F488810

General Info

Members Datasets Scaffolds Average Seq Length
1040 569 930 88

Family's Representative Sequence

Representative Sequence 3300005549|Ga0070704_100639706|Ga0070704_1006397062
Length 100
Sequence MPAFREETNQSMSVSVTEKAQIVQQYQRGAGDTGSPEVQIALLTARINGLTDHFKTHVKDHHSRRGLLKLVSQRRKMLDYLKRKDNGKYHELIEQLGLRK

Samples

Sample ID Description Type Environment
1 2547132181 Kosakonia sacchari SP1 Isolate Stem
2 2547132416 Enterobacter sp. MR1 Isolate Rhizoplane
3 2561511199 Enterobacter sp. R4-368 Isolate Nodule
4 2599185169 Klebsiella quasipneumoniae NFPP35 Isolate Rhizoplane
5 2600255254 Klebsiella quasipneumoniae NFIX15 Isolate Rhizoplane
6 2600255255 Klebsiella quasipneumoniae NFIX23 Isolate Rhizoplane
7 2600255256 Enterobacter sp. NFIX08 Isolate Rhizoplane
8 2600255257 Enterobacter sp. NFIX03 Isolate Rhizoplane
9 2600255280 Klebsiella quasipneumoniae NFIX42 Isolate Rhizoplane
10 2600255281 Klebsiella quasipneumoniae NFIX43 Isolate Rhizoplane
11 2600255287 Klebsiella quasipneumoniae NFIX11 Isolate Rhizoplane
12 2600255288 Klebsiella quasipneumoniae NFIX14 Isolate Rhizoplane
13 2600255289 Klebsiella quasipneumoniae NFIX16 Isolate Rhizoplane
14 2600255290 Klebsiella quasipneumoniae NFIX17 Isolate Rhizoplane
15 2600255291 Klebsiella quasipneumoniae NFIX19 Isolate Rhizoplane
16 2600255298 Klebsiella quasipneumoniae NFIX21 Isolate Rhizoplane
17 2600255299 Klebsiella quasipneumoniae NFIX22 Isolate Rhizoplane
18 2600255300 Klebsiella quasipneumoniae NFIX30 Isolate Rhizoplane
19 2600255301 Klebsiella quasipneumoniae NFIX33 Isolate Rhizoplane
20 2600255302 Klebsiella quasipneumoniae NFIX35 Isolate Rhizoplane
21 2600255303 Klebsiella quasipneumoniae NFIX36 Isolate Rhizoplane
22 2600255304 Klebsiella quasipneumoniae NFIX37 Isolate Rhizoplane
23 2600255305 Klebsiella quasipneumoniae NFIX41 Isolate Rhizoplane
24 2600255306 Klebsiella quasipneumoniae NFIX44 Isolate Rhizoplane
25 2600255307 Klebsiella quasipneumoniae NFIX56 Isolate Rhizoplane
26 2600255309 Klebsiella sp. NFIX53 Isolate Rhizoplane
27 2600255310 Enterobacter sp. NFIX06 Isolate Rhizoplane
28 2600255311 Enterobacter sp. NFIX04 Isolate Rhizoplane
29 2600255392 Klebsiella quasipneumoniae NFIX54 Isolate Rhizoplane
30 2602042046 Enterobacter sp. NFIX09 Isolate Rhizoplane
31 2602042047 Enterobacter sp. NFIX59 Isolate Rhizoplane
32 2602042052 Klebsiella quasipneumoniae NFIX18 Isolate Rhizoplane
33 2602042053 Klebsiella quasipneumoniae NFIX12 Isolate Rhizoplane
34 2602042066 Enterobacter sp. NFIX45 Isolate Rhizoplane
35 2602042067 Enterobacter sp. NFIX58 Isolate Rhizoplane
36 2602042103 Klebsiella quasipneumoniae NFIX29 Isolate Rhizoplane
37 2602042104 Klebsiella quasipneumoniae NFIX26 Isolate Rhizoplane
38 2602042105 Klebsiella quasipneumoniae NFIX25 Isolate Rhizoplane
39 2602042106 Klebsiella quasipneumoniae NFIX13 Isolate Rhizoplane
40 2602042109 Klebsiella aerogenes NFIX39 Isolate Rhizoplane
41 2602042110 Klebsiella quasipneumoniae NFIX40 Isolate Rhizoplane
42 2602042111 Klebsiella quasipneumoniae NFIX20 Isolate Rhizoplane
43 2603880178 Klebsiella quasipneumoniae NFIX34 Isolate Rhizoplane
44 2603880184 Klebsiella quasipneumoniae NFIX27 Isolate Rhizoplane
45 2603880202 Klebsiella quasipneumoniae NFIX38 Isolate Rhizoplane
46 2603880211 Klebsiella quasipneumoniae NFIX24 Isolate Rhizoplane
47 2609459761 Enterobacter sp. NFR05 Isolate Rhizoplane
48 2636415599 Klebsiella variicola DX120E Isolate Unclassified
49 2643221541 Sphingomonas sp. Root50 Isolate Unclassified
50 2643221606 Sphingomonas sp. Root720 Isolate Unclassified
51 2643221671 Sphingomonas sp. Root1294 Isolate Unclassified
52 2667528172 Enterobacteriaceae bacterium NFIX31 Isolate Rhizoplane
53 2671180115 Cedecea sp. NFIX57 Isolate Rhizoplane
54 2675903046 Klebsiella quasipneumoniae NFIX52 Isolate Rhizoplane
55 2681812866 Enterobacter asburiae NFIX55 Isolate Rhizoplane
56 2681812869 Enterobacter ludwigii NFPP41 Isolate Rhizoplane
57 2706794495 Dickeya zeae ZJU1202 Isolate Unclassified
58 2711768156 Atlantibacter hermannii DDE1 Isolate Unclassified
59 2751185917 Enterobacter sp. HK169 Isolate Unclassified
60 2765235842 Enterobacter ludwigii AA4 Isolate Unclassified
61 2775506706 Enterobacter asburiae 1216 Isolate Unclassified
62 2775507074 Klebsiella sp. D5A Isolate Unclassified
63 2791354903 Mangrovibacter phragmitis MP23 Isolate Unclassified
64 2791355010 Kosakonia pseudosacchari NN143 Isolate Unclassified
65 2791355275 Enterobacter sp. Sa187 Isolate Unclassified
66 2811995292 Kosakonia oryzae Ola 51 Isolate Unclassified
67 2814123068 Kosakonia radicincitans GXGL-4A Isolate Rhizosphere
68 2821118458 Enterobacter asburiae 609 Isolate Unclassified
69 2823373977 Enterobacter ludwigii NCR3 Isolate Rhizosphere
70 2844425489 Enterobacter cloacae SBP-8 Isolate Rhizosphere
71 2846540461 Photorhabdus luminescens HIM3 Isolate Rhizosphere
72 2854601825 Dickeya dianthicola SS70 Isolate Stem Tuber
73 2855020534 Paracoccus endophyticus SYSUP0003 Isolate Stem Tuber
74 2876601092 Pantoea endophytica 596 Isolate Unclassified
75 2881714928 Pseudidiomarina mangrovi ZQ330 Isolate Rhizosphere
76 2884086401 Kluyvera sp. PO2S7 Isolate Rhizosphere
77 2891670763 Buttiauxella sp. B2 Isolate Rhizosphere
78 2904513164 Klebsiella variicola 1431 Isolate Rhizosphere
79 2919108558 Klebsiella sp. 1400 Isolate Rhizosphere
80 2923634449 Enterobacter kobei SLBN-76 Isolate Rhizosphere
81 2927833300 Enterobacter sp. SLBN-59 Isolate Rhizosphere
82 2935625433 Kosakonia sp. 1610 Isolate Rhizosphere
83 2937539931 Pantoea sp. LS15 Isolate Unclassified
84 2939568625 Lelliottia sp. 489 Isolate Rhizosphere
85 2939573065 Citrobacter sp. 506 Isolate Rhizosphere
86 2939602548 Pantoea dispersa 1175 Isolate Rhizosphere
87 2939607340 Leclercia sp. 1548 Isolate Rhizosphere
88 2939617950 Kosakonia cowanii 2056 Isolate Rhizosphere
89 2939642701 Lelliottia nimipressuralis 2756 Isolate Rhizosphere
90 2945874760 Phytobacter diazotrophicus UAEU22 Isolate Rhizosphere
91 2969079654 Klebsiella variicola E57-7 Isolate Unclassified
92 2971820967 Klebsiella sp. MPUS7 Isolate Rhizosphere
93 2974310843 Enterobacter sp. SORGH_AS 287 Isolate Unclassified
94 2974435778 Kosakonia cowanii SORGH_AS 304 Isolate Unclassified
95 2984559226 Klebsiella variicola SORGH_AS834 Isolate Aerial Root
96 2984595703 Klebsiella variicola SORGH_AS1070 Isolate Aerial Root
97 3000376612 Enterobacteriaceae bacterium 4M9 Isolate Rhizosphere
98 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
99 3300003300 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
100 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
101 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
102 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
103 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
104 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
105 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
106 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
107 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
108 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
109 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
110 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
111 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
112 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
113 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
114 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
115 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
116 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
117 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
118 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
119 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
120 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
121 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
122 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
123 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
124 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
125 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
126 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
127 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
128 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
129 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
130 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
131 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
132 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
133 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
134 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
135 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
136 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
137 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
138 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
139 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
140 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
141 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
142 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
143 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
144 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
145 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
146 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
147 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
148 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
149 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
150 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
151 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
152 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
153 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
154 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
155 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
156 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
157 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
158 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
159 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
160 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
161 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
162 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
163 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
164 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
165 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
166 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
167 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
168 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
169 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
170 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
171 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
172 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
173 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
174 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
175 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
176 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
177 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
178 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
179 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
180 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
181 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
182 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
183 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
184 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
185 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
186 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
187 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
188 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
189 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
190 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
191 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
192 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
193 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
194 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
195 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
196 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
197 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
198 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
199 3300009986 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG Metagenome Rhizosphere
200 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
201 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
202 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
203 3300012482 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.130510 Metagenome Rhizosphere
204 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
205 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
206 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
207 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
208 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
209 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
210 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
211 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
212 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
213 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
214 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
215 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
216 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
217 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
218 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
219 3300015679 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.4_F08 Metagenome Unclassified
220 3300015680 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.2_H03 Metagenome Rhizosphere
221 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
222 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
223 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
224 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
225 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
226 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
227 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
228 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
229 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
230 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
231 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
232 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
248 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
249 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
250 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
251 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
252 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
253 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
254 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
255 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
256 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
257 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
258 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
259 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
260 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
261 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
262 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
263 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
264 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
265 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
266 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
267 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
268 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
269 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
270 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
271 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
272 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
273 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
274 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
275 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
276 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
277 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
278 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
279 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
280 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
281 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
282 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
283 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
284 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
285 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
286 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
287 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
288 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
289 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
290 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
291 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
292 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
293 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
294 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
295 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
296 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
297 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
298 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
299 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
300 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
301 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
302 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
303 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
304 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
305 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
306 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
307 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
308 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
309 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
310 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
311 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
312 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
313 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
314 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
315 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
316 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
317 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
318 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
319 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
320 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
321 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
322 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
323 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
324 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
325 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
326 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
327 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
328 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
329 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
330 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
331 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
332 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
333 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
334 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
335 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
336 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
337 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
338 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
339 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
340 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
341 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
342 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
343 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
344 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
345 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
346 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
347 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
348 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
349 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
350 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
351 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
352 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
353 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
354 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
355 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
356 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
357 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
358 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
359 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
360 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
361 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
362 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
363 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
364 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
365 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
366 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
367 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
368 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
369 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
370 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
371 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
372 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
373 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
374 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
375 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
376 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
377 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
378 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
379 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
380 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
381 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
382 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
383 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
384 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
385 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
386 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
387 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
388 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
389 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
390 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
391 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
392 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
393 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
394 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
395 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
396 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
397 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
398 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
399 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
400 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
401 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
402 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
403 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
404 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
405 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
406 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
407 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
408 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
409 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
410 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
411 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
412 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
413 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
414 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
415 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
416 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
417 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
418 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
419 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
420 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
421 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
422 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
423 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
424 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
425 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
426 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
427 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
428 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
429 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
430 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
431 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
432 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
433 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
434 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
435 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
436 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
437 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
438 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
439 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
440 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
441 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
442 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
443 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
444 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
445 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
446 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
447 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
448 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
449 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
450 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
451 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
452 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
453 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
454 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
455 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
456 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
457 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
458 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
459 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
460 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
461 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
462 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
463 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
464 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
465 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
466 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
467 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
468 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
469 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
470 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
471 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
472 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
473 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
474 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
475 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
476 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
477 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
478 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
479 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
480 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
481 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
482 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
483 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
484 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
485 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
486 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
487 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
488 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
489 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
490 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
491 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
492 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
493 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
494 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
495 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
496 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
497 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
498 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
499 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
500 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
501 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
502 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
503 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
504 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
505 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
506 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
507 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
508 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
509 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
510 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
511 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
512 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
513 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
514 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
515 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
516 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
517 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
518 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
519 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
520 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
521 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
522 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
523 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
524 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
525 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
526 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
527 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
528 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
529 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
530 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
531 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
532 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
533 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
534 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
535 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
536 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
537 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
538 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
539 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
540 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
541 3300059627 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
542 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
543 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
544 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
545 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
546 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
547 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
548 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
549 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
550 3300059648 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
551 3300059654 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 148R_CW_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
552 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
553 3300059656 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 153R_AW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
554 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
555 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
556 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
557 8016733728 Pantoea sp. SORGH_AS 659 Isolate Unclassified
558 8018221730 Enterobacter sp. CM29 Isolate Unclassified
559 8018405270 Enterobacter sp. 198 Isolate Rhizosphere
560 8019499862 Kluyvera sp. 1366 Isolate Rhizosphere
561 8019504834 Atlantibacter hermannii 1903 Isolate Rhizosphere
562 8054357960 Idiomarina rhizosphaerae M1R2S28 Isolate Rhizosphere
563 8054844752 Dryocola boscaweniae H18W14 Isolate Rhizosphere
564 8054849141 Dryocola clanedunensis H11S18 Isolate Rhizosphere
565 8055087960 Silvania hatchlandensis H19S6 Isolate Rhizosphere
566 8055092621 Silvania confinis H4N4 Isolate Rhizosphere
567 8055097453 Leclercia tamurae H6W5 Isolate Rhizosphere
568 8055693939 Hafnia alvei A23BA Isolate Rhizosphere
569 8057304971 Scandinavium manionii H17S15 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 82.69
Metatranscriptomes 6.73
Isolates 10.58

Biome Distribution

Category Percentage (%)
Aerial Root 0.19
Bulb 0
Endosphere 2.12
Nodule 0.87
Rhizoplane 6.92
Rhizosphere 82.12
Stem 0.1
Stem Tuber 0.19
Unclassified 7.5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0006759J45824_1058806 3300003163 Bacteria 881
2 Ga0006758J48902_1012343 3300003300 Bacteria 669
3 rootH2_10099991 3300003320 Bacteria 8309
4 JGI25407J50210_10014098 3300003373 Bacteria 2059
5 JGI25407J50210_10022505 3300003373 Bacteria 1638
6 Ga0058692_1001828 3300003856 Bacteria 7486
7 Ga0058692_1003718 3300003856 Bacteria 4654
8 Ga0058692_1007337 3300003856 Bacteria 2935
9 Ga0058692_1008844 3300003856 Bacteria 2580
10 Ga0058863_11886113 3300004799 Bacteria 550
11 Ga0058861_11616176 3300004800 Bacteria 554
12 Ga0058861_11934168 3300004800 Bacteria 537
13 Ga0065704_10079030 3300005289 Bacteria 4270
14 Ga0065704_10192621 3300005289 Bacteria 1182
15 Ga0065704_10668912 3300005289 Bacteria 574
16 Ga0065712_10006792 3300005290 Bacteria 3153
17 Ga0065715_10524455 3300005293 Bacteria 761
18 Ga0070670_100000019 3300005331 Bacteria 215812
19 Ga0070670_100994175 3300005331 Bacteria 763
20 Ga0070670_101006352 3300005331 Unclassified 758
21 Ga0070670_101210985 3300005331 Bacteria 690
22 Ga0068869_100209344 3300005334 Bacteria 1541
23 Ga0068869_101922093 3300005334 Bacteria 530
24 Ga0070666_10074462 3300005335 Bacteria 2314
25 Ga0070682_100621414 3300005337 Bacteria 856
26 Ga0068868_100744812 3300005338 Bacteria 880
27 Ga0070660_100809058 3300005339 Bacteria 788
28 Ga0070689_101479796 3300005340 Unclassified 615
29 Ga0070689_101969575 3300005340 Bacteria 534
30 Ga0070691_10115008 3300005341 Bacteria 1349
31 Ga0070687_101072020 3300005343 Bacteria 588
32 Ga0070687_101205932 3300005343 Bacteria 558
33 Ga0070661_100004365 3300005344 Bacteria 9757
34 Ga0070668_100101690 3300005347 Bacteria 2278
35 Ga0070669_100000695 3300005353 Bacteria 24614
36 Ga0070675_101278470 3300005354 Bacteria 676
37 Ga0070671_100000080 3300005355 Bacteria 60926
38 Ga0070674_100005188 3300005356 Bacteria 7490
39 Ga0070688_100032517 3300005365 Bacteria 3146
40 Ga0070659_100094862 3300005366 Bacteria 2396
41 Ga0070659_100162621 3300005366 Bacteria 1826
42 Ga0070659_100675619 3300005366 Bacteria 892
43 Ga0070659_101310826 3300005366 Bacteria 642
44 Ga0070667_100000020 3300005367 Bacteria 215812
45 Ga0070667_100020021 3300005367 Bacteria 5554
46 Ga0070709_10384656 3300005434 Bacteria 1044
47 Ga0070714_100014691 3300005435 Bacteria 6292
48 Ga0070708_100084158 3300005445 Bacteria 2885
49 Ga0070708_100147665 3300005445 Bacteria 2185
50 Ga0070663_100133296 3300005455 Bacteria 1889
51 Ga0070663_100279881 3300005455 Bacteria 1329
52 Ga0070678_101391748 3300005456 Bacteria 655
53 Ga0070662_100810496 3300005457 Bacteria 796
54 Ga0070681_10020737 3300005458 Bacteria 6583
55 Ga0068867_100147103 3300005459 Bacteria 1847
56 Ga0068867_100440284 3300005459 Bacteria 1108
57 Ga0068867_100566459 3300005459 Bacteria 986
58 Ga0070685_10000015 3300005466 Bacteria 115963
59 Ga0070706_100331957 3300005467 Bacteria 1418
60 Ga0070706_101731440 3300005467 Bacteria 569
61 Ga0070707_100320586 3300005468 Bacteria 1506
62 Ga0070707_100552277 3300005468 Bacteria 1114
63 Ga0070698_100588143 3300005471 Unclassified 1053
64 Ga0070698_100903659 3300005471 Bacteria 829
65 Ga0070699_100070624 3300005518 Bacteria 3036
66 Ga0070699_100804801 3300005518 Bacteria 860
67 Ga0070679_100029874 3300005530 Bacteria 5378
68 Ga0070679_100490261 3300005530 Bacteria 1173
69 Ga0070679_100512280 3300005530 Bacteria 1144
70 Ga0070679_100971313 3300005530 Bacteria 793
71 Ga0070684_100010844 3300005535 Bacteria 7240
72 Ga0070684_101799832 3300005535 Unclassified 578
73 Ga0070697_100103411 3300005536 Bacteria 2368
74 Ga0070697_100360800 3300005536 Bacteria 1256
75 Ga0070697_100390845 3300005536 Bacteria 1206
76 Ga0068853_100146357 3300005539 Bacteria 2123
77 Ga0068853_100645924 3300005539 Bacteria 1007
78 Ga0068853_101785807 3300005539 Bacteria 596
79 Ga0070686_100309541 3300005544 Bacteria 1174
80 Ga0070696_100098489 3300005546 Bacteria 2092
81 Ga0070696_100277229 3300005546 Bacteria 1277
82 Ga0070693_100076511 3300005547 Bacteria 1984
83 Ga0070693_101193623 3300005547 Bacteria 584
84 Ga0070665_100000743 3300005548 Bacteria 43398
85 Ga0070665_100010055 3300005548 Bacteria 9573
86 Ga0070665_100111083 3300005548 Bacteria 2744
87 Ga0070665_101562233 3300005548 Bacteria 668
88 Ga0070704_100036945 3300005549 Bacteria 3332
89 Ga0070704_100199961 3300005549 Bacteria 1612
90 Ga0070704_100639706 3300005549 Bacteria 938
91 Ga0070704_100757196 3300005549 Bacteria 865
92 Ga0068855_100011893 3300005563 Bacteria 10523
93 Ga0070664_100057429 3300005564 Bacteria 3308
94 Ga0070664_100444857 3300005564 Bacteria 1189
95 Ga0070664_100801220 3300005564 Bacteria 881
96 Ga0070664_101763249 3300005564 Bacteria 587
97 Ga0068857_100000067 3300005577 Bacteria 58903
98 Ga0068857_100001500 3300005577 Bacteria 18598
99 Ga0068854_100145626 3300005578 Bacteria 1822
100 Ga0068854_101712014 3300005578 Bacteria 575
101 Ga0068856_100154036 3300005614 Bacteria 2308
102 Ga0070702_101744924 3300005615 Bacteria 518
103 Ga0068852_100001033 3300005616 Bacteria 18283
104 Ga0068859_100063249 3300005617 Bacteria 3731
105 Ga0068859_100115845 3300005617 Bacteria 2744
106 Ga0068859_100221937 3300005617 Bacteria 1978
107 Ga0068859_101291674 3300005617 Bacteria 804
108 Ga0068859_101334818 3300005617 Bacteria 791
109 Ga0068859_102784201 3300005617 Bacteria 537
110 Ga0068864_100000030 3300005618 Bacteria 215812
111 Ga0068864_100161442 3300005618 Bacteria 2037
112 Ga0068866_10474091 3300005718 Bacteria 823
113 Ga0068866_10681168 3300005718 Bacteria 703
114 Ga0068851_10007777 3300005834 Bacteria 4931
115 Ga0068851_10026625 3300005834 Bacteria 2844
116 Ga0068863_100050349 3300005841 Bacteria 3949
117 Ga0068863_100210302 3300005841 Bacteria 1873
118 Ga0068858_100030063 3300005842 Bacteria 5044
119 Ga0068858_100534677 3300005842 Bacteria 1134
120 Ga0068860_100005350 3300005843 Bacteria 13023
121 Ga0068860_100012322 3300005843 Bacteria 8424
122 Ga0068860_101296361 3300005843 Bacteria 749
123 Ga0068862_100004594 3300005844 Bacteria 11632
124 Ga0068862_100023696 3300005844 Bacteria 5144
125 Ga0068862_100269434 3300005844 Bacteria 1557
126 Ga0068862_100899789 3300005844 Bacteria 870
127 Ga0068862_102159059 3300005844 Bacteria 568
128 Ga0081455_10745870 3300005937 Bacteria 619
129 Ga0081538_10000316 3300005981 Bacteria 55223
130 Ga0081538_10000568 3300005981 Bacteria 40894
131 Ga0081538_10011351 3300005981 Bacteria 7224
132 Ga0070717_10395338 3300006028 Bacteria 1241
133 Ga0070717_10909930 3300006028 Bacteria 801
134 Ga0070717_11541774 3300006028 Bacteria 603
135 Ga0075365_11300008 3300006038 Bacteria 511
136 Ga0075368_10248206 3300006042 Bacteria 760
137 Ga0075364_10592572 3300006051 Bacteria 757
138 Ga0070715_10092670 3300006163 Bacteria 1393
139 Ga0070716_100032327 3300006173 Bacteria 2853
140 Ga0070716_100054495 3300006173 Bacteria 2284
141 Ga0070716_100947520 3300006173 Bacteria 677
142 Ga0075366_10002842 3300006195 Bacteria 8966
143 Ga0075366_10623185 3300006195 Bacteria 669
144 Ga0097621_100146214 3300006237 Bacteria 2024
145 Ga0097621_101403989 3300006237 Bacteria 661
146 Ga0068871_100137733 3300006358 Bacteria 2074
147 Ga0068871_100268104 3300006358 Bacteria 1491
148 Ga0068871_100946271 3300006358 Bacteria 800
149 Ga0075431_101290581 3300006847 Bacteria 691
150 Ga0075431_101461878 3300006847 Unclassified 642
151 Ga0075431_101972585 3300006847 Unclassified 539
152 Ga0075433_10125052 3300006852 Bacteria 2284
153 Ga0075433_10869318 3300006852 Bacteria 787
154 Ga0075433_11520870 3300006852 Bacteria 578
155 Ga0075433_11829087 3300006852 Bacteria 522
156 Ga0075434_100031638 3300006871 Bacteria 5217
157 Ga0075434_100389043 3300006871 Bacteria 1415
158 Ga0075434_101898296 3300006871 Bacteria 602
159 Ga0075429_100041033 3300006880 Bacteria 4030
160 Ga0075429_100677979 3300006880 Bacteria 903
161 Ga0075429_101102091 3300006880 Bacteria 693
162 Ga0068865_101429667 3300006881 Bacteria 618
163 Ga0075436_100019903 3300006914 Bacteria 4603
164 Ga0075436_100040846 3300006914 Bacteria 3200
165 Ga0075436_100046672 3300006914 Bacteria 2987
166 Ga0075436_100199794 3300006914 Bacteria 1416
167 Ga0097620_100063253 3300006931 Bacteria 3731
168 Ga0097620_100115855 3300006931 Bacteria 2744
169 Ga0097620_100221926 3300006931 Bacteria 1978
170 Ga0097620_101291610 3300006931 Bacteria 804
171 Ga0097620_101334918 3300006931 Bacteria 791
172 Ga0097620_102784747 3300006931 Bacteria 537
173 Ga0079104_1002525 3300006946 Bacteria 9685
174 Ga0079104_1005316 3300006946 Bacteria 5178
175 Ga0075435_100156276 3300007076 Bacteria 1919
176 Ga0075435_101016481 3300007076 Bacteria 724
177 Ga0099794_10068445 3300007265 Bacteria 1736
178 Ga0099794_10072242 3300007265 Bacteria 1691
179 Ga0099794_10085643 3300007265 Bacteria 1560
180 Ga0099795_10304542 3300007788 Bacteria 702
181 Ga0105251_10006629 3300009011 Bacteria 7328
182 Ga0105251_10098795 3300009011 Bacteria 1335
183 Ga0105251_10123698 3300009011 Bacteria 1174
184 Ga0105244_10000033 3300009036 Bacteria 172219
185 Ga0105244_10001764 3300009036 Bacteria 16994
186 Ga0105244_10007310 3300009036 Bacteria 7027
187 Ga0105244_10019924 3300009036 Bacteria 3730
188 Ga0105244_10028021 3300009036 Bacteria 3027
189 Ga0105244_10035931 3300009036 Bacteria 2599
190 Ga0105250_10000171 3300009092 Bacteria 56587
191 Ga0105250_10000367 3300009092 Bacteria 33714
192 Ga0105250_10002542 3300009092 Bacteria 9122
193 Ga0105250_10004133 3300009092 Bacteria 6734
194 Ga0105250_10015315 3300009092 Bacteria 3140
195 Ga0105240_10004408 3300009093 Bacteria 21471
196 Ga0111539_10004274 3300009094 Bacteria 18700
197 Ga0111539_11900195 3300009094 Bacteria 690
198 Ga0111539_12618092 3300009094 Bacteria 585
199 Ga0105245_10724033 3300009098 Bacteria 1029
200 Ga0105245_11648019 3300009098 Bacteria 693
201 Ga0114129_10000835 3300009147 Bacteria 39878
202 Ga0114129_10097411 3300009147 Bacteria 4072
203 Ga0114129_10409703 3300009147 Bacteria 1785
204 Ga0114129_13015265 3300009147 Bacteria 553
205 Ga0114129_13438895 3300009147 Bacteria 508
206 Ga0105243_10000946 3300009148 Bacteria 27191
207 Ga0105243_10034677 3300009148 Bacteria 3909
208 Ga0105243_10042550 3300009148 Bacteria 3556
209 Ga0105243_10175145 3300009148 Bacteria 1861
210 Ga0105243_11529111 3300009148 Bacteria 692
211 Ga0105241_10013752 3300009174 Bacteria 5928
212 Ga0105241_12315424 3300009174 Bacteria 535
213 Ga0105242_10119392 3300009176 Bacteria 2260
214 Ga0105242_10329362 3300009176 Bacteria 1404
215 Ga0105242_10478764 3300009176 Bacteria 1179
216 Ga0105242_10628096 3300009176 Bacteria 1042
217 Ga0105242_10738312 3300009176 Bacteria 968
218 Ga0105242_11090123 3300009176 Bacteria 812
219 Ga0105242_12191000 3300009176 Bacteria 598
220 Ga0105248_10120360 3300009177 Bacteria 2962
221 Ga0105248_11473311 3300009177 Bacteria 770
222 Ga0105237_10334099 3300009545 Bacteria 1520
223 Ga0105237_10342305 3300009545 Bacteria 1500
224 Ga0105237_11562069 3300009545 Bacteria 667
225 Ga0105237_11815305 3300009545 Bacteria 617
226 Ga0105237_11897824 3300009545 Bacteria 604
227 Ga0105237_12612570 3300009545 Bacteria 516
228 Ga0105238_10009119 3300009551 Bacteria 9930
229 Ga0105249_10036609 3300009553 Bacteria 4452
230 Ga0105249_10312258 3300009553 Bacteria 1581
231 Ga0105249_10552453 3300009553 Bacteria 1202
232 Ga0105249_11276104 3300009553 Bacteria 806
233 Ga0105249_11605073 3300009553 Bacteria 723
234 Ga0105033_122519 3300009986 Bacteria 576
235 Ga0099796_10084423 3300010159 Bacteria 1170
236 Ga0105239_10605920 3300010375 Bacteria 1249
237 Ga0105239_10975641 3300010375 Bacteria 974
238 Ga0105239_11356693 3300010375 Bacteria 820
239 Ga0105246_10247296 3300011119 Bacteria 1413
240 Ga0105246_10262157 3300011119 Bacteria 1377
241 Ga0105246_10522491 3300011119 Bacteria 1012
242 Ga0157318_1012286 3300012482 Unclassified 659
243 Ga0157373_10005140 3300013100 Bacteria 9837
244 Ga0157373_10006277 3300013100 Bacteria 8883
245 Ga0157373_10086503 3300013100 Bacteria 2209
246 Ga0157373_10096795 3300013100 Bacteria 2078
247 Ga0157371_10003717 3300013102 Bacteria 13683
248 Ga0157371_10006288 3300013102 Bacteria 9837
249 Ga0157371_10110671 3300013102 Bacteria 1949
250 Ga0157370_10020171 3300013104 Bacteria 6663
251 Ga0157370_10040666 3300013104 Bacteria 4488
252 Ga0157369_10000859 3300013105 Bacteria 38720
253 Ga0157369_10813069 3300013105 Bacteria 960
254 Ga0157374_10000041 3300013296 Bacteria 150386
255 Ga0157374_10202007 3300013296 Bacteria 1946
256 Ga0157378_10853802 3300013297 Bacteria 939
257 Ga0157378_11302111 3300013297 Bacteria 768
258 Ga0157378_11555733 3300013297 Bacteria 707
259 Ga0163162_10032762 3300013306 Bacteria 5161
260 Ga0163162_10079829 3300013306 Bacteria 3338
261 Ga0163162_10081411 3300013306 Bacteria 3308
262 Ga0157372_10000517 3300013307 Bacteria 42523
263 Ga0157372_10005826 3300013307 Bacteria 13126
264 Ga0157372_10033421 3300013307 Bacteria 5649
265 Ga0157372_10080425 3300013307 Bacteria 3687
266 Ga0157372_10140182 3300013307 Bacteria 2785
267 Ga0157372_10519603 3300013307 Bacteria 1388
268 Ga0157372_11133127 3300013307 Bacteria 905
269 Ga0157375_10263011 3300013308 Bacteria 1887
270 Ga0157375_11288226 3300013308 Bacteria 859
271 Ga0157380_10421311 3300014326 Bacteria 1273
272 Ga0157380_11021783 3300014326 Bacteria 861
273 Ga0157380_11909416 3300014326 Bacteria 654
274 Ga0157380_13338239 3300014326 Bacteria 513
275 Ga0182008_10202502 3300014497 Bacteria 1010
276 Ga0157377_11261080 3300014745 Bacteria 575
277 Ga0157379_10044050 3300014968 Bacteria 3985
278 Ga0157379_10425968 3300014968 Bacteria 1223
279 Ga0157379_11063450 3300014968 Bacteria 774
280 Ga0157376_10000279 3300014969 Bacteria 34619
281 Ga0182007_10358591 3300015262 Unclassified 549
282 Ga0183366_1002 3300015679 Bacteria 791639
283 Ga0183370_1002 3300015680 Bacteria 791639
284 Ga0183369_1002 3300015685 Bacteria 791621
285 Ga0183368_1005 3300015687 Bacteria 791621
286 Ga0183361_15145 3300016635 Bacteria 710
287 Ga0163161_10310264 3300017792 Bacteria 1244
288 Ga0206355_1691689 3300020076 Bacteria 705
289 Ga0206351_10564155 3300020077 Bacteria 1254
290 Ga0213872_10404087 3300021361 Bacteria 553
291 Ga0213876_10000013 3300021384 Bacteria 342052
292 Ga0224712_10275353 3300022467 Bacteria 782
293 Ga0207425_1004532 3300025245 Bacteria 4134
294 Ga0209129_1000010 3300025258 Bacteria 583357
295 Ga0207656_10013864 3300025321 Bacteria 3092
296 Ga0207696_1000102 3300025711 Bacteria 167962
297 Ga0207696_1000137 3300025711 Bacteria 127683
298 Ga0207696_1000272 3300025711 Bacteria 62222
299 Ga0207696_1000356 3300025711 Bacteria 46221
300 Ga0207696_1001421 3300025711 Bacteria 13043
301 Ga0207655_1000024 3300025728 Bacteria 459774
302 Ga0207655_1000065 3300025728 Bacteria 252767
303 Ga0207655_1000072 3300025728 Bacteria 236536
304 Ga0207655_1000186 3300025728 Bacteria 110125
305 Ga0207655_1014327 3300025728 Bacteria 4488
306 Ga0207655_1016739 3300025728 Bacteria 3995
307 Ga0207655_1023983 3300025728 Bacteria 3005
308 Ga0207713_1000019 3300025735 Bacteria 361225
309 Ga0207713_1000157 3300025735 Bacteria 102471
310 Ga0207713_1000300 3300025735 Bacteria 56459
311 Ga0207713_1003240 3300025735 Bacteria 11227
312 Ga0207713_1004405 3300025735 Bacteria 9139
313 Ga0207713_1093261 3300025735 Bacteria 1053
314 Ga0207642_10034211 3300025899 Bacteria 2158
315 Ga0207710_10056669 3300025900 Bacteria 1769
316 Ga0207680_10016832 3300025903 Bacteria 3849
317 Ga0207685_10114787 3300025905 Bacteria 1173
318 Ga0207699_10882658 3300025906 Bacteria 659
319 Ga0207684_10443962 3300025910 Bacteria 1114
320 Ga0207684_11413695 3300025910 Bacteria 569
321 Ga0207654_10102010 3300025911 Bacteria 1769
322 Ga0207707_10089282 3300025912 Bacteria 2693
323 Ga0207707_10545442 3300025912 Bacteria 985
324 Ga0207695_10164440 3300025913 Bacteria 2148
325 Ga0207662_10926657 3300025918 Bacteria 617
326 Ga0207657_10010093 3300025919 Bacteria 9441
327 Ga0207649_10462963 3300025920 Bacteria 959
328 Ga0207652_10082248 3300025921 Bacteria 2817
329 Ga0207652_11360482 3300025921 Bacteria 613
330 Ga0207646_10124778 3300025922 Bacteria 2315
331 Ga0207646_10427501 3300025922 Bacteria 1195
332 Ga0207681_10001475 3300025923 Bacteria 15155
333 Ga0207681_10384258 3300025923 Bacteria 1131
334 Ga0207694_10013370 3300025924 Bacteria 6181
335 Ga0207650_10000034 3300025925 Bacteria 215826
336 Ga0207650_11601334 3300025925 Bacteria 553
337 Ga0207659_10363763 3300025926 Bacteria 1203
338 Ga0207687_11372906 3300025927 Bacteria 607
339 Ga0207644_10000554 3300025931 Bacteria 24219
340 Ga0207690_10034322 3300025932 Bacteria 3268
341 Ga0207690_10113459 3300025932 Bacteria 1956
342 Ga0207706_11362368 3300025933 Bacteria 584
343 Ga0207686_10146215 3300025934 Bacteria 1640
344 Ga0207686_10219613 3300025934 Bacteria 1372
345 Ga0207686_10409747 3300025934 Bacteria 1034
346 Ga0207686_11681316 3300025934 Bacteria 525
347 Ga0207709_10004416 3300025935 Bacteria 8140
348 Ga0207709_10028321 3300025935 Bacteria 3239
349 Ga0207709_10040659 3300025935 Bacteria 2785
350 Ga0207709_10140124 3300025935 Bacteria 1661
351 Ga0207670_10297155 3300025936 Bacteria 1263
352 Ga0207670_11195146 3300025936 Bacteria 643
353 Ga0207704_11265850 3300025938 Bacteria 630
354 Ga0207704_11949122 3300025938 Bacteria 505
355 Ga0207665_10013281 3300025939 Bacteria 5414
356 Ga0207665_10048624 3300025939 Bacteria 2848
357 Ga0207665_11214242 3300025939 Bacteria 601
358 Ga0207711_10001883 3300025941 Bacteria 19121
359 Ga0207711_10147279 3300025941 Bacteria 2122
360 Ga0207689_10167430 3300025942 Bacteria 1811
361 Ga0207689_10291749 3300025942 Bacteria 1351
362 Ga0207689_10714172 3300025942 Bacteria 845
363 Ga0207661_10114147 3300025944 Bacteria 2290
364 Ga0207661_10972406 3300025944 Bacteria 782
365 Ga0207679_10665972 3300025945 Bacteria 942
366 Ga0207679_11065287 3300025945 Bacteria 741
367 Ga0207712_10073913 3300025961 Bacteria 2460
368 Ga0207712_10172929 3300025961 Bacteria 1690
369 Ga0207712_10445966 3300025961 Bacteria 1097
370 Ga0207712_10887116 3300025961 Bacteria 787
371 Ga0207712_11369293 3300025961 Bacteria 633
372 Ga0207668_10079704 3300025972 Bacteria 2370
373 Ga0207640_11814113 3300025981 Bacteria 551
374 Ga0207658_10000015 3300025986 Bacteria 215826
375 Ga0207658_10089130 3300025986 Bacteria 2387
376 Ga0207658_10756672 3300025986 Bacteria 880
377 Ga0207703_10019954 3300026035 Bacteria 5238
378 Ga0207639_10209170 3300026041 Bacteria 1678
379 Ga0207639_10435721 3300026041 Bacteria 1187
380 Ga0207678_10333724 3300026067 Bacteria 1306
381 Ga0207708_11984966 3300026075 Bacteria 509
382 Ga0207641_10013032 3300026088 Bacteria 6819
383 Ga0207641_10212145 3300026088 Bacteria 1791
384 Ga0207641_10631733 3300026088 Bacteria 1050
385 Ga0207648_10066218 3300026089 Bacteria 3150
386 Ga0207648_10241563 3300026089 Bacteria 1608
387 Ga0207676_10000032 3300026095 Bacteria 215826
388 Ga0207676_10045203 3300026095 Bacteria 3401
389 Ga0207676_10173247 3300026095 Bacteria 1882
390 Ga0207674_10000242 3300026116 Bacteria 67777
391 Ga0207674_10001008 3300026116 Bacteria 36810
392 Ga0207675_102275058 3300026118 Bacteria 556
393 Ga0207683_10737361 3300026121 Bacteria 914
394 Ga0207698_10164811 3300026142 Bacteria 1943
395 Ga0207698_10665837 3300026142 Bacteria 1033
396 Ga0209281_1000025 3300027111 Bacteria 488275
397 Ga0209281_1000089 3300027111 Bacteria 243650
398 Ga0209281_1000279 3300027111 Bacteria 96898
399 Ga0209281_1000369 3300027111 Bacteria 73041
400 Ga0209281_1000559 3300027111 Bacteria 45161
401 Ga0209281_1003542 3300027111 Bacteria 5099
402 Ga0209973_1085902 3300027252 Bacteria 503
403 Ga0209371_1000013 3300027312 Bacteria 691516
404 Ga0209371_1000019 3300027312 Bacteria 583561
405 Ga0209371_1000149 3300027312 Bacteria 110455
406 Ga0209371_1000346 3300027312 Bacteria 50802
407 Ga0209371_1000430 3300027312 Bacteria 42665
408 Ga0209371_1000649 3300027312 Bacteria 30391
409 Ga0209371_1000701 3300027312 Bacteria 28374
410 Ga0209371_1001333 3300027312 Bacteria 17187
411 Ga0209371_1005086 3300027312 Bacteria 5394
412 Ga0209371_1005550 3300027312 Bacteria 4973
413 Ga0209371_1007231 3300027312 Bacteria 3910
414 Ga0209371_1027476 3300027312 Bacteria 1280
415 Ga0209969_1011685 3300027360 Bacteria 1262
416 Ga0209967_1004221 3300027364 Bacteria 1902
417 Ga0209967_1006222 3300027364 Bacteria 1616
418 Ga0209981_1034326 3300027378 Bacteria 749
419 Ga0210000_1014047 3300027462 Bacteria 1197
420 Ga0210000_1073563 3300027462 Bacteria 558
421 Ga0209995_1082834 3300027471 Bacteria 551
422 Ga0209179_1031179 3300027512 Bacteria 1093
423 Ga0209999_1038460 3300027543 Bacteria 895
424 Ga0209999_1043159 3300027543 Unclassified 846
425 Ga0210002_1051324 3300027617 Bacteria 711
426 Ga0209983_1051643 3300027665 Bacteria 900
427 Ga0209588_1069503 3300027671 Bacteria 1138
428 Ga0209588_1118027 3300027671 Bacteria 850
429 Ga0209588_1123610 3300027671 Bacteria 827
430 Ga0209971_1006049 3300027682 Bacteria 2867
431 Ga0209966_1157507 3300027695 Bacteria 530
432 Ga0209998_10102751 3300027717 Bacteria 709
433 Ga0209974_10002074 3300027876 Bacteria 7329
434 Ga0209974_10147921 3300027876 Bacteria 846
435 Ga0209974_10285719 3300027876 Bacteria 628
436 Ga0207428_10051391 3300027907 Bacteria 3295
437 Ga0207428_10834273 3300027907 Bacteria 654
438 Ga0268266_10000142 3300028379 Bacteria 138183
439 Ga0268266_10013140 3300028379 Bacteria 7139
440 Ga0268266_11913141 3300028379 Bacteria 567
441 Ga0268265_10003694 3300028380 Bacteria 10914
442 Ga0268265_10178350 3300028380 Bacteria 1823
443 Ga0268265_10975089 3300028380 Bacteria 836
444 Ga0268265_11122145 3300028380 Bacteria 781
445 Ga0268264_10000009 3300028381 Bacteria 724972
446 Ga0268264_10200304 3300028381 Bacteria 1826
447 Ga0268264_10614269 3300028381 Bacteria 1073
448 Ga0268256_1000014 3300030500 Bacteria 691435
449 Ga0268256_1000024 3300030500 Bacteria 488637
450 Ga0268256_1000293 3300030500 Bacteria 50802
451 Ga0268256_1000868 3300030500 Bacteria 21089
452 Ga0268256_1002881 3300030500 Bacteria 8258
453 Ga0268256_1004055 3300030500 Bacteria 6281
454 Ga0268256_1004909 3300030500 Bacteria 5395
455 Ga0268256_1004912 3300030500 Bacteria 5394
456 Ga0268256_1005247 3300030500 Bacteria 5137
457 Ga0268256_1007258 3300030500 Bacteria 3980
458 Ga0268256_1021783 3300030500 Bacteria 1696
459 Ga0268256_1031248 3300030500 Bacteria 1280
460 Ga0265332_10002686 3300031238 Bacteria 8903
461 Ga0265327_10126045 3300031251 Bacteria 1209
462 Ga0307408_100047310 3300031548 Bacteria 3080
463 Ga0265313_10311083 3300031595 Bacteria 631
464 Ga0316575_10000197 3300031665 Bacteria 15992
465 Ga0316579_10407697 3300031691 Bacteria 657
466 Ga0316576_10063914 3300031727 Bacteria 2703
467 Ga0316576_10147785 3300031727 Bacteria 1771
468 Ga0307405_11107526 3300031731 Bacteria 681
469 Ga0307406_11276624 3300031901 Bacteria 640
470 Ga0307412_10131597 3300031911 Bacteria 1818
471 Ga0307412_11417406 3300031911 Bacteria 629
472 Ga0307409_100361700 3300031995 Unclassified 1373
473 Ga0307409_101487959 3300031995 Bacteria 704
474 Ga0307416_100916550 3300032002 Bacteria 977
475 Ga0307416_101520757 3300032002 Bacteria 775
476 Ga0307411_10384953 3300032005 Bacteria 1155
477 Ga0307415_100583389 3300032126 Bacteria 992
478 Ga0316583_10027512 3300032133 Bacteria 2030
479 Ga0316593_10004458 3300032168 Bacteria 3597
480 Ga0316593_10006857 3300032168 Bacteria 3100
481 Ga0316593_10101388 3300032168 Bacteria 1021
482 Ga0316586_1112115 3300033527 Bacteria 528
483 Ga0316588_1170524 3300033528 Bacteria 563
484 Ga0316587_1080659 3300033529 Bacteria 615
485 Ga0316587_1094570 3300033529 Bacteria 572
486 Ga0316587_1127523 3300033529 Unclassified 501
487 Ga0316596_1132804 3300033541 Bacteria 680
488 Ga0316596_1241947 3300033541 Bacteria 508
489 Ga0373926_0142250 3300035083 Bacteria 911
490 Ga0373934_0001761 3300035086 Bacteria 7959
491 Ga0373934_0001842 3300035086 Bacteria 7796
492 Ga0373923_0234769 3300035111 Bacteria 855
493 Ga0373941_0479960 3300035115 Bacteria 526
494 Ga0373945_0011097 3300035116 Bacteria 2974
495 Ga0373953_0039043 3300035117 Bacteria 1880
496 Ga0373953_0045113 3300035117 Bacteria 1765
497 Ga0373954_0003250 3300035118 Bacteria 6861
498 Ga0373954_0006306 3300035118 Bacteria 5168
499 Ga0373954_0119326 3300035118 Bacteria 1279
500 Ga0373956_0000012 3300035119 Bacteria 57485
501 Ga0373957_0004992 3300035120 Bacteria 4089
502 Ga0373957_0075454 3300035120 Bacteria 1324
503 Ga0373957_0481802 3300035120 Bacteria 539
504 Ga0373943_0536708 3300035170 Bacteria 686
505 Ga0373946_0020618 3300035171 Bacteria 2549
506 Ga0373955_0022269 3300035172 Bacteria 3212
507 Ga0373955_0300230 3300035172 Bacteria 968
508 Ga0373955_0306801 3300035172 Bacteria 957
509 Ga0373924_0005709 3300035410 Bacteria 4418
510 Ga0373931_0274859 3300035691 Bacteria 1032
511 Ga0373935_0007523 3300035692 Bacteria 6521
512 Ga0373935_0206669 3300035692 Bacteria 1359
513 Ga0373927_0040170 3300035695 Bacteria 3036
514 Ga0373933_0000489 3300035724 Bacteria 24730
515 Ga0373933_0285071 3300035724 Bacteria 1067
516 Ga0373947_0490721 3300035725 Bacteria 834
517 Ga0373937_0001078 3300036401 Bacteria 23022
518 Ga0373937_0028161 3300036401 Bacteria 5083
519 Ga0373937_0110119 3300036401 Bacteria 2561
520 Ga0373937_0226604 3300036401 Bacteria 1759
521 Ga0373937_0634165 3300036401 Bacteria 1014
522 Ga0316582_0110901 3300036647 Bacteria 1826
523 Ga0316582_0290448 3300036647 Bacteria 1123
524 Ga0316582_0958278 3300036647 Unclassified 585
525 Ga0316584_0685043 3300036712 Bacteria 704
526 Ga0373925_0007488 3300037068 Bacteria 7961
527 Ga0395899_0071185 3300037312 Bacteria 2545
528 Ga0395899_0222985 3300037312 Bacteria 1305
529 Ga0395899_0708613 3300037312 Bacteria 630
530 Ga0395900_0052173 3300037418 Bacteria 4210
531 Ga0395900_0200350 3300037418 Bacteria 2020
532 Ga0395900_1047588 3300037418 Bacteria 734
533 Ga0395900_1103261 3300037418 Bacteria 711
534 Ga0395898_0081015 3300037466 Bacteria 3131
535 Ga0395898_0150819 3300037466 Bacteria 2224
536 Ga0395898_0719478 3300037466 Bacteria 940
537 Ga0395905_0037515 3300037471 Bacteria 4549
538 Ga0395905_0746529 3300037471 Bacteria 881
539 Ga0395905_1011183 3300037471 Bacteria 734
540 Ga0395901_0123522 3300038443 Bacteria 2720
541 Ga0395901_0348549 3300038443 Bacteria 1528
542 Ga0395901_1066242 3300038443 Bacteria 780
543 Ga0400490_06112 3300038726 Bacteria 5203
544 Ga0242420_090756 3300038996 Bacteria 641
545 Ga0400483_215647 3300039062 Bacteria 2630
546 Ga0436365_0315664 3300039437 Bacteria 663
547 Ga0436365_0471682 3300039437 Bacteria 352256
548 Ga0436360_0425236 3300039438 Bacteria 1795
549 Ga0436360_1083522 3300039438 Bacteria 612
550 Ga0436361_1050827 3300039447 Bacteria 2216
551 Ga0436363_1096406 3300039450 Bacteria 547
552 Ga0439438_000003 3300041405 Bacteria 464587
553 Ga0439438_001217 3300041405 Bacteria 11409
554 Ga0439438_002463 3300041405 Bacteria 7872
555 Ga0439439_0156978 3300041406 Bacteria 648
556 Ga0439447_001374 3300041407 Bacteria 8900
557 Ga0439447_006949 3300041407 Bacteria 3629
558 Ga0451789_0815379 3300041443 Bacteria 731
559 Ga0451807_1802159 3300041486 Bacteria 502
560 Ga0451851_0983120 3300041507 Bacteria 620
561 Ga0451853_2078609 3300041512 Bacteria 2086
562 Ga0439432_010449 3300042006 Bacteria 3212
563 Ga0439432_013582 3300042006 Bacteria 2768
564 Ga0439432_153023 3300042006 Bacteria 676
565 Ga0439432_218898 3300042006 Bacteria 550
566 Ga0439452_000006 3300042010 Bacteria 645083
567 Ga0439452_000011 3300042010 Bacteria 428451
568 Ga0439452_004096 3300042010 Bacteria 4955
569 Ga0439434_0279246 3300042435 Bacteria 575
570 Ga0439464_0007335 3300042439 Bacteria 2882
571 Ga0451577_0032270 3300042876 Bacteria 4719
572 Ga0451577_0161487 3300042876 Bacteria 2018
573 Ga0466972_0522066 3300044658 Bacteria 559
574 Ga0453683_0687554 3300044673 Bacteria 670
575 Ga0466963_0516298 3300044694 Bacteria 844
576 Ga0453684_0072303 3300044712 Bacteria 4355
577 Ga0453684_0374116 3300044712 Bacteria 1601
578 Ga0453684_1699961 3300044712 Bacteria 645
579 Ga0451576_0007360 3300045051 Bacteria 13193
580 Ga0451576_2125887 3300045051 Bacteria 577
581 Ga0466967_0328006 3300045976 Bacteria 1478
582 Ga0495617_066705 3300046452 Bacteria 1185
583 Ga0495592_0014092 3300046454 Bacteria 6073
584 Ga0495592_0017267 3300046454 Bacteria 5481
585 Ga0495592_0116005 3300046454 Bacteria 1890
586 Ga0495592_0708128 3300046454 Bacteria 605
587 Ga0495603_0094613 3300046455 Bacteria 1745
588 Ga0495603_0744530 3300046455 Bacteria 560
589 Ga0495591_000010 3300046458 Bacteria 327794
590 Ga0495591_000411 3300046458 Bacteria 35586
591 Ga0495591_000777 3300046458 Bacteria 22942
592 Ga0495591_013135 3300046458 Bacteria 3047
593 Ga0495629_0000050 3300046459 Bacteria 107147
594 Ga0495629_0098574 3300046459 Bacteria 2039
595 Ga0495638_0080060 3300046460 Bacteria 1985
596 Ga0495641_0042009 3300046461 Bacteria 2121
597 Ga0495651_0000085 3300046462 Bacteria 68214
598 Ga0495651_0014818 3300046462 Bacteria 6029
599 Ga0495653_0010312 3300046463 Bacteria 7644
600 Ga0495653_0427184 3300046463 Bacteria 837
601 Ga0495653_0805546 3300046463 Bacteria 564
602 Ga0495650_0000008 3300046471 Bacteria 688246
603 Ga0495650_0000040 3300046471 Bacteria 366254
604 Ga0495650_0045630 3300046471 Bacteria 1844
605 Ga0495582_0043522 3300046473 Bacteria 2473
606 Ga0495605_0032390 3300046474 Bacteria 2660
607 Ga0495639_0001499 3300046475 Bacteria 10412
608 Ga0495639_0038817 3300046475 Bacteria 2139
609 Ga0495662_0041525 3300046476 Bacteria 2220
610 Ga0495662_0150273 3300046476 Bacteria 1147
611 Ga0495664_0004079 3300046477 Bacteria 7965
612 Ga0495584_0000811 3300046491 Bacteria 20557
613 Ga0495594_0037887 3300046499 Bacteria 2632
614 Ga0495594_0144215 3300046499 Bacteria 1351
615 Ga0495607_0010549 3300046501 Bacteria 6206
616 Ga0495606_0000966 3300046507 Bacteria 42048
617 Ga0495608_0008762 3300046511 Bacteria 7076
618 Ga0495608_0315308 3300046511 Bacteria 967
619 Ga0495616_0041166 3300046513 Bacteria 2358
620 Ga0495616_0166109 3300046513 Bacteria 989
621 Ga0495618_0011792 3300046514 Bacteria 5303
622 Ga0495620_0022016 3300046515 Bacteria 3081
623 Ga0495628_0010586 3300046516 Bacteria 7826
624 Ga0495628_0027653 3300046516 Bacteria 4612
625 Ga0495628_0031313 3300046516 Bacteria 4303
626 Ga0495628_0390873 3300046516 Bacteria 1017
627 Ga0495630_0001044 3300046517 Bacteria 19075
628 Ga0495630_0077499 3300046517 Bacteria 2506
629 Ga0495643_0271986 3300046522 Bacteria 783
630 Ga0495644_0010576 3300046523 Bacteria 3556
631 Ga0495648_0002943 3300046524 Bacteria 15281
632 Ga0495666_0007265 3300046526 Bacteria 5557
633 Ga0495652_0019967 3300046529 Bacteria 5958
634 Ga0495652_0218806 3300046529 Bacteria 1432
635 Ga0495652_0268818 3300046529 Bacteria 1254
636 Ga0495654_0000031 3300046530 Bacteria 206800
637 Ga0495654_0000089 3300046530 Bacteria 102765
638 Ga0495640_0029552 3300046533 Bacteria 3934
639 Ga0495640_0286804 3300046533 Bacteria 1024
640 Ga0495640_0505436 3300046533 Bacteria 735
641 Ga0495586_0012489 3300046535 Bacteria 4505
642 Ga0495587_0004041 3300046536 Bacteria 9721
643 Ga0495597_0004073 3300046542 Bacteria 8169
644 Ga0495645_0014068 3300046543 Bacteria 5670
645 Ga0495645_0114980 3300046543 Bacteria 1901
646 Ga0495622_0151327 3300046557 Bacteria 1050
647 Ga0495667_0064631 3300046559 Bacteria 2393
648 Ga0495667_0106079 3300046559 Bacteria 1816
649 Ga0495667_0299619 3300046559 Bacteria 1018
650 Ga0495668_0043831 3300046616 Bacteria 2487
651 Ga0495634_0123409 3300046642 Bacteria 1657
652 Ga0495634_0242652 3300046642 Bacteria 1104
653 Ga0495611_0075933 3300046648 Bacteria 1540
654 Ga0495625_0016265 3300046660 Bacteria 5860
655 Ga0495635_0004071 3300046663 Bacteria 10150
656 Ga0495635_0009364 3300046663 Bacteria 6845
657 Ga0495635_0023162 3300046663 Bacteria 4328
658 Ga0495661_0514755 3300046665 Bacteria 569
659 Ga0495588_0033862 3300046674 Bacteria 2583
660 Ga0495657_0004414 3300046675 Bacteria 11226
661 Ga0495657_0044070 3300046675 Bacteria 3038
662 Ga0495657_0170064 3300046675 Bacteria 1343
663 Ga0495599_0005051 3300046678 Bacteria 7851
664 Ga0495599_0015150 3300046678 Bacteria 4781
665 Ga0495599_0101320 3300046678 Bacteria 1795
666 Ga0495623_0627986 3300046679 Bacteria 556
667 Ga0495647_0324062 3300046681 Bacteria 698
668 Ga0495647_0419455 3300046681 Bacteria 616
669 Ga0495658_0000628 3300046683 Bacteria 19169
670 Ga0495658_0015072 3300046683 Bacteria 3961
671 Ga0495658_0274040 3300046683 Bacteria 1064
672 Ga0495613_0012456 3300046689 Bacteria 6320
673 Ga0495613_0548915 3300046689 Bacteria 773
674 Ga0495624_0291624 3300046690 Bacteria 984
675 Ga0495624_0425656 3300046690 Bacteria 796
676 Ga0495671_0001988 3300046692 Bacteria 13137
677 Ga0495649_0043412 3300046694 Bacteria 2454
678 Ga0495649_0055527 3300046694 Bacteria 2139
679 Ga0495589_0041517 3300046794 Bacteria 2295
680 Ga0495600_0018687 3300046809 Bacteria 4419
681 Ga0495660_0000184 3300046810 Bacteria 67383
682 Ga0495581_0003831 3300047315 Bacteria 8649
683 Ga0495581_0613341 3300047315 Bacteria 630
684 Ga0495604_0028106 3300047317 Bacteria 4474
685 Ga0495636_0272095 3300047318 Bacteria 787
686 Ga0495674_0010947 3300047319 Bacteria 8569
687 Ga0495674_0193637 3300047319 Bacteria 1689
688 Ga0495672_0000003 3300047320 Bacteria 728845
689 Ga0495672_0000082 3300047320 Bacteria 159422
690 Ga0495680_0100224 3300047322 Bacteria 2158
691 Ga0495680_0252804 3300047322 Bacteria 1249
692 Ga0495680_0796429 3300047322 Bacteria 617
693 Ga0495680_0959366 3300047322 Bacteria 549
694 Ga0495675_0003667 3300047444 Bacteria 9280
695 Ga0495675_0405458 3300047444 Bacteria 794
696 Ga0495679_000059 3300047446 Bacteria 109922
697 Ga0495679_034458 3300047446 Bacteria 1611
698 Ga0495679_094751 3300047446 Bacteria 834
699 Ga0495673_0000011 3300047469 Bacteria 674140
700 Ga0495673_0000117 3300047469 Bacteria 148662
701 Ga0495681_0050350 3300047470 Bacteria 1964
702 Ga0495684_0025150 3300047471 Bacteria 4578
703 Ga0495593_0080675 3300047673 Bacteria 1683
704 Ga0495602_0054829 3300048088 Bacteria 3516
705 Ga0495602_0388662 3300048088 Bacteria 998
706 Ga0495614_0045025 3300048089 Bacteria 1892
707 Ga0496100_0159656 3300048903 Bacteria 1615
708 Ga0496101_0000144 3300048904 Bacteria 63019
709 Ga0496101_0106694 3300048904 Bacteria 2103
710 Ga0496102_0067100 3300048905 Bacteria 3290
711 Ga0496102_1854620 3300048905 Bacteria 520
712 Ga0496103_0622336 3300048906 Bacteria 687
713 Ga0496104_0188756 3300048907 Bacteria 1972
714 Ga0496104_0353648 3300048907 Bacteria 1382
715 Ga0496106_0128267 3300048909 Bacteria 1988
716 Ga0496106_0513142 3300048909 Bacteria 963
717 Ga0496106_1572538 3300048909 Bacteria 504
718 Ga0496108_0329617 3300048911 Bacteria 1331
719 Ga0496109_0152471 3300048912 Bacteria 2164
720 Ga0496109_1045946 3300048912 Bacteria 754
721 Ga0496110_0480424 3300048913 Bacteria 1132
722 Ga0496110_1213064 3300048913 Bacteria 663
723 Ga0496111_0818000 3300048914 Bacteria 674
724 Ga0496112_0190813 3300048915 Bacteria 2011
725 Ga0496113_0978838 3300048916 Bacteria 667
726 Ga0496114_0844450 3300048917 Bacteria 796
727 Ga0496116_0008711 3300048919 Bacteria 8761
728 Ga0496116_0030592 3300048919 Bacteria 3864
729 Ga0496116_0123723 3300048919 Bacteria 1490
730 Ga0496117_0074056 3300048920 Bacteria 2269
731 Ga0496117_0192360 3300048920 Bacteria 1160
732 Ga0496117_0220973 3300048920 Bacteria 1054
733 Ga0496118_0086857 3300048921 Bacteria 2171
734 Ga0496118_0105054 3300048921 Bacteria 1894
735 Ga0496118_0167214 3300048921 Bacteria 1349
736 Ga0496118_0182307 3300048921 Bacteria 1267
737 Ga0496119_0000096 3300048922 Bacteria 129464
738 Ga0496119_0043543 3300048922 Bacteria 2834
739 Ga0496119_0141017 3300048922 Bacteria 1301
740 Ga0496120_0000068 3300048923 Bacteria 166108
741 Ga0496120_0001484 3300048923 Bacteria 27899
742 Ga0496120_0012013 3300048923 Bacteria 5917
743 Ga0496120_0037924 3300048923 Bacteria 2855
744 Ga0496122_0015833 3300048925 Bacteria 7183
745 Ga0496122_0036749 3300048925 Bacteria 3954
746 Ga0496122_0041854 3300048925 Bacteria 3613
747 Ga0496122_0091384 3300048925 Bacteria 2072
748 Ga0496122_0106151 3300048925 Bacteria 1860
749 Ga0496122_0110038 3300048925 Bacteria 1811
750 Ga0496123_0000017 3300048926 Bacteria 415261
751 Ga0496123_0003747 3300048926 Bacteria 16670
752 Ga0496123_0003886 3300048926 Bacteria 16250
753 Ga0496123_0047025 3300048926 Bacteria 2920
754 Ga0496123_0081909 3300048926 Bacteria 1958
755 Ga0496124_0002686 3300048927 Bacteria 22780
756 Ga0496124_0007846 3300048927 Bacteria 11258
757 Ga0496124_0014571 3300048927 Bacteria 7595
758 Ga0496124_0112980 3300048927 Bacteria 2183
759 Ga0496124_0129821 3300048927 Bacteria 2003
760 Ga0496124_0132795 3300048927 Bacteria 1975
761 Ga0496124_0426659 3300048927 Bacteria 911
762 Ga0496125_0000257 3300048928 Bacteria 109544
763 Ga0496125_0062599 3300048928 Bacteria 2973
764 Ga0496125_0378314 3300048928 Bacteria 835
765 Ga0496125_0423078 3300048928 Bacteria 771
766 Ga0496126_0026967 3300048929 Bacteria 5498
767 Ga0496126_0121308 3300048929 Bacteria 2266
768 Ga0496126_0223284 3300048929 Bacteria 1581
769 Ga0496126_0278353 3300048929 Bacteria 1386
770 Ga0496126_0538184 3300048929 Bacteria 928
771 Ga0496126_0578795 3300048929 Bacteria 887
772 Ga0501309_064336 3300049129 Bacteria 594
773 Ga0495678_000142 3300049459 Bacteria 86788
774 Ga0495682_0000034 3300049460 Bacteria 131806
775 Ga0501321_064068 3300049537 Bacteria 561
776 Ga0501031_0834514 3300049568 Bacteria 591
777 Ga0501031_0890105 3300049568 Bacteria 570
778 Ga0501036_0123130 3300049572 Bacteria 2190
779 Ga0501036_0404512 3300049572 Bacteria 1139
780 Ga0501036_0790560 3300049572 Bacteria 782
781 Ga0501037_1073158 3300049573 Bacteria 522
782 Ga0501038_1365656 3300049574 Bacteria 510
783 Ga0501039_0730678 3300049575 Bacteria 774
784 Ga0501040_0000689 3300049576 Bacteria 20856
785 Ga0501040_0035854 3300049576 Bacteria 3365
786 Ga0501040_0379717 3300049576 Bacteria 1014
787 Ga0501041_0081307 3300049577 Bacteria 1995
788 Ga0501041_0208653 3300049577 Bacteria 1225
789 Ga0501041_0813086 3300049577 Bacteria 599
790 Ga0501041_0929675 3300049577 Bacteria 559
791 Ga0501042_0001376 3300049578 Bacteria 14274
792 Ga0501042_0182779 3300049578 Bacteria 1513
793 Ga0501042_0451370 3300049578 Bacteria 932
794 Ga0501046_0137026 3300049580 Bacteria 1854
795 Ga0501046_0998607 3300049580 Bacteria 581
796 Ga0501048_0077675 3300049582 Bacteria 2343
797 Ga0501048_0525545 3300049582 Bacteria 849
798 Ga0501067_0018036 3300049583 Bacteria 3908
799 Ga0501067_0151956 3300049583 Bacteria 1290
800 Ga0501069_0058259 3300049585 Bacteria 2154
801 Ga0501069_0179463 3300049585 Bacteria 1224
802 Ga0501069_0616401 3300049585 Bacteria 652
803 Ga0501071_0126574 3300049587 Bacteria 1896
804 Ga0501071_0279281 3300049587 Bacteria 1264
805 Ga0501071_0533925 3300049587 Bacteria 900
806 Ga0501071_0569203 3300049587 Bacteria 871
807 Ga0501071_0905556 3300049587 Bacteria 681
808 Ga0501072_0185035 3300049588 Bacteria 1662
809 Ga0501072_0227978 3300049588 Bacteria 1484
810 Ga0501072_1542066 3300049588 Bacteria 512
811 Ga0501073_1188386 3300049589 Bacteria 524
812 Ga0501074_0189973 3300049590 Bacteria 1465
813 Ga0501075_0083830 3300049591 Bacteria 2414
814 Ga0501075_0104718 3300049591 Bacteria 2150
815 Ga0501075_1358960 3300049591 Bacteria 538
816 Ga0501076_0142777 3300049592 Bacteria 1946
817 Ga0501076_0178315 3300049592 Bacteria 1732
818 Ga0501076_0262777 3300049592 Bacteria 1413
819 Ga0501076_0373776 3300049592 Bacteria 1171
820 Ga0501077_0152455 3300049593 Bacteria 1467
821 Ga0501077_0728935 3300049593 Bacteria 637
822 Ga0501079_0016757 3300049741 Bacteria 5597
823 Ga0501079_0441297 3300049741 Bacteria 1022
824 Ga0501081_0137179 3300049743 Bacteria 1752
825 Ga0501081_0680257 3300049743 Bacteria 772
826 Ga0501268_108178 3300049765 Bacteria 604
827 Ga0501044_1184625 3300049823 Bacteria 632
828 Ga0501045_0018929 3300049824 Bacteria 4903
829 Ga0501045_0384123 3300049824 Bacteria 1045
830 nmdc:mga03n38_933098_c1 3300050490 Bacteria 511
831 nmdc:mga00v17_103934_c1 3300050491 Bacteria 1796
832 nmdc:mga00v17_428050_c1 3300050491 Bacteria 860
833 nmdc:mga00v17_4898_c1 3300050491 Bacteria 7017
834 nmdc:mga00v17_7754_c1 3300050491 Bacteria 5751
835 nmdc:mga0k408_724843_c1 3300050493 Bacteria 582
836 nmdc:mga05p37_12536_c1 3300050507 Bacteria 10122
837 nmdc:mga05p37_333447_c1 3300050507 Bacteria 1791
838 nmdc:mga09592_364608_c1 3300050508 Bacteria 1250
839 nmdc:mga06r32_1243223_c1 3300050510 Bacteria 690
840 nmdc:mga06r32_608563_c1 3300050510 Bacteria 1063
841 nmdc:mga08y16_325473_c1 3300050511 Bacteria 1582
842 nmdc:mga08y16_710939_c1 3300050511 Bacteria 1004
843 nmdc:mga0n895_131003_c1 3300050512 Bacteria 2533
844 nmdc:mga0n895_1375284_c1 3300050512 Bacteria 675
845 nmdc:mga0n895_1596768_c1 3300050512 Bacteria 617
846 nmdc:mga0n895_172295_c1 3300050512 Bacteria 2196
847 nmdc:mga0n895_539572_c1 3300050512 Bacteria 1173
848 nmdc:mga0n895_633293_c1 3300050512 Bacteria 1069
849 nmdc:mga0rr50_1461385_c1 3300050513 Bacteria 578
850 nmdc:mga0rr50_342789_c1 3300050513 Bacteria 1256
851 nmdc:mga0rr50_903011_c1 3300050513 Bacteria 753
852 nmdc:mga0rr50_999897_c1 3300050513 Bacteria 712
853 nmdc:mga08x19_169150_c1 3300050514 Bacteria 1488
854 nmdc:mga08x19_2213_c1 3300050514 Bacteria 11886
855 nmdc:mga08x19_253604_c1 3300050514 Bacteria 1215
856 nmdc:mga0a205_1018053_c1 3300050515 Bacteria 675
857 nmdc:mga0a205_1114950_c1 3300050515 Bacteria 636
858 nmdc:mga0a205_1436397_c1 3300050515 Bacteria 538
859 nmdc:mga0a205_20518_c1 3300050515 Bacteria 6237
860 Ga0495601_0030814 3300053077 Bacteria 3332
861 Ga0495601_0062156 3300053077 Bacteria 2371
862 Ga0495601_0145275 3300053077 Bacteria 1548
863 Ga0495601_0862894 3300053077 Bacteria 573
864 Ga0495595_0005704 3300053084 Bacteria 5040
865 Ga0495619_0009495 3300053085 Bacteria 6136
866 Ga0495619_0845462 3300053085 Bacteria 617
867 Ga0500643_091563 3300053087 Bacteria 829
868 Ga0500651_0331508 3300053093 Bacteria 867
869 Ga0500566_0151491 3300053094 Bacteria 1219
870 Ga0500650_0000042 3300053098 Bacteria 45991
871 Ga0500650_0169634 3300053098 Bacteria 1004
872 Ga0500556_0000982 3300053104 Bacteria 15104
873 Ga0500621_000010 3300053126 Bacteria 169537
874 Ga0500616_0006500 3300053153 Bacteria 7646
875 Ga0500599_005452 3300053736 Bacteria 1598
876 Ga0501084_0189534 3300054114 Bacteria 1735
877 Ga0587084_004200 3300059477 Bacteria 1636
878 Ga0587084_006709 3300059477 Bacteria 1407
879 Ga0587093_028911 3300059478 Bacteria 787
880 Ga0587066_010059 3300059490 Bacteria 1355
881 Ga0587066_173776 3300059490 Unclassified 550
882 Ga0587070_048654 3300059491 Bacteria 839
883 Ga0587073_0042409 3300059492 Bacteria 998
884 Ga0587073_0173368 3300059492 Bacteria 628
885 Ga0587077_063206 3300059493 Bacteria 808
886 Ga0587077_188075 3300059493 Bacteria 564
887 Ga0587080_019861 3300059503 Bacteria 1092
888 Ga0587082_094100 3300059504 Bacteria 644
889 Ga0587083_0101259 3300059505 Bacteria 718
890 Ga0587085_018762 3300059506 Bacteria 1029
891 Ga0587085_170550 3300059506 Bacteria 515
892 Ga0587086_018610 3300059507 Bacteria 927
893 Ga0587086_053610 3300059507 Bacteria 656
894 Ga0587088_025139 3300059508 Bacteria 1026
895 Ga0587090_031596 3300059510 Bacteria 888
896 Ga0587091_011222 3300059511 Bacteria 1393
897 Ga0587094_024100 3300059513 Bacteria 904
898 Ga0587098_062939 3300059604 Bacteria 586
899 Ga0587106_044632 3300059605 Bacteria 765
900 Ga0587101_005837 3300059623 Bacteria 1385
901 Ga0587101_018117 3300059623 Bacteria 984
902 Ga0587109_022371 3300059624 Bacteria 1138
903 Ga0587109_060844 3300059624 Bacteria 795
904 Ga0587109_076277 3300059624 Bacteria 733
905 Ga0587109_223183 3300059624 Bacteria 500
906 Ga0587115_072543 3300059626 Bacteria 597
907 Ga0587117_008158 3300059627 Bacteria 1222
908 Ga0587062_005914 3300059639 Bacteria 1370
909 Ga0587062_072607 3300059639 Bacteria 625
910 Ga0587062_106812 3300059639 Bacteria 551
911 Ga0587067_210518 3300059640 Bacteria 522
912 Ga0587068_007153 3300059641 Bacteria 1584
913 Ga0587068_007869 3300059641 Bacteria 1530
914 Ga0587068_126083 3300059641 Bacteria 560
915 Ga0587069_006520 3300059642 Bacteria 1406
916 Ga0587072_053091 3300059643 Bacteria 817
917 Ga0587075_107564 3300059644 Bacteria 564
918 Ga0587078_003122 3300059646 Bacteria 1653
919 Ga0587079_096896 3300059647 Bacteria 699
920 Ga0587100_004513 3300059648 Bacteria 1001
921 Ga0587110_010347 3300059654 Bacteria 930
922 Ga0587114_054034 3300059655 Bacteria 688
923 Ga0587116_06544 3300059656 Bacteria 721
924 Ga0587111_0015439 3300060346 Bacteria 1396
925 Ga0587111_0063890 3300060346 Bacteria 844
926 Ga0587111_0104283 3300060346 Bacteria 710
927 Ga0501082_0055023 3300060353 Bacteria 3429
928 Ga0501082_0834776 3300060353 Bacteria 806
929 Ga0530510_0028513 3300061734 Bacteria 4004
930 Ga0530510_1373887 3300061734 Bacteria 542

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009094 Ga0111539_10004274 Ga0111539_100042747 76
2 3300009545 Ga0105237_11562069 Ga0105237_115620691 76
3 3300014326 Ga0157380_11909416 Ga0157380_119094162 76
4 3300028381 Ga0268264_10614269 Ga0268264_106142692 76
5 3300050511 nmdc:mga08y16_325473_c1 nmdc:mga08y16_325473_c1_372_653 76
6 3300050512 nmdc:mga0n895_539572_c1 nmdc:mga0n895_539572_c1_170_451 76
7 3300006358 Ga0068871_100268104 Ga0068871_1002681042 77
8 3300009148 Ga0105243_11529111 Ga0105243_115291111 77
9 3300013296 Ga0157374_10000041 Ga0157374_10000041110 77
10 3300014745 Ga0157377_11261080 Ga0157377_112610801 77
11 3300014969 Ga0157376_10000279 Ga0157376_1000027930 77
12 3300009098 Ga0105245_11648019 Ga0105245_116480192 78
13 3300003373 JGI25407J50210_10014098 JGI25407J50210_100140982 80
14 3300003373 JGI25407J50210_10022505 JGI25407J50210_100225052 80
15 3300005289 Ga0065704_10192621 Ga0065704_101926211 80
16 3300005334 Ga0068869_101922093 Ga0068869_1019220931 80
17 3300005338 Ga0068868_100744812 Ga0068868_1007448122 80
18 3300005344 Ga0070661_100004365 Ga0070661_1000043652 80
19 3300005356 Ga0070674_100005188 Ga0070674_1000051885 80
20 3300005366 Ga0070659_100162621 Ga0070659_1001626212 80
21 3300005366 Ga0070659_100675619 Ga0070659_1006756192 80
22 3300005366 Ga0070659_101310826 Ga0070659_1013108261 80
23 3300005455 Ga0070663_100133296 Ga0070663_1001332962 80
24 3300005455 Ga0070663_100279881 Ga0070663_1002798812 80
25 3300005456 Ga0070678_101391748 Ga0070678_1013917481 80
26 3300005458 Ga0070681_10020737 Ga0070681_100207375 80
27 3300005459 Ga0068867_100440284 Ga0068867_1004402841 80
28 3300005459 Ga0068867_100566459 Ga0068867_1005664592 80
29 3300005535 Ga0070684_100010844 Ga0070684_1000108446 80
30 3300005536 Ga0070697_100103411 Ga0070697_1001034112 80
31 3300005544 Ga0070686_100309541 Ga0070686_1003095412 80
32 3300005546 Ga0070696_100098489 Ga0070696_1000984893 80
33 3300005549 Ga0070704_100036945 Ga0070704_1000369452 80
34 3300005549 Ga0070704_100757196 Ga0070704_1007571962 80
35 3300005564 Ga0070664_100801220 Ga0070664_1008012202 80
36 3300005577 Ga0068857_100001500 Ga0068857_10000150016 80
37 3300005614 Ga0068856_100154036 Ga0068856_1001540362 80
38 3300005616 Ga0068852_100001033 Ga0068852_10000103317 80
39 3300005617 Ga0068859_102784201 Ga0068859_1027842012 80
40 3300005718 Ga0068866_10474091 Ga0068866_104740912 80
41 3300005834 Ga0068851_10026625 Ga0068851_100266252 80
42 3300005844 Ga0068862_100269434 Ga0068862_1002694342 80
43 3300005981 Ga0081538_10000316 Ga0081538_1000031646 80
44 3300005981 Ga0081538_10000568 Ga0081538_1000056835 80
45 3300005981 Ga0081538_10011351 Ga0081538_100113515 80
46 3300006028 Ga0070717_10395338 Ga0070717_103953382 80
47 3300006028 Ga0070717_10909930 Ga0070717_109099302 80
48 3300006038 Ga0075365_11300008 Ga0075365_113000082 80
49 3300006042 Ga0075368_10248206 Ga0075368_102482062 80
50 3300006847 Ga0075431_101290581 Ga0075431_1012905812 80
51 3300006852 Ga0075433_10125052 Ga0075433_101250522 80
52 3300006871 Ga0075434_100031638 Ga0075434_1000316383 80
53 3300006871 Ga0075434_101898296 Ga0075434_1018982962 80
54 3300006931 Ga0097620_102784747 Ga0097620_1027847472 80
55 3300007076 Ga0075435_100156276 Ga0075435_1001562762 80
56 3300009098 Ga0105245_10724033 Ga0105245_107240332 80
57 3300009147 Ga0114129_10000835 Ga0114129_1000083525 80
58 3300009147 Ga0114129_13438895 Ga0114129_134388951 80
59 3300009148 Ga0105243_10034677 Ga0105243_100346774 80
60 3300009148 Ga0105243_10042550 Ga0105243_100425503 80
61 3300009148 Ga0105243_10175145 Ga0105243_101751453 80
62 3300009174 Ga0105241_10013752 Ga0105241_100137522 80
63 3300009176 Ga0105242_10329362 Ga0105242_103293622 80
64 3300009176 Ga0105242_10738312 Ga0105242_107383122 80
65 3300009176 Ga0105242_11090123 Ga0105242_110901231 80
66 3300009545 Ga0105237_10334099 Ga0105237_103340992 80
67 3300009545 Ga0105237_11897824 Ga0105237_118978242 80
68 3300009553 Ga0105249_10552453 Ga0105249_105524532 80
69 3300010375 Ga0105239_11356693 Ga0105239_113566932 80
70 3300013100 Ga0157373_10086503 Ga0157373_100865032 80
71 3300013104 Ga0157370_10020171 Ga0157370_100201716 80
72 3300013105 Ga0157369_10813069 Ga0157369_108130691 80
73 3300013306 Ga0163162_10081411 Ga0163162_100814114 80
74 3300013307 Ga0157372_10033421 Ga0157372_100334215 80
75 3300014326 Ga0157380_13338239 Ga0157380_133382392 80
76 3300014968 Ga0157379_11063450 Ga0157379_110634502 80
77 3300025899 Ga0207642_10034211 Ga0207642_100342113 80
78 3300025911 Ga0207654_10102010 Ga0207654_101020102 80
79 3300025912 Ga0207707_10089282 Ga0207707_100892823 80
80 3300025919 Ga0207657_10010093 Ga0207657_100100939 80
81 3300025927 Ga0207687_11372906 Ga0207687_113729061 80
82 3300025932 Ga0207690_10113459 Ga0207690_101134592 80
83 3300025934 Ga0207686_10409747 Ga0207686_104097472 80
84 3300025935 Ga0207709_10040659 Ga0207709_100406593 80
85 3300025935 Ga0207709_10140124 Ga0207709_101401242 80
86 3300025938 Ga0207704_11949122 Ga0207704_119491221 80
87 3300025942 Ga0207689_10167430 Ga0207689_101674302 80
88 3300025944 Ga0207661_10114147 Ga0207661_101141472 80
89 3300025944 Ga0207661_10972406 Ga0207661_109724061 80
90 3300025945 Ga0207679_11065287 Ga0207679_110652872 80
91 3300026041 Ga0207639_10209170 Ga0207639_102091702 80
92 3300026067 Ga0207678_10333724 Ga0207678_103337242 80
93 3300026075 Ga0207708_11984966 Ga0207708_119849661 80
94 3300026089 Ga0207648_10241563 Ga0207648_102415632 80
95 3300026118 Ga0207675_102275058 Ga0207675_1022750582 80
96 3300026121 Ga0207683_10737361 Ga0207683_107373612 80
97 3300026142 Ga0207698_10164811 Ga0207698_101648112 80
98 3300032002 Ga0307416_101520757 Ga0307416_1015207572 80
99 3300037418 Ga0395900_1103261 Ga0395900_1103261_46_324 80
100 3300037466 Ga0395898_0719478 Ga0395898_0719478_25_303 80
101 3300038443 Ga0395901_1066242 Ga0395901_1066242_354_623 80
102 3300046455 Ga0495603_0094613 Ga0495603_0094613_29_298 80
103 3300046683 Ga0495658_0274040 Ga0495658_0274040_381_650 80
104 3300046690 Ga0495624_0425656 Ga0495624_0425656_15_284 80
105 3300048905 Ga0496102_0067100 Ga0496102_0067100_1270_1539 80
106 3300048906 Ga0496103_0622336 Ga0496103_0622336_118_387 80
107 3300048907 Ga0496104_0353648 Ga0496104_0353648_1037_1306 80
108 3300048909 Ga0496106_0128267 Ga0496106_0128267_781_1050 80
109 3300048909 Ga0496106_0513142 Ga0496106_0513142_525_794 80
110 3300048912 Ga0496109_1045946 Ga0496109_1045946_473_742 80
111 3300048913 Ga0496110_1213064 Ga0496110_1213064_294_563 80
112 3300049583 Ga0501067_0151956 Ga0501067_0151956_692_961 80
113 3300049585 Ga0501069_0179463 Ga0501069_0179463_455_724 80
114 3300049585 Ga0501069_0616401 Ga0501069_0616401_221_490 80
115 3300050490 nmdc:mga03n38_933098_c1 nmdc:mga03n38_933098_c1_196_465 80
116 3300050507 nmdc:mga05p37_12536_c1 nmdc:mga05p37_12536_c1_5891_6160 80
117 3300050510 nmdc:mga06r32_1243223_c1 nmdc:mga06r32_1243223_c1_268_537 80
118 3300050512 nmdc:mga0n895_131003_c1 nmdc:mga0n895_131003_c1_1456_1725 80
119 3300050512 nmdc:mga0n895_1596768_c1 nmdc:mga0n895_1596768_c1_31_300 80
120 3300050513 nmdc:mga0rr50_342789_c1 nmdc:mga0rr50_342789_c1_879_1148 80
121 3300050515 nmdc:mga0a205_20518_c1 nmdc:mga0a205_20518_c1_5113_5382 80
122 3300053104 Ga0500556_0000982 Ga0500556_0000982_4825_5094 80
123 3300053153 Ga0500616_0006500 Ga0500616_0006500_5009_5278 80
124 3300053736 Ga0500599_005452 Ga0500599_005452_867_1136 80
125 3300005341 Ga0070691_10115008 Ga0070691_101150082 81
126 3300005435 Ga0070714_100014691 Ga0070714_1000146912 81
127 3300005530 Ga0070679_100029874 Ga0070679_1000298742 81
128 3300005539 Ga0068853_100146357 Ga0068853_1001463573 81
129 3300005563 Ga0068855_100011893 Ga0068855_1000118936 81
130 3300005564 Ga0070664_100057429 Ga0070664_1000574294 81
131 3300005578 Ga0068854_100145626 Ga0068854_1001456262 81
132 3300009093 Ga0105240_10004408 Ga0105240_1000440816 81
133 3300009551 Ga0105238_10009119 Ga0105238_100091195 81
134 3300013102 Ga0157371_10110671 Ga0157371_101106712 81
135 3300013296 Ga0157374_10202007 Ga0157374_102020072 81
136 3300014497 Ga0182008_10202502 Ga0182008_102025022 81
137 3300025921 Ga0207652_10082248 Ga0207652_100822482 81
138 3300025924 Ga0207694_10013370 Ga0207694_100133704 81
139 3300026116 Ga0207674_10000242 Ga0207674_1000024239 81
140 3300041443 Ga0451789_0815379 Ga0451789_0815379_345_680 81
141 3300050512 nmdc:mga0n895_633293_c1 nmdc:mga0n895_633293_c1_740_1009 82
142 3300036647 Ga0316582_0958278 Ga0316582_0958278_116_385 83
143 3300033529 Ga0316587_1094570 Ga0316587_10945702 84
144 3300042435 Ga0439434_0279246 Ga0439434_0279246_63_317 84
145 3300041406 Ga0439439_0156978 Ga0439439_0156978_96_353 85
146 3300048914 Ga0496111_0818000 Ga0496111_0818000_366_623 85
147 iso_pu_bacteria 2547132181 2547696016 85
148 iso_pu_bacteria 2547132416 2548649188 85
149 iso_pu_bacteria 2561511199 2562464593 85
150 iso_pu_bacteria 2599185169 2599410267 85
151 iso_pu_bacteria 2600255254 2601523479 85
152 iso_pu_bacteria 2600255255 2601528638 85
153 iso_pu_bacteria 2600255256 2601534406 85
154 iso_pu_bacteria 2600255257 2601538815 85
155 iso_pu_bacteria 2600255280 2601615471 85
156 iso_pu_bacteria 2600255281 2601619603 85
157 iso_pu_bacteria 2600255287 2601643982 85
158 iso_pu_bacteria 2600255288 2601648008 85
159 iso_pu_bacteria 2600255289 2601653523 85
160 iso_pu_bacteria 2600255290 2601658356 85
161 iso_pu_bacteria 2600255291 2601663807 85
162 iso_pu_bacteria 2600255298 2601696312 85
163 iso_pu_bacteria 2600255299 2601701439 85
164 iso_pu_bacteria 2600255300 2601706178 85
165 iso_pu_bacteria 2600255301 2601711763 85
166 iso_pu_bacteria 2600255302 2601716781 85
167 iso_pu_bacteria 2600255303 2601721336 85
168 iso_pu_bacteria 2600255304 2601727187 85
169 iso_pu_bacteria 2600255305 2601731727 85
170 iso_pu_bacteria 2600255306 2601736739 85
171 iso_pu_bacteria 2600255307 2601740295 85
172 iso_pu_bacteria 2600255309 2601751232 85
173 iso_pu_bacteria 2600255310 2601757164 85
174 iso_pu_bacteria 2600255311 2601762235 85
175 iso_pu_bacteria 2600255392 2602018908 85
176 iso_pu_bacteria 2602042046 2603639513 85
177 iso_pu_bacteria 2602042047 2603644309 85
178 iso_pu_bacteria 2602042052 2603661195 85
179 iso_pu_bacteria 2602042053 2603666470 85
180 iso_pu_bacteria 2602042066 2603701167 85
181 iso_pu_bacteria 2602042067 2603704916 85
182 iso_pu_bacteria 2602042103 2603839124 85
183 iso_pu_bacteria 2602042104 2603843616 85
184 iso_pu_bacteria 2602042105 2603849281 85
185 iso_pu_bacteria 2602042106 2603854351 85
186 iso_pu_bacteria 2602042109 2603865690 85
187 iso_pu_bacteria 2602042110 2603872406 85
188 iso_pu_bacteria 2602042111 2603877282 85
189 iso_pu_bacteria 2603880178 2606049587 85
190 iso_pu_bacteria 2603880184 2606070902 85
191 iso_pu_bacteria 2603880202 2606147271 85
192 iso_pu_bacteria 2603880211 2606176996 85
193 iso_pu_bacteria 2609459761 2609911431 85
194 iso_pu_bacteria 2636415599 2637223171 85
195 iso_pu_bacteria 2643221541 2643728030 85
196 iso_pu_bacteria 2643221606 2644043020 85
197 iso_pu_bacteria 2643221671 2644395549 85
198 iso_pu_bacteria 2667528172 2671104565 85
199 iso_pu_bacteria 2671180115 2671586100 85
200 iso_pu_bacteria 2675903046 2676408638 85
201 iso_pu_bacteria 2681812866 2681998073 85
202 iso_pu_bacteria 2681812869 2682008193 85
203 iso_pu_bacteria 2706794495 2707101911 85
204 iso_pu_bacteria 2711768156 2712471273 85
205 iso_pu_bacteria 2751185917 2753857705 85
206 iso_pu_bacteria 2765235842 2765590821 85
207 iso_pu_bacteria 2775506706 2775540377 85
208 iso_pu_bacteria 2775507074 2777019495 85
209 iso_pu_bacteria 2791354903 2791925271 85
210 iso_pu_bacteria 2791355010 2792312601 85
211 iso_pu_bacteria 2791355275 2793403895 85
212 iso_pu_bacteria 2811995292 2813726799 85
213 iso_pu_bacteria 2814123068 2814694172 85
214 iso_pu_bacteria 2821118458 2821120703 85
215 iso_pu_bacteria 2823373977 2823376581 85
216 iso_pu_bacteria 2844425489 2844429194 85
217 iso_pu_bacteria 2846540461 2846544675 85
218 iso_pu_bacteria 2854601825 2854603105 85
219 iso_pu_bacteria 2855020534 2855021257 85
220 iso_pu_bacteria 2876601092 2876605843 85
221 iso_pu_bacteria 2881714928 2881716442 85
222 iso_pu_bacteria 2884086401 2884087048 85
223 iso_pu_bacteria 2891670763 2891675539 85
224 iso_pu_bacteria 2904513164 2904517086 85
225 iso_pu_bacteria 2919108558 2919113459 85
226 iso_pu_bacteria 2923634449 2923636711 85
227 iso_pu_bacteria 2927833300 2927836828 85
228 iso_pu_bacteria 2935625433 2935629480 85
229 iso_pu_bacteria 2937539931 2937544092 85
230 iso_pu_bacteria 2939568625 2939572395 85
231 iso_pu_bacteria 2939573065 2939576567 85
232 iso_pu_bacteria 2939602548 2939605923 85
233 iso_pu_bacteria 2939607340 2939610536 85
234 iso_pu_bacteria 2939617950 2939620543 85
235 iso_pu_bacteria 2939642701 2939645606 85
236 iso_pu_bacteria 2945874760 2945875862 85
237 iso_pu_bacteria 2969079654 2969080203 85
238 iso_pu_bacteria 2971820967 2971821547 85
239 iso_pu_bacteria 2974310843 2974314951 85
240 iso_pu_bacteria 2974435778 2974440276 85
241 iso_pu_bacteria 2984559226 2984562658 85
242 iso_pu_bacteria 2984595703 2984600718 85
243 iso_pu_bacteria 3000376612 3000377510 85
244 iso_pu_bacteria 8016733728 8016737383 85
245 iso_pu_bacteria 8018221730 8018226351 85
246 iso_pu_bacteria 8018405270 8018407059 85
247 iso_pu_bacteria 8019499862 8019502611 85
248 iso_pu_bacteria 8019504834 8019507500 85
249 iso_pu_bacteria 8054357960 8054359826 85
250 iso_pu_bacteria 8054844752 8054848216 85
251 iso_pu_bacteria 8054849141 8054853632 85
252 iso_pu_bacteria 8055087960 8055089559 85
253 iso_pu_bacteria 8055092621 8055095956 85
254 iso_pu_bacteria 8055097453 8055101700 85
255 iso_pu_bacteria 8055693939 8055694489 85
256 iso_pu_bacteria 8057304971 8057308436 85
257 3300014326 Ga0157380_11021783 Ga0157380_110217832 86
258 3300032133 Ga0316583_10027512 Ga0316583_100275122 87
259 3300044712 Ga0453684_1699961 Ga0453684_1699961_47_310 87
260 3300004800 Ga0058861_11934168 Ga0058861_119341681 88
261 3300005290 Ga0065712_10006792 Ga0065712_100067922 88
262 3300005293 Ga0065715_10524455 Ga0065715_105244551 88
263 3300005331 Ga0070670_100994175 Ga0070670_1009941752 88
264 3300005337 Ga0070682_100621414 Ga0070682_1006214141 88
265 3300005343 Ga0070687_101072020 Ga0070687_1010720201 88
266 3300005354 Ga0070675_101278470 Ga0070675_1012784702 88
267 3300005457 Ga0070662_100810496 Ga0070662_1008104961 88
268 3300005530 Ga0070679_100512280 Ga0070679_1005122802 88
269 3300005530 Ga0070679_100971313 Ga0070679_1009713132 88
270 3300005539 Ga0068853_100645924 Ga0068853_1006459242 88
271 3300005547 Ga0070693_100076511 Ga0070693_1000765113 88
272 3300005564 Ga0070664_101763249 Ga0070664_1017632492 88
273 3300005617 Ga0068859_100221937 Ga0068859_1002219372 88
274 3300005617 Ga0068859_101334818 Ga0068859_1013348182 88
275 3300006880 Ga0075429_101102091 Ga0075429_1011020912 88
276 3300006931 Ga0097620_100221926 Ga0097620_1002219262 88
277 3300006931 Ga0097620_101334918 Ga0097620_1013349182 88
278 3300009094 Ga0111539_11900195 Ga0111539_119001951 88
279 3300009094 Ga0111539_12618092 Ga0111539_126180921 88
280 3300009553 Ga0105249_11276104 Ga0105249_112761041 88
281 3300014326 Ga0157380_10421311 Ga0157380_104213112 88
282 3300015262 Ga0182007_10358591 Ga0182007_103585912 88
283 3300025912 Ga0207707_10545442 Ga0207707_105454422 88
284 3300025921 Ga0207652_11360482 Ga0207652_113604822 88
285 3300025923 Ga0207681_10384258 Ga0207681_103842581 88
286 3300025926 Ga0207659_10363763 Ga0207659_103637631 88
287 3300025932 Ga0207690_10034322 Ga0207690_100343222 88
288 3300025933 Ga0207706_11362368 Ga0207706_113623682 88
289 3300025936 Ga0207670_11195146 Ga0207670_111951461 88
290 3300025938 Ga0207704_11265850 Ga0207704_112658501 88
291 3300025961 Ga0207712_10887116 Ga0207712_108871162 88
292 3300025986 Ga0207658_10756672 Ga0207658_107566722 88
293 3300026041 Ga0207639_10435721 Ga0207639_104357212 88
294 3300027876 Ga0209974_10147921 Ga0209974_101479212 88
295 3300027907 Ga0207428_10051391 Ga0207428_100513913 88
296 3300027907 Ga0207428_10834273 Ga0207428_108342731 88
297 3300035170 Ga0373943_0536708 Ga0373943_0536708_106_372 88
298 3300035692 Ga0373935_0206669 Ga0373935_0206669_285_551 88
299 3300036401 Ga0373937_0028161 Ga0373937_0028161_1427_1693 88
300 3300036401 Ga0373937_0634165 Ga0373937_0634165_338_604 88
301 3300045051 Ga0451576_2125887 Ga0451576_2125887_113_379 88
302 3300046459 Ga0495629_0000050 Ga0495629_0000050_7646_7912 88
303 3300046475 Ga0495639_0038817 Ga0495639_0038817_1692_1958 88
304 3300046476 Ga0495662_0150273 Ga0495662_0150273_463_729 88
305 3300046499 Ga0495594_0144215 Ga0495594_0144215_1013_1279 88
306 3300046533 Ga0495640_0505436 Ga0495640_0505436_15_281 88
307 3300046642 Ga0495634_0123409 Ga0495634_0123409_180_446 88
308 3300046663 Ga0495635_0004071 Ga0495635_0004071_5093_5359 88
309 3300046681 Ga0495647_0324062 Ga0495647_0324062_265_531 88
310 3300046683 Ga0495658_0000628 Ga0495658_0000628_18005_18271 88
311 3300046689 Ga0495613_0012456 Ga0495613_0012456_4455_4721 88
312 3300047315 Ga0495581_0003831 Ga0495581_0003831_5750_6016 88
313 3300047322 Ga0495680_0100224 Ga0495680_0100224_60_326 88
314 3300048089 Ga0495614_0045025 Ga0495614_0045025_542_808 88
315 3300048905 Ga0496102_1854620 Ga0496102_1854620_217_483 88
316 3300048909 Ga0496106_1572538 Ga0496106_1572538_142_408 88
317 3300048911 Ga0496108_0329617 Ga0496108_0329617_613_879 88
318 3300048912 Ga0496109_0152471 Ga0496109_0152471_1862_2128 88
319 3300048915 Ga0496112_0190813 Ga0496112_0190813_1325_1591 88
320 3300049572 Ga0501036_0123130 Ga0501036_0123130_24_290 88
321 3300049576 Ga0501040_0035854 Ga0501040_0035854_1630_1896 88
322 3300049576 Ga0501040_0379717 Ga0501040_0379717_53_319 88
323 3300049577 Ga0501041_0208653 Ga0501041_0208653_151_417 88
324 3300049578 Ga0501042_0451370 Ga0501042_0451370_157_423 88
325 3300049580 Ga0501046_0137026 Ga0501046_0137026_584_850 88
326 3300049582 Ga0501048_0077675 Ga0501048_0077675_1666_1932 88
327 3300049583 Ga0501067_0018036 Ga0501067_0018036_1219_1485 88
328 3300049585 Ga0501069_0058259 Ga0501069_0058259_1444_1710 88
329 3300049587 Ga0501071_0126574 Ga0501071_0126574_706_972 88
330 3300049587 Ga0501071_0533925 Ga0501071_0533925_537_803 88
331 3300049588 Ga0501072_1542066 Ga0501072_1542066_72_338 88
332 3300049591 Ga0501075_0083830 Ga0501075_0083830_805_1071 88
333 3300049591 Ga0501075_0104718 Ga0501075_0104718_527_793 88
334 3300049592 Ga0501076_0178315 Ga0501076_0178315_110_376 88
335 3300049592 Ga0501076_0262777 Ga0501076_0262777_187_453 88
336 3300049741 Ga0501079_0016757 Ga0501079_0016757_33_299 88
337 3300049743 Ga0501081_0137179 Ga0501081_0137179_683_949 88
338 3300049743 Ga0501081_0680257 Ga0501081_0680257_363_629 88
339 3300049824 Ga0501045_0018929 Ga0501045_0018929_56_322 88
340 3300049824 Ga0501045_0384123 Ga0501045_0384123_291_557 88
341 3300050511 nmdc:mga08y16_710939_c1 nmdc:mga08y16_710939_c1_655_921 88
342 3300050512 nmdc:mga0n895_1375284_c1 nmdc:mga0n895_1375284_c1_238_504 88
343 3300050513 nmdc:mga0rr50_1461385_c1 nmdc:mga0rr50_1461385_c1_163_429 88
344 3300053085 Ga0495619_0009495 Ga0495619_0009495_4316_4582 88
345 3300059492 Ga0587073_0173368 Ga0587073_0173368_104_370 88
346 3300059506 Ga0587085_170550 Ga0587085_170550_88_354 88
347 3300059624 Ga0587109_223183 Ga0587109_223183_57_323 88
348 3300059639 Ga0587062_072607 Ga0587062_072607_278_544 88
349 3300059641 Ga0587068_126083 Ga0587068_126083_243_509 88
350 3300059655 Ga0587114_054034 Ga0587114_054034_279_545 88
351 3300060353 Ga0501082_0055023 Ga0501082_0055023_1957_2223 88
352 3300061734 Ga0530510_0028513 Ga0530510_0028513_2125_2391 88
353 3300003163 Ga0006759J45824_1058806 Ga0006759J45824_10588062 89
354 3300003300 Ga0006758J48902_1012343 Ga0006758J48902_10123432 89
355 3300003320 rootH2_10099991 rootH2_100999914 89
356 3300003856 Ga0058692_1001828 Ga0058692_10018284 89
357 3300003856 Ga0058692_1003718 Ga0058692_10037184 89
358 3300003856 Ga0058692_1007337 Ga0058692_10073372 89
359 3300003856 Ga0058692_1008844 Ga0058692_10088444 89
360 3300004799 Ga0058863_11886113 Ga0058863_118861131 89
361 3300004800 Ga0058861_11616176 Ga0058861_116161761 89
362 3300005289 Ga0065704_10079030 Ga0065704_100790303 89
363 3300005289 Ga0065704_10668912 Ga0065704_106689121 89
364 3300005331 Ga0070670_100000019 Ga0070670_1000000199 89
365 3300005331 Ga0070670_101006352 Ga0070670_1010063521 89
366 3300005331 Ga0070670_101210985 Ga0070670_1012109851 89
367 3300005334 Ga0068869_100209344 Ga0068869_1002093442 89
368 3300005335 Ga0070666_10074462 Ga0070666_100744622 89
369 3300005339 Ga0070660_100809058 Ga0070660_1008090582 89
370 3300005340 Ga0070689_101479796 Ga0070689_1014797961 89
371 3300005340 Ga0070689_101969575 Ga0070689_1019695751 89
372 3300005343 Ga0070687_101205932 Ga0070687_1012059321 89
373 3300005347 Ga0070668_100101690 Ga0070668_1001016902 89
374 3300005353 Ga0070669_100000695 Ga0070669_10000069516 89
375 3300005355 Ga0070671_100000080 Ga0070671_1000000809 89
376 3300005365 Ga0070688_100032517 Ga0070688_1000325172 89
377 3300005366 Ga0070659_100094862 Ga0070659_1000948622 89
378 3300005367 Ga0070667_100000020 Ga0070667_1000000209 89
379 3300005367 Ga0070667_100020021 Ga0070667_1000200211 89
380 3300005434 Ga0070709_10384656 Ga0070709_103846562 89
381 3300005445 Ga0070708_100084158 Ga0070708_1000841583 89
382 3300005445 Ga0070708_100147665 Ga0070708_1001476652 89
383 3300005459 Ga0068867_100147103 Ga0068867_1001471032 89
384 3300005466 Ga0070685_10000015 Ga0070685_10000015113 89
385 3300005467 Ga0070706_100331957 Ga0070706_1003319572 89
386 3300005467 Ga0070706_101731440 Ga0070706_1017314402 89
387 3300005468 Ga0070707_100320586 Ga0070707_1003205862 89
388 3300005468 Ga0070707_100552277 Ga0070707_1005522772 89
389 3300005471 Ga0070698_100588143 Ga0070698_1005881432 89
390 3300005471 Ga0070698_100903659 Ga0070698_1009036592 89
391 3300005518 Ga0070699_100070624 Ga0070699_1000706241 89
392 3300005518 Ga0070699_100804801 Ga0070699_1008048011 89
393 3300005530 Ga0070679_100490261 Ga0070679_1004902612 89
394 3300005535 Ga0070684_101799832 Ga0070684_1017998321 89
395 3300005536 Ga0070697_100360800 Ga0070697_1003608002 89
396 3300005536 Ga0070697_100390845 Ga0070697_1003908452 89
397 3300005539 Ga0068853_101785807 Ga0068853_1017858072 89
398 3300005546 Ga0070696_100277229 Ga0070696_1002772292 89
399 3300005547 Ga0070693_101193623 Ga0070693_1011936231 89
400 3300005548 Ga0070665_100000743 Ga0070665_10000074338 89
401 3300005548 Ga0070665_100010055 Ga0070665_1000100554 89
402 3300005548 Ga0070665_100111083 Ga0070665_1001110832 89
403 3300005548 Ga0070665_101562233 Ga0070665_1015622331 89
404 3300005549 Ga0070704_100199961 Ga0070704_1001999611 89
405 3300005549 Ga0070704_100639706 Ga0070704_1006397062 89
406 3300005564 Ga0070664_100444857 Ga0070664_1004448572 89
407 3300005577 Ga0068857_100000067 Ga0068857_10000006721 89
408 3300005578 Ga0068854_101712014 Ga0068854_1017120142 89
409 3300005615 Ga0070702_101744924 Ga0070702_1017449241 89
410 3300005617 Ga0068859_100063249 Ga0068859_1000632492 89
411 3300005617 Ga0068859_100115845 Ga0068859_1001158452 89
412 3300005617 Ga0068859_101291674 Ga0068859_1012916741 89
413 3300005618 Ga0068864_100000030 Ga0068864_10000003010 89
414 3300005618 Ga0068864_100161442 Ga0068864_1001614422 89
415 3300005718 Ga0068866_10681168 Ga0068866_106811682 89
416 3300005834 Ga0068851_10007777 Ga0068851_100077774 89
417 3300005841 Ga0068863_100050349 Ga0068863_1000503492 89
418 3300005841 Ga0068863_100210302 Ga0068863_1002103022 89
419 3300005842 Ga0068858_100030063 Ga0068858_1000300635 89
420 3300005842 Ga0068858_100534677 Ga0068858_1005346772 89
421 3300005843 Ga0068860_100005350 Ga0068860_1000053502 89
422 3300005843 Ga0068860_100012322 Ga0068860_1000123222 89
423 3300005843 Ga0068860_101296361 Ga0068860_1012963612 89
424 3300005844 Ga0068862_100004594 Ga0068862_1000045944 89
425 3300005844 Ga0068862_100023696 Ga0068862_1000236965 89
426 3300005844 Ga0068862_100899789 Ga0068862_1008997891 89
427 3300005844 Ga0068862_102159059 Ga0068862_1021590592 89
428 3300005937 Ga0081455_10745870 Ga0081455_107458701 89
429 3300006028 Ga0070717_11541774 Ga0070717_115417741 89
430 3300006051 Ga0075364_10592572 Ga0075364_105925721 89
431 3300006163 Ga0070715_10092670 Ga0070715_100926702 89
432 3300006173 Ga0070716_100032327 Ga0070716_1000323273 89
433 3300006173 Ga0070716_100054495 Ga0070716_1000544951 89
434 3300006173 Ga0070716_100947520 Ga0070716_1009475202 89
435 3300006195 Ga0075366_10002842 Ga0075366_100028424 89
436 3300006195 Ga0075366_10623185 Ga0075366_106231851 89
437 3300006237 Ga0097621_100146214 Ga0097621_1001462142 89
438 3300006237 Ga0097621_101403989 Ga0097621_1014039891 89
439 3300006358 Ga0068871_100137733 Ga0068871_1001377332 89
440 3300006358 Ga0068871_100946271 Ga0068871_1009462711 89
441 3300006847 Ga0075431_101461878 Ga0075431_1014618782 89
442 3300006847 Ga0075431_101972585 Ga0075431_1019725851 89
443 3300006852 Ga0075433_10869318 Ga0075433_108693182 89
444 3300006852 Ga0075433_11520870 Ga0075433_115208701 89
445 3300006852 Ga0075433_11829087 Ga0075433_118290871 89
446 3300006871 Ga0075434_100389043 Ga0075434_1003890432 89
447 3300006880 Ga0075429_100041033 Ga0075429_1000410335 89
448 3300006880 Ga0075429_100677979 Ga0075429_1006779791 89
449 3300006881 Ga0068865_101429667 Ga0068865_1014296671 89
450 3300006914 Ga0075436_100019903 Ga0075436_1000199032 89
451 3300006914 Ga0075436_100040846 Ga0075436_1000408463 89
452 3300006914 Ga0075436_100046672 Ga0075436_1000466722 89
453 3300006914 Ga0075436_100199794 Ga0075436_1001997941 89
454 3300006931 Ga0097620_100063253 Ga0097620_1000632532 89
455 3300006931 Ga0097620_100115855 Ga0097620_1001158552 89
456 3300006931 Ga0097620_101291610 Ga0097620_1012916101 89
457 3300006946 Ga0079104_1002525 Ga0079104_10025253 89
458 3300006946 Ga0079104_1005316 Ga0079104_10053164 89
459 3300007076 Ga0075435_101016481 Ga0075435_1010164812 89
460 3300007265 Ga0099794_10068445 Ga0099794_100684452 89
461 3300007265 Ga0099794_10072242 Ga0099794_100722423 89
462 3300007265 Ga0099794_10085643 Ga0099794_100856432 89
463 3300007788 Ga0099795_10304542 Ga0099795_103045422 89
464 3300009011 Ga0105251_10006629 Ga0105251_100066292 89
465 3300009011 Ga0105251_10098795 Ga0105251_100987952 89
466 3300009011 Ga0105251_10123698 Ga0105251_101236982 89
467 3300009036 Ga0105244_10000033 Ga0105244_10000033142 89
468 3300009036 Ga0105244_10001764 Ga0105244_1000176416 89
469 3300009036 Ga0105244_10007310 Ga0105244_100073104 89
470 3300009036 Ga0105244_10019924 Ga0105244_100199243 89
471 3300009036 Ga0105244_10028021 Ga0105244_100280214 89
472 3300009036 Ga0105244_10035931 Ga0105244_100359314 89
473 3300009092 Ga0105250_10000171 Ga0105250_1000017123 89
474 3300009092 Ga0105250_10000367 Ga0105250_1000036732 89
475 3300009092 Ga0105250_10002542 Ga0105250_100025424 89
476 3300009092 Ga0105250_10004133 Ga0105250_100041333 89
477 3300009092 Ga0105250_10015315 Ga0105250_100153154 89
478 3300009147 Ga0114129_10097411 Ga0114129_100974112 89
479 3300009147 Ga0114129_10409703 Ga0114129_104097032 89
480 3300009147 Ga0114129_13015265 Ga0114129_130152651 89
481 3300009148 Ga0105243_10000946 Ga0105243_100009462 89
482 3300009174 Ga0105241_12315424 Ga0105241_123154241 89
483 3300009176 Ga0105242_10119392 Ga0105242_101193922 89
484 3300009176 Ga0105242_10478764 Ga0105242_104787642 89
485 3300009176 Ga0105242_10628096 Ga0105242_106280962 89
486 3300009176 Ga0105242_12191000 Ga0105242_121910002 89
487 3300009177 Ga0105248_10120360 Ga0105248_101203602 89
488 3300009177 Ga0105248_11473311 Ga0105248_114733111 89
489 3300009545 Ga0105237_10342305 Ga0105237_103423052 89
490 3300009545 Ga0105237_11815305 Ga0105237_118153052 89
491 3300009545 Ga0105237_12612570 Ga0105237_126125702 89
492 3300009553 Ga0105249_10036609 Ga0105249_100366092 89
493 3300009553 Ga0105249_10312258 Ga0105249_103122582 89
494 3300009553 Ga0105249_11605073 Ga0105249_116050731 89
495 3300009986 Ga0105033_122519 Ga0105033_1225191 89
496 3300010159 Ga0099796_10084423 Ga0099796_100844232 89
497 3300010375 Ga0105239_10605920 Ga0105239_106059202 89
498 3300010375 Ga0105239_10975641 Ga0105239_109756411 89
499 3300011119 Ga0105246_10247296 Ga0105246_102472962 89
500 3300011119 Ga0105246_10262157 Ga0105246_102621572 89
501 3300011119 Ga0105246_10522491 Ga0105246_105224912 89
502 3300012482 Ga0157318_1012286 Ga0157318_10122862 89
503 3300013100 Ga0157373_10005140 Ga0157373_100051407 89
504 3300013100 Ga0157373_10006277 Ga0157373_100062775 89
505 3300013100 Ga0157373_10096795 Ga0157373_100967952 89
506 3300013102 Ga0157371_10003717 Ga0157371_100037177 89
507 3300013102 Ga0157371_10006288 Ga0157371_100062887 89
508 3300013104 Ga0157370_10040666 Ga0157370_100406662 89
509 3300013105 Ga0157369_10000859 Ga0157369_100008595 89
510 3300013297 Ga0157378_10853802 Ga0157378_108538022 89
511 3300013297 Ga0157378_11302111 Ga0157378_113021111 89
512 3300013297 Ga0157378_11555733 Ga0157378_115557331 89
513 3300013306 Ga0163162_10032762 Ga0163162_100327622 89
514 3300013306 Ga0163162_10079829 Ga0163162_100798292 89
515 3300013307 Ga0157372_10000517 Ga0157372_1000051745 89
516 3300013307 Ga0157372_10005826 Ga0157372_100058265 89
517 3300013307 Ga0157372_10080425 Ga0157372_100804254 89
518 3300013307 Ga0157372_10140182 Ga0157372_101401822 89
519 3300013307 Ga0157372_10519603 Ga0157372_105196032 89
520 3300013307 Ga0157372_11133127 Ga0157372_111331272 89
521 3300013308 Ga0157375_10263011 Ga0157375_102630112 89
522 3300013308 Ga0157375_11288226 Ga0157375_112882261 89
523 3300014968 Ga0157379_10044050 Ga0157379_100440503 89
524 3300014968 Ga0157379_10425968 Ga0157379_104259682 89
525 3300015679 Ga0183366_1002 Ga0183366_1002661 89
526 3300015680 Ga0183370_1002 Ga0183370_1002661 89
527 3300015685 Ga0183369_1002 Ga0183369_1002661 89
528 3300015687 Ga0183368_1005 Ga0183368_1005661 89
529 3300016635 Ga0183361_15145 Ga0183361_151452 89
530 3300017792 Ga0163161_10310264 Ga0163161_103102641 89
531 3300020076 Ga0206355_1691689 Ga0206355_16916891 89
532 3300020077 Ga0206351_10564155 Ga0206351_105641552 89
533 3300021361 Ga0213872_10404087 Ga0213872_104040872 89
534 3300021384 Ga0213876_10000013 Ga0213876_10000013234 89
535 3300022467 Ga0224712_10275353 Ga0224712_102753531 89
536 3300025245 Ga0207425_1004532 Ga0207425_10045323 89
537 3300025258 Ga0209129_1000010 Ga0209129_100001096 89
538 3300025321 Ga0207656_10013864 Ga0207656_100138644 89
539 3300025711 Ga0207696_1000102 Ga0207696_1000102158 89
540 3300025711 Ga0207696_1000137 Ga0207696_100013735 89
541 3300025711 Ga0207696_1000272 Ga0207696_10002723 89
542 3300025711 Ga0207696_1000356 Ga0207696_100035647 89
543 3300025711 Ga0207696_1001421 Ga0207696_10014214 89
544 3300025728 Ga0207655_1000024 Ga0207655_1000024242 89
545 3300025728 Ga0207655_1000065 Ga0207655_1000065118 89
546 3300025728 Ga0207655_1000072 Ga0207655_1000072101 89
547 3300025728 Ga0207655_1000186 Ga0207655_10001863 89
548 3300025728 Ga0207655_1014327 Ga0207655_10143272 89
549 3300025728 Ga0207655_1016739 Ga0207655_10167393 89
550 3300025728 Ga0207655_1023983 Ga0207655_10239833 89
551 3300025735 Ga0207713_1000019 Ga0207713_1000019109 89
552 3300025735 Ga0207713_1000157 Ga0207713_10001572 89
553 3300025735 Ga0207713_1000300 Ga0207713_10003002 89
554 3300025735 Ga0207713_1003240 Ga0207713_10032408 89
555 3300025735 Ga0207713_1004405 Ga0207713_10044055 89
556 3300025735 Ga0207713_1093261 Ga0207713_10932612 89
557 3300025900 Ga0207710_10056669 Ga0207710_100566692 89
558 3300025903 Ga0207680_10016832 Ga0207680_100168324 89
559 3300025905 Ga0207685_10114787 Ga0207685_101147872 89
560 3300025906 Ga0207699_10882658 Ga0207699_108826581 89
561 3300025910 Ga0207684_10443962 Ga0207684_104439621 89
562 3300025910 Ga0207684_11413695 Ga0207684_114136951 89
563 3300025913 Ga0207695_10164440 Ga0207695_101644403 89
564 3300025918 Ga0207662_10926657 Ga0207662_109266571 89
565 3300025920 Ga0207649_10462963 Ga0207649_104629631 89
566 3300025922 Ga0207646_10124778 Ga0207646_101247782 89
567 3300025922 Ga0207646_10427501 Ga0207646_104275012 89
568 3300025923 Ga0207681_10001475 Ga0207681_100014758 89
569 3300025925 Ga0207650_10000034 Ga0207650_10000034207 89
570 3300025925 Ga0207650_11601334 Ga0207650_116013341 89
571 3300025931 Ga0207644_10000554 Ga0207644_100005548 89
572 3300025934 Ga0207686_10146215 Ga0207686_101462152 89
573 3300025934 Ga0207686_10219613 Ga0207686_102196132 89
574 3300025934 Ga0207686_11681316 Ga0207686_116813161 89
575 3300025935 Ga0207709_10004416 Ga0207709_100044166 89
576 3300025935 Ga0207709_10028321 Ga0207709_100283214 89
577 3300025936 Ga0207670_10297155 Ga0207670_102971552 89
578 3300025939 Ga0207665_10013281 Ga0207665_100132816 89
579 3300025939 Ga0207665_10048624 Ga0207665_100486243 89
580 3300025939 Ga0207665_11214242 Ga0207665_112142421 89
581 3300025941 Ga0207711_10001883 Ga0207711_100018834 89
582 3300025941 Ga0207711_10147279 Ga0207711_101472792 89
583 3300025942 Ga0207689_10291749 Ga0207689_102917492 89
584 3300025942 Ga0207689_10714172 Ga0207689_107141722 89
585 3300025945 Ga0207679_10665972 Ga0207679_106659721 89
586 3300025961 Ga0207712_10073913 Ga0207712_100739132 89
587 3300025961 Ga0207712_10172929 Ga0207712_101729292 89
588 3300025961 Ga0207712_10445966 Ga0207712_104459661 89
589 3300025961 Ga0207712_11369293 Ga0207712_113692932 89
590 3300025972 Ga0207668_10079704 Ga0207668_100797042 89
591 3300025981 Ga0207640_11814113 Ga0207640_118141131 89
592 3300025986 Ga0207658_10000015 Ga0207658_10000015207 89
593 3300025986 Ga0207658_10089130 Ga0207658_100891302 89
594 3300026035 Ga0207703_10019954 Ga0207703_100199542 89
595 3300026088 Ga0207641_10013032 Ga0207641_100130325 89
596 3300026088 Ga0207641_10212145 Ga0207641_102121452 89
597 3300026088 Ga0207641_10631733 Ga0207641_106317332 89
598 3300026089 Ga0207648_10066218 Ga0207648_100662182 89
599 3300026095 Ga0207676_10000032 Ga0207676_10000032207 89
600 3300026095 Ga0207676_10045203 Ga0207676_100452032 89
601 3300026095 Ga0207676_10173247 Ga0207676_101732473 89
602 3300026116 Ga0207674_10001008 Ga0207674_1000100817 89
603 3300026142 Ga0207698_10665837 Ga0207698_106658372 89
604 3300027111 Ga0209281_1000025 Ga0209281_1000025112 89
605 3300027111 Ga0209281_1000089 Ga0209281_100008920 89
606 3300027111 Ga0209281_1000279 Ga0209281_10002793 89
607 3300027111 Ga0209281_1000369 Ga0209281_100036971 89
608 3300027111 Ga0209281_1000559 Ga0209281_10005595 89
609 3300027111 Ga0209281_1003542 Ga0209281_10035424 89
610 3300027252 Ga0209973_1085902 Ga0209973_10859021 89
611 3300027312 Ga0209371_1000013 Ga0209371_1000013564 89
612 3300027312 Ga0209371_1000019 Ga0209371_1000019447 89
613 3300027312 Ga0209371_1000149 Ga0209371_100014933 89
614 3300027312 Ga0209371_1000346 Ga0209371_10003463 89
615 3300027312 Ga0209371_1000430 Ga0209371_100043031 89
616 3300027312 Ga0209371_1000649 Ga0209371_100064924 89
617 3300027312 Ga0209371_1000701 Ga0209371_10007012 89
618 3300027312 Ga0209371_1001333 Ga0209371_10013334 89
619 3300027312 Ga0209371_1005086 Ga0209371_10050862 89
620 3300027312 Ga0209371_1005550 Ga0209371_10055504 89
621 3300027312 Ga0209371_1007231 Ga0209371_10072313 89
622 3300027312 Ga0209371_1027476 Ga0209371_10274761 89
623 3300027360 Ga0209969_1011685 Ga0209969_10116852 89
624 3300027364 Ga0209967_1004221 Ga0209967_10042212 89
625 3300027364 Ga0209967_1006222 Ga0209967_10062222 89
626 3300027378 Ga0209981_1034326 Ga0209981_10343262 89
627 3300027462 Ga0210000_1014047 Ga0210000_10140472 89
628 3300027462 Ga0210000_1073563 Ga0210000_10735631 89
629 3300027471 Ga0209995_1082834 Ga0209995_10828341 89
630 3300027512 Ga0209179_1031179 Ga0209179_10311792 89
631 3300027543 Ga0209999_1038460 Ga0209999_10384602 89
632 3300027543 Ga0209999_1043159 Ga0209999_10431591 89
633 3300027617 Ga0210002_1051324 Ga0210002_10513241 89
634 3300027665 Ga0209983_1051643 Ga0209983_10516432 89
635 3300027671 Ga0209588_1069503 Ga0209588_10695032 89
636 3300027671 Ga0209588_1118027 Ga0209588_11180272 89
637 3300027671 Ga0209588_1123610 Ga0209588_11236101 89
638 3300027682 Ga0209971_1006049 Ga0209971_10060495 89
639 3300027695 Ga0209966_1157507 Ga0209966_11575072 89
640 3300027717 Ga0209998_10102751 Ga0209998_101027512 89
641 3300027876 Ga0209974_10002074 Ga0209974_100020748 89
642 3300027876 Ga0209974_10285719 Ga0209974_102857192 89
643 3300028379 Ga0268266_10000142 Ga0268266_1000014234 89
644 3300028379 Ga0268266_10013140 Ga0268266_100131403 89
645 3300028379 Ga0268266_11913141 Ga0268266_119131411 89
646 3300028380 Ga0268265_10003694 Ga0268265_100036946 89
647 3300028380 Ga0268265_10178350 Ga0268265_101783502 89
648 3300028380 Ga0268265_10975089 Ga0268265_109750892 89
649 3300028380 Ga0268265_11122145 Ga0268265_111221452 89
650 3300028381 Ga0268264_10000009 Ga0268264_10000009651 89
651 3300028381 Ga0268264_10200304 Ga0268264_102003042 89
652 3300030500 Ga0268256_1000014 Ga0268256_1000014114 89
653 3300030500 Ga0268256_1000024 Ga0268256_100002478 89
654 3300030500 Ga0268256_1000293 Ga0268256_10002933 89
655 3300030500 Ga0268256_1000868 Ga0268256_10008683 89
656 3300030500 Ga0268256_1002881 Ga0268256_10028814 89
657 3300030500 Ga0268256_1004055 Ga0268256_10040553 89
658 3300030500 Ga0268256_1004909 Ga0268256_10049092 89
659 3300030500 Ga0268256_1004912 Ga0268256_10049124 89
660 3300030500 Ga0268256_1005247 Ga0268256_10052474 89
661 3300030500 Ga0268256_1007258 Ga0268256_10072583 89
662 3300030500 Ga0268256_1021783 Ga0268256_10217831 89
663 3300030500 Ga0268256_1031248 Ga0268256_10312482 89
664 3300031238 Ga0265332_10002686 Ga0265332_100026863 89
665 3300031251 Ga0265327_10126045 Ga0265327_101260452 89
666 3300031548 Ga0307408_100047310 Ga0307408_1000473102 89
667 3300031595 Ga0265313_10311083 Ga0265313_103110832 89
668 3300031665 Ga0316575_10000197 Ga0316575_1000019720 89
669 3300031691 Ga0316579_10407697 Ga0316579_104076971 89
670 3300031727 Ga0316576_10063914 Ga0316576_100639142 89
671 3300031727 Ga0316576_10147785 Ga0316576_101477852 89
672 3300031731 Ga0307405_11107526 Ga0307405_111075261 89
673 3300031901 Ga0307406_11276624 Ga0307406_112766241 89
674 3300031911 Ga0307412_10131597 Ga0307412_101315972 89
675 3300031911 Ga0307412_11417406 Ga0307412_114174061 89
676 3300031995 Ga0307409_100361700 Ga0307409_1003617002 89
677 3300031995 Ga0307409_101487959 Ga0307409_1014879592 89
678 3300032002 Ga0307416_100916550 Ga0307416_1009165501 89
679 3300032005 Ga0307411_10384953 Ga0307411_103849532 89
680 3300032126 Ga0307415_100583389 Ga0307415_1005833892 89
681 3300032168 Ga0316593_10004458 Ga0316593_100044584 89
682 3300032168 Ga0316593_10006857 Ga0316593_100068572 89
683 3300032168 Ga0316593_10101388 Ga0316593_101013882 89
684 3300033527 Ga0316586_1112115 Ga0316586_11121151 89
685 3300033528 Ga0316588_1170524 Ga0316588_11705241 89
686 3300033529 Ga0316587_1080659 Ga0316587_10806592 89
687 3300033529 Ga0316587_1127523 Ga0316587_11275231 89
688 3300033541 Ga0316596_1132804 Ga0316596_11328041 89
689 3300033541 Ga0316596_1241947 Ga0316596_12419471 89
690 3300035083 Ga0373926_0142250 Ga0373926_0142250_73_342 89
691 3300035086 Ga0373934_0001761 Ga0373934_0001761_1499_1768 89
692 3300035086 Ga0373934_0001842 Ga0373934_0001842_4089_4358 89
693 3300035111 Ga0373923_0234769 Ga0373923_0234769_568_837 89
694 3300035115 Ga0373941_0479960 Ga0373941_0479960_48_317 89
695 3300035116 Ga0373945_0011097 Ga0373945_0011097_1651_1920 89
696 3300035117 Ga0373953_0039043 Ga0373953_0039043_1115_1384 89
697 3300035117 Ga0373953_0045113 Ga0373953_0045113_184_453 89
698 3300035118 Ga0373954_0003250 Ga0373954_0003250_6523_6792 89
699 3300035118 Ga0373954_0006306 Ga0373954_0006306_4292_4561 89
700 3300035118 Ga0373954_0119326 Ga0373954_0119326_31_300 89
701 3300035119 Ga0373956_0000012 Ga0373956_0000012_53966_54235 89
702 3300035120 Ga0373957_0004992 Ga0373957_0004992_1709_1978 89
703 3300035120 Ga0373957_0075454 Ga0373957_0075454_256_525 89
704 3300035120 Ga0373957_0481802 Ga0373957_0481802_210_479 89
705 3300035171 Ga0373946_0020618 Ga0373946_0020618_699_968 89
706 3300035172 Ga0373955_0022269 Ga0373955_0022269_1032_1301 89
707 3300035172 Ga0373955_0300230 Ga0373955_0300230_651_920 89
708 3300035172 Ga0373955_0306801 Ga0373955_0306801_19_288 89
709 3300035410 Ga0373924_0005709 Ga0373924_0005709_1488_1757 89
710 3300035691 Ga0373931_0274859 Ga0373931_0274859_60_329 89
711 3300035692 Ga0373935_0007523 Ga0373935_0007523_5064_5333 89
712 3300035695 Ga0373927_0040170 Ga0373927_0040170_1661_1930 89
713 3300035724 Ga0373933_0000489 Ga0373933_0000489_3050_3319 89
714 3300035724 Ga0373933_0285071 Ga0373933_0285071_138_407 89
715 3300035725 Ga0373947_0490721 Ga0373947_0490721_479_748 89
716 3300036401 Ga0373937_0001078 Ga0373937_0001078_2247_2516 89
717 3300036401 Ga0373937_0110119 Ga0373937_0110119_1076_1345 89
718 3300036401 Ga0373937_0226604 Ga0373937_0226604_202_471 89
719 3300036647 Ga0316582_0110901 Ga0316582_0110901_301_570 89
720 3300036647 Ga0316582_0290448 Ga0316582_0290448_761_1030 89
721 3300036712 Ga0316584_0685043 Ga0316584_0685043_348_617 89
722 3300037068 Ga0373925_0007488 Ga0373925_0007488_2836_3105 89
723 3300037312 Ga0395899_0071185 Ga0395899_0071185_2225_2494 89
724 3300037312 Ga0395899_0222985 Ga0395899_0222985_977_1246 89
725 3300037312 Ga0395899_0708613 Ga0395899_0708613_310_579 89
726 3300037418 Ga0395900_0052173 Ga0395900_0052173_1816_2085 89
727 3300037418 Ga0395900_0200350 Ga0395900_0200350_887_1156 89
728 3300037418 Ga0395900_1047588 Ga0395900_1047588_50_319 89
729 3300037466 Ga0395898_0081015 Ga0395898_0081015_2745_3014 89
730 3300037466 Ga0395898_0150819 Ga0395898_0150819_998_1267 89
731 3300037471 Ga0395905_0037515 Ga0395905_0037515_3280_3549 89
732 3300037471 Ga0395905_0746529 Ga0395905_0746529_12_293 89
733 3300037471 Ga0395905_1011183 Ga0395905_1011183_145_414 89
734 3300038443 Ga0395901_0123522 Ga0395901_0123522_1253_1522 89
735 3300038443 Ga0395901_0348549 Ga0395901_0348549_1087_1356 89
736 3300038726 Ga0400490_06112 Ga0400490_06112_2291_2560 89
737 3300038996 Ga0242420_090756 Ga0242420_090756_154_423 89
738 3300039062 Ga0400483_215647 Ga0400483_215647_634_903 89
739 3300039437 Ga0436365_0315664 Ga0436365_0315664_98_373 89
740 3300039437 Ga0436365_0471682 Ga0436365_0471682_98920_99189 89
741 3300039438 Ga0436360_0425236 Ga0436360_0425236_929_1198 89
742 3300039438 Ga0436360_1083522 Ga0436360_1083522_203_472 89
743 3300039447 Ga0436361_1050827 Ga0436361_1050827_1020_1289 89
744 3300039450 Ga0436363_1096406 Ga0436363_1096406_187_456 89
745 3300041405 Ga0439438_000003 Ga0439438_000003_359353_359622 89
746 3300041405 Ga0439438_001217 Ga0439438_001217_10046_10315 89
747 3300041405 Ga0439438_002463 Ga0439438_002463_6548_6817 89
748 3300041407 Ga0439447_001374 Ga0439447_001374_1401_1670 89
749 3300041407 Ga0439447_006949 Ga0439447_006949_2557_2826 89
750 3300041486 Ga0451807_1802159 Ga0451807_1802159_130_405 89
751 3300041507 Ga0451851_0983120 Ga0451851_0983120_202_471 89
752 3300041512 Ga0451853_2078609 Ga0451853_2078609_1435_1704 89
753 3300042006 Ga0439432_010449 Ga0439432_010449_1915_2184 89
754 3300042006 Ga0439432_013582 Ga0439432_013582_405_674 89
755 3300042006 Ga0439432_153023 Ga0439432_153023_317_586 89
756 3300042006 Ga0439432_218898 Ga0439432_218898_250_519 89
757 3300042010 Ga0439452_000006 Ga0439452_000006_13205_13474 89
758 3300042010 Ga0439452_000011 Ga0439452_000011_124672_124941 89
759 3300042010 Ga0439452_004096 Ga0439452_004096_2543_2812 89
760 3300042439 Ga0439464_0007335 Ga0439464_0007335_2136_2405 89
761 3300042876 Ga0451577_0032270 Ga0451577_0032270_4331_4612 89
762 3300042876 Ga0451577_0161487 Ga0451577_0161487_1027_1296 89
763 3300044658 Ga0466972_0522066 Ga0466972_0522066_206_475 89
764 3300044673 Ga0453683_0687554 Ga0453683_0687554_321_590 89
765 3300044694 Ga0466963_0516298 Ga0466963_0516298_11_280 89
766 3300044712 Ga0453684_0072303 Ga0453684_0072303_961_1230 89
767 3300044712 Ga0453684_0374116 Ga0453684_0374116_765_1034 89
768 3300045051 Ga0451576_0007360 Ga0451576_0007360_12677_12946 89
769 3300045976 Ga0466967_0328006 Ga0466967_0328006_707_976 89
770 3300046452 Ga0495617_066705 Ga0495617_066705_494_763 89
771 3300046454 Ga0495592_0014092 Ga0495592_0014092_2943_3212 89
772 3300046454 Ga0495592_0017267 Ga0495592_0017267_313_582 89
773 3300046454 Ga0495592_0116005 Ga0495592_0116005_497_766 89
774 3300046454 Ga0495592_0708128 Ga0495592_0708128_306_575 89
775 3300046455 Ga0495603_0744530 Ga0495603_0744530_35_304 89
776 3300046458 Ga0495591_000010 Ga0495591_000010_287103_287372 89
777 3300046458 Ga0495591_000411 Ga0495591_000411_33176_33445 89
778 3300046458 Ga0495591_000777 Ga0495591_000777_16208_16477 89
779 3300046458 Ga0495591_013135 Ga0495591_013135_2075_2344 89
780 3300046459 Ga0495629_0098574 Ga0495629_0098574_471_740 89
781 3300046460 Ga0495638_0080060 Ga0495638_0080060_1166_1435 89
782 3300046461 Ga0495641_0042009 Ga0495641_0042009_1539_1808 89
783 3300046462 Ga0495651_0000085 Ga0495651_0000085_21541_21810 89
784 3300046462 Ga0495651_0014818 Ga0495651_0014818_3670_3939 89
785 3300046463 Ga0495653_0010312 Ga0495653_0010312_6576_6845 89
786 3300046463 Ga0495653_0427184 Ga0495653_0427184_436_705 89
787 3300046463 Ga0495653_0805546 Ga0495653_0805546_119_388 89
788 3300046471 Ga0495650_0000008 Ga0495650_0000008_94354_94623 89
789 3300046471 Ga0495650_0000040 Ga0495650_0000040_118286_118555 89
790 3300046471 Ga0495650_0045630 Ga0495650_0045630_867_1136 89
791 3300046473 Ga0495582_0043522 Ga0495582_0043522_1503_1772 89
792 3300046474 Ga0495605_0032390 Ga0495605_0032390_2241_2510 89
793 3300046475 Ga0495639_0001499 Ga0495639_0001499_465_734 89
794 3300046476 Ga0495662_0041525 Ga0495662_0041525_1161_1430 89
795 3300046477 Ga0495664_0004079 Ga0495664_0004079_7369_7638 89
796 3300046491 Ga0495584_0000811 Ga0495584_0000811_12594_12863 89
797 3300046499 Ga0495594_0037887 Ga0495594_0037887_459_728 89
798 3300046501 Ga0495607_0010549 Ga0495607_0010549_5328_5597 89
799 3300046507 Ga0495606_0000966 Ga0495606_0000966_36638_36907 89
800 3300046511 Ga0495608_0008762 Ga0495608_0008762_5655_5924 89
801 3300046511 Ga0495608_0315308 Ga0495608_0315308_323_592 89
802 3300046513 Ga0495616_0041166 Ga0495616_0041166_55_324 89
803 3300046513 Ga0495616_0166109 Ga0495616_0166109_128_397 89
804 3300046514 Ga0495618_0011792 Ga0495618_0011792_217_486 89
805 3300046515 Ga0495620_0022016 Ga0495620_0022016_2124_2393 89
806 3300046516 Ga0495628_0010586 Ga0495628_0010586_5242_5511 89
807 3300046516 Ga0495628_0027653 Ga0495628_0027653_2474_2743 89
808 3300046516 Ga0495628_0031313 Ga0495628_0031313_1812_2081 89
809 3300046516 Ga0495628_0390873 Ga0495628_0390873_203_472 89
810 3300046517 Ga0495630_0001044 Ga0495630_0001044_6172_6441 89
811 3300046517 Ga0495630_0077499 Ga0495630_0077499_1295_1564 89
812 3300046522 Ga0495643_0271986 Ga0495643_0271986_498_767 89
813 3300046523 Ga0495644_0010576 Ga0495644_0010576_2276_2545 89
814 3300046524 Ga0495648_0002943 Ga0495648_0002943_7482_7751 89
815 3300046526 Ga0495666_0007265 Ga0495666_0007265_3898_4167 89
816 3300046529 Ga0495652_0019967 Ga0495652_0019967_2953_3222 89
817 3300046529 Ga0495652_0218806 Ga0495652_0218806_28_297 89
818 3300046529 Ga0495652_0268818 Ga0495652_0268818_665_934 89
819 3300046530 Ga0495654_0000031 Ga0495654_0000031_165798_166067 89
820 3300046530 Ga0495654_0000089 Ga0495654_0000089_8093_8362 89
821 3300046533 Ga0495640_0029552 Ga0495640_0029552_2391_2660 89
822 3300046533 Ga0495640_0286804 Ga0495640_0286804_571_840 89
823 3300046535 Ga0495586_0012489 Ga0495586_0012489_4148_4417 89
824 3300046536 Ga0495587_0004041 Ga0495587_0004041_4540_4809 89
825 3300046542 Ga0495597_0004073 Ga0495597_0004073_2166_2435 89
826 3300046543 Ga0495645_0014068 Ga0495645_0014068_288_557 89
827 3300046543 Ga0495645_0114980 Ga0495645_0114980_540_809 89
828 3300046557 Ga0495622_0151327 Ga0495622_0151327_459_728 89
829 3300046559 Ga0495667_0064631 Ga0495667_0064631_1399_1668 89
830 3300046559 Ga0495667_0106079 Ga0495667_0106079_15_284 89
831 3300046559 Ga0495667_0299619 Ga0495667_0299619_661_930 89
832 3300046616 Ga0495668_0043831 Ga0495668_0043831_2145_2414 89
833 3300046642 Ga0495634_0242652 Ga0495634_0242652_36_305 89
834 3300046648 Ga0495611_0075933 Ga0495611_0075933_1061_1330 89
835 3300046660 Ga0495625_0016265 Ga0495625_0016265_1854_2123 89
836 3300046663 Ga0495635_0009364 Ga0495635_0009364_5780_6049 89
837 3300046663 Ga0495635_0023162 Ga0495635_0023162_2118_2387 89
838 3300046665 Ga0495661_0514755 Ga0495661_0514755_145_414 89
839 3300046674 Ga0495588_0033862 Ga0495588_0033862_1392_1661 89
840 3300046675 Ga0495657_0004414 Ga0495657_0004414_8789_9058 89
841 3300046675 Ga0495657_0044070 Ga0495657_0044070_1480_1749 89
842 3300046675 Ga0495657_0170064 Ga0495657_0170064_295_564 89
843 3300046678 Ga0495599_0005051 Ga0495599_0005051_1601_1870 89
844 3300046678 Ga0495599_0015150 Ga0495599_0015150_1534_1803 89
845 3300046678 Ga0495599_0101320 Ga0495599_0101320_45_314 89
846 3300046679 Ga0495623_0627986 Ga0495623_0627986_103_372 89
847 3300046681 Ga0495647_0419455 Ga0495647_0419455_35_304 89
848 3300046683 Ga0495658_0015072 Ga0495658_0015072_2429_2698 89
849 3300046689 Ga0495613_0548915 Ga0495613_0548915_185_454 89
850 3300046690 Ga0495624_0291624 Ga0495624_0291624_336_605 89
851 3300046692 Ga0495671_0001988 Ga0495671_0001988_858_1127 89
852 3300046694 Ga0495649_0043412 Ga0495649_0043412_903_1172 89
853 3300046694 Ga0495649_0055527 Ga0495649_0055527_1163_1432 89
854 3300046794 Ga0495589_0041517 Ga0495589_0041517_1254_1523 89
855 3300046809 Ga0495600_0018687 Ga0495600_0018687_4011_4280 89
856 3300046810 Ga0495660_0000184 Ga0495660_0000184_64874_65143 89
857 3300047315 Ga0495581_0613341 Ga0495581_0613341_300_569 89
858 3300047317 Ga0495604_0028106 Ga0495604_0028106_3567_3836 89
859 3300047318 Ga0495636_0272095 Ga0495636_0272095_156_425 89
860 3300047319 Ga0495674_0010947 Ga0495674_0010947_4540_4809 89
861 3300047319 Ga0495674_0193637 Ga0495674_0193637_1364_1633 89
862 3300047320 Ga0495672_0000003 Ga0495672_0000003_634138_634407 89
863 3300047320 Ga0495672_0000082 Ga0495672_0000082_94595_94864 89
864 3300047322 Ga0495680_0252804 Ga0495680_0252804_904_1173 89
865 3300047322 Ga0495680_0796429 Ga0495680_0796429_36_305 89
866 3300047322 Ga0495680_0959366 Ga0495680_0959366_103_372 89
867 3300047444 Ga0495675_0003667 Ga0495675_0003667_1288_1557 89
868 3300047444 Ga0495675_0405458 Ga0495675_0405458_267_536 89
869 3300047446 Ga0495679_000059 Ga0495679_000059_95889_96158 89
870 3300047446 Ga0495679_034458 Ga0495679_034458_1055_1324 89
871 3300047446 Ga0495679_094751 Ga0495679_094751_95_364 89
872 3300047469 Ga0495673_0000011 Ga0495673_0000011_94618_94887 89
873 3300047469 Ga0495673_0000117 Ga0495673_0000117_118772_119041 89
874 3300047470 Ga0495681_0050350 Ga0495681_0050350_900_1169 89
875 3300047471 Ga0495684_0025150 Ga0495684_0025150_571_840 89
876 3300047673 Ga0495593_0080675 Ga0495593_0080675_98_367 89
877 3300048088 Ga0495602_0054829 Ga0495602_0054829_1188_1457 89
878 3300048088 Ga0495602_0388662 Ga0495602_0388662_489_758 89
879 3300048903 Ga0496100_0159656 Ga0496100_0159656_862_1131 89
880 3300048904 Ga0496101_0000144 Ga0496101_0000144_62180_62449 89
881 3300048904 Ga0496101_0106694 Ga0496101_0106694_67_336 89
882 3300048907 Ga0496104_0188756 Ga0496104_0188756_560_829 89
883 3300048913 Ga0496110_0480424 Ga0496110_0480424_850_1119 89
884 3300048916 Ga0496113_0978838 Ga0496113_0978838_20_289 89
885 3300048917 Ga0496114_0844450 Ga0496114_0844450_123_392 89
886 3300048919 Ga0496116_0008711 Ga0496116_0008711_3511_3780 89
887 3300048919 Ga0496116_0030592 Ga0496116_0030592_3266_3535 89
888 3300048919 Ga0496116_0123723 Ga0496116_0123723_1052_1321 89
889 3300048920 Ga0496117_0074056 Ga0496117_0074056_336_605 89
890 3300048920 Ga0496117_0192360 Ga0496117_0192360_695_964 89
891 3300048920 Ga0496117_0220973 Ga0496117_0220973_610_879 89
892 3300048921 Ga0496118_0086857 Ga0496118_0086857_1185_1454 89
893 3300048921 Ga0496118_0105054 Ga0496118_0105054_364_633 89
894 3300048921 Ga0496118_0167214 Ga0496118_0167214_884_1153 89
895 3300048921 Ga0496118_0182307 Ga0496118_0182307_118_387 89
896 3300048922 Ga0496119_0000096 Ga0496119_0000096_96152_96421 89
897 3300048922 Ga0496119_0043543 Ga0496119_0043543_1853_2122 89
898 3300048922 Ga0496119_0141017 Ga0496119_0141017_209_478 89
899 3300048923 Ga0496120_0000068 Ga0496120_0000068_36180_36449 89
900 3300048923 Ga0496120_0001484 Ga0496120_0001484_6501_6770 89
901 3300048923 Ga0496120_0012013 Ga0496120_0012013_1853_2122 89
902 3300048923 Ga0496120_0037924 Ga0496120_0037924_1788_2057 89
903 3300048925 Ga0496122_0015833 Ga0496122_0015833_2533_2802 89
904 3300048925 Ga0496122_0036749 Ga0496122_0036749_1909_2178 89
905 3300048925 Ga0496122_0041854 Ga0496122_0041854_2087_2356 89
906 3300048925 Ga0496122_0091384 Ga0496122_0091384_448_717 89
907 3300048925 Ga0496122_0106151 Ga0496122_0106151_1359_1628 89
908 3300048925 Ga0496122_0110038 Ga0496122_0110038_1068_1337 89
909 3300048926 Ga0496123_0000017 Ga0496123_0000017_42697_42966 89
910 3300048926 Ga0496123_0003747 Ga0496123_0003747_3047_3316 89
911 3300048926 Ga0496123_0003886 Ga0496123_0003886_13381_13650 89
912 3300048926 Ga0496123_0047025 Ga0496123_0047025_1858_2127 89
913 3300048926 Ga0496123_0081909 Ga0496123_0081909_820_1089 89
914 3300048927 Ga0496124_0002686 Ga0496124_0002686_2144_2413 89
915 3300048927 Ga0496124_0007846 Ga0496124_0007846_7885_8154 89
916 3300048927 Ga0496124_0014571 Ga0496124_0014571_3044_3313 89
917 3300048927 Ga0496124_0112980 Ga0496124_0112980_552_821 89
918 3300048927 Ga0496124_0129821 Ga0496124_0129821_1614_1883 89
919 3300048927 Ga0496124_0132795 Ga0496124_0132795_197_466 89
920 3300048927 Ga0496124_0426659 Ga0496124_0426659_313_582 89
921 3300048928 Ga0496125_0000257 Ga0496125_0000257_91872_92141 89
922 3300048928 Ga0496125_0062599 Ga0496125_0062599_1857_2126 89
923 3300048928 Ga0496125_0378314 Ga0496125_0378314_515_784 89
924 3300048928 Ga0496125_0423078 Ga0496125_0423078_63_332 89
925 3300048929 Ga0496126_0026967 Ga0496126_0026967_982_1251 89
926 3300048929 Ga0496126_0121308 Ga0496126_0121308_419_688 89
927 3300048929 Ga0496126_0223284 Ga0496126_0223284_208_477 89
928 3300048929 Ga0496126_0278353 Ga0496126_0278353_910_1179 89
929 3300048929 Ga0496126_0538184 Ga0496126_0538184_647_916 89
930 3300048929 Ga0496126_0578795 Ga0496126_0578795_37_306 89
931 3300049129 Ga0501309_064336 Ga0501309_064336_307_576 89
932 3300049459 Ga0495678_000142 Ga0495678_000142_2898_3167 89
933 3300049460 Ga0495682_0000034 Ga0495682_0000034_37152_37421 89
934 3300049537 Ga0501321_064068 Ga0501321_064068_234_503 89
935 3300049568 Ga0501031_0834514 Ga0501031_0834514_185_454 89
936 3300049568 Ga0501031_0890105 Ga0501031_0890105_76_345 89
937 3300049572 Ga0501036_0404512 Ga0501036_0404512_28_297 89
938 3300049572 Ga0501036_0790560 Ga0501036_0790560_221_490 89
939 3300049573 Ga0501037_1073158 Ga0501037_1073158_100_369 89
940 3300049574 Ga0501038_1365656 Ga0501038_1365656_127_396 89
941 3300049575 Ga0501039_0730678 Ga0501039_0730678_151_420 89
942 3300049576 Ga0501040_0000689 Ga0501040_0000689_18780_19049 89
943 3300049577 Ga0501041_0081307 Ga0501041_0081307_284_553 89
944 3300049577 Ga0501041_0813086 Ga0501041_0813086_38_307 89
945 3300049577 Ga0501041_0929675 Ga0501041_0929675_86_391 89
946 3300049578 Ga0501042_0001376 Ga0501042_0001376_12486_12755 89
947 3300049578 Ga0501042_0182779 Ga0501042_0182779_1140_1409 89
948 3300049580 Ga0501046_0998607 Ga0501046_0998607_174_443 89
949 3300049582 Ga0501048_0525545 Ga0501048_0525545_40_309 89
950 3300049587 Ga0501071_0279281 Ga0501071_0279281_550_855 89
951 3300049587 Ga0501071_0569203 Ga0501071_0569203_218_487 89
952 3300049587 Ga0501071_0905556 Ga0501071_0905556_151_420 89
953 3300049588 Ga0501072_0185035 Ga0501072_0185035_1023_1328 89
954 3300049588 Ga0501072_0227978 Ga0501072_0227978_1151_1420 89
955 3300049589 Ga0501073_1188386 Ga0501073_1188386_192_461 89
956 3300049590 Ga0501074_0189973 Ga0501074_0189973_200_505 89
957 3300049591 Ga0501075_1358960 Ga0501075_1358960_99_368 89
958 3300049592 Ga0501076_0142777 Ga0501076_0142777_541_846 89
959 3300049592 Ga0501076_0373776 Ga0501076_0373776_852_1121 89
960 3300049593 Ga0501077_0152455 Ga0501077_0152455_1025_1294 89
961 3300049593 Ga0501077_0728935 Ga0501077_0728935_245_550 89
962 3300049741 Ga0501079_0441297 Ga0501079_0441297_170_439 89
963 3300049765 Ga0501268_108178 Ga0501268_108178_28_297 89
964 3300049823 Ga0501044_1184625 Ga0501044_1184625_288_557 89
965 3300050491 nmdc:mga00v17_103934_c1 nmdc:mga00v17_103934_c1_655_924 89
966 3300050491 nmdc:mga00v17_428050_c1 nmdc:mga00v17_428050_c1_460_729 89
967 3300050491 nmdc:mga00v17_4898_c1 nmdc:mga00v17_4898_c1_4654_4923 89
968 3300050491 nmdc:mga00v17_7754_c1 nmdc:mga00v17_7754_c1_5446_5715 89
969 3300050493 nmdc:mga0k408_724843_c1 nmdc:mga0k408_724843_c1_94_363 89
970 3300050507 nmdc:mga05p37_333447_c1 nmdc:mga05p37_333447_c1_1440_1709 89
971 3300050508 nmdc:mga09592_364608_c1 nmdc:mga09592_364608_c1_252_521 89
972 3300050510 nmdc:mga06r32_608563_c1 nmdc:mga06r32_608563_c1_462_731 89
973 3300050512 nmdc:mga0n895_172295_c1 nmdc:mga0n895_172295_c1_468_737 89
974 3300050513 nmdc:mga0rr50_903011_c1 nmdc:mga0rr50_903011_c1_23_292 89
975 3300050513 nmdc:mga0rr50_999897_c1 nmdc:mga0rr50_999897_c1_311_580 89
976 3300050514 nmdc:mga08x19_169150_c1 nmdc:mga08x19_169150_c1_1054_1323 89
977 3300050514 nmdc:mga08x19_2213_c1 nmdc:mga08x19_2213_c1_416_685 89
978 3300050514 nmdc:mga08x19_253604_c1 nmdc:mga08x19_253604_c1_82_351 89
979 3300050515 nmdc:mga0a205_1018053_c1 nmdc:mga0a205_1018053_c1_224_493 89
980 3300050515 nmdc:mga0a205_1114950_c1 nmdc:mga0a205_1114950_c1_306_575 89
981 3300050515 nmdc:mga0a205_1436397_c1 nmdc:mga0a205_1436397_c1_178_447 89
982 3300053077 Ga0495601_0030814 Ga0495601_0030814_2952_3221 89
983 3300053077 Ga0495601_0062156 Ga0495601_0062156_1550_1819 89
984 3300053077 Ga0495601_0145275 Ga0495601_0145275_209_478 89
985 3300053077 Ga0495601_0862894 Ga0495601_0862894_162_431 89
986 3300053084 Ga0495595_0005704 Ga0495595_0005704_3665_3934 89
987 3300053085 Ga0495619_0845462 Ga0495619_0845462_36_305 89
988 3300053087 Ga0500643_091563 Ga0500643_091563_288_557 89
989 3300053093 Ga0500651_0331508 Ga0500651_0331508_442_711 89
990 3300053094 Ga0500566_0151491 Ga0500566_0151491_789_1058 89
991 3300053098 Ga0500650_0000042 Ga0500650_0000042_34818_35087 89
992 3300053098 Ga0500650_0169634 Ga0500650_0169634_194_463 89
993 3300053126 Ga0500621_000010 Ga0500621_000010_74975_75244 89
994 3300054114 Ga0501084_0189534 Ga0501084_0189534_216_485 89
995 3300059477 Ga0587084_004200 Ga0587084_004200_267_536 89
996 3300059477 Ga0587084_006709 Ga0587084_006709_176_445 89
997 3300059478 Ga0587093_028911 Ga0587093_028911_359_628 89
998 3300059490 Ga0587066_010059 Ga0587066_010059_181_450 89
999 3300059490 Ga0587066_173776 Ga0587066_173776_130_399 89
1000 3300059491 Ga0587070_048654 Ga0587070_048654_176_445 89
1001 3300059492 Ga0587073_0042409 Ga0587073_0042409_542_811 89
1002 3300059493 Ga0587077_063206 Ga0587077_063206_273_542 89
1003 3300059493 Ga0587077_188075 Ga0587077_188075_188_457 89
1004 3300059503 Ga0587080_019861 Ga0587080_019861_665_934 89
1005 3300059504 Ga0587082_094100 Ga0587082_094100_112_381 89
1006 3300059505 Ga0587083_0101259 Ga0587083_0101259_355_624 89
1007 3300059506 Ga0587085_018762 Ga0587085_018762_186_455 89
1008 3300059507 Ga0587086_018610 Ga0587086_018610_355_624 89
1009 3300059507 Ga0587086_053610 Ga0587086_053610_124_393 89
1010 3300059508 Ga0587088_025139 Ga0587088_025139_187_456 89
1011 3300059510 Ga0587090_031596 Ga0587090_031596_355_624 89
1012 3300059511 Ga0587091_011222 Ga0587091_011222_246_515 89
1013 3300059513 Ga0587094_024100 Ga0587094_024100_191_460 89
1014 3300059604 Ga0587098_062939 Ga0587098_062939_129_398 89
1015 3300059605 Ga0587106_044632 Ga0587106_044632_355_624 89
1016 3300059623 Ga0587101_005837 Ga0587101_005837_848_1117 89
1017 3300059623 Ga0587101_018117 Ga0587101_018117_412_681 89
1018 3300059624 Ga0587109_022371 Ga0587109_022371_255_524 89
1019 3300059624 Ga0587109_060844 Ga0587109_060844_371_640 89
1020 3300059624 Ga0587109_076277 Ga0587109_076277_36_305 89
1021 3300059626 Ga0587115_072543 Ga0587115_072543_119_388 89
1022 3300059627 Ga0587117_008158 Ga0587117_008158_275_544 89
1023 3300059639 Ga0587062_005914 Ga0587062_005914_896_1165 89
1024 3300059639 Ga0587062_106812 Ga0587062_106812_266_535 89
1025 3300059640 Ga0587067_210518 Ga0587067_210518_136_405 89
1026 3300059641 Ga0587068_007153 Ga0587068_007153_267_536 89
1027 3300059641 Ga0587068_007869 Ga0587068_007869_263_532 89
1028 3300059642 Ga0587069_006520 Ga0587069_006520_937_1206 89
1029 3300059643 Ga0587072_053091 Ga0587072_053091_355_624 89
1030 3300059644 Ga0587075_107564 Ga0587075_107564_17_286 89
1031 3300059646 Ga0587078_003122 Ga0587078_003122_267_536 89
1032 3300059647 Ga0587079_096896 Ga0587079_096896_187_456 89
1033 3300059648 Ga0587100_004513 Ga0587100_004513_473_742 89
1034 3300059654 Ga0587110_010347 Ga0587110_010347_294_563 89
1035 3300059656 Ga0587116_06544 Ga0587116_06544_188_457 89
1036 3300060346 Ga0587111_0015439 Ga0587111_0015439_264_533 89
1037 3300060346 Ga0587111_0063890 Ga0587111_0063890_215_484 89
1038 3300060346 Ga0587111_0104283 Ga0587111_0104283_406_675 89
1039 3300060353 Ga0501082_0834776 Ga0501082_0834776_99_368 89
1040 3300061734 Ga0530510_1373887 Ga0530510_1373887_76_345 89

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00312

Ribosomal_S15

Ribosomal protein S15

19

99

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
6th6-assembly1.cif.gz_Aq cryo-em structure of t. kodakarensis 70s ribosome 0.9977 29 74
7zag-assembly1.cif.gz_Q cryo-em structure of a pyrococcus abyssi 30s bound to met-initiator trna,mrna, aif1a and the c-terminal domain of aif5b. 0.9967 29 73
8cdu-assembly1.cif.gz_O rnase r bound to a 30s degradation intermediate (main state) 0.9965 4 88
7qv2-assembly1.cif.gz_o bacillus subtilis collided disome (collided 70s) 0.9955 4 88
7nhn-assembly1.cif.gz_p vgal, an antibiotic resistance abcf, in complex with 70s ribosome from listeria monocytogenes 0.9921 3 88
ID Description Score Start End Superfamily
6g18N02 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;S15/NS1, RNA-binding 0.987 29 73 1.10.287.10
3u5gN02 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;S15/NS1, RNA-binding 0.9828 29 74 1.10.287.10
4bpeO02 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;S15/NS1, RNA-binding 0.9818 29 73 1.10.287.10
5xyiN02 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;S15/NS1, RNA-binding 0.9811 29 73 1.10.287.10
5ll6Y02 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;S15/NS1, RNA-binding 0.9805 29 72 1.10.287.10
ID Description Score Start End GO Terms
AF-A0A2U9SB23-F1-model_v4 Small ribosomal subunit protein uS15 1.003 1 89 GO:0003735
GO:0006412
GO:0019843
GO:0022627
AF-A0A2U1VDM4-F1-model_v4 Small ribosomal subunit protein uS15 1.003 1 89 GO:0003735
GO:0006412
GO:0019843
GO:0022627
AF-A0A1I4HU16-F1-model_v4 Small ribosomal subunit protein uS15 1.002 1 89 GO:0003735
GO:0006412
GO:0019843
GO:0022627
AF-A0A7V2YZ13-F1-model_v4 Small ribosomal subunit protein uS15 1.002 1 89 GO:0003735
GO:0006412
GO:0019843
GO:0022627
AF-A0A0G0LSJ6-F1-model_v4 Small ribosomal subunit protein uS15 1.002 3 88 GO:0003735
GO:0005737
GO:0005840
GO:0006412
GO:0019843
GO:1990904

Feature Viewer

pLDDT pTM Quality
93.07 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map