | 1778 |
| 517 | Ga0207689_10001171 | 3300025942 | Bacteria | 25256 |
| 518 | Ga0207689_10003301 | 3300025942 | Bacteria | 14767 |
| 519 | Ga0207689_10005831 | 3300025942 | Bacteria | 10925 |
| 520 | Ga0207689_10021640 | 3300025942 | Bacteria | 5408 |
| 521 | Ga0207689_10609065 | 3300025942 | Bacteria | 919 |
| 522 | Ga0207661_10007995 | 3300025944 | Bacteria | 7541 |
| 523 | Ga0207661_10096868 | 3300025944 | Bacteria | 2469 |
| 524 | Ga0207661_10160717 | 3300025944 | Bacteria | 1949 |
| 525 | Ga0207661_10257157 | 3300025944 | Bacteria | 1554 |
| 526 | Ga0207679_10529645 | 3300025945 | Bacteria | 1055 |
| 527 | Ga0207667_10000670 | 3300025949 | Bacteria | 44352 |
| 528 | Ga0207667_10016129 | 3300025949 | Bacteria | 8449 |
| 529 | Ga0207667_10071697 | 3300025949 | Bacteria | 3601 |
| 530 | Ga0207667_10116036 | 3300025949 | Bacteria | 2759 |
| 531 | Ga0207667_10174449 | 3300025949 | Bacteria | 2209 |
| 532 | Ga0207667_10189347 | 3300025949 | Bacteria | 2111 |
| 533 | Ga0207667_10763691 | 3300025949 | Archaea | 965 |
| 534 | Ga0207651_10000006 | 3300025960 | Bacteria | 227893 |
| 535 | Ga0207651_10031297 | 3300025960 | Bacteria | 3399 |
| 536 | Ga0207651_10080253 | 3300025960 | Bacteria | 2347 |
| 537 | Ga0207651_10276692 | 3300025960 | Bacteria | 1385 |
| 538 | Ga0207712_10000030 | 3300025961 | Bacteria | 216514 |
| 539 | Ga0207712_10022826 | 3300025961 | Bacteria | 4124 |
| 540 | Ga0207712_10227561 | 3300025961 | Archaea | 1495 |
| 541 | Ga0207712_10691653 | 3300025961 | Bacteria | 889 |
| 542 | Ga0207668_10000842 | 3300025972 | Bacteria | 18543 |
| 543 | Ga0207640_10000010 | 3300025981 | Bacteria | 275745 |
| 544 | Ga0207640_10007482 | 3300025981 | Bacteria | 6033 |
| 545 | Ga0207658_10059219 | 3300025986 | Bacteria | 2853 |
| 546 | Ga0207677_10000156 | 3300026023 | Bacteria | 54081 |
| 547 | Ga0207677_10010386 | 3300026023 | Bacteria | 5266 |
| 548 | Ga0207703_10000048 | 3300026035 | Bacteria | 151143 |
| 549 | Ga0207639_10000033 | 3300026041 | Bacteria | 157588 |
| 550 | Ga0207639_10083620 | 3300026041 | Bacteria | 2534 |
| 551 | Ga0207639_10098449 | 3300026041 | Bacteria | 2357 |
| 552 | Ga0207639_10377459 | 3300026041 | Bacteria | 1272 |
| 553 | Ga0207639_10863330 | 3300026041 | Unclassified | 845 |
| 554 | Ga0207678_10001977 | 3300026067 | Bacteria | 18680 |
| 555 | Ga0207678_10003120 | 3300026067 | Bacteria | 15000 |
| 556 | Ga0207678_10014128 | 3300026067 | Bacteria | 7022 |
| 557 | Ga0207678_10030569 | 3300026067 | Bacteria | 4701 |
| 558 | Ga0207678_10043107 | 3300026067 | Bacteria | 3906 |
| 559 | Ga0207678_10212996 | 3300026067 | Unclassified | 1653 |
| 560 | Ga0207708_10000285 | 3300026075 | Bacteria | 39702 |
| 561 | Ga0207708_10001695 | 3300026075 | Bacteria | 16315 |
| 562 | Ga0207708_10535621 | 3300026075 | Bacteria | 986 |
| 563 | Ga0207702_10017599 | 3300026078 | Bacteria | 5913 |
| 564 | Ga0207702_10091648 | 3300026078 | Bacteria | 2661 |
| 565 | Ga0207702_10617630 | 3300026078 | Bacteria | 1064 |
| 566 | Ga0207702_10894447 | 3300026078 | Bacteria | 880 |
| 567 | Ga0207641_10054302 | 3300026088 | Bacteria | 3399 |
| 568 | Ga0207641_10120388 | 3300026088 | Bacteria | 2341 |
| 569 | Ga0207641_10914630 | 3300026088 | Bacteria | 872 |
| 570 | Ga0207648_10000363 | 3300026089 | Bacteria | 50049 |
| 571 | Ga0207648_10000578 | 3300026089 | Bacteria | 41060 |
| 572 | Ga0207648_10053460 | 3300026089 | Bacteria | 3530 |
| 573 | Ga0207648_10247146 | 3300026089 | Unclassified | 1590 |
| 574 | Ga0207648_10458938 | 3300026089 | Bacteria | 1161 |
| 575 | Ga0207676_10000151 | 3300026095 | Bacteria | 60274 |
| 576 | Ga0207674_10018739 | 3300026116 | Bacteria | 7513 |
| 577 | Ga0207674_10023980 | 3300026116 | Bacteria | 6525 |
| 578 | Ga0207674_10270278 | 3300026116 | Bacteria | 1647 |
| 579 | Ga0207674_10297320 | 3300026116 | Bacteria | 1563 |
| 580 | Ga0207674_10540119 | 3300026116 | Bacteria | 1126 |
| 581 | Ga0207674_10730268 | 3300026116 | Bacteria | 956 |
| 582 | Ga0207674_10888322 | 3300026116 | Bacteria | 859 |
| 583 | Ga0207675_100021047 | 3300026118 | Bacteria | 6080 |
| 584 | Ga0207675_100182317 | 3300026118 | Bacteria | 2011 |
| 585 | Ga0207675_100688550 | 3300026118 | Archaea | 1030 |
| 586 | Ga0207683_10001101 | 3300026121 | Bacteria | 24602 |
| 587 | Ga0207683_10142336 | 3300026121 | Bacteria | 2161 |
| 588 | Ga0207698_10038066 | 3300026142 | Bacteria | 3550 |
| 589 | Ga0207698_10226721 | 3300026142 | Unclassified | 1693 |
| 590 | Ga0209967_1000003 | 3300027364 | Bacteria | 32175 |
| 591 | Ga0209981_1000058 | 3300027378 | Bacteria | 11739 |
| 592 | Ga0209996_1000094 | 3300027395 | Bacteria | 11768 |
| 593 | Ga0209996_1006207 | 3300027395 | Bacteria | 1540 |
| 594 | Ga0209984_1000587 | 3300027424 | Bacteria | 3961 |
| 595 | Ga0209995_1000234 | 3300027471 | Bacteria | 8760 |
| 596 | Ga0209968_1001470 | 3300027526 | Bacteria | 3578 |
| 597 | Ga0209999_1000320 | 3300027543 | Bacteria | 7192 |
| 598 | Ga0209982_1000017 | 3300027552 | Bacteria | 15324 |
| 599 | Ga0209970_1003145 | 3300027614 | Bacteria | 2788 |
| 600 | Ga0210002_1001187 | 3300027617 | Bacteria | 3632 |
| 601 | Ga0210002_1007107 | 3300027617 | Bacteria | 1696 |
| 602 | Ga0209983_1001997 | 3300027665 | Bacteria | 4516 |
| 603 | Ga0209971_1000718 | 3300027682 | Bacteria | 8538 |
| 604 | Ga0209966_1000115 | 3300027695 | Bacteria | 35332 |
| 605 | Ga0209998_10000074 | 3300027717 | Bacteria | 40240 |
| 606 | Ga0209974_10000017 | 3300027876 | Bacteria | 39244 |
| 607 | Ga0207428_10000760 | 3300027907 | Bacteria | 36731 |
| 608 | Ga0265356_1006515 | 3300028017 | Bacteria | 1362 |
| 609 | Ga0268266_10030855 | 3300028379 | Bacteria | 4552 |
| 610 | Ga0268266_10042398 | 3300028379 | Bacteria | 3887 |
| 611 | Ga0268265_10000132 | 3300028380 | Bacteria | 95410 |
| 612 | Ga0268265_10004280 | 3300028380 | Bacteria | 9961 |
| 613 | Ga0268265_10489093 | 3300028380 | Bacteria | 1157 |
| 614 | Ga0268264_10000779 | 3300028381 | Bacteria | 35038 |
| 615 | Ga0268264_10039724 | 3300028381 | Bacteria | 3888 |
| 616 | Ga0265338_10010001 | 3300028800 | Bacteria | 11215 |
| 617 | Ga0265338_10113490 | 3300028800 | Unclassified | 2176 |
| 618 | Ga0265338_10441430 | 3300028800 | Bacteria | 922 |
| 619 | Ga0265338_10486397 | 3300028800 | Bacteria | 870 |
| 620 | Ga0265760_10057064 | 3300031090 | Bacteria | 1182 |
| 621 | Ga0265330_10008443 | 3300031235 | Bacteria | 4956 |
| 622 | Ga0265330_10009351 | 3300031235 | Bacteria | 4660 |
| 623 | Ga0265330_10050263 | 3300031235 | Bacteria | 1829 |
| 624 | Ga0265330_10076756 | 3300031235 | Bacteria | 1442 |
| 625 | Ga0265332_10056629 | 3300031238 | Bacteria | 1680 |
| 626 | Ga0265328_10000002 | 3300031239 | Bacteria | 275819 |
| 627 | Ga0265328_10017261 | 3300031239 | Bacteria | 2796 |
| 628 | Ga0265320_10252766 | 3300031240 | Bacteria | 782 |
| 629 | Ga0265325_10016951 | 3300031241 | Bacteria | 4061 |
| 630 | Ga0265325_10018497 | 3300031241 | Bacteria | 3864 |
| 631 | Ga0265325_10023255 | 3300031241 | Bacteria | 3387 |
| 632 | Ga0265340_10009415 | 3300031247 | Bacteria | 5243 |
| 633 | Ga0265340_10021003 | 3300031247 | Bacteria | 3349 |
| 634 | Ga0265340_10026809 | 3300031247 | Bacteria | 2910 |
| 635 | Ga0265340_10051438 | 3300031247 | Bacteria | 1995 |
| 636 | Ga0265340_10114174 | 3300031247 | Bacteria | 1246 |
| 637 | Ga0265340_10144543 | 3300031247 | Bacteria | 1087 |
| 638 | Ga0265339_10000041 | 3300031249 | Bacteria | 119820 |
| 639 | Ga0265339_10008146 | 3300031249 | Bacteria | 6690 |
| 640 | Ga0265339_10013760 | 3300031249 | Bacteria | 4897 |
| 641 | Ga0265339_10019346 | 3300031249 | Bacteria | 4000 |
| 642 | Ga0265339_10075185 | 3300031249 | Bacteria | 1794 |
| 643 | Ga0265339_10140922 | 3300031249 | Unclassified | 1227 |
| 644 | Ga0265331_10005230 | 3300031250 | Bacteria | 7867 |
| 645 | Ga0265331_10021149 | 3300031250 | Bacteria | 3332 |
| 646 | Ga0265327_10002507 | 3300031251 | Bacteria | 19190 |
| 647 | Ga0265327_10014068 | 3300031251 | Bacteria | 5264 |
| 648 | Ga0265327_10039801 | 3300031251 | Bacteria | 2550 |
| 649 | Ga0265327_10097074 | 3300031251 | Bacteria | 1428 |
| 650 | Ga0265316_10002381 | 3300031344 | Bacteria | 19567 |
| 651 | Ga0265316_10006492 | 3300031344 | Bacteria | 11166 |
| 652 | Ga0265316_10013220 | 3300031344 | Bacteria | 7352 |
| 653 | Ga0265316_10154517 | 3300031344 | Bacteria | 1717 |
| 654 | Ga0265316_10175048 | 3300031344 | Bacteria | 1600 |
| 655 | Ga0265316_10255882 | 3300031344 | Bacteria | 1284 |
| 656 | Ga0265316_10313457 | 3300031344 | Unclassified | 1141 |
| 657 | Ga0307513_10032360 | 3300031456 | Bacteria | 5899 |
| 658 | Ga0307509_10183477 | 3300031507 | Bacteria | 1954 |
| 659 | Ga0265313_10000295 | 3300031595 | Bacteria | 54290 |
| 660 | Ga0265313_10168513 | 3300031595 | Bacteria | 927 |
| 661 | Ga0316575_10042091 | 3300031665 | Bacteria | 1808 |
| 662 | Ga0265314_10015714 | 3300031711 | Bacteria | 5998 |
| 663 | Ga0265314_10049612 | 3300031711 | Bacteria | 2937 |
| 664 | Ga0265314_10114606 | 3300031711 | Bacteria | 1707 |
| 665 | Ga0265342_10008298 | 3300031712 | Bacteria | 7473 |
| 666 | Ga0265342_10020393 | 3300031712 | Bacteria | 4252 |
| 667 | Ga0265342_10051354 | 3300031712 | Bacteria | 2460 |
| 668 | Ga0265342_10128427 | 3300031712 | Bacteria | 1422 |
| 669 | Ga0307405_10019461 | 3300031731 | Bacteria | 3772 |
| 670 | Ga0307405_10196094 | 3300031731 | Bacteria | 1462 |
| 671 | Ga0307410_10051262 | 3300031852 | Bacteria | 2780 |
| 672 | Ga0307406_10076490 | 3300031901 | Bacteria | 2211 |
| 673 | Ga0307412_10036252 | 3300031911 | Bacteria | 3158 |
| 674 | Ga0307412_10069114 | 3300031911 | Bacteria | 2403 |
| 675 | Ga0307416_100204854 | 3300032002 | Bacteria | 1875 |
| 676 | Ga0307414_10035292 | 3300032004 | Bacteria | 3327 |
| 677 | Ga0307411_10105380 | 3300032005 | Bacteria | 2005 |
| 678 | Ga0307510_10001934 | 3300033180 | Bacteria | 23277 |
| 679 | Ga0373959_0061410 | 3300034820 | Bacteria | 832 |
| 680 | Ga0373926_0006990 | 3300035083 | Bacteria | 3753 |
| 681 | Ga0373926_0020718 | 3300035083 | Bacteria | 2272 |
| 682 | Ga0373923_0069382 | 3300035111 | Bacteria | 1511 |
| 683 | Ga0373923_0098605 | 3300035111 | Bacteria | 1286 |
| 684 | Ga0373936_0011513 | 3300035113 | Bacteria | 3349 |
| 685 | Ga0373936_0050621 | 3300035113 | Bacteria | 1680 |
| 686 | Ga0373945_0006150 | 3300035116 | Bacteria | 3861 |
| 687 | Ga0373945_0013358 | 3300035116 | Bacteria | 2738 |
| 688 | Ga0373960_0120889 | 3300035121 | Archaea | 869 |
| 689 | Ga0373943_0000343 | 3300035170 | Bacteria | 19547 |
| 690 | Ga0373943_0008884 | 3300035170 | Bacteria | 4501 |
| 691 | Ga0373943_0060351 | 3300035170 | Bacteria | 1893 |
| 692 | Ga0373946_0001335 | 3300035171 | Bacteria | 8521 |
| 693 | Ga0373946_0089478 | 3300035171 | Bacteria | 1362 |
| 694 | Ga0373946_0102077 | 3300035171 | Bacteria | 1287 |
| 695 | Ga0373924_0212762 | 3300035410 | Unclassified | 854 |
| 696 | Ga0373935_0009490 | 3300035692 | Bacteria | 5822 |
| 697 | Ga0373935_0039504 | 3300035692 | Bacteria | 2959 |
| 698 | Ga0373935_0135376 | 3300035692 | Bacteria | 1659 |
| 699 | Ga0373927_0001986 | 3300035695 | Bacteria | 15072 |
| 700 | Ga0373927_0122333 | 3300035695 | Bacteria | 1698 |
| 701 | Ga0373927_0169301 | 3300035695 | Bacteria | 1432 |
| 702 | Ga0373933_0086789 | 3300035724 | Bacteria | 1926 |
| 703 | Ga0373947_0000156 | 3300035725 | Bacteria | 36048 |
| 704 | Ga0373947_0009196 | 3300035725 | Bacteria | 5678 |
| 705 | Ga0373947_0049742 | 3300035725 | Bacteria | 2518 |
| 706 | Ga0373937_0026783 | 3300036401 | Bacteria | 5211 |
| 707 | Ga0373937_0488410 | 3300036401 | Bacteria | 1170 |
| 708 | Ga0373937_0580775 | 3300036401 | Bacteria | 1064 |
| 709 | Ga0373925_0000628 | 3300037068 | Bacteria | 33530 |
| 710 | Ga0373925_0004286 | 3300037068 | Bacteria | 10809 |
| 711 | Ga0373925_0038072 | 3300037068 | Bacteria | 3553 |
| 712 | Ga0373925_0044359 | 3300037068 | Bacteria | 3302 |
| 713 | Ga0373925_0068568 | 3300037068 | Bacteria | 2678 |
| 714 | Ga0373925_0261445 | 3300037068 | Bacteria | 1390 |
| 715 | Ga0373925_0509873 | 3300037068 | Bacteria | 988 |
| 716 | Ga0373925_0778592 | 3300037068 | Bacteria | 789 |
| 717 | Ga0395899_0005273 | 3300037312 | Bacteria | 10039 |
| 718 | Ga0395899_0007715 | 3300037312 | Bacteria | 8297 |
| 719 | Ga0395899_0058990 | 3300037312 | Bacteria | 2829 |
| 720 | Ga0395900_0003899 | 3300037418 | Bacteria | 15936 |
| 721 | Ga0395900_0004815 | 3300037418 | Bacteria | 14222 |
| 722 | Ga0395900_0144526 | 3300037418 | Bacteria | 2433 |
| 723 | Ga0395900_0163403 | 3300037418 | Bacteria | 2270 |
| 724 | Ga0395900_0183595 | 3300037418 | Bacteria | 2124 |
| 725 | Ga0395900_0205490 | 3300037418 | Bacteria | 1991 |
| 726 | Ga0395900_0316700 | 3300037418 | Bacteria | 1541 |
| 727 | Ga0395900_0472647 | 3300037418 | Bacteria | 1207 |
| 728 | Ga0395900_0637162 | 3300037418 | Bacteria | 1003 |
| 729 | Ga0395900_0769407 | 3300037418 | Bacteria | 892 |
| 730 | Ga0395898_0006201 | 3300037466 | Bacteria | 12811 |
| 731 | Ga0395898_0035276 | 3300037466 | Bacteria | 4976 |
| 732 | Ga0395898_0071760 | 3300037466 | Bacteria | 3345 |
| 733 | Ga0395898_0078853 | 3300037466 | Bacteria | 3177 |
| 734 | Ga0395898_0631359 | 3300037466 | Bacteria | 1014 |
| 735 | Ga0395905_0044827 | 3300037471 | Bacteria | 4149 |
| 736 | Ga0436364_0012403 | 3300037853 | Bacteria | 2028 |
| 737 | Ga0436364_0023814 | 3300037853 | Bacteria | 1922 |
| 738 | Ga0436364_1049814 | 3300037853 | Bacteria | 6319 |
| 739 | Ga0436364_1290526 | 3300037853 | Bacteria | 21813 |
| 740 | Ga0436364_1505222 | 3300037853 | Bacteria | 5008 |
| 741 | Ga0395901_0000594 | 3300038443 | Bacteria | 42185 |
| 742 | Ga0395901_0104521 | 3300038443 | Bacteria | 2972 |
| 743 | Ga0395901_0137933 | 3300038443 | Bacteria | 2563 |
| 744 | Ga0395901_0241516 | 3300038443 | Bacteria | 1884 |
| 745 | Ga0395901_0628258 | 3300038443 | Bacteria | 1080 |
| 746 | Ga0395901_0946633 | 3300038443 | Unclassified | 840 |
| 747 | Ga0436365_0049975 | 3300039437 | Bacteria | 1148 |
| 748 | Ga0436365_0311528 | 3300039437 | Unclassified | 1051 |
| 749 | Ga0436365_0870553 | 3300039437 | Bacteria | 3040 |
| 750 | Ga0436365_1548123 | 3300039437 | Bacteria | 1455 |
| 751 | Ga0436360_0989526 | 3300039438 | Bacteria | 1386 |
| 752 | Ga0436360_1310211 | 3300039438 | Unclassified | 1809 |
| 753 | Ga0436361_0090086 | 3300039447 | Bacteria | 1948 |
| 754 | Ga0436363_0661182 | 3300039450 | Bacteria | 1730 |
| 755 | Ga0436363_1151103 | 3300039450 | Bacteria | 794 |
| 756 | Ga0436363_1471237 | 3300039450 | Bacteria | 4133 |
| 757 | Ga0436362_0141115 | 3300039453 | Bacteria | 1939 |
| 758 | Ga0436362_0591404 | 3300039453 | Bacteria | 2816 |
| 759 | Ga0439461_0092762 | 3300041410 | Bacteria | 726 |
| 760 | Ga0439466_0033219 | 3300041411 | Bacteria | 1754 |
| 761 | Ga0439431_0028292 | 3300041997 | Bacteria | 1381 |
| 762 | Ga0439441_010838 | 3300042001 | Bacteria | 1537 |
| 763 | Ga0439448_0086740 | 3300042005 | Archaea | 1055 |
| 764 | Ga0439432_013411 | 3300042006 | Bacteria | 2788 |
| 765 | Ga0450909_005249 | 3300042185 | Bacteria | 1864 |
| 766 | Ga0439434_0004960 | 3300042435 | Bacteria | 3890 |
| 767 | Ga0439435_0035039 | 3300042436 | Bacteria | 1382 |
| 768 | Ga0439460_0026455 | 3300042461 | Bacteria | 1623 |
| 769 | Ga0451577_0000003 | 3300042876 | Bacteria | 921850 |
| 770 | Ga0451577_0000051 | 3300042876 | Bacteria | 297831 |
| 771 | Ga0451577_0019556 | 3300042876 | Bacteria | 6225 |
| 772 | Ga0451577_0035562 | 3300042876 | Bacteria | 4487 |
| 773 | Ga0451577_0107254 | 3300042876 | Bacteria | 2496 |
| 774 | Ga0451577_0206920 | 3300042876 | Bacteria | 1772 |
| 775 | Ga0451577_0279404 | 3300042876 | Bacteria | 1513 |
| 776 | Ga0439440_0154462 | 3300042993 | Bacteria | 659 |
| 777 | Ga0453683_0006913 | 3300044673 | Bacteria | 7737 |
| 778 | Ga0453683_0015820 | 3300044673 | Bacteria | 4877 |
| 779 | Ga0453683_0050864 | 3300044673 | Bacteria | 2596 |
| 780 | Ga0453683_0210673 | 3300044673 | Bacteria | 1235 |
| 781 | Ga0453683_0275321 | 3300044673 | Bacteria | 1074 |
| 782 | Ga0453683_0623103 | 3300044673 | Bacteria | 704 |
| 783 | Ga0466966_0212518 | 3300044684 | Bacteria | 1169 |
| 784 | Ga0466961_0038286 | 3300044693 | Bacteria | 3076 |
| 785 | Ga0466963_0000249 | 3300044694 | Bacteria | 23560 |
| 786 | Ga0466963_0010330 | 3300044694 | Bacteria | 5651 |
| 787 | Ga0453684_0000042 | 3300044712 | Bacteria | 682980 |
| 788 | Ga0453684_0015307 | 3300044712 | Bacteria | 12159 |
| 789 | Ga0453684_0057131 | 3300044712 | Bacteria | 5054 |
| 790 | Ga0453684_0068319 | 3300044712 | Bacteria | 4513 |
| 791 | Ga0453684_0115585 | 3300044712 | Bacteria | 3251 |
| 792 | Ga0453684_0453084 | 3300044712 | Bacteria | 1428 |
| 793 | Ga0453684_0826714 | 3300044712 | Bacteria | 997 |
| 794 | Ga0453684_1051636 | 3300044712 | Bacteria | 863 |
| 795 | Ga0466971_0005591 | 3300044719 | Bacteria | 5464 |
| 796 | Ga0466971_0210930 | 3300044719 | Bacteria | 919 |
| 797 | Ga0466968_0074808 | 3300044735 | Bacteria | 1479 |
| 798 | Ga0466957_0018836 | 3300044842 | Bacteria | 4058 |
| 799 | Ga0466957_0032113 | 3300044842 | Bacteria | 3142 |
| 800 | Ga0466957_0089965 | 3300044842 | Bacteria | 1922 |
| 801 | Ga0466959_0005151 | 3300045049 | Bacteria | 8908 |
| 802 | Ga0466959_0394446 | 3300045049 | Bacteria | 941 |
| 803 | Ga0451576_0005563 | 3300045051 | Bacteria | 15746 |
| 804 | Ga0451576_0014134 | 3300045051 | Bacteria | 8895 |
| 805 | Ga0451576_0089836 | 3300045051 | Bacteria | 3195 |
| 806 | Ga0451576_0133154 | 3300045051 | Bacteria | 2591 |
| 807 | Ga0451576_0136809 | 3300045051 | Unclassified | 2555 |
| 808 | Ga0451576_0197868 | 3300045051 | Bacteria | 2099 |
| 809 | Ga0451576_0234010 | 3300045051 | Bacteria | 1918 |
| 810 | Ga0451576_0295492 | 3300045051 | Bacteria | 1694 |
| 811 | Ga0451576_0405312 | 3300045051 | Bacteria | 1430 |
| 812 | Ga0451576_0981182 | 3300045051 | Bacteria | 886 |
| 813 | Ga0451576_1313476 | 3300045051 | Unclassified | 754 |
| 814 | Ga0466958_0147698 | 3300045836 | Bacteria | 1482 |
| 815 | Ga0466967_0004012 | 3300045976 | Bacteria | 9814 |
| 816 | Ga0466967_0066862 | 3300045976 | Bacteria | 3204 |
| 817 | Ga0466967_0194008 | 3300045976 | Bacteria | 1921 |
| 818 | Ga0466967_0292381 | 3300045976 | Bacteria | 1566 |
| 819 | Ga0466967_1300924 | 3300045976 | Bacteria | 724 |
| 820 | Ga0495592_0020241 | 3300046454 | Bacteria | 5063 |
| 821 | Ga0495592_0354454 | 3300046454 | Bacteria | 940 |
| 822 | Ga0495629_0094572 | 3300046459 | Bacteria | 2085 |
| 823 | Ga0495638_0020748 | 3300046460 | Bacteria | 4338 |
| 824 | Ga0495651_0344850 | 3300046462 | Bacteria | 986 |
| 825 | Ga0495650_0000029 | 3300046471 | Bacteria | 453466 |
| 826 | Ga0495650_0046340 | 3300046471 | Bacteria | 1825 |
| 827 | Ga0495580_0049804 | 3300046472 | Bacteria | 2963 |
| 828 | Ga0495662_0000558 | 3300046476 | Bacteria | 17109 |
| 829 | Ga0495664_0000393 | 3300046477 | Bacteria | 21384 |
| 830 | Ga0495584_0197059 | 3300046491 | Bacteria | 1024 |
| 831 | Ga0495585_0052689 | 3300046492 | Bacteria | 2253 |
| 832 | Ga0495594_0122254 | 3300046499 | Bacteria | 1472 |
| 833 | Ga0495583_0004795 | 3300046506 | Bacteria | 9484 |
| 834 | Ga0495583_0026841 | 3300046506 | Bacteria | 2849 |
| 835 | Ga0495618_0011586 | 3300046514 | Bacteria | 5349 |
| 836 | Ga0495618_0536385 | 3300046514 | Unclassified | 702 |
| 837 | Ga0495630_0005525 | 3300046517 | Bacteria | 8920 |
| 838 | Ga0495630_0322750 | 3300046517 | Bacteria | 1180 |
| 839 | Ga0495630_0839610 | 3300046517 | Bacteria | 701 |
| 840 | Ga0495648_0255744 | 3300046524 | Bacteria | 843 |
| 841 | Ga0495666_0020887 | 3300046526 | Bacteria | 3242 |
| 842 | Ga0495652_0018394 | 3300046529 | Bacteria | 6232 |
| 843 | Ga0495665_0039805 | 3300046531 | Bacteria | 2503 |
| 844 | Ga0495665_0051775 | 3300046531 | Bacteria | 2174 |
| 845 | Ga0495640_0001485 | 3300046533 | Bacteria | 18461 |
| 846 | Ga0495640_0014441 | 3300046533 | Bacteria | 5977 |
| 847 | Ga0495640_0029192 | 3300046533 | Bacteria | 3963 |
| 848 | Ga0495621_0000338 | 3300046539 | Bacteria | 11428 |
| 849 | Ga0495645_0003126 | 3300046543 | Bacteria | 11213 |
| 850 | Ga0495622_0057169 | 3300046557 | Bacteria | 1809 |
| 851 | Ga0495633_0042449 | 3300046558 | Bacteria | 2160 |
| 852 | Ga0495668_0397965 | 3300046616 | Bacteria | 757 |
| 853 | Ga0495634_0001637 | 3300046642 | Bacteria | 19490 |
| 854 | Ga0495634_0024760 | 3300046642 | Bacteria | 4207 |
| 855 | Ga0495634_0029021 | 3300046642 | Bacteria | 3834 |
| 856 | Ga0495625_0006253 | 3300046660 | Bacteria | 10665 |
| 857 | Ga0495635_0002416 | 3300046663 | Bacteria | 12732 |
| 858 | Ga0495659_0052266 | 3300046664 | Bacteria | 1491 |
| 859 | Ga0495588_0050508 | 3300046674 | Bacteria | 2140 |
| 860 | Ga0495657_0008879 | 3300046675 | Bacteria | 7651 |
| 861 | Ga0495657_0298977 | 3300046675 | Bacteria | 960 |
| 862 | Ga0495623_0014264 | 3300046679 | Bacteria | 5148 |
| 863 | Ga0495613_0006144 | 3300046689 | Bacteria | 8988 |
| 864 | Ga0495613_0050039 | 3300046689 | Bacteria | 3083 |
| 865 | Ga0495624_0003130 | 3300046690 | Bacteria | 12351 |
| 866 | Ga0495624_0017004 | 3300046690 | Bacteria | 4888 |
| 867 | Ga0495581_0113672 | 3300047315 | Bacteria | 1574 |
| 868 | Ga0495581_0139900 | 3300047315 | Unclassified | 1412 |
| 869 | Ga0495636_0259836 | 3300047318 | Unclassified | 805 |
| 870 | Ga0495674_0002951 | 3300047319 | Bacteria | 16537 |
| 871 | Ga0495674_0129785 | 3300047319 | Bacteria | 2124 |
| 872 | Ga0495672_0035055 | 3300047320 | Bacteria | 3093 |
| 873 | Ga0495676_0073566 | 3300047321 | Bacteria | 2620 |
| 874 | Ga0495680_0101483 | 3300047322 | Bacteria | 2143 |
| 875 | Ga0495683_0121315 | 3300047323 | Bacteria | 1240 |
| 876 | Ga0495677_0011648 | 3300047445 | Bacteria | 3213 |
| 877 | Ga0495684_0001554 | 3300047471 | Bacteria | 18387 |
| 878 | Ga0495684_0028817 | 3300047471 | Bacteria | 4262 |
| 879 | Ga0495684_0696552 | 3300047471 | Bacteria | 674 |
| 880 | Ga0495686_0000147 | 3300047472 | Bacteria | 139008 |
| 881 | Ga0495686_0001655 | 3300047472 | Bacteria | 23210 |
| 882 | Ga0495686_0005626 | 3300047472 | Bacteria | 9833 |
| 883 | Ga0495593_0142960 | 3300047673 | Bacteria | 1212 |
| 884 | Ga0495593_0229689 | 3300047673 | Bacteria | 930 |
| 885 | Ga0495602_0173812 | 3300048088 | Bacteria | 1669 |
| 886 | Ga0495614_0208027 | 3300048089 | Bacteria | 887 |
| 887 | Ga0496101_0242460 | 3300048904 | Bacteria | 1403 |
| 888 | Ga0496104_0078128 | 3300048907 | Bacteria | 3154 |
| 889 | Ga0496104_0132754 | 3300048907 | Bacteria | 2392 |
| 890 | Ga0496104_0802887 | 3300048907 | Bacteria | 847 |
| 891 | Ga0496105_0145579 | 3300048908 | Bacteria | 1948 |
| 892 | Ga0496106_0153406 | 3300048909 | Bacteria | 1818 |
| 893 | Ga0496109_0338427 | 3300048912 | Bacteria | 1421 |
| 894 | Ga0496110_0165894 | 3300048913 | Bacteria | 2003 |
| 895 | Ga0496110_1032687 | 3300048913 | Unclassified | 730 |
| 896 | Ga0496112_0223885 | 3300048915 | Unclassified | 1837 |
| 897 | Ga0496115_0262424 | 3300048918 | Bacteria | 1420 |
| 898 | Ga0496118_0047204 | 3300048921 | Bacteria | 3341 |
| 899 | Ga0496118_0073618 | 3300048921 | Bacteria | 2446 |
| 900 | Ga0496118_0088640 | 3300048921 | Bacteria | 2139 |
| 901 | Ga0496118_0379262 | 3300048921 | Bacteria | 742 |
| 902 | Ga0496120_0275317 | 3300048923 | Bacteria | 780 |
| 903 | Ga0496120_0361089 | 3300048923 | Bacteria | 650 |
| 904 | Ga0496121_0000671 | 3300048924 | Bacteria | 63867 |
| 905 | Ga0496121_0058623 | 3300048924 | Bacteria | 3181 |
| 906 | Ga0496122_0007143 | 3300048925 | Bacteria | 12523 |
| 907 | Ga0496123_0023691 | 3300048926 | Bacteria | 4691 |
| 908 | Ga0496125_0030934 | 3300048928 | Bacteria | 4779 |
| 909 | Ga0496125_0262713 | 3300048928 | Bacteria | 1081 |
| 910 | Ga0496126_0013389 | 3300048929 | Bacteria | 8347 |
| 911 | Ga0496126_0035580 | 3300048929 | Bacteria | 4666 |
| 912 | Ga0495682_0012097 | 3300049460 | Bacteria | 3317 |
| 913 | Ga0501290_000127 | 3300049513 | Bacteria | 11762 |
| 914 | Ga0501291_000073 | 3300049514 | Bacteria | 11763 |
| 915 | Ga0501292_000656 | 3300049515 | Bacteria | 4224 |
| 916 | Ga0501293_000116 | 3300049516 | Bacteria | 5265 |
| 917 | Ga0501295_000033 | 3300049518 | Bacteria | 13877 |
| 918 | Ga0501296_001586 | 3300049519 | Bacteria | 2312 |
| 919 | Ga0501297_000231 | 3300049520 | Bacteria | 5734 |
| 920 | Ga0501299_007248 | 3300049522 | Bacteria | 1764 |
| 921 | Ga0501301_000531 | 3300049524 | Bacteria | 2343 |
| 922 | Ga0501302_000131 | 3300049525 | Bacteria | 3710 |
| 923 | Ga0501303_000304 | 3300049526 | Bacteria | 4009 |
| 924 | Ga0501031_0050714 | 3300049568 | Bacteria | 2703 |
| 925 | Ga0501031_0064981 | 3300049568 | Bacteria | 2377 |
| 926 | Ga0501032_0010146 | 3300049569 | Bacteria | 6798 |
| 927 | Ga0501033_0002717 | 3300049570 | Bacteria | 14842 |
| 928 | Ga0501033_0115002 | 3300049570 | Bacteria | 1955 |
| 929 | Ga0501033_0123441 | 3300049570 | Bacteria | 1878 |
| 930 | Ga0501034_0013551 | 3300049571 | Bacteria | 8392 |
| 931 | Ga0501034_0013990 | 3300049571 | Bacteria | 8259 |
| 932 | Ga0501036_0057816 | 3300049572 | Bacteria | 3285 |
| 933 | Ga0501037_0048585 | 3300049573 | Bacteria | 3108 |
| 934 | Ga0501038_0000648 | 3300049574 | Bacteria | 30905 |
| 935 | Ga0501038_0430862 | 3300049574 | Bacteria | 1016 |
| 936 | Ga0501039_0139968 | 3300049575 | Bacteria | 1901 |
| 937 | Ga0501040_0119641 | 3300049576 | Bacteria | 1847 |
| 938 | Ga0501042_0254784 | 3300049578 | Bacteria | 1266 |
| 939 | Ga0501043_0044299 | 3300049579 | Bacteria | 3498 |
| 940 | Ga0501046_0000498 | 3300049580 | Bacteria | 39183 |
| 941 | Ga0501046_0267232 | 3300049580 | Bacteria | 1255 |
| 942 | Ga0501047_0002363 | 3300049581 | Bacteria | 18041 |
| 943 | Ga0501048_0025839 | 3300049582 | Bacteria | 4278 |
| 944 | Ga0501068_0074176 | 3300049584 | Bacteria | 2079 |
| 945 | Ga0501068_0241653 | 3300049584 | Bacteria | 1149 |
| 946 | Ga0501072_0177584 | 3300049588 | Bacteria | 1698 |
| 947 | Ga0501073_0009955 | 3300049589 | Bacteria | 6994 |
| 948 | Ga0501075_0296176 | 3300049591 | Unclassified | 1232 |
| 949 | Ga0501077_0440421 | 3300049593 | Bacteria | 834 |
| 950 | Ga0501201_000711 | 3300049651 | Bacteria | 3114 |
| 951 | Ga0501206_000679 | 3300049653 | Bacteria | 4134 |
| 952 | Ga0501209_007531 | 3300049656 | Bacteria | 2094 |
| 953 | Ga0501217_003614 | 3300049661 | Bacteria | 3133 |
| 954 | Ga0501223_011372 | 3300049663 | Bacteria | 1786 |
| 955 | Ga0501228_000754 | 3300049666 | Bacteria | 2163 |
| 956 | Ga0501230_000458 | 3300049667 | Bacteria | 4033 |
| 957 | Ga0501233_000630 | 3300049668 | Bacteria | 5752 |
| 958 | Ga0501239_000120 | 3300049672 | Bacteria | 5245 |
| 959 | Ga0501243_008412 | 3300049675 | Bacteria | 1589 |
| 960 | Ga0501246_001039 | 3300049676 | Bacteria | 2084 |
| 961 | Ga0501247_000206 | 3300049677 | Bacteria | 3929 |
| 962 | Ga0501248_000294 | 3300049678 | Bacteria | 2570 |
| 963 | Ga0501249_001011 | 3300049679 | Bacteria | 6041 |
| 964 | Ga0501251_000884 | 3300049681 | Bacteria | 2753 |
| 965 | Ga0501257_000648 | 3300049686 | Bacteria | 6930 |
| 966 | Ga0501258_000554 | 3300049687 | Bacteria | 2595 |
| 967 | Ga0501260_004679 | 3300049689 | Bacteria | 1270 |
| 968 | Ga0501261_001701 | 3300049690 | Bacteria | 2700 |
| 969 | Ga0501219_000199 | 3300049703 | Bacteria | 11152 |
| 970 | Ga0501225_0041548 | 3300049705 | Bacteria | 1268 |
| 971 | Ga0501229_000227 | 3300049706 | Bacteria | 6262 |
| 972 | Ga0501234_000041 | 3300049707 | Bacteria | 14565 |
| 973 | Ga0501245_001648 | 3300049708 | Bacteria | 2911 |
| 974 | Ga0501079_0048518 | 3300049741 | Bacteria | 3276 |
| 975 | Ga0501080_0004889 | 3300049742 | Bacteria | 11944 |
| 976 | Ga0501080_0168729 | 3300049742 | Bacteria | 2019 |
| 977 | Ga0501083_0362976 | 3300049744 | Unclassified | 942 |
| 978 | Ga0501264_003294 | 3300049761 | Bacteria | 1470 |
| 979 | Ga0501265_000322 | 3300049762 | Bacteria | 4981 |
| 980 | Ga0501266_000188 | 3300049763 | Bacteria | 7865 |
| 981 | Ga0501267_025178 | 3300049764 | Bacteria | 676 |
| 982 | Ga0501271_009200 | 3300049768 | Bacteria | 1025 |
| 983 | Ga0501272_000011 | 3300049769 | Bacteria | 12072 |
| 984 | Ga0501273_001280 | 3300049770 | Bacteria | 2357 |
| 985 | Ga0501274_000050 | 3300049771 | Bacteria | 6776 |
| 986 | Ga0501276_000206 | 3300049773 | Bacteria | 3273 |
| 987 | Ga0501278_001024 | 3300049774 | Bacteria | 2025 |
| 988 | Ga0501279_001327 | 3300049775 | Bacteria | 3252 |
| 989 | Ga0501283_000138 | 3300049779 | Bacteria | 9191 |
| 990 | Ga0501035_0003773 | 3300049822 | Bacteria | 14438 |
| 991 | Ga0501035_0197667 | 3300049822 | Bacteria | 1726 |
| 992 | Ga0501044_0015480 | 3300049823 | Bacteria | 8214 |
| 993 | Ga0501044_0044484 | 3300049823 | Bacteria | 4607 |
| 994 | Ga0501044_0642057 | 3300049823 | Bacteria | 951 |
| 995 | Ga0501045_0169436 | 3300049824 | Bacteria | 1626 |
| 996 | Ga0501212_000330 | 3300049851 | Bacteria | 4412 |
| 997 | nmdc:mga0k408_244614_c1 | 3300050493 | Unclassified | 1071 |
| 998 | nmdc:mga05p37_104050_c1 | 3300050507 | Bacteria | 3493 |
| 999 | nmdc:mga05p37_12082_c1 | 3300050507 | Bacteria | 10307 |
| 1000 | nmdc:mga05p37_9949_c1 | 3300050507 | Bacteria | 11293 |
| 1001 | nmdc:mga09592_192642_c1 | 3300050508 | Bacteria | 1765 |
| 1002 | nmdc:mga09592_51000_c1 | 3300050508 | Bacteria | 3491 |
| 1003 | nmdc:mga0qj67_32357_c1 | 3300050509 | Bacteria | 4078 |
| 1004 | nmdc:mga0qj67_8496_c1 | 3300050509 | Bacteria | 7621 |
| 1005 | nmdc:mga06r32_141730_c1 | 3300050510 | Bacteria | 2380 |
| 1006 | nmdc:mga06r32_2306_c1 | 3300050510 | Bacteria | 17073 |
| 1007 | nmdc:mga08y16_27834_c1 | 3300050511 | Bacteria | 5958 |
| 1008 | nmdc:mga0n895_13540_c1 | 3300050512 | Bacteria | 7366 |
| 1009 | nmdc:mga0n895_97777_c1 | 3300050512 | Bacteria | 1487 |
| 1010 | nmdc:mga0rr50_109047_c1 | 3300050513 | Bacteria | 2188 |
| 1011 | nmdc:mga0rr50_840255_c1 | 3300050513 | Unclassified | 783 |
| 1012 | nmdc:mga08x19_109179_c1 | 3300050514 | Bacteria | 1844 |
| 1013 | nmdc:mga08x19_120691_c1 | 3300050514 | Bacteria | 1757 |
| 1014 | nmdc:mga08x19_75755_c1 | 3300050514 | Bacteria | 2200 |
| 1015 | nmdc:mga08x19_96045_c1 | 3300050514 | Bacteria | 1961 |
| 1016 | nmdc:mga0a205_11730_c1 | 3300050515 | Bacteria | 8085 |
| 1017 | nmdc:mga0a205_201295_c1 | 3300050515 | Bacteria | 1882 |
| 1018 | nmdc:mga0a205_70062_c1 | 3300050515 | Bacteria | 3385 |
| 1019 | nmdc:mga0a205_777_c1 | 3300050515 | Bacteria | 25858 |
| 1020 | nmdc:mga0a205_9958_c1 | 3300050515 | Bacteria | 8721 |
| 1021 | Ga0495601_0001800 | 3300053077 | Bacteria | 11897 |
| 1022 | Ga0495601_0073634 | 3300053077 | Bacteria | 2184 |
| 1023 | Ga0495601_0314731 | 3300053077 | Bacteria | 1019 |
| 1024 | Ga0495612_0000118 | 3300053078 | Bacteria | 33388 |
| 1025 | Ga0495619_0002839 | 3300053085 | Bacteria | 11284 |
| 1026 | Ga0500643_004736 | 3300053087 | Bacteria | 6044 |
| 1027 | Ga0500643_010897 | 3300053087 | Bacteria | 3354 |
| 1028 | Ga0500643_016789 | 3300053087 | Bacteria | 2470 |
| 1029 | Ga0500651_0000008 | 3300053093 | Bacteria | 287738 |
| 1030 | Ga0500559_0133033 | 3300053136 | Bacteria | 1162 |
| 1031 | Ga0500559_0144777 | 3300053136 | Bacteria | 1114 |
| 1032 | Ga0500573_0261208 | 3300053140 | Bacteria | 887 |
| 1033 | Ga0500616_0000008 | 3300053153 | Bacteria | 785239 |
| 1034 | Ga0501084_0036726 | 3300054114 | Bacteria | 4093 |
| 1035 | Ga0587111_0049596 | 3300060346 | Bacteria | 922 |
| 1036 | Ga0501082_0473075 | 3300060353 | Unclassified | 1095 |
| 1037 | Ga0466962_0003999 | 3300061719 | Bacteria | 7057 |
| 1038 | Ga0530510_0068874 | 3300061734 | Bacteria | 2567 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300034820 | Ga0373959_0061410 | Ga0373959_0061410_59_646 | 165 |
| 2 | 3300045051 | Ga0451576_0136809 | Ga0451576_0136809_22_588 | 169 |
| 3 | 3300042993 | Ga0439440_0154462 | Ga0439440_0154462_129_647 | 171 |
| 4 | 3300028381 | Ga0268264_10039724 | Ga0268264_100397245 | 177 |
| 5 | 3300045976 | Ga0466967_1300924 | Ga0466967_1300924_22_567 | 180 |
| 6 | 3300049764 | Ga0501267_025178 | Ga0501267_025178_117_662 | 180 |
| 7 | 3300026078 | Ga0207702_10894447 | Ga0207702_108944471 | 181 |
| 8 | 3300048913 | Ga0496110_0165894 | Ga0496110_0165894_1148_1702 | 182 |
| 9 | 3300005440 | Ga0070705_100714401 | Ga0070705_1007144011 | 184 |
| 10 | 3300046514 | Ga0495618_0536385 | Ga0495618_0536385_101_682 | 184 |
| 11 | 3300009176 | Ga0105242_10152312 | Ga0105242_101523122 | 185 |
| 12 | 3300009545 | Ga0105237_10705893 | Ga0105237_107058931 | 185 |
| 13 | 3300009174 | Ga0105241_10183356 | Ga0105241_101833562 | 187 |
| 14 | 3300048923 | Ga0496120_0361089 | Ga0496120_0361089_12_584 | 190 |
| 15 | 3300005530 | Ga0070679_100029563 | Ga0070679_1000295635 | 191 |
| 16 | 3300005563 | Ga0068855_100501393 | Ga0068855_1005013931 | 191 |
| 17 | 3300013104 | Ga0157370_10009337 | Ga0157370_1000933711 | 191 |
| 18 | 3300025912 | Ga0207707_10014069 | Ga0207707_100140699 | 191 |
| 19 | 3300025917 | Ga0207660_10039228 | Ga0207660_100392284 | 191 |
| 20 | 3300046517 | Ga0495630_0839610 | Ga0495630_0839610_17_601 | 192 |
| 21 | 3300005467 | Ga0070706_100141818 | Ga0070706_1001418182 | 193 |
| 22 | 3300025885 | Ga0207653_10019781 | Ga0207653_100197812 | 193 |
| 23 | 3300002075 | JGI24738J21930_10024866 | JGI24738J21930_100248662 | 194 |
| 24 | 3300005339 | Ga0070660_100533940 | Ga0070660_1005339401 | 194 |
| 25 | 3300005455 | Ga0070663_100005903 | Ga0070663_1000059035 | 194 |
| 26 | 3300005539 | Ga0068853_100183011 | Ga0068853_1001830112 | 194 |
| 27 | 3300005578 | Ga0068854_100000874 | Ga0068854_10000087417 | 194 |
| 28 | 3300006237 | Ga0097621_100291482 | Ga0097621_1002914822 | 194 |
| 29 | 3300006358 | Ga0068871_100099478 | Ga0068871_1000994783 | 194 |
| 30 | 3300009174 | Ga0105241_10125412 | Ga0105241_101254122 | 194 |
| 31 | 3300009177 | Ga0105248_10157103 | Ga0105248_101571033 | 194 |
| 32 | 3300009551 | Ga0105238_10117902 | Ga0105238_101179023 | 194 |
| 33 | 3300010375 | Ga0105239_10020412 | Ga0105239_100204126 | 194 |
| 34 | 3300013100 | Ga0157373_10032985 | Ga0157373_100329853 | 194 |
| 35 | 3300013296 | Ga0157374_10088416 | Ga0157374_100884162 | 194 |
| 36 | 3300025911 | Ga0207654_10077432 | Ga0207654_100774321 | 194 |
| 37 | 3300025919 | Ga0207657_10470177 | Ga0207657_104701771 | 194 |
| 38 | 3300025924 | Ga0207694_10179118 | Ga0207694_101791182 | 194 |
| 39 | 3300025941 | Ga0207711_10134897 | Ga0207711_101348973 | 194 |
| 40 | 3300025981 | Ga0207640_10007482 | Ga0207640_100074824 | 194 |
| 41 | 3300026041 | Ga0207639_10377459 | Ga0207639_103774592 | 194 |
| 42 | 3300026067 | Ga0207678_10003120 | Ga0207678_1000312013 | 194 |
| 43 | 3300031249 | Ga0265339_10075185 | Ga0265339_100751852 | 194 |
| 44 | 3300031712 | Ga0265342_10128427 | Ga0265342_101284272 | 194 |
| 45 | 3300037471 | Ga0395905_0044827 | Ga0395905_0044827_3254_3883 | 194 |
| 46 | 3300044673 | Ga0453683_0623103 | Ga0453683_0623103_67_687 | 194 |
| 47 | 3300005328 | Ga0070676_10000104 | Ga0070676_1000010419 | 195 |
| 48 | 3300005334 | Ga0068869_100001148 | Ga0068869_10000114812 | 195 |
| 49 | 3300005338 | Ga0068868_100000073 | Ga0068868_10000007342 | 195 |
| 50 | 3300005364 | Ga0070673_100000047 | Ga0070673_10000004719 | 195 |
| 51 | 3300005459 | Ga0068867_100000119 | Ga0068867_10000011933 | 195 |
| 52 | 3300005543 | Ga0070672_100144460 | Ga0070672_1001444602 | 195 |
| 53 | 3300006881 | Ga0068865_100000005 | Ga0068865_100000005206 | 195 |
| 54 | 3300009098 | Ga0105245_10000281 | Ga0105245_1000028116 | 195 |
| 55 | 3300009148 | Ga0105243_10000411 | Ga0105243_1000041125 | 195 |
| 56 | 3300009176 | Ga0105242_10001969 | Ga0105242_1000196916 | 195 |
| 57 | 3300011119 | Ga0105246_10067482 | Ga0105246_100674822 | 195 |
| 58 | 3300013105 | Ga0157369_10068459 | Ga0157369_100684593 | 195 |
| 59 | 3300013296 | Ga0157374_10001017 | Ga0157374_1000101713 | 195 |
| 60 | 3300013297 | Ga0157378_10001127 | Ga0157378_1000112713 | 195 |
| 61 | 3300013308 | Ga0157375_10002160 | Ga0157375_100021602 | 195 |
| 62 | 3300014745 | Ga0157377_10030512 | Ga0157377_100305122 | 195 |
| 63 | 3300014969 | Ga0157376_10002783 | Ga0157376_100027838 | 195 |
| 64 | 3300025907 | Ga0207645_10001707 | Ga0207645_100017073 | 195 |
| 65 | 3300025927 | Ga0207687_10001504 | Ga0207687_100015042 | 195 |
| 66 | 3300025934 | Ga0207686_10007878 | Ga0207686_100078784 | 195 |
| 67 | 3300025935 | Ga0207709_10000051 | Ga0207709_1000005119 | 195 |
| 68 | 3300025938 | Ga0207704_10000001 | Ga0207704_10000001221 | 195 |
| 69 | 3300025940 | Ga0207691_10406462 | Ga0207691_104064621 | 195 |
| 70 | 3300025942 | Ga0207689_10001171 | Ga0207689_100011712 | 195 |
| 71 | 3300025960 | Ga0207651_10000006 | Ga0207651_1000000618 | 195 |
| 72 | 3300025961 | Ga0207712_10022826 | Ga0207712_100228263 | 195 |
| 73 | 3300026023 | Ga0207677_10000156 | Ga0207677_1000015618 | 195 |
| 74 | 3300026089 | Ga0207648_10000363 | Ga0207648_1000036333 | 195 |
| 75 | 3300005327 | Ga0070658_10061244 | Ga0070658_100612444 | 196 |
| 76 | 3300005336 | Ga0070680_100417852 | Ga0070680_1004178522 | 196 |
| 77 | 3300005366 | Ga0070659_100339597 | Ga0070659_1003395972 | 196 |
| 78 | 3300025917 | Ga0207660_10278545 | Ga0207660_102785452 | 196 |
| 79 | 3300025919 | Ga0207657_10002404 | Ga0207657_100024043 | 196 |
| 80 | 3300025932 | Ga0207690_10225916 | Ga0207690_102259162 | 196 |
| 81 | 3300044673 | Ga0453683_0050864 | Ga0453683_0050864_1381_2028 | 196 |
| 82 | 3300044712 | Ga0453684_0453084 | Ga0453684_0453084_295_942 | 196 |
| 83 | 3300048921 | Ga0496118_0088640 | Ga0496118_0088640_222_854 | 196 |
| 84 | 3300048925 | Ga0496122_0007143 | Ga0496122_0007143_11843_12475 | 196 |
| 85 | 3300048926 | Ga0496123_0023691 | Ga0496123_0023691_3535_4167 | 196 |
| 86 | 3300048928 | Ga0496125_0262713 | Ga0496125_0262713_104_736 | 196 |
| 87 | 3300050507 | nmdc:mga05p37_104050_c1 | nmdc:mga05p37_104050_c1_1815_2480 | 196 |
| 88 | 3300039437 | Ga0436365_0049975 | Ga0436365_0049975_79_690 | 198 |
| 89 | 3300005327 | Ga0070658_10000010 | Ga0070658_10000010191 | 199 |
| 90 | 3300005518 | Ga0070699_100300786 | Ga0070699_1003007862 | 199 |
| 91 | 3300005546 | Ga0070696_100121612 | Ga0070696_1001216122 | 199 |
| 92 | 3300006914 | Ga0075436_100138760 | Ga0075436_1001387602 | 199 |
| 93 | 3300025909 | Ga0207705_10000016 | Ga0207705_10000016257 | 199 |
| 94 | 3300046471 | Ga0495650_0000029 | Ga0495650_0000029_215540_216178 | 199 |
| 95 | 3300050514 | nmdc:mga08x19_120691_c1 | nmdc:mga08x19_120691_c1_866_1492 | 199 |
| 96 | 3300053087 | Ga0500643_016789 | Ga0500643_016789_1161_1799 | 199 |
| 97 | 3300053136 | Ga0500559_0144777 | Ga0500559_0144777_329_964 | 199 |
| 98 | 3300005327 | Ga0070658_10644503 | Ga0070658_106445031 | 200 |
| 99 | 3300005455 | Ga0070663_100013623 | Ga0070663_1000136235 | 200 |
| 100 | 3300005563 | Ga0068855_100005375 | Ga0068855_10000537511 | 200 |
| 101 | 3300025254 | Ga0209148_1002133 | Ga0209148_10021334 | 200 |
| 102 | 3300025272 | Ga0209455_1000467 | Ga0209455_100046722 | 200 |
| 103 | 3300025949 | Ga0207667_10016129 | Ga0207667_100161295 | 200 |
| 104 | 3300026067 | Ga0207678_10030569 | Ga0207678_100305694 | 200 |
| 105 | 3300031456 | Ga0307513_10032360 | Ga0307513_100323603 | 200 |
| 106 | 3300033180 | Ga0307510_10001934 | Ga0307510_1000193417 | 200 |
| 107 | 3300038443 | Ga0395901_0946633 | Ga0395901_0946633_54_695 | 200 |
| 108 | 3300046460 | Ga0495638_0020748 | Ga0495638_0020748_2448_3074 | 200 |
| 109 | 3300046506 | Ga0495583_0004795 | Ga0495583_0004795_4839_5465 | 200 |
| 110 | 3300046524 | Ga0495648_0255744 | Ga0495648_0255744_104_730 | 200 |
| 111 | 3300046660 | Ga0495625_0006253 | Ga0495625_0006253_4827_5453 | 200 |
| 112 | 3300047445 | Ga0495677_0011648 | Ga0495677_0011648_1676_2302 | 200 |
| 113 | 3300048923 | Ga0496120_0275317 | Ga0496120_0275317_80_715 | 200 |
| 114 | 3300053087 | Ga0500643_004736 | Ga0500643_004736_5203_5829 | 200 |
| 115 | 3300053136 | Ga0500559_0133033 | Ga0500559_0133033_379_1005 | 200 |
| 116 | 3300003214 | JGI25165J46597_1000023 | JGI25165J46597_1000023257 | 201 |
| 117 | 3300005327 | Ga0070658_10011417 | Ga0070658_100114175 | 201 |
| 118 | 3300005468 | Ga0070707_100265752 | Ga0070707_1002657522 | 201 |
| 119 | 3300005471 | Ga0070698_100005990 | Ga0070698_1000059909 | 201 |
| 120 | 3300005614 | Ga0068856_100161800 | Ga0068856_1001618001 | 201 |
| 121 | 3300011119 | Ga0105246_10080107 | Ga0105246_100801071 | 201 |
| 122 | 3300013104 | Ga0157370_10000611 | Ga0157370_1000061121 | 201 |
| 123 | 3300013105 | Ga0157369_10680569 | Ga0157369_106805692 | 201 |
| 124 | 3300013307 | Ga0157372_10185877 | Ga0157372_101858774 | 201 |
| 125 | 3300025231 | Ga0207427_101709 | Ga0207427_1017095 | 201 |
| 126 | 3300025261 | Ga0209233_1000003 | Ga0209233_10000031094 | 201 |
| 127 | 3300025909 | Ga0207705_10000046 | Ga0207705_10000046144 | 201 |
| 128 | 3300025913 | Ga0207695_10030170 | Ga0207695_100301702 | 201 |
| 129 | 3300026078 | Ga0207702_10017599 | Ga0207702_100175993 | 201 |
| 130 | 3300037312 | Ga0395899_0005273 | Ga0395899_0005273_3332_3964 | 201 |
| 131 | 3300037418 | Ga0395900_0144526 | Ga0395900_0144526_1368_2000 | 201 |
| 132 | 3300044693 | Ga0466961_0038286 | Ga0466961_0038286_2160_2801 | 201 |
| 133 | 3300046616 | Ga0495668_0397965 | Ga0495668_0397965_106_744 | 201 |
| 134 | 3300049568 | Ga0501031_0064981 | Ga0501031_0064981_99_737 | 201 |
| 135 | 3300049569 | Ga0501032_0010146 | Ga0501032_0010146_3992_4630 | 201 |
| 136 | 3300049570 | Ga0501033_0002717 | Ga0501033_0002717_9698_10336 | 201 |
| 137 | 3300049571 | Ga0501034_0013551 | Ga0501034_0013551_2334_2972 | 201 |
| 138 | 3300049572 | Ga0501036_0057816 | Ga0501036_0057816_1254_1892 | 201 |
| 139 | 3300049573 | Ga0501037_0048585 | Ga0501037_0048585_1902_2540 | 201 |
| 140 | 3300049574 | Ga0501038_0000648 | Ga0501038_0000648_7503_8141 | 201 |
| 141 | 3300049579 | Ga0501043_0044299 | Ga0501043_0044299_1503_2141 | 201 |
| 142 | 3300049580 | Ga0501046_0000498 | Ga0501046_0000498_1255_1893 | 201 |
| 143 | 3300049581 | Ga0501047_0002363 | Ga0501047_0002363_16217_16855 | 201 |
| 144 | 3300049584 | Ga0501068_0241653 | Ga0501068_0241653_47_685 | 201 |
| 145 | 3300049589 | Ga0501073_0009955 | Ga0501073_0009955_4442_5080 | 201 |
| 146 | 3300049742 | Ga0501080_0168729 | Ga0501080_0168729_582_1220 | 201 |
| 147 | 3300049822 | Ga0501035_0003773 | Ga0501035_0003773_4103_4741 | 201 |
| 148 | 3300049823 | Ga0501044_0015480 | Ga0501044_0015480_778_1416 | 201 |
| 149 | 3300005468 | Ga0070707_100791006 | Ga0070707_1007910062 | 202 |
| 150 | 3300025941 | Ga0207711_10010970 | Ga0207711_100109708 | 202 |
| 151 | 3300045051 | Ga0451576_0089836 | Ga0451576_0089836_645_1268 | 202 |
| 152 | iso_pu_bacteria | 2895395659 | 2895398484 | 202 |
| 153 | 3300005471 | Ga0070698_100000654 | Ga0070698_10000065421 | 203 |
| 154 | 3300005518 | Ga0070699_100007860 | Ga0070699_1000078602 | 203 |
| 155 | 3300014325 | Ga0163163_11510263 | Ga0163163_115102631 | 203 |
| 156 | 3300025910 | Ga0207684_10756118 | Ga0207684_107561181 | 203 |
| 157 | 3300031250 | Ga0265331_10021149 | Ga0265331_100211492 | 203 |
| 158 | 3300031251 | Ga0265327_10014068 | Ga0265327_100140682 | 203 |
| 159 | 3300032005 | Ga0307411_10105380 | Ga0307411_101053802 | 203 |
| 160 | 3300045049 | Ga0466959_0005151 | Ga0466959_0005151_3675_4313 | 203 |
| 161 | 3300045051 | Ga0451576_0981182 | Ga0451576_0981182_222_845 | 203 |
| 162 | 3300005327 | Ga0070658_10001110 | Ga0070658_100011102 | 204 |
| 163 | 3300005329 | Ga0070683_100122814 | Ga0070683_1001228142 | 204 |
| 164 | 3300005337 | Ga0070682_100299018 | Ga0070682_1002990181 | 204 |
| 165 | 3300005354 | Ga0070675_100101571 | Ga0070675_1001015712 | 204 |
| 166 | 3300005365 | Ga0070688_100380416 | Ga0070688_1003804162 | 204 |
| 167 | 3300005458 | Ga0070681_10022448 | Ga0070681_100224484 | 204 |
| 168 | 3300005458 | Ga0070681_10067584 | Ga0070681_100675842 | 204 |
| 169 | 3300005458 | Ga0070681_10136893 | Ga0070681_101368931 | 204 |
| 170 | 3300005530 | Ga0070679_100034244 | Ga0070679_1000342444 | 204 |
| 171 | 3300005530 | Ga0070679_100162689 | Ga0070679_1001626892 | 204 |
| 172 | 3300005563 | Ga0068855_100088628 | Ga0068855_1000886284 | 204 |
| 173 | 3300005577 | Ga0068857_100240030 | Ga0068857_1002400302 | 204 |
| 174 | 3300005614 | Ga0068856_100200125 | Ga0068856_1002001253 | 204 |
| 175 | 3300006237 | Ga0097621_100506732 | Ga0097621_1005067322 | 204 |
| 176 | 3300009093 | Ga0105240_11393867 | Ga0105240_113938671 | 204 |
| 177 | 3300010375 | Ga0105239_10058747 | Ga0105239_100587472 | 204 |
| 178 | 3300013296 | Ga0157374_10074484 | Ga0157374_100744842 | 204 |
| 179 | 3300013307 | Ga0157372_10091083 | Ga0157372_100910832 | 204 |
| 180 | 3300021388 | Ga0213875_10004572 | Ga0213875_100045725 | 204 |
| 181 | 3300025909 | Ga0207705_10001249 | Ga0207705_1000124919 | 204 |
| 182 | 3300025912 | Ga0207707_10057911 | Ga0207707_100579112 | 204 |
| 183 | 3300025912 | Ga0207707_10058144 | Ga0207707_100581442 | 204 |
| 184 | 3300025912 | Ga0207707_10063990 | Ga0207707_100639902 | 204 |
| 185 | 3300025921 | Ga0207652_10025526 | Ga0207652_100255262 | 204 |
| 186 | 3300025921 | Ga0207652_10032239 | Ga0207652_100322393 | 204 |
| 187 | 3300025921 | Ga0207652_10154919 | Ga0207652_101549193 | 204 |
| 188 | 3300025926 | Ga0207659_10257686 | Ga0207659_102576862 | 204 |
| 189 | 3300025944 | Ga0207661_10096868 | Ga0207661_100968683 | 204 |
| 190 | 3300025949 | Ga0207667_10071697 | Ga0207667_100716971 | 204 |
| 191 | 3300026041 | Ga0207639_10863330 | Ga0207639_108633301 | 204 |
| 192 | 3300026088 | Ga0207641_10914630 | Ga0207641_109146302 | 204 |
| 193 | 3300026116 | Ga0207674_10270278 | Ga0207674_102702782 | 204 |
| 194 | 3300026116 | Ga0207674_10297320 | Ga0207674_102973202 | 204 |
| 195 | 3300026121 | Ga0207683_10142336 | Ga0207683_101423362 | 204 |
| 196 | 3300031239 | Ga0265328_10000002 | Ga0265328_10000002206 | 204 |
| 197 | 3300031507 | Ga0307509_10183477 | Ga0307509_101834772 | 204 |
| 198 | 3300031665 | Ga0316575_10042091 | Ga0316575_100420912 | 204 |
| 199 | 3300031711 | Ga0265314_10114606 | Ga0265314_101146062 | 204 |
| 200 | 3300037853 | Ga0436364_1290526 | Ga0436364_1290526_3960_4574 | 204 |
| 201 | 3300039447 | Ga0436361_0090086 | Ga0436361_0090086_593_1252 | 204 |
| 202 | 3300039450 | Ga0436363_0661182 | Ga0436363_0661182_636_1292 | 204 |
| 203 | 3300045049 | Ga0466959_0394446 | Ga0466959_0394446_141_797 | 204 |
| 204 | 3300046454 | Ga0495592_0354454 | Ga0495592_0354454_85_732 | 204 |
| 205 | 3300046462 | Ga0495651_0344850 | Ga0495651_0344850_152_799 | 204 |
| 206 | 3300046675 | Ga0495657_0298977 | Ga0495657_0298977_277_924 | 204 |
| 207 | 3300046679 | Ga0495623_0014264 | Ga0495623_0014264_3168_3815 | 204 |
| 208 | 3300046689 | Ga0495613_0050039 | Ga0495613_0050039_2399_3061 | 204 |
| 209 | 3300048918 | Ga0496115_0262424 | Ga0496115_0262424_463_1128 | 204 |
| 210 | 3300005335 | Ga0070666_10368401 | Ga0070666_103684011 | 205 |
| 211 | 3300005355 | Ga0070671_100003495 | Ga0070671_1000034957 | 205 |
| 212 | 3300005444 | Ga0070694_100181065 | Ga0070694_1001810652 | 205 |
| 213 | 3300005458 | Ga0070681_10401611 | Ga0070681_104016112 | 205 |
| 214 | 3300006173 | Ga0070716_100235405 | Ga0070716_1002354052 | 205 |
| 215 | 3300006914 | Ga0075436_100452430 | Ga0075436_1004524301 | 205 |
| 216 | 3300013307 | Ga0157372_10180790 | Ga0157372_101807903 | 205 |
| 217 | 3300014326 | Ga0157380_10037236 | Ga0157380_100372365 | 205 |
| 218 | 3300021388 | Ga0213875_10018387 | Ga0213875_100183873 | 205 |
| 219 | 3300025931 | Ga0207644_10000772 | Ga0207644_100007727 | 205 |
| 220 | 3300025939 | Ga0207665_10234380 | Ga0207665_102343802 | 205 |
| 221 | 3300026088 | Ga0207641_10054302 | Ga0207641_100543024 | 205 |
| 222 | 3300037312 | Ga0395899_0007715 | Ga0395899_0007715_4109_4729 | 205 |
| 223 | 3300037312 | Ga0395899_0058990 | Ga0395899_0058990_987_1607 | 205 |
| 224 | 3300037418 | Ga0395900_0003899 | Ga0395900_0003899_11776_12396 | 205 |
| 225 | 3300037418 | Ga0395900_0004815 | Ga0395900_0004815_1847_2467 | 205 |
| 226 | 3300037418 | Ga0395900_0163403 | Ga0395900_0163403_445_1065 | 205 |
| 227 | 3300037418 | Ga0395900_0769407 | Ga0395900_0769407_124_744 | 205 |
| 228 | 3300037466 | Ga0395898_0035276 | Ga0395898_0035276_2561_3181 | 205 |
| 229 | 3300037466 | Ga0395898_0078853 | Ga0395898_0078853_2117_2737 | 205 |
| 230 | 3300037853 | Ga0436364_1505222 | Ga0436364_1505222_2310_2936 | 205 |
| 231 | 3300038443 | Ga0395901_0104521 | Ga0395901_0104521_446_1066 | 205 |
| 232 | 3300039450 | Ga0436363_1471237 | Ga0436363_1471237_2381_3007 | 205 |
| 233 | 3300039453 | Ga0436362_0591404 | Ga0436362_0591404_921_1547 | 205 |
| 234 | 3300042876 | Ga0451577_0000051 | Ga0451577_0000051_34030_34683 | 205 |
| 235 | 3300044712 | Ga0453684_0015307 | Ga0453684_0015307_6603_7277 | 205 |
| 236 | 3300044712 | Ga0453684_0057131 | Ga0453684_0057131_2957_3610 | 205 |
| 237 | 3300044712 | Ga0453684_1051636 | Ga0453684_1051636_143_769 | 205 |
| 238 | 3300044842 | Ga0466957_0089965 | Ga0466957_0089965_85_702 | 205 |
| 239 | 3300045976 | Ga0466967_0292381 | Ga0466967_0292381_773_1399 | 205 |
| 240 | iso_pu_bacteria | 2884215851 | 2884216688 | 205 |
| 241 | iso_pu_bacteria | 2928027323 | 2928030697 | 205 |
| 242 | iso_pu_bacteria | 2984555340 | 2984557175 | 205 |
| 243 | iso_pu_bacteria | 2984564862 | 2984568458 | 205 |
| 244 | iso_pu_bacteria | 2993356040 | 2993359509 | 205 |
| 245 | 3300005295 | Ga0065707_10178805 | Ga0065707_101788052 | 206 |
| 246 | 3300005366 | Ga0070659_100410270 | Ga0070659_1004102701 | 206 |
| 247 | 3300005471 | Ga0070698_100041365 | Ga0070698_1000413652 | 206 |
| 248 | 3300005518 | Ga0070699_100000005 | Ga0070699_100000005222 | 206 |
| 249 | 3300005539 | Ga0068853_100014923 | Ga0068853_1000149233 | 206 |
| 250 | 3300006844 | Ga0075428_100824092 | Ga0075428_1008240922 | 206 |
| 251 | 3300006846 | Ga0075430_100006526 | Ga0075430_10000652610 | 206 |
| 252 | 3300006852 | Ga0075433_10008862 | Ga0075433_100088623 | 206 |
| 253 | 3300006852 | Ga0075433_10115992 | Ga0075433_101159922 | 206 |
| 254 | 3300006871 | Ga0075434_100097005 | Ga0075434_1000970051 | 206 |
| 255 | 3300009147 | Ga0114129_10012148 | Ga0114129_100121482 | 206 |
| 256 | 3300009147 | Ga0114129_10830192 | Ga0114129_108301922 | 206 |
| 257 | 3300013100 | Ga0157373_10042767 | Ga0157373_100427675 | 206 |
| 258 | 3300015261 | Ga0182006_1020670 | Ga0182006_10206705 | 206 |
| 259 | 3300025919 | Ga0207657_10233401 | Ga0207657_102334012 | 206 |
| 260 | 3300025932 | Ga0207690_10010111 | Ga0207690_100101118 | 206 |
| 261 | 3300026041 | Ga0207639_10098449 | Ga0207639_100984494 | 206 |
| 262 | 3300026116 | Ga0207674_10540119 | Ga0207674_105401192 | 206 |
| 263 | 3300031251 | Ga0265327_10002507 | Ga0265327_1000250717 | 206 |
| 264 | 3300031251 | Ga0265327_10039801 | Ga0265327_100398011 | 206 |
| 265 | 3300031344 | Ga0265316_10175048 | Ga0265316_101750482 | 206 |
| 266 | 3300035170 | Ga0373943_0060351 | Ga0373943_0060351_453_1076 | 206 |
| 267 | 3300035724 | Ga0373933_0086789 | Ga0373933_0086789_1083_1703 | 206 |
| 268 | 3300036401 | Ga0373937_0488410 | Ga0373937_0488410_185_805 | 206 |
| 269 | 3300036401 | Ga0373937_0580775 | Ga0373937_0580775_121_744 | 206 |
| 270 | 3300037068 | Ga0373925_0509873 | Ga0373925_0509873_106_729 | 206 |
| 271 | 3300037418 | Ga0395900_0183595 | Ga0395900_0183595_205_825 | 206 |
| 272 | 3300038443 | Ga0395901_0000594 | Ga0395901_0000594_39756_40376 | 206 |
| 273 | 3300042876 | Ga0451577_0000003 | Ga0451577_0000003_383557_384195 | 206 |
| 274 | 3300042876 | Ga0451577_0019556 | Ga0451577_0019556_388_1044 | 206 |
| 275 | 3300042876 | Ga0451577_0107254 | Ga0451577_0107254_1145_1801 | 206 |
| 276 | 3300042876 | Ga0451577_0279404 | Ga0451577_0279404_861_1499 | 206 |
| 277 | 3300044673 | Ga0453683_0006913 | Ga0453683_0006913_4913_5533 | 206 |
| 278 | 3300044673 | Ga0453683_0015820 | Ga0453683_0015820_2664_3320 | 206 |
| 279 | 3300044673 | Ga0453683_0210673 | Ga0453683_0210673_165_821 | 206 |
| 280 | 3300044673 | Ga0453683_0275321 | Ga0453683_0275321_86_742 | 206 |
| 281 | 3300044712 | Ga0453684_0000042 | Ga0453684_0000042_257146_257772 | 206 |
| 282 | 3300044712 | Ga0453684_0068319 | Ga0453684_0068319_554_1210 | 206 |
| 283 | 3300045051 | Ga0451576_0014134 | Ga0451576_0014134_6917_7573 | 206 |
| 284 | 3300045051 | Ga0451576_0133154 | Ga0451576_0133154_49_705 | 206 |
| 285 | 3300045051 | Ga0451576_0197868 | Ga0451576_0197868_986_1642 | 206 |
| 286 | 3300045051 | Ga0451576_0295492 | Ga0451576_0295492_114_746 | 206 |
| 287 | 3300049574 | Ga0501038_0430862 | Ga0501038_0430862_367_1002 | 206 |
| 288 | 3300050513 | nmdc:mga0rr50_840255_c1 | nmdc:mga0rr50_840255_c1_70_708 | 206 |
| 289 | 3300050515 | nmdc:mga0a205_9958_c1 | nmdc:mga0a205_9958_c1_4937_5557 | 206 |
| 290 | 3300053153 | Ga0500616_0000008 | Ga0500616_0000008_643155_643787 | 206 |
| 291 | 3300005440 | Ga0070705_100394558 | Ga0070705_1003945582 | 207 |
| 292 | 3300005445 | Ga0070708_100053670 | Ga0070708_1000536703 | 207 |
| 293 | 3300005467 | Ga0070706_100162916 | Ga0070706_1001629163 | 207 |
| 294 | 3300005536 | Ga0070697_100005515 | Ga0070697_1000055156 | 207 |
| 295 | 3300005546 | Ga0070696_100004259 | Ga0070696_1000042591 | 207 |
| 296 | 3300025929 | Ga0207664_10516174 | Ga0207664_105161742 | 207 |
| 297 | 3300025937 | Ga0207669_10026342 | Ga0207669_100263422 | 207 |
| 298 | 3300025941 | Ga0207711_10007869 | Ga0207711_100078692 | 207 |
| 299 | 3300031251 | Ga0265327_10097074 | Ga0265327_100970741 | 207 |
| 300 | 3300037068 | Ga0373925_0261445 | Ga0373925_0261445_591_1229 | 207 |
| 301 | 3300039437 | Ga0436365_1548123 | Ga0436365_1548123_269_892 | 207 |
| 302 | 3300039453 | Ga0436362_0141115 | Ga0436362_0141115_1217_1840 | 207 |
| 303 | 3300046675 | Ga0495657_0008879 | Ga0495657_0008879_6551_7189 | 207 |
| 304 | 3300047322 | Ga0495680_0101483 | Ga0495680_0101483_762_1400 | 207 |
| 305 | 3300048089 | Ga0495614_0208027 | Ga0495614_0208027_221_859 | 207 |
| 306 | 3300048928 | Ga0496125_0030934 | Ga0496125_0030934_4088_4753 | 207 |
| 307 | 3300053087 | Ga0500643_010897 | Ga0500643_010897_1246_1869 | 207 |
| 308 | 3300053140 | Ga0500573_0261208 | Ga0500573_0261208_28_654 | 207 |
| 309 | 3300001990 | JGI24737J22298_10035281 | JGI24737J22298_100352811 | 208 |
| 310 | 3300002067 | JGI24735J21928_10011016 | JGI24735J21928_100110163 | 208 |
| 311 | 3300005289 | Ga0065704_10082883 | Ga0065704_100828832 | 208 |
| 312 | 3300005293 | Ga0065715_10018369 | Ga0065715_100183692 | 208 |
| 313 | 3300005295 | Ga0065707_10083298 | Ga0065707_100832988 | 208 |
| 314 | 3300005327 | Ga0070658_10017036 | Ga0070658_100170362 | 208 |
| 315 | 3300005327 | Ga0070658_10058839 | Ga0070658_100588392 | 208 |
| 316 | 3300005327 | Ga0070658_10472471 | Ga0070658_104724711 | 208 |
| 317 | 3300005328 | Ga0070676_10005496 | Ga0070676_100054967 | 208 |
| 318 | 3300005329 | Ga0070683_100081574 | Ga0070683_1000815743 | 208 |
| 319 | 3300005329 | Ga0070683_100593170 | Ga0070683_1005931702 | 208 |
| 320 | 3300005330 | Ga0070690_100000347 | Ga0070690_10000034714 | 208 |
| 321 | 3300005330 | Ga0070690_100002465 | Ga0070690_10000246510 | 208 |
| 322 | 3300005330 | Ga0070690_100019596 | Ga0070690_1000195962 | 208 |
| 323 | 3300005331 | Ga0070670_100094759 | Ga0070670_1000947592 | 208 |
| 324 | 3300005331 | Ga0070670_100288284 | Ga0070670_1002882842 | 208 |
| 325 | 3300005333 | Ga0070677_10003087 | Ga0070677_100030877 | 208 |
| 326 | 3300005334 | Ga0068869_100027201 | Ga0068869_1000272012 | 208 |
| 327 | 3300005334 | Ga0068869_100206486 | Ga0068869_1002064862 | 208 |
| 328 | 3300005336 | Ga0070680_100001484 | Ga0070680_1000014842 | 208 |
| 329 | 3300005336 | Ga0070680_100010569 | Ga0070680_1000105692 | 208 |
| 330 | 3300005336 | Ga0070680_100473280 | Ga0070680_1004732801 | 208 |
| 331 | 3300005337 | Ga0070682_100109549 | Ga0070682_1001095492 | 208 |
| 332 | 3300005337 | Ga0070682_100578953 | Ga0070682_1005789531 | 208 |
| 333 | 3300005339 | Ga0070660_100001591 | Ga0070660_1000015912 | 208 |
| 334 | 3300005339 | Ga0070660_100008686 | Ga0070660_1000086862 | 208 |
| 335 | 3300005340 | Ga0070689_100000037 | Ga0070689_10000003725 | 208 |
| 336 | 3300005340 | Ga0070689_100001740 | Ga0070689_1000017402 | 208 |
| 337 | 3300005340 | Ga0070689_100656150 | Ga0070689_1006561501 | 208 |
| 338 | 3300005341 | Ga0070691_10004779 | Ga0070691_100047792 | 208 |
| 339 | 3300005343 | Ga0070687_100004347 | Ga0070687_1000043477 | 208 |
| 340 | 3300005344 | Ga0070661_100139136 | Ga0070661_1001391362 | 208 |
| 341 | 3300005344 | Ga0070661_100223159 | Ga0070661_1002231592 | 208 |
| 342 | 3300005345 | Ga0070692_10002936 | Ga0070692_100029366 | 208 |
| 343 | 3300005345 | Ga0070692_10136461 | Ga0070692_101364612 | 208 |
| 344 | 3300005347 | Ga0070668_100114637 | Ga0070668_1001146372 | 208 |
| 345 | 3300005353 | Ga0070669_100011872 | Ga0070669_1000118722 | 208 |
| 346 | 3300005356 | Ga0070674_100003796 | Ga0070674_1000037962 | 208 |
| 347 | 3300005364 | Ga0070673_100006972 | Ga0070673_1000069728 | 208 |
| 348 | 3300005364 | Ga0070673_100666738 | Ga0070673_1006667381 | 208 |
| 349 | 3300005365 | Ga0070688_100000176 | Ga0070688_10000017616 | 208 |
| 350 | 3300005365 | Ga0070688_100107882 | Ga0070688_1001078821 | 208 |
| 351 | 3300005365 | Ga0070688_100758418 | Ga0070688_1007584181 | 208 |
| 352 | 3300005367 | Ga0070667_100056577 | Ga0070667_1000565775 | 208 |
| 353 | 3300005434 | Ga0070709_10324365 | Ga0070709_103243652 | 208 |
| 354 | 3300005437 | Ga0070710_10069362 | Ga0070710_100693622 | 208 |
| 355 | 3300005438 | Ga0070701_10000079 | Ga0070701_1000007914 | 208 |
| 356 | 3300005440 | Ga0070705_100011424 | Ga0070705_1000114246 | 208 |
| 357 | 3300005440 | Ga0070705_100059492 | Ga0070705_1000594922 | 208 |
| 358 | 3300005441 | Ga0070700_100000334 | Ga0070700_10000033421 | 208 |
| 359 | 3300005441 | Ga0070700_100103673 | Ga0070700_1001036732 | 208 |
| 360 | 3300005444 | Ga0070694_100022341 | Ga0070694_1000223416 | 208 |
| 361 | 3300005444 | Ga0070694_100175669 | Ga0070694_1001756692 | 208 |
| 362 | 3300005444 | Ga0070694_100574632 | Ga0070694_1005746321 | 208 |
| 363 | 3300005445 | Ga0070708_100873390 | Ga0070708_1008733901 | 208 |
| 364 | 3300005455 | Ga0070663_100010199 | Ga0070663_1000101997 | 208 |
| 365 | 3300005455 | Ga0070663_100076604 | Ga0070663_1000766042 | 208 |
| 366 | 3300005455 | Ga0070663_100222644 | Ga0070663_1002226442 | 208 |
| 367 | 3300005456 | Ga0070678_100000915 | Ga0070678_10000091516 | 208 |
| 368 | 3300005457 | Ga0070662_100001269 | Ga0070662_1000012692 | 208 |
| 369 | 3300005458 | Ga0070681_10023191 | Ga0070681_100231912 | 208 |
| 370 | 3300005458 | Ga0070681_10074256 | Ga0070681_100742562 | 208 |
| 371 | 3300005459 | Ga0068867_100000402 | Ga0068867_1000004022 | 208 |
| 372 | 3300005459 | Ga0068867_100003137 | Ga0068867_10000313711 | 208 |
| 373 | 3300005459 | Ga0068867_100610739 | Ga0068867_1006107392 | 208 |
| 374 | 3300005466 | Ga0070685_10000066 | Ga0070685_100000667 | 208 |
| 375 | 3300005468 | Ga0070707_100000072 | Ga0070707_10000007288 | 208 |
| 376 | 3300005468 | Ga0070707_100235707 | Ga0070707_1002357072 | 208 |
| 377 | 3300005471 | Ga0070698_100124329 | Ga0070698_1001243292 | 208 |
| 378 | 3300005518 | Ga0070699_100167110 | Ga0070699_1001671103 | 208 |
| 379 | 3300005518 | Ga0070699_100227953 | Ga0070699_1002279532 | 208 |
| 380 | 3300005530 | Ga0070679_100452016 | Ga0070679_1004520162 | 208 |
| 381 | 3300005530 | Ga0070679_100520102 | Ga0070679_1005201021 | 208 |
| 382 | 3300005535 | Ga0070684_100156619 | Ga0070684_1001566192 | 208 |
| 383 | 3300005535 | Ga0070684_100360872 | Ga0070684_1003608722 | 208 |
| 384 | 3300005536 | Ga0070697_100010394 | Ga0070697_1000103941 | 208 |
| 385 | 3300005543 | Ga0070672_100028473 | Ga0070672_1000284733 | 208 |
| 386 | 3300005544 | Ga0070686_100000072 | Ga0070686_10000007253 | 208 |
| 387 | 3300005544 | Ga0070686_100001120 | Ga0070686_10000112013 | 208 |
| 388 | 3300005544 | Ga0070686_100052555 | Ga0070686_1000525552 | 208 |
| 389 | 3300005544 | Ga0070686_100153962 | Ga0070686_1001539622 | 208 |
| 390 | 3300005545 | Ga0070695_100001295 | Ga0070695_10000129515 | 208 |
| 391 | 3300005545 | Ga0070695_100117864 | Ga0070695_1001178642 | 208 |
| 392 | 3300005545 | Ga0070695_100515902 | Ga0070695_1005159022 | 208 |
| 393 | 3300005546 | Ga0070696_100004964 | Ga0070696_1000049649 | 208 |
| 394 | 3300005546 | Ga0070696_100082144 | Ga0070696_1000821442 | 208 |
| 395 | 3300005547 | Ga0070693_100007294 | Ga0070693_1000072942 | 208 |
| 396 | 3300005547 | Ga0070693_100079033 | Ga0070693_1000790332 | 208 |
| 397 | 3300005548 | Ga0070665_100080652 | Ga0070665_1000806522 | 208 |
| 398 | 3300005549 | Ga0070704_100057938 | Ga0070704_1000579385 | 208 |
| 399 | 3300005549 | Ga0070704_100063948 | Ga0070704_1000639481 | 208 |
| 400 | 3300005563 | Ga0068855_100454905 | Ga0068855_1004549052 | 208 |
| 401 | 3300005563 | Ga0068855_100533080 | Ga0068855_1005330802 | 208 |
| 402 | 3300005564 | Ga0070664_100000873 | Ga0070664_1000008733 | 208 |
| 403 | 3300005564 | Ga0070664_100003255 | Ga0070664_1000032559 | 208 |
| 404 | 3300005577 | Ga0068857_100053911 | Ga0068857_1000539113 | 208 |
| 405 | 3300005577 | Ga0068857_100113923 | Ga0068857_1001139232 | 208 |
| 406 | 3300005578 | Ga0068854_100011675 | Ga0068854_1000116752 | 208 |
| 407 | 3300005615 | Ga0070702_100004518 | Ga0070702_1000045183 | 208 |
| 408 | 3300005615 | Ga0070702_100033964 | Ga0070702_1000339643 | 208 |
| 409 | 3300005617 | Ga0068859_100587780 | Ga0068859_1005877802 | 208 |
| 410 | 3300005618 | Ga0068864_100000111 | Ga0068864_10000011132 | 208 |
| 411 | 3300005618 | Ga0068864_100097668 | Ga0068864_1000976686 | 208 |
| 412 | 3300005719 | Ga0068861_100017480 | Ga0068861_1000174802 | 208 |
| 413 | 3300005719 | Ga0068861_100089507 | Ga0068861_1000895072 | 208 |
| 414 | 3300005842 | Ga0068858_100000022 | Ga0068858_100000022185 | 208 |
| 415 | 3300005843 | Ga0068860_100013042 | Ga0068860_1000130422 | 208 |
| 416 | 3300005844 | Ga0068862_100110279 | Ga0068862_1001102793 | 208 |
| 417 | 3300006058 | Ga0075432_10000146 | Ga0075432_1000014616 | 208 |
| 418 | 3300006163 | Ga0070715_10130521 | Ga0070715_101305212 | 208 |
| 419 | 3300006163 | Ga0070715_10131828 | Ga0070715_101318282 | 208 |
| 420 | 3300006173 | Ga0070716_100322906 | Ga0070716_1003229062 | 208 |
| 421 | 3300006237 | Ga0097621_100020509 | Ga0097621_1000205093 | 208 |
| 422 | 3300006237 | Ga0097621_100089216 | Ga0097621_1000892164 | 208 |
| 423 | 3300006237 | Ga0097621_100122288 | Ga0097621_1001222882 | 208 |
| 424 | 3300006358 | Ga0068871_100044823 | Ga0068871_1000448232 | 208 |
| 425 | 3300006846 | Ga0075430_100008729 | Ga0075430_1000087292 | 208 |
| 426 | 3300006846 | Ga0075430_100017031 | Ga0075430_1000170317 | 208 |
| 427 | 3300006847 | Ga0075431_100011189 | Ga0075431_1000111897 | 208 |
| 428 | 3300006852 | Ga0075433_10005027 | Ga0075433_100050279 | 208 |
| 429 | 3300006852 | Ga0075433_10018091 | Ga0075433_100180917 | 208 |
| 430 | 3300006852 | Ga0075433_10109987 | Ga0075433_101099871 | 208 |
| 431 | 3300006880 | Ga0075429_100011609 | Ga0075429_1000116097 | 208 |
| 432 | 3300006880 | Ga0075429_100050521 | Ga0075429_1000505212 | 208 |
| 433 | 3300006881 | Ga0068865_100001245 | Ga0068865_10000124516 | 208 |
| 434 | 3300006881 | Ga0068865_100567845 | Ga0068865_1005678452 | 208 |
| 435 | 3300006914 | Ga0075436_100074038 | Ga0075436_1000740382 | 208 |
| 436 | 3300006914 | Ga0075436_100114555 | Ga0075436_1001145552 | 208 |
| 437 | 3300006931 | Ga0097620_100587815 | Ga0097620_1005878151 | 208 |
| 438 | 3300007076 | Ga0075435_100068984 | Ga0075435_1000689845 | 208 |
| 439 | 3300007076 | Ga0075435_100286224 | Ga0075435_1002862242 | 208 |
| 440 | 3300009093 | Ga0105240_10102207 | Ga0105240_101022073 | 208 |
| 441 | 3300009093 | Ga0105240_10182979 | Ga0105240_101829792 | 208 |
| 442 | 3300009098 | Ga0105245_10020460 | Ga0105245_100204607 | 208 |
| 443 | 3300009147 | Ga0114129_10007246 | Ga0114129_100072462 | 208 |
| 444 | 3300009147 | Ga0114129_10297553 | Ga0114129_102975532 | 208 |
| 445 | 3300009148 | Ga0105243_10016408 | Ga0105243_100164087 | 208 |
| 446 | 3300009174 | Ga0105241_10020096 | Ga0105241_100200966 | 208 |
| 447 | 3300009176 | Ga0105242_10005679 | Ga0105242_1000567910 | 208 |
| 448 | 3300009176 | Ga0105242_10080013 | Ga0105242_100800132 | 208 |
| 449 | 3300009176 | Ga0105242_10160971 | Ga0105242_101609712 | 208 |
| 450 | 3300009177 | Ga0105248_10002568 | Ga0105248_1000256817 | 208 |
| 451 | 3300009177 | Ga0105248_10006274 | Ga0105248_100062743 | 208 |
| 452 | 3300009177 | Ga0105248_10718204 | Ga0105248_107182041 | 208 |
| 453 | 3300009545 | Ga0105237_10002288 | Ga0105237_100022887 | 208 |
| 454 | 3300009553 | Ga0105249_10063181 | Ga0105249_100631812 | 208 |
| 455 | 3300009553 | Ga0105249_11037219 | Ga0105249_110372192 | 208 |
| 456 | 3300011119 | Ga0105246_10007739 | Ga0105246_100077392 | 208 |
| 457 | 3300013102 | Ga0157371_10065655 | Ga0157371_100656552 | 208 |
| 458 | 3300013104 | Ga0157370_10039339 | Ga0157370_100393393 | 208 |
| 459 | 3300013104 | Ga0157370_10101703 | Ga0157370_101017032 | 208 |
| 460 | 3300013105 | Ga0157369_10035178 | Ga0157369_100351784 | 208 |
| 461 | 3300013296 | Ga0157374_10010625 | Ga0157374_100106252 | 208 |
| 462 | 3300013297 | Ga0157378_10036078 | Ga0157378_100360783 | 208 |
| 463 | 3300013297 | Ga0157378_10118500 | Ga0157378_101185003 | 208 |
| 464 | 3300013306 | Ga0163162_10099988 | Ga0163162_100999882 | 208 |
| 465 | 3300013307 | Ga0157372_10048563 | Ga0157372_100485635 | 208 |
| 466 | 3300013307 | Ga0157372_10102985 | Ga0157372_101029853 | 208 |
| 467 | 3300013308 | Ga0157375_10159424 | Ga0157375_101594241 | 208 |
| 468 | 3300014325 | Ga0163163_10244126 | Ga0163163_102441261 | 208 |
| 469 | 3300014326 | Ga0157380_10003770 | Ga0157380_100037703 | 208 |
| 470 | 3300014326 | Ga0157380_10005347 | Ga0157380_1000534711 | 208 |
| 471 | 3300014326 | Ga0157380_10106604 | Ga0157380_101066042 | 208 |
| 472 | 3300014745 | Ga0157377_10003125 | Ga0157377_100031259 | 208 |
| 473 | 3300014969 | Ga0157376_10001880 | Ga0157376_1000188013 | 208 |
| 474 | 3300014969 | Ga0157376_10028395 | Ga0157376_100283954 | 208 |
| 475 | 3300017792 | Ga0163161_10180539 | Ga0163161_101805392 | 208 |
| 476 | 3300025893 | Ga0207682_10058329 | Ga0207682_100583292 | 208 |
| 477 | 3300025898 | Ga0207692_10167004 | Ga0207692_101670042 | 208 |
| 478 | 3300025901 | Ga0207688_10060783 | Ga0207688_100607832 | 208 |
| 479 | 3300025903 | Ga0207680_10067310 | Ga0207680_100673102 | 208 |
| 480 | 3300025905 | Ga0207685_10004793 | Ga0207685_100047933 | 208 |
| 481 | 3300025905 | Ga0207685_10098322 | Ga0207685_100983222 | 208 |
| 482 | 3300025906 | Ga0207699_10487896 | Ga0207699_104878961 | 208 |
| 483 | 3300025907 | Ga0207645_10000106 | Ga0207645_1000010663 | 208 |
| 484 | 3300025908 | Ga0207643_10074006 | Ga0207643_100740062 | 208 |
| 485 | 3300025909 | Ga0207705_10004105 | Ga0207705_100041051 | 208 |
| 486 | 3300025909 | Ga0207705_10457421 | Ga0207705_104574211 | 208 |
| 487 | 3300025910 | Ga0207684_10118130 | Ga0207684_101181302 | 208 |
| 488 | 3300025912 | Ga0207707_10021217 | Ga0207707_100212172 | 208 |
| 489 | 3300025912 | Ga0207707_10256389 | Ga0207707_102563892 | 208 |
| 490 | 3300025913 | Ga0207695_10093976 | Ga0207695_100939762 | 208 |
| 491 | 3300025913 | Ga0207695_10123346 | Ga0207695_101233462 | 208 |
| 492 | 3300025917 | Ga0207660_10009791 | Ga0207660_100097912 | 208 |
| 493 | 3300025917 | Ga0207660_10105156 | Ga0207660_101051561 | 208 |
| 494 | 3300025917 | Ga0207660_10127553 | Ga0207660_101275532 | 208 |
| 495 | 3300025918 | Ga0207662_10031065 | Ga0207662_100310652 | 208 |
| 496 | 3300025919 | Ga0207657_10001750 | Ga0207657_1000175022 | 208 |
| 497 | 3300025919 | Ga0207657_10014426 | Ga0207657_100144264 | 208 |
| 498 | 3300025920 | Ga0207649_10058357 | Ga0207649_100583573 | 208 |
| 499 | 3300025922 | Ga0207646_10000002 | Ga0207646_10000002369 | 208 |
| 500 | 3300025922 | Ga0207646_10827406 | Ga0207646_108274061 | 208 |
| 501 | 3300025923 | Ga0207681_10006532 | Ga0207681_100065328 | 208 |
| 502 | 3300025925 | Ga0207650_10095734 | Ga0207650_100957342 | 208 |
| 503 | 3300025925 | Ga0207650_10234257 | Ga0207650_102342572 | 208 |
| 504 | 3300025927 | Ga0207687_10020033 | Ga0207687_100200332 | 208 |
| 505 | 3300025932 | Ga0207690_10003524 | Ga0207690_1000352410 | 208 |
| 506 | 3300025933 | Ga0207706_10003580 | Ga0207706_1000358016 | 208 |
| 507 | 3300025934 | Ga0207686_10066765 | Ga0207686_100667651 | 208 |
| 508 | 3300025934 | Ga0207686_10075812 | Ga0207686_100758121 | 208 |
| 509 | 3300025934 | Ga0207686_10173842 | Ga0207686_101738422 | 208 |
| 510 | 3300025935 | Ga0207709_10010716 | Ga0207709_100107162 | 208 |
| 511 | 3300025936 | Ga0207670_10000048 | Ga0207670_1000004852 | 208 |
| 512 | 3300025936 | Ga0207670_10006030 | Ga0207670_100060308 | 208 |
| 513 | 3300025939 | Ga0207665_10095338 | Ga0207665_100953382 | 208 |
| 514 | 3300025939 | Ga0207665_10343655 | Ga0207665_103436552 | 208 |
| 515 | 3300025940 | Ga0207691_10003100 | Ga0207691_1000310016 | 208 |
| 516 | 3300025940 | Ga0207691_10042650 | Ga0207691_100426504 | 208 |
| 517 | 3300025941 | Ga0207711_10004553 | Ga0207711_100045537 | 208 |
| 518 | 3300025941 | Ga0207711_10018382 | Ga0207711_100183822 | 208 |
| 519 | 3300025941 | Ga0207711_10210061 | Ga0207711_102100612 | 208 |
| 520 | 3300025942 | Ga0207689_10003301 | Ga0207689_1000330112 | 208 |
| 521 | 3300025942 | Ga0207689_10021640 | Ga0207689_100216403 | 208 |
| 522 | 3300025942 | Ga0207689_10609065 | Ga0207689_106090652 | 208 |
| 523 | 3300025944 | Ga0207661_10160717 | Ga0207661_101607172 | 208 |
| 524 | 3300025944 | Ga0207661_10257157 | Ga0207661_102571571 | 208 |
| 525 | 3300025949 | Ga0207667_10189347 | Ga0207667_101893472 | 208 |
| 526 | 3300025949 | Ga0207667_10763691 | Ga0207667_107636911 | 208 |
| 527 | 3300025960 | Ga0207651_10031297 | Ga0207651_100312974 | 208 |
| 528 | 3300025960 | Ga0207651_10080253 | Ga0207651_100802532 | 208 |
| 529 | 3300025960 | Ga0207651_10276692 | Ga0207651_102766922 | 208 |
| 530 | 3300025961 | Ga0207712_10227561 | Ga0207712_102275612 | 208 |
| 531 | 3300025961 | Ga0207712_10691653 | Ga0207712_106916532 | 208 |
| 532 | 3300025986 | Ga0207658_10059219 | Ga0207658_100592195 | 208 |
| 533 | 3300026023 | Ga0207677_10010386 | Ga0207677_100103865 | 208 |
| 534 | 3300026035 | Ga0207703_10000048 | Ga0207703_1000004828 | 208 |
| 535 | 3300026067 | Ga0207678_10001977 | Ga0207678_100019777 | 208 |
| 536 | 3300026067 | Ga0207678_10014128 | Ga0207678_100141287 | 208 |
| 537 | 3300026067 | Ga0207678_10212996 | Ga0207678_102129962 | 208 |
| 538 | 3300026075 | Ga0207708_10000285 | Ga0207708_100002853 | 208 |
| 539 | 3300026075 | Ga0207708_10001695 | Ga0207708_100016952 | 208 |
| 540 | 3300026075 | Ga0207708_10535621 | Ga0207708_105356212 | 208 |
| 541 | 3300026089 | Ga0207648_10000578 | Ga0207648_100005783 | 208 |
| 542 | 3300026089 | Ga0207648_10053460 | Ga0207648_100534604 | 208 |
| 543 | 3300026089 | Ga0207648_10458938 | Ga0207648_104589381 | 208 |
| 544 | 3300026095 | Ga0207676_10000151 | Ga0207676_1000015155 | 208 |
| 545 | 3300026116 | Ga0207674_10018739 | Ga0207674_100187394 | 208 |
| 546 | 3300026116 | Ga0207674_10023980 | Ga0207674_100239803 | 208 |
| 547 | 3300026118 | Ga0207675_100182317 | Ga0207675_1001823172 | 208 |
| 548 | 3300026118 | Ga0207675_100688550 | Ga0207675_1006885501 | 208 |
| 549 | 3300026121 | Ga0207683_10001101 | Ga0207683_1000110111 | 208 |
| 550 | 3300026142 | Ga0207698_10226721 | Ga0207698_102267212 | 208 |
| 551 | 3300027364 | Ga0209967_1000003 | Ga0209967_100000333 | 208 |
| 552 | 3300027378 | Ga0209981_1000058 | Ga0209981_10000582 | 208 |
| 553 | 3300027395 | Ga0209996_1000094 | Ga0209996_100009411 | 208 |
| 554 | 3300027395 | Ga0209996_1006207 | Ga0209996_10062072 | 208 |
| 555 | 3300027424 | Ga0209984_1000587 | Ga0209984_10005872 | 208 |
| 556 | 3300027471 | Ga0209995_1000234 | Ga0209995_10002349 | 208 |
| 557 | 3300027526 | Ga0209968_1001470 | Ga0209968_10014703 | 208 |
| 558 | 3300027543 | Ga0209999_1000320 | Ga0209999_10003207 | 208 |
| 559 | 3300027552 | Ga0209982_1000017 | Ga0209982_100001716 | 208 |
| 560 | 3300027614 | Ga0209970_1003145 | Ga0209970_10031452 | 208 |
| 561 | 3300027617 | Ga0210002_1001187 | Ga0210002_10011875 | 208 |
| 562 | 3300027617 | Ga0210002_1007107 | Ga0210002_10071072 | 208 |
| 563 | 3300027665 | Ga0209983_1001997 | Ga0209983_10019976 | 208 |
| 564 | 3300027682 | Ga0209971_1000718 | Ga0209971_10007182 | 208 |
| 565 | 3300027695 | Ga0209966_1000115 | Ga0209966_100011522 | 208 |
| 566 | 3300027717 | Ga0209998_10000074 | Ga0209998_1000007441 | 208 |
| 567 | 3300027876 | Ga0209974_10000017 | Ga0209974_1000001740 | 208 |
| 568 | 3300027907 | Ga0207428_10000760 | Ga0207428_1000076037 | 208 |
| 569 | 3300028379 | Ga0268266_10042398 | Ga0268266_100423985 | 208 |
| 570 | 3300028380 | Ga0268265_10004280 | Ga0268265_1000428011 | 208 |
| 571 | 3300031731 | Ga0307405_10196094 | Ga0307405_101960942 | 208 |
| 572 | 3300031852 | Ga0307410_10051262 | Ga0307410_100512622 | 208 |
| 573 | 3300031901 | Ga0307406_10076490 | Ga0307406_100764903 | 208 |
| 574 | 3300031911 | Ga0307412_10069114 | Ga0307412_100691142 | 208 |
| 575 | 3300032002 | Ga0307416_100204854 | Ga0307416_1002048542 | 208 |
| 576 | 3300032004 | Ga0307414_10035292 | Ga0307414_100352924 | 208 |
| 577 | 3300035083 | Ga0373926_0006990 | Ga0373926_0006990_2363_3001 | 208 |
| 578 | 3300035083 | Ga0373926_0020718 | Ga0373926_0020718_1534_2175 | 208 |
| 579 | 3300035111 | Ga0373923_0069382 | Ga0373923_0069382_138_779 | 208 |
| 580 | 3300035111 | Ga0373923_0098605 | Ga0373923_0098605_282_923 | 208 |
| 581 | 3300035113 | Ga0373936_0011513 | Ga0373936_0011513_510_1151 | 208 |
| 582 | 3300035113 | Ga0373936_0050621 | Ga0373936_0050621_725_1360 | 208 |
| 583 | 3300035116 | Ga0373945_0006150 | Ga0373945_0006150_2492_3133 | 208 |
| 584 | 3300035116 | Ga0373945_0013358 | Ga0373945_0013358_1369_2010 | 208 |
| 585 | 3300035121 | Ga0373960_0120889 | Ga0373960_0120889_119_757 | 208 |
| 586 | 3300035170 | Ga0373943_0000343 | Ga0373943_0000343_685_1326 | 208 |
| 587 | 3300035170 | Ga0373943_0008884 | Ga0373943_0008884_2007_2648 | 208 |
| 588 | 3300035171 | Ga0373946_0001335 | Ga0373946_0001335_2695_3336 | 208 |
| 589 | 3300035171 | Ga0373946_0089478 | Ga0373946_0089478_536_1174 | 208 |
| 590 | 3300035171 | Ga0373946_0102077 | Ga0373946_0102077_460_1095 | 208 |
| 591 | 3300035692 | Ga0373935_0009490 | Ga0373935_0009490_5049_5690 | 208 |
| 592 | 3300035692 | Ga0373935_0039504 | Ga0373935_0039504_672_1313 | 208 |
| 593 | 3300035692 | Ga0373935_0135376 | Ga0373935_0135376_621_1259 | 208 |
| 594 | 3300035695 | Ga0373927_0001986 | Ga0373927_0001986_2598_3239 | 208 |
| 595 | 3300035695 | Ga0373927_0122333 | Ga0373927_0122333_761_1402 | 208 |
| 596 | 3300035695 | Ga0373927_0169301 | Ga0373927_0169301_264_902 | 208 |
| 597 | 3300035725 | Ga0373947_0000156 | Ga0373947_0000156_17205_17846 | 208 |
| 598 | 3300035725 | Ga0373947_0009196 | Ga0373947_0009196_4860_5495 | 208 |
| 599 | 3300035725 | Ga0373947_0049742 | Ga0373947_0049742_937_1575 | 208 |
| 600 | 3300037068 | Ga0373925_0000628 | Ga0373925_0000628_27160_27801 | 208 |
| 601 | 3300037068 | Ga0373925_0004286 | Ga0373925_0004286_6725_7366 | 208 |
| 602 | 3300037068 | Ga0373925_0068568 | Ga0373925_0068568_1213_1851 | 208 |
| 603 | 3300037418 | Ga0395900_0637162 | Ga0395900_0637162_122_760 | 208 |
| 604 | 3300037466 | Ga0395898_0071760 | Ga0395898_0071760_68_706 | 208 |
| 605 | 3300038443 | Ga0395901_0137933 | Ga0395901_0137933_196_834 | 208 |
| 606 | 3300039437 | Ga0436365_0311528 | Ga0436365_0311528_174_800 | 208 |
| 607 | 3300041410 | Ga0439461_0092762 | Ga0439461_0092762_42_680 | 208 |
| 608 | 3300041411 | Ga0439466_0033219 | Ga0439466_0033219_407_1042 | 208 |
| 609 | 3300041997 | Ga0439431_0028292 | Ga0439431_0028292_414_1049 | 208 |
| 610 | 3300042001 | Ga0439441_010838 | Ga0439441_010838_83_721 | 208 |
| 611 | 3300042005 | Ga0439448_0086740 | Ga0439448_0086740_150_788 | 208 |
| 612 | 3300042006 | Ga0439432_013411 | Ga0439432_013411_1049_1684 | 208 |
| 613 | 3300042185 | Ga0450909_005249 | Ga0450909_005249_903_1538 | 208 |
| 614 | 3300042435 | Ga0439434_0004960 | Ga0439434_0004960_2358_2993 | 208 |
| 615 | 3300042436 | Ga0439435_0035039 | Ga0439435_0035039_518_1156 | 208 |
| 616 | 3300042461 | Ga0439460_0026455 | Ga0439460_0026455_651_1286 | 208 |
| 617 | 3300042876 | Ga0451577_0035562 | Ga0451577_0035562_3399_4031 | 208 |
| 618 | 3300042876 | Ga0451577_0206920 | Ga0451577_0206920_259_897 | 208 |
| 619 | 3300044694 | Ga0466963_0010330 | Ga0466963_0010330_4314_4946 | 208 |
| 620 | 3300044712 | Ga0453684_0826714 | Ga0453684_0826714_323_955 | 208 |
| 621 | 3300044719 | Ga0466971_0005591 | Ga0466971_0005591_1000_1632 | 208 |
| 622 | 3300044719 | Ga0466971_0210930 | Ga0466971_0210930_181_813 | 208 |
| 623 | 3300044842 | Ga0466957_0018836 | Ga0466957_0018836_3032_3664 | 208 |
| 624 | 3300045051 | Ga0451576_0005563 | Ga0451576_0005563_13419_14057 | 208 |
| 625 | 3300045051 | Ga0451576_0234010 | Ga0451576_0234010_542_1180 | 208 |
| 626 | 3300045051 | Ga0451576_0405312 | Ga0451576_0405312_608_1246 | 208 |
| 627 | 3300045051 | Ga0451576_1313476 | Ga0451576_1313476_51_689 | 208 |
| 628 | 3300045976 | Ga0466967_0066862 | Ga0466967_0066862_1522_2154 | 208 |
| 629 | 3300046454 | Ga0495592_0020241 | Ga0495592_0020241_4134_4775 | 208 |
| 630 | 3300046459 | Ga0495629_0094572 | Ga0495629_0094572_938_1579 | 208 |
| 631 | 3300046472 | Ga0495580_0049804 | Ga0495580_0049804_1657_2298 | 208 |
| 632 | 3300046476 | Ga0495662_0000558 | Ga0495662_0000558_9824_10465 | 208 |
| 633 | 3300046477 | Ga0495664_0000393 | Ga0495664_0000393_17506_18147 | 208 |
| 634 | 3300046491 | Ga0495584_0197059 | Ga0495584_0197059_135_773 | 208 |
| 635 | 3300046499 | Ga0495594_0122254 | Ga0495594_0122254_88_726 | 208 |
| 636 | 3300046514 | Ga0495618_0011586 | Ga0495618_0011586_2293_2934 | 208 |
| 637 | 3300046517 | Ga0495630_0005525 | Ga0495630_0005525_2489_3130 | 208 |
| 638 | 3300046517 | Ga0495630_0322750 | Ga0495630_0322750_406_1047 | 208 |
| 639 | 3300046526 | Ga0495666_0020887 | Ga0495666_0020887_2390_3031 | 208 |
| 640 | 3300046529 | Ga0495652_0018394 | Ga0495652_0018394_1323_1964 | 208 |
| 641 | 3300046531 | Ga0495665_0039805 | Ga0495665_0039805_1128_1769 | 208 |
| 642 | 3300046531 | Ga0495665_0051775 | Ga0495665_0051775_308_949 | 208 |
| 643 | 3300046533 | Ga0495640_0001485 | Ga0495640_0001485_9900_10541 | 208 |
| 644 | 3300046533 | Ga0495640_0029192 | Ga0495640_0029192_182_823 | 208 |
| 645 | 3300046543 | Ga0495645_0003126 | Ga0495645_0003126_7490_8131 | 208 |
| 646 | 3300046557 | Ga0495622_0057169 | Ga0495622_0057169_1094_1732 | 208 |
| 647 | 3300046642 | Ga0495634_0001637 | Ga0495634_0001637_1461_2102 | 208 |
| 648 | 3300046642 | Ga0495634_0024760 | Ga0495634_0024760_3403_4044 | 208 |
| 649 | 3300046642 | Ga0495634_0029021 | Ga0495634_0029021_2486_3127 | 208 |
| 650 | 3300046663 | Ga0495635_0002416 | Ga0495635_0002416_9675_10316 | 208 |
| 651 | 3300046664 | Ga0495659_0052266 | Ga0495659_0052266_331_969 | 208 |
| 652 | 3300046689 | Ga0495613_0006144 | Ga0495613_0006144_7143_7784 | 208 |
| 653 | 3300046690 | Ga0495624_0003130 | Ga0495624_0003130_2119_2760 | 208 |
| 654 | 3300046690 | Ga0495624_0017004 | Ga0495624_0017004_2615_3256 | 208 |
| 655 | 3300047315 | Ga0495581_0113672 | Ga0495581_0113672_410_1051 | 208 |
| 656 | 3300047319 | Ga0495674_0002951 | Ga0495674_0002951_8551_9192 | 208 |
| 657 | 3300047319 | Ga0495674_0129785 | Ga0495674_0129785_455_1096 | 208 |
| 658 | 3300047321 | Ga0495676_0073566 | Ga0495676_0073566_1235_1876 | 208 |
| 659 | 3300047471 | Ga0495684_0001554 | Ga0495684_0001554_11937_12578 | 208 |
| 660 | 3300047471 | Ga0495684_0028817 | Ga0495684_0028817_2583_3224 | 208 |
| 661 | 3300047471 | Ga0495684_0696552 | Ga0495684_0696552_20_652 | 208 |
| 662 | 3300047673 | Ga0495593_0229689 | Ga0495593_0229689_66_707 | 208 |
| 663 | 3300048909 | Ga0496106_0153406 | Ga0496106_0153406_497_1135 | 208 |
| 664 | 3300048921 | Ga0496118_0047204 | Ga0496118_0047204_2533_3159 | 208 |
| 665 | 3300048921 | Ga0496118_0379262 | Ga0496118_0379262_26_652 | 208 |
| 666 | 3300049513 | Ga0501290_000127 | Ga0501290_000127_1876_2511 | 208 |
| 667 | 3300049514 | Ga0501291_000073 | Ga0501291_000073_8584_9219 | 208 |
| 668 | 3300049515 | Ga0501292_000656 | Ga0501292_000656_2545_3180 | 208 |
| 669 | 3300049516 | Ga0501293_000116 | Ga0501293_000116_4331_4966 | 208 |
| 670 | 3300049518 | Ga0501295_000033 | Ga0501295_000033_8559_9194 | 208 |
| 671 | 3300049519 | Ga0501296_001586 | Ga0501296_001586_1050_1685 | 208 |
| 672 | 3300049520 | Ga0501297_000231 | Ga0501297_000231_4650_5285 | 208 |
| 673 | 3300049522 | Ga0501299_007248 | Ga0501299_007248_450_1085 | 208 |
| 674 | 3300049524 | Ga0501301_000531 | Ga0501301_000531_679_1314 | 208 |
| 675 | 3300049525 | Ga0501302_000131 | Ga0501302_000131_2033_2668 | 208 |
| 676 | 3300049526 | Ga0501303_000304 | Ga0501303_000304_973_1608 | 208 |
| 677 | 3300049568 | Ga0501031_0050714 | Ga0501031_0050714_811_1449 | 208 |
| 678 | 3300049570 | Ga0501033_0123441 | Ga0501033_0123441_257_895 | 208 |
| 679 | 3300049571 | Ga0501034_0013990 | Ga0501034_0013990_5634_6260 | 208 |
| 680 | 3300049576 | Ga0501040_0119641 | Ga0501040_0119641_941_1579 | 208 |
| 681 | 3300049578 | Ga0501042_0254784 | Ga0501042_0254784_317_955 | 208 |
| 682 | 3300049580 | Ga0501046_0267232 | Ga0501046_0267232_398_1036 | 208 |
| 683 | 3300049582 | Ga0501048_0025839 | Ga0501048_0025839_3079_3717 | 208 |
| 684 | 3300049584 | Ga0501068_0074176 | Ga0501068_0074176_169_807 | 208 |
| 685 | 3300049588 | Ga0501072_0177584 | Ga0501072_0177584_543_1181 | 208 |
| 686 | 3300049591 | Ga0501075_0296176 | Ga0501075_0296176_497_1135 | 208 |
| 687 | 3300049593 | Ga0501077_0440421 | Ga0501077_0440421_193_819 | 208 |
| 688 | 3300049651 | Ga0501201_000711 | Ga0501201_000711_583_1218 | 208 |
| 689 | 3300049653 | Ga0501206_000679 | Ga0501206_000679_3004_3639 | 208 |
| 690 | 3300049656 | Ga0501209_007531 | Ga0501209_007531_711_1346 | 208 |
| 691 | 3300049661 | Ga0501217_003614 | Ga0501217_003614_1177_1812 | 208 |
| 692 | 3300049663 | Ga0501223_011372 | Ga0501223_011372_679_1314 | 208 |
| 693 | 3300049666 | Ga0501228_000754 | Ga0501228_000754_1389_2024 | 208 |
| 694 | 3300049667 | Ga0501230_000458 | Ga0501230_000458_2090_2725 | 208 |
| 695 | 3300049668 | Ga0501233_000630 | Ga0501233_000630_4541_5176 | 208 |
| 696 | 3300049672 | Ga0501239_000120 | Ga0501239_000120_2836_3471 | 208 |
| 697 | 3300049675 | Ga0501243_008412 | Ga0501243_008412_378_1013 | 208 |
| 698 | 3300049676 | Ga0501246_001039 | Ga0501246_001039_375_1010 | 208 |
| 699 | 3300049677 | Ga0501247_000206 | Ga0501247_000206_536_1171 | 208 |
| 700 | 3300049678 | Ga0501248_000294 | Ga0501248_000294_913_1548 | 208 |
| 701 | 3300049679 | Ga0501249_001011 | Ga0501249_001011_2236_2871 | 208 |
| 702 | 3300049681 | Ga0501251_000884 | Ga0501251_000884_997_1632 | 208 |
| 703 | 3300049686 | Ga0501257_000648 | Ga0501257_000648_2269_2904 | 208 |
| 704 | 3300049687 | Ga0501258_000554 | Ga0501258_000554_1469_2104 | 208 |
| 705 | 3300049689 | Ga0501260_004679 | Ga0501260_004679_268_903 | 208 |
| 706 | 3300049690 | Ga0501261_001701 | Ga0501261_001701_405_1040 | 208 |
| 707 | 3300049703 | Ga0501219_000199 | Ga0501219_000199_9347_9982 | 208 |
| 708 | 3300049705 | Ga0501225_0041548 | Ga0501225_0041548_493_1128 | 208 |
| 709 | 3300049706 | Ga0501229_000227 | Ga0501229_000227_4939_5574 | 208 |
| 710 | 3300049707 | Ga0501234_000041 | Ga0501234_000041_10229_10864 | 208 |
| 711 | 3300049708 | Ga0501245_001648 | Ga0501245_001648_256_891 | 208 |
| 712 | 3300049741 | Ga0501079_0048518 | Ga0501079_0048518_266_904 | 208 |
| 713 | 3300049742 | Ga0501080_0004889 | Ga0501080_0004889_8187_8825 | 208 |
| 714 | 3300049744 | Ga0501083_0362976 | Ga0501083_0362976_288_926 | 208 |
| 715 | 3300049761 | Ga0501264_003294 | Ga0501264_003294_334_969 | 208 |
| 716 | 3300049762 | Ga0501265_000322 | Ga0501265_000322_3043_3678 | 208 |
| 717 | 3300049763 | Ga0501266_000188 | Ga0501266_000188_1885_2520 | 208 |
| 718 | 3300049768 | Ga0501271_009200 | Ga0501271_009200_17_652 | 208 |
| 719 | 3300049769 | Ga0501272_000011 | Ga0501272_000011_7145_7780 | 208 |
| 720 | 3300049770 | Ga0501273_001280 | Ga0501273_001280_897_1532 | 208 |
| 721 | 3300049771 | Ga0501274_000050 | Ga0501274_000050_598_1233 | 208 |
| 722 | 3300049773 | Ga0501276_000206 | Ga0501276_000206_812_1447 | 208 |
| 723 | 3300049774 | Ga0501278_001024 | Ga0501278_001024_482_1117 | 208 |
| 724 | 3300049775 | Ga0501279_001327 | Ga0501279_001327_1571_2206 | 208 |
| 725 | 3300049779 | Ga0501283_000138 | Ga0501283_000138_2242_2877 | 208 |
| 726 | 3300049824 | Ga0501045_0169436 | Ga0501045_0169436_948_1586 | 208 |
| 727 | 3300049851 | Ga0501212_000330 | Ga0501212_000330_1119_1754 | 208 |
| 728 | 3300050507 | nmdc:mga05p37_12082_c1 | nmdc:mga05p37_12082_c1_8938_9576 | 208 |
| 729 | 3300050507 | nmdc:mga05p37_9949_c1 | nmdc:mga05p37_9949_c1_7472_8110 | 208 |
| 730 | 3300050508 | nmdc:mga09592_192642_c1 | nmdc:mga09592_192642_c1_1031_1666 | 208 |
| 731 | 3300050508 | nmdc:mga09592_51000_c1 | nmdc:mga09592_51000_c1_534_1172 | 208 |
| 732 | 3300050509 | nmdc:mga0qj67_32357_c1 | nmdc:mga0qj67_32357_c1_3250_3885 | 208 |
| 733 | 3300050509 | nmdc:mga0qj67_8496_c1 | nmdc:mga0qj67_8496_c1_1016_1654 | 208 |
| 734 | 3300050510 | nmdc:mga06r32_141730_c1 | nmdc:mga06r32_141730_c1_509_1144 | 208 |
| 735 | 3300050510 | nmdc:mga06r32_2306_c1 | nmdc:mga06r32_2306_c1_188_826 | 208 |
| 736 | 3300050511 | nmdc:mga08y16_27834_c1 | nmdc:mga08y16_27834_c1_720_1358 | 208 |
| 737 | 3300050512 | nmdc:mga0n895_13540_c1 | nmdc:mga0n895_13540_c1_3938_4582 | 208 |
| 738 | 3300050513 | nmdc:mga0rr50_109047_c1 | nmdc:mga0rr50_109047_c1_1054_1698 | 208 |
| 739 | 3300050514 | nmdc:mga08x19_96045_c1 | nmdc:mga08x19_96045_c1_1137_1781 | 208 |
| 740 | 3300050515 | nmdc:mga0a205_11730_c1 | nmdc:mga0a205_11730_c1_5482_6120 | 208 |
| 741 | 3300050515 | nmdc:mga0a205_201295_c1 | nmdc:mga0a205_201295_c1_49_687 | 208 |
| 742 | 3300050515 | nmdc:mga0a205_70062_c1 | nmdc:mga0a205_70062_c1_685_1329 | 208 |
| 743 | 3300050515 | nmdc:mga0a205_777_c1 | nmdc:mga0a205_777_c1_20613_21251 | 208 |
| 744 | 3300053077 | Ga0495601_0001800 | Ga0495601_0001800_3532_4173 | 208 |
| 745 | 3300053078 | Ga0495612_0000118 | Ga0495612_0000118_18201_18842 | 208 |
| 746 | 3300053085 | Ga0495619_0002839 | Ga0495619_0002839_2437_3078 | 208 |
| 747 | 3300054114 | Ga0501084_0036726 | Ga0501084_0036726_794_1432 | 208 |
| 748 | 3300060353 | Ga0501082_0473075 | Ga0501082_0473075_231_869 | 208 |
| 749 | 3300061719 | Ga0466962_0003999 | Ga0466962_0003999_5928_6560 | 208 |
| 750 | 3300061734 | Ga0530510_0068874 | Ga0530510_0068874_1836_2474 | 208 |
| 751 | 3300003320 | rootH2_10059427 | rootH2_100594274 | 209 |
| 752 | 3300004803 | Ga0058862_10201493 | Ga0058862_102014932 | 209 |
| 753 | 3300005327 | Ga0070658_10267601 | Ga0070658_102676012 | 209 |
| 754 | 3300005329 | Ga0070683_100055157 | Ga0070683_1000551573 | 209 |
| 755 | 3300005329 | Ga0070683_100201881 | Ga0070683_1002018813 | 209 |
| 756 | 3300005336 | Ga0070680_100003506 | Ga0070680_1000035063 | 209 |
| 757 | 3300005344 | Ga0070661_100405893 | Ga0070661_1004058932 | 209 |
| 758 | 3300005366 | Ga0070659_100000313 | Ga0070659_1000003133 | 209 |
| 759 | 3300005434 | Ga0070709_10184785 | Ga0070709_101847851 | 209 |
| 760 | 3300005435 | Ga0070714_100345453 | Ga0070714_1003454532 | 209 |
| 761 | 3300005435 | Ga0070714_100971284 | Ga0070714_1009712841 | 209 |
| 762 | 3300005436 | Ga0070713_100038385 | Ga0070713_1000383853 | 209 |
| 763 | 3300005437 | Ga0070710_10518414 | Ga0070710_105184141 | 209 |
| 764 | 3300005439 | Ga0070711_100038261 | Ga0070711_1000382613 | 209 |
| 765 | 3300005458 | Ga0070681_10006757 | Ga0070681_100067573 | 209 |
| 766 | 3300005458 | Ga0070681_10012093 | Ga0070681_100120933 | 209 |
| 767 | 3300005458 | Ga0070681_10103061 | Ga0070681_101030612 | 209 |
| 768 | 3300005458 | Ga0070681_10212113 | Ga0070681_102121133 | 209 |
| 769 | 3300005530 | Ga0070679_100024432 | Ga0070679_1000244324 | 209 |
| 770 | 3300005530 | Ga0070679_100337399 | Ga0070679_1003373992 | 209 |
| 771 | 3300005530 | Ga0070679_100387941 | Ga0070679_1003879412 | 209 |
| 772 | 3300005539 | Ga0068853_100000014 | Ga0068853_10000001451 | 209 |
| 773 | 3300005539 | Ga0068853_100018832 | Ga0068853_1000188323 | 209 |
| 774 | 3300005547 | Ga0070693_100148917 | Ga0070693_1001489171 | 209 |
| 775 | 3300005563 | Ga0068855_100313116 | Ga0068855_1003131162 | 209 |
| 776 | 3300005563 | Ga0068855_100401908 | Ga0068855_1004019082 | 209 |
| 777 | 3300005577 | Ga0068857_100664463 | Ga0068857_1006644631 | 209 |
| 778 | 3300005578 | Ga0068854_100000014 | Ga0068854_10000001411 | 209 |
| 779 | 3300005578 | Ga0068854_100079955 | Ga0068854_1000799552 | 209 |
| 780 | 3300005578 | Ga0068854_100112690 | Ga0068854_1001126903 | 209 |
| 781 | 3300005614 | Ga0068856_100257262 | Ga0068856_1002572622 | 209 |
| 782 | 3300005616 | Ga0068852_100051406 | Ga0068852_1000514064 | 209 |
| 783 | 3300005843 | Ga0068860_100011193 | Ga0068860_1000111935 | 209 |
| 784 | 3300005844 | Ga0068862_100000095 | Ga0068862_10000009516 | 209 |
| 785 | 3300005844 | Ga0068862_100466318 | Ga0068862_1004663182 | 209 |
| 786 | 3300006028 | Ga0070717_10240298 | Ga0070717_102402982 | 209 |
| 787 | 3300006173 | Ga0070716_100207092 | Ga0070716_1002070922 | 209 |
| 788 | 3300006175 | Ga0070712_100001112 | Ga0070712_10000111211 | 209 |
| 789 | 3300006175 | Ga0070712_100236338 | Ga0070712_1002363382 | 209 |
| 790 | 3300006195 | Ga0075366_10136273 | Ga0075366_101362732 | 209 |
| 791 | 3300006871 | Ga0075434_100442007 | Ga0075434_1004420072 | 209 |
| 792 | 3300006931 | Ga0097620_100033113 | Ga0097620_1000331134 | 209 |
| 793 | 3300009093 | Ga0105240_10029355 | Ga0105240_100293556 | 209 |
| 794 | 3300009093 | Ga0105240_10039411 | Ga0105240_100394115 | 209 |
| 795 | 3300009093 | Ga0105240_10071968 | Ga0105240_100719682 | 209 |
| 796 | 3300009093 | Ga0105240_10448481 | Ga0105240_104484813 | 209 |
| 797 | 3300009093 | Ga0105240_11066389 | Ga0105240_110663891 | 209 |
| 798 | 3300009098 | Ga0105245_10001545 | Ga0105245_1000154511 | 209 |
| 799 | 3300009101 | Ga0105247_10003191 | Ga0105247_100031918 | 209 |
| 800 | 3300009148 | Ga0105243_10247019 | Ga0105243_102470192 | 209 |
| 801 | 3300009177 | Ga0105248_10081810 | Ga0105248_100818102 | 209 |
| 802 | 3300009545 | Ga0105237_10319578 | Ga0105237_103195783 | 209 |
| 803 | 3300009545 | Ga0105237_10378438 | Ga0105237_103784383 | 209 |
| 804 | 3300009553 | Ga0105249_10000079 | Ga0105249_1000007928 | 209 |
| 805 | 3300010375 | Ga0105239_10000025 | Ga0105239_1000002522 | 209 |
| 806 | 3300010375 | Ga0105239_10303359 | Ga0105239_103033593 | 209 |
| 807 | 3300010375 | Ga0105239_10935765 | Ga0105239_109357651 | 209 |
| 808 | 3300013102 | Ga0157371_10064577 | Ga0157371_100645772 | 209 |
| 809 | 3300013104 | Ga0157370_10022338 | Ga0157370_100223385 | 209 |
| 810 | 3300013104 | Ga0157370_10051887 | Ga0157370_100518874 | 209 |
| 811 | 3300013104 | Ga0157370_10054949 | Ga0157370_100549492 | 209 |
| 812 | 3300013104 | Ga0157370_10165738 | Ga0157370_101657383 | 209 |
| 813 | 3300013105 | Ga0157369_10086664 | Ga0157369_100866644 | 209 |
| 814 | 3300013105 | Ga0157369_10168943 | Ga0157369_101689432 | 209 |
| 815 | 3300013105 | Ga0157369_10749327 | Ga0157369_107493272 | 209 |
| 816 | 3300013296 | Ga0157374_10437316 | Ga0157374_104373161 | 209 |
| 817 | 3300013306 | Ga0163162_10147414 | Ga0163162_101474143 | 209 |
| 818 | 3300013307 | Ga0157372_10083280 | Ga0157372_100832804 | 209 |
| 819 | 3300013308 | Ga0157375_10870902 | Ga0157375_108709022 | 209 |
| 820 | 3300014968 | Ga0157379_10081801 | Ga0157379_100818012 | 209 |
| 821 | 3300014968 | Ga0157379_10213557 | Ga0157379_102135573 | 209 |
| 822 | 3300014969 | Ga0157376_10222773 | Ga0157376_102227732 | 209 |
| 823 | 3300025900 | Ga0207710_10040359 | Ga0207710_100403592 | 209 |
| 824 | 3300025906 | Ga0207699_10260142 | Ga0207699_102601423 | 209 |
| 825 | 3300025909 | Ga0207705_10015092 | Ga0207705_100150923 | 209 |
| 826 | 3300025909 | Ga0207705_10030685 | Ga0207705_100306854 | 209 |
| 827 | 3300025912 | Ga0207707_10004769 | Ga0207707_1000476911 | 209 |
| 828 | 3300025912 | Ga0207707_10016769 | Ga0207707_100167693 | 209 |
| 829 | 3300025912 | Ga0207707_10292243 | Ga0207707_102922432 | 209 |
| 830 | 3300025913 | Ga0207695_10005655 | Ga0207695_100056552 | 209 |
| 831 | 3300025913 | Ga0207695_10053761 | Ga0207695_100537612 | 209 |
| 832 | 3300025913 | Ga0207695_10121442 | Ga0207695_101214422 | 209 |
| 833 | 3300025914 | Ga0207671_10083288 | Ga0207671_100832882 | 209 |
| 834 | 3300025914 | Ga0207671_10124374 | Ga0207671_101243743 | 209 |
| 835 | 3300025915 | Ga0207693_10070547 | Ga0207693_100705471 | 209 |
| 836 | 3300025915 | Ga0207693_10333456 | Ga0207693_103334561 | 209 |
| 837 | 3300025916 | Ga0207663_10064719 | Ga0207663_100647192 | 209 |
| 838 | 3300025917 | Ga0207660_10005550 | Ga0207660_100055502 | 209 |
| 839 | 3300025917 | Ga0207660_10314164 | Ga0207660_103141642 | 209 |
| 840 | 3300025917 | Ga0207660_10435524 | Ga0207660_104355242 | 209 |
| 841 | 3300025919 | Ga0207657_10091025 | Ga0207657_100910251 | 209 |
| 842 | 3300025921 | Ga0207652_10016969 | Ga0207652_100169692 | 209 |
| 843 | 3300025921 | Ga0207652_10119929 | Ga0207652_101199292 | 209 |
| 844 | 3300025921 | Ga0207652_10158898 | Ga0207652_101588982 | 209 |
| 845 | 3300025921 | Ga0207652_10361168 | Ga0207652_103611682 | 209 |
| 846 | 3300025927 | Ga0207687_10003874 | Ga0207687_100038749 | 209 |
| 847 | 3300025928 | Ga0207700_10003248 | Ga0207700_100032484 | 209 |
| 848 | 3300025928 | Ga0207700_10194295 | Ga0207700_101942952 | 209 |
| 849 | 3300025929 | Ga0207664_10151806 | Ga0207664_101518061 | 209 |
| 850 | 3300025932 | Ga0207690_10000642 | Ga0207690_1000064217 | 209 |
| 851 | 3300025933 | Ga0207706_10188168 | Ga0207706_101881683 | 209 |
| 852 | 3300025944 | Ga0207661_10007995 | Ga0207661_100079956 | 209 |
| 853 | 3300025949 | Ga0207667_10000670 | Ga0207667_100006708 | 209 |
| 854 | 3300025949 | Ga0207667_10116036 | Ga0207667_101160363 | 209 |
| 855 | 3300025949 | Ga0207667_10174449 | Ga0207667_101744492 | 209 |
| 856 | 3300025961 | Ga0207712_10000030 | Ga0207712_1000003097 | 209 |
| 857 | 3300025972 | Ga0207668_10000842 | Ga0207668_1000084213 | 209 |
| 858 | 3300025981 | Ga0207640_10000010 | Ga0207640_10000010110 | 209 |
| 859 | 3300026041 | Ga0207639_10000033 | Ga0207639_1000003355 | 209 |
| 860 | 3300026041 | Ga0207639_10083620 | Ga0207639_100836202 | 209 |
| 861 | 3300026067 | Ga0207678_10043107 | Ga0207678_100431072 | 209 |
| 862 | 3300026078 | Ga0207702_10091648 | Ga0207702_100916481 | 209 |
| 863 | 3300026078 | Ga0207702_10617630 | Ga0207702_106176302 | 209 |
| 864 | 3300026089 | Ga0207648_10247146 | Ga0207648_102471462 | 209 |
| 865 | 3300026116 | Ga0207674_10730268 | Ga0207674_107302682 | 209 |
| 866 | 3300026116 | Ga0207674_10888322 | Ga0207674_108883221 | 209 |
| 867 | 3300026142 | Ga0207698_10038066 | Ga0207698_100380662 | 209 |
| 868 | 3300028017 | Ga0265356_1006515 | Ga0265356_10065152 | 209 |
| 869 | 3300028379 | Ga0268266_10030855 | Ga0268266_100308551 | 209 |
| 870 | 3300028380 | Ga0268265_10000132 | Ga0268265_1000013285 | 209 |
| 871 | 3300028380 | Ga0268265_10489093 | Ga0268265_104890931 | 209 |
| 872 | 3300028381 | Ga0268264_10000779 | Ga0268264_100007793 | 209 |
| 873 | 3300028800 | Ga0265338_10010001 | Ga0265338_100100013 | 209 |
| 874 | 3300028800 | Ga0265338_10441430 | Ga0265338_104414301 | 209 |
| 875 | 3300028800 | Ga0265338_10486397 | Ga0265338_104863971 | 209 |
| 876 | 3300031235 | Ga0265330_10008443 | Ga0265330_100084436 | 209 |
| 877 | 3300031235 | Ga0265330_10009351 | Ga0265330_100093512 | 209 |
| 878 | 3300031235 | Ga0265330_10050263 | Ga0265330_100502632 | 209 |
| 879 | 3300031235 | Ga0265330_10076756 | Ga0265330_100767561 | 209 |
| 880 | 3300031238 | Ga0265332_10056629 | Ga0265332_100566292 | 209 |
| 881 | 3300031239 | Ga0265328_10017261 | Ga0265328_100172612 | 209 |
| 882 | 3300031240 | Ga0265320_10252766 | Ga0265320_102527661 | 209 |
| 883 | 3300031241 | Ga0265325_10016951 | Ga0265325_100169514 | 209 |
| 884 | 3300031247 | Ga0265340_10026809 | Ga0265340_100268092 | 209 |
| 885 | 3300031247 | Ga0265340_10051438 | Ga0265340_100514382 | 209 |
| 886 | 3300031247 | Ga0265340_10114174 | Ga0265340_101141742 | 209 |
| 887 | 3300031249 | Ga0265339_10013760 | Ga0265339_100137602 | 209 |
| 888 | 3300031249 | Ga0265339_10019346 | Ga0265339_100193462 | 209 |
| 889 | 3300031344 | Ga0265316_10002381 | Ga0265316_100023816 | 209 |
| 890 | 3300031344 | Ga0265316_10013220 | Ga0265316_100132203 | 209 |
| 891 | 3300031344 | Ga0265316_10154517 | Ga0265316_101545172 | 209 |
| 892 | 3300031344 | Ga0265316_10255882 | Ga0265316_102558821 | 209 |
| 893 | 3300031595 | Ga0265313_10168513 | Ga0265313_101685131 | 209 |
| 894 | 3300031711 | Ga0265314_10049612 | Ga0265314_100496122 | 209 |
| 895 | 3300031712 | Ga0265342_10008298 | Ga0265342_100082982 | 209 |
| 896 | 3300031731 | Ga0307405_10019461 | Ga0307405_100194612 | 209 |
| 897 | 3300031911 | Ga0307412_10036252 | Ga0307412_100362522 | 209 |
| 898 | 3300035410 | Ga0373924_0212762 | Ga0373924_0212762_143_781 | 209 |
| 899 | 3300036401 | Ga0373937_0026783 | Ga0373937_0026783_3084_3719 | 209 |
| 900 | 3300037068 | Ga0373925_0038072 | Ga0373925_0038072_1233_1868 | 209 |
| 901 | 3300037068 | Ga0373925_0778592 | Ga0373925_0778592_85_762 | 209 |
| 902 | 3300037418 | Ga0395900_0205490 | Ga0395900_0205490_1317_1952 | 209 |
| 903 | 3300037418 | Ga0395900_0316700 | Ga0395900_0316700_648_1280 | 209 |
| 904 | 3300037466 | Ga0395898_0006201 | Ga0395898_0006201_2739_3398 | 209 |
| 905 | 3300037466 | Ga0395898_0631359 | Ga0395898_0631359_30_665 | 209 |
| 906 | 3300037853 | Ga0436364_0012403 | Ga0436364_0012403_59_697 | 209 |
| 907 | 3300038443 | Ga0395901_0241516 | Ga0395901_0241516_269_901 | 209 |
| 908 | 3300038443 | Ga0395901_0628258 | Ga0395901_0628258_51_710 | 209 |
| 909 | 3300039438 | Ga0436360_0989526 | Ga0436360_0989526_661_1290 | 209 |
| 910 | 3300039450 | Ga0436363_1151103 | Ga0436363_1151103_137_781 | 209 |
| 911 | 3300044684 | Ga0466966_0212518 | Ga0466966_0212518_375_1019 | 209 |
| 912 | 3300044694 | Ga0466963_0000249 | Ga0466963_0000249_9408_10049 | 209 |
| 913 | 3300044735 | Ga0466968_0074808 | Ga0466968_0074808_230_859 | 209 |
| 914 | 3300044842 | Ga0466957_0032113 | Ga0466957_0032113_2350_2985 | 209 |
| 915 | 3300045836 | Ga0466958_0147698 | Ga0466958_0147698_334_969 | 209 |
| 916 | 3300045976 | Ga0466967_0004012 | Ga0466967_0004012_4565_5206 | 209 |
| 917 | 3300046471 | Ga0495650_0046340 | Ga0495650_0046340_839_1468 | 209 |
| 918 | 3300046492 | Ga0495585_0052689 | Ga0495585_0052689_1032_1670 | 209 |
| 919 | 3300046506 | Ga0495583_0026841 | Ga0495583_0026841_309_947 | 209 |
| 920 | 3300046558 | Ga0495633_0042449 | Ga0495633_0042449_499_1137 | 209 |
| 921 | 3300046674 | Ga0495588_0050508 | Ga0495588_0050508_130_768 | 209 |
| 922 | 3300047315 | Ga0495581_0139900 | Ga0495581_0139900_75_710 | 209 |
| 923 | 3300047323 | Ga0495683_0121315 | Ga0495683_0121315_373_1011 | 209 |
| 924 | 3300047472 | Ga0495686_0000147 | Ga0495686_0000147_117713_118354 | 209 |
| 925 | 3300047472 | Ga0495686_0001655 | Ga0495686_0001655_1939_2568 | 209 |
| 926 | 3300047472 | Ga0495686_0005626 | Ga0495686_0005626_5108_5743 | 209 |
| 927 | 3300047673 | Ga0495593_0142960 | Ga0495593_0142960_414_1052 | 209 |
| 928 | 3300048088 | Ga0495602_0173812 | Ga0495602_0173812_700_1335 | 209 |
| 929 | 3300048904 | Ga0496101_0242460 | Ga0496101_0242460_178_807 | 209 |
| 930 | 3300048907 | Ga0496104_0078128 | Ga0496104_0078128_835_1473 | 209 |
| 931 | 3300048907 | Ga0496104_0132754 | Ga0496104_0132754_598_1233 | 209 |
| 932 | 3300048907 | Ga0496104_0802887 | Ga0496104_0802887_71_706 | 209 |
| 933 | 3300048908 | Ga0496105_0145579 | Ga0496105_0145579_835_1470 | 209 |
| 934 | 3300048912 | Ga0496109_0338427 | Ga0496109_0338427_716_1357 | 209 |
| 935 | 3300048921 | Ga0496118_0073618 | Ga0496118_0073618_568_1251 | 209 |
| 936 | 3300048924 | Ga0496121_0000671 | Ga0496121_0000671_17296_17979 | 209 |
| 937 | 3300048924 | Ga0496121_0058623 | Ga0496121_0058623_2278_2970 | 209 |
| 938 | 3300048929 | Ga0496126_0013389 | Ga0496126_0013389_4294_4929 | 209 |
| 939 | 3300048929 | Ga0496126_0035580 | Ga0496126_0035580_2955_3638 | 209 |
| 940 | 3300049460 | Ga0495682_0012097 | Ga0495682_0012097_2612_3250 | 209 |
| 941 | 3300049570 | Ga0501033_0115002 | Ga0501033_0115002_1209_1838 | 209 |
| 942 | 3300049575 | Ga0501039_0139968 | Ga0501039_0139968_1000_1638 | 209 |
| 943 | 3300049822 | Ga0501035_0197667 | Ga0501035_0197667_749_1387 | 209 |
| 944 | 3300049823 | Ga0501044_0044484 | Ga0501044_0044484_2737_3366 | 209 |
| 945 | 3300049823 | Ga0501044_0642057 | Ga0501044_0642057_226_864 | 209 |
| 946 | 3300050493 | nmdc:mga0k408_244614_c1 | nmdc:mga0k408_244614_c1_389_1021 | 209 |
| 947 | 3300050512 | nmdc:mga0n895_97777_c1 | nmdc:mga0n895_97777_c1_761_1396 | 209 |
| 948 | 3300050514 | nmdc:mga08x19_109179_c1 | nmdc:mga08x19_109179_c1_961_1596 | 209 |
| 949 | 3300050514 | nmdc:mga08x19_75755_c1 | nmdc:mga08x19_75755_c1_1335_1979 | 209 |
| 950 | 3300053077 | Ga0495601_0073634 | Ga0495601_0073634_1066_1755 | 209 |
| 951 | 3300053093 | Ga0500651_0000008 | Ga0500651_0000008_43306_43944 | 209 |
| 952 | 3300060346 | Ga0587111_0049596 | Ga0587111_0049596_166_801 | 209 |
| 953 | 3300005536 | Ga0070697_100113279 | Ga0070697_1001132794 | 210 |
| 954 | 3300005719 | Ga0068861_100011968 | Ga0068861_1000119686 | 210 |
| 955 | 3300006173 | Ga0070716_100019973 | Ga0070716_1000199734 | 210 |
| 956 | 3300009545 | Ga0105237_10431142 | Ga0105237_104311421 | 210 |
| 957 | 3300025915 | Ga0207693_10028969 | Ga0207693_100289693 | 210 |
| 958 | 3300025916 | Ga0207663_10603064 | Ga0207663_106030641 | 210 |
| 959 | 3300025939 | Ga0207665_10096437 | Ga0207665_100964372 | 210 |
| 960 | 3300025939 | Ga0207665_10631508 | Ga0207665_106315082 | 210 |
| 961 | 3300026118 | Ga0207675_100021047 | Ga0207675_1000210473 | 210 |
| 962 | 3300047320 | Ga0495672_0035055 | Ga0495672_0035055_2269_2910 | 210 |
| 963 | 3300005458 | Ga0070681_10104289 | Ga0070681_101042893 | 211 |
| 964 | 3300005547 | Ga0070693_100025282 | Ga0070693_1000252824 | 211 |
| 965 | 3300005985 | Ga0081539_10001185 | Ga0081539_1000118535 | 211 |
| 966 | 3300007788 | Ga0099795_10221620 | Ga0099795_102216201 | 211 |
| 967 | 3300021388 | Ga0213875_10032108 | Ga0213875_100321082 | 211 |
| 968 | 3300025912 | Ga0207707_10027639 | Ga0207707_100276396 | 211 |
| 969 | 3300025945 | Ga0207679_10529645 | Ga0207679_105296452 | 211 |
| 970 | 3300031344 | Ga0265316_10006492 | Ga0265316_100064925 | 211 |
| 971 | 3300037418 | Ga0395900_0472647 | Ga0395900_0472647_396_1067 | 211 |
| 972 | 3300037853 | Ga0436364_0023814 | Ga0436364_0023814_338_988 | 211 |
| 973 | 3300037853 | Ga0436364_1049814 | Ga0436364_1049814_5022_5672 | 211 |
| 974 | 3300039437 | Ga0436365_0870553 | Ga0436365_0870553_134_784 | 211 |
| 975 | 3300044712 | Ga0453684_0115585 | Ga0453684_0115585_1115_1762 | 211 |
| 976 | 3300048915 | Ga0496112_0223885 | Ga0496112_0223885_327_977 | 211 |
| 977 | 2162886007 | SwRhRL2b_contig_301344 | SwRhRL2b_0178.00003920 | 212 |
| 978 | 3300005293 | Ga0065715_10093602 | Ga0065715_100936023 | 212 |
| 979 | 3300005331 | Ga0070670_100001702 | Ga0070670_1000017024 | 212 |
| 980 | 3300005334 | Ga0068869_100012828 | Ga0068869_1000128283 | 212 |
| 981 | 3300005353 | Ga0070669_100062644 | Ga0070669_1000626441 | 212 |
| 982 | 3300005435 | Ga0070714_100226102 | Ga0070714_1002261023 | 212 |
| 983 | 3300005436 | Ga0070713_100036322 | Ga0070713_1000363225 | 212 |
| 984 | 3300005445 | Ga0070708_100179160 | Ga0070708_1001791603 | 212 |
| 985 | 3300005467 | Ga0070706_100035985 | Ga0070706_1000359853 | 212 |
| 986 | 3300005468 | Ga0070707_100006340 | Ga0070707_1000063404 | 212 |
| 987 | 3300005471 | Ga0070698_100001679 | Ga0070698_10000167914 | 212 |
| 988 | 3300005471 | Ga0070698_100078675 | Ga0070698_1000786754 | 212 |
| 989 | 3300005471 | Ga0070698_100097602 | Ga0070698_1000976022 | 212 |
| 990 | 3300005518 | Ga0070699_100159013 | Ga0070699_1001590132 | 212 |
| 991 | 3300005536 | Ga0070697_100000185 | Ga0070697_10000018515 | 212 |
| 992 | 3300005536 | Ga0070697_100022623 | Ga0070697_1000226234 | 212 |
| 993 | 3300005545 | Ga0070695_100430563 | Ga0070695_1004305631 | 212 |
| 994 | 3300005546 | Ga0070696_100189408 | Ga0070696_1001894082 | 212 |
| 995 | 3300005841 | Ga0068863_100138935 | Ga0068863_1001389353 | 212 |
| 996 | 3300006175 | Ga0070712_100134018 | Ga0070712_1001340182 | 212 |
| 997 | 3300006852 | Ga0075433_10166511 | Ga0075433_101665112 | 212 |
| 998 | 3300006914 | Ga0075436_100359196 | Ga0075436_1003591961 | 212 |
| 999 | 3300007265 | Ga0099794_10146149 | Ga0099794_101461492 | 212 |
| 1000 | 3300009093 | Ga0105240_10034089 | Ga0105240_100340893 | 212 |
| 1001 | 3300009093 | Ga0105240_10735317 | Ga0105240_107353171 | 212 |
| 1002 | 3300009098 | Ga0105245_11412302 | Ga0105245_114123021 | 212 |
| 1003 | 3300009148 | Ga0105243_10096541 | Ga0105243_100965412 | 212 |
| 1004 | 3300009148 | Ga0105243_10574657 | Ga0105243_105746571 | 212 |
| 1005 | 3300009553 | Ga0105249_11034441 | Ga0105249_110344411 | 212 |
| 1006 | 3300011119 | Ga0105246_10983706 | Ga0105246_109837061 | 212 |
| 1007 | 3300013297 | Ga0157378_10897357 | Ga0157378_108973571 | 212 |
| 1008 | 3300014326 | Ga0157380_10065144 | Ga0157380_100651443 | 212 |
| 1009 | 3300014326 | Ga0157380_10834339 | Ga0157380_108343391 | 212 |
| 1010 | 3300025910 | Ga0207684_10008569 | Ga0207684_100085694 | 212 |
| 1011 | 3300025910 | Ga0207684_10041105 | Ga0207684_100411052 | 212 |
| 1012 | 3300025922 | Ga0207646_10069925 | Ga0207646_100699253 | 212 |
| 1013 | 3300025923 | Ga0207681_10003295 | Ga0207681_100032956 | 212 |
| 1014 | 3300025925 | Ga0207650_10018098 | Ga0207650_100180984 | 212 |
| 1015 | 3300025928 | Ga0207700_10024352 | Ga0207700_100243524 | 212 |
| 1016 | 3300025929 | Ga0207664_10037680 | Ga0207664_100376805 | 212 |
| 1017 | 3300025933 | Ga0207706_10152131 | Ga0207706_101521312 | 212 |
| 1018 | 3300025934 | Ga0207686_10470987 | Ga0207686_104709872 | 212 |
| 1019 | 3300025942 | Ga0207689_10005831 | Ga0207689_100058313 | 212 |
| 1020 | 3300026088 | Ga0207641_10120388 | Ga0207641_101203882 | 212 |
| 1021 | 3300028800 | Ga0265338_10113490 | Ga0265338_101134902 | 212 |
| 1022 | 3300031090 | Ga0265760_10057064 | Ga0265760_100570641 | 212 |
| 1023 | 3300031241 | Ga0265325_10018497 | Ga0265325_100184972 | 212 |
| 1024 | 3300031241 | Ga0265325_10023255 | Ga0265325_100232553 | 212 |
| 1025 | 3300031247 | Ga0265340_10009415 | Ga0265340_100094153 | 212 |
| 1026 | 3300031247 | Ga0265340_10021003 | Ga0265340_100210034 | 212 |
| 1027 | 3300031247 | Ga0265340_10144543 | Ga0265340_101445432 | 212 |
| 1028 | 3300031249 | Ga0265339_10000041 | Ga0265339_1000004137 | 212 |
| 1029 | 3300031249 | Ga0265339_10008146 | Ga0265339_100081467 | 212 |
| 1030 | 3300031249 | Ga0265339_10140922 | Ga0265339_101409221 | 212 |
| 1031 | 3300031250 | Ga0265331_10005230 | Ga0265331_100052309 | 212 |
| 1032 | 3300031344 | Ga0265316_10313457 | Ga0265316_103134571 | 212 |
| 1033 | 3300031595 | Ga0265313_10000295 | Ga0265313_1000029529 | 212 |
| 1034 | 3300031711 | Ga0265314_10015714 | Ga0265314_100157147 | 212 |
| 1035 | 3300031712 | Ga0265342_10020393 | Ga0265342_100203933 | 212 |
| 1036 | 3300031712 | Ga0265342_10051354 | Ga0265342_100513542 | 212 |
| 1037 | 3300037068 | Ga0373925_0044359 | Ga0373925_0044359_604_1296 | 212 |
| 1038 | 3300039438 | Ga0436360_1310211 | Ga0436360_1310211_288_944 | 212 |
| 1039 | 3300045976 | Ga0466967_0194008 | Ga0466967_0194008_529_1185 | 212 |
| 1040 | 3300046533 | Ga0495640_0014441 | Ga0495640_0014441_3061_3753 | 212 |
| 1041 | 3300046539 | Ga0495621_0000338 | Ga0495621_0000338_5177_5842 | 212 |
| 1042 | 3300047318 | Ga0495636_0259836 | Ga0495636_0259836_131_769 | 212 |
| 1043 | 3300048913 | Ga0496110_1032687 | Ga0496110_1032687_53_691 | 212 |
| 1044 | 3300053077 | Ga0495601_0314731 | Ga0495601_0314731_256_948 | 212 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8giw-assembly2.cif.gz_D | c143k variant of citrate synthase (cita) in mycobacterium tuberculosis | 0.3877 | 30 | 167 |
| 8s9d-assembly1.cif.gz_A-2 | c143s variant of citrate synthase (cita) in mycobacterium tuberculosis | 0.3588 | 24 | 167 |
| 8gm9-assembly2.cif.gz_C | structure of citrate synthase(cita) in mycobacterium tuberculosis | 0.3455 | 24 | 167 |
| 3tdx-assembly1.cif.gz_E | crystal structure of hsc l82v | 0.2949 | 4 | 167 |
| 3tds-assembly1.cif.gz_E | crystal structure of hsc f194i | 0.2938 | 4 | 167 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P0ADR0_21_135_1.10.1760.20 | Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; | 0.8127 | 41 | 163 | 1.10.1760.20 |
| af_P0ADR0_21_135_1.10.1760.20 | Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; | 0.77 | 41 | 163 | 1.10.1760.20 |
| af_Q2FUT1_1_180_1.10.1760.20 | Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; | 0.3189 | 6 | 161 | 1.10.1760.20 |
| af_Q8BG39_106_432_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.3185 | 26 | 195 | 1.20.1250.20 |
| af_A0A1D6N1F2_8_207_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.3073 | 25 | 190 | 1.20.1250.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7V4DCA7-F1-model_v4 | DedA family protein | 0.937 | 2 | 162 |
GO:0005886
|
| AF-A0A431JC60-F1-model_v4 | deleted | 0.935 | 2 | 156 |
|
| AF-A0A4P5WPZ3-F1-model_v4 | Alkaline phosphatase | 0.9344 | 2 | 202 |
GO:0005886
|
| AF-A0A381U777-F1-model_v4 | VTT domain-containing protein | 0.9332 | 20 | 171 |
GO:0005886
|
| AF-A0A7V3RDZ0-F1-model_v4 | DedA family protein | 0.9322 | 1 | 169 |
GO:0005886
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar