F488810
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1040 | 569 | 930 | 88 |
Family's Representative Sequence
| Representative Sequence | 3300005549|Ga0070704_100639706|Ga0070704_1006397062 |
| Length | 100 |
| Sequence | MPAFREETNQSMSVSVTEKAQIVQQYQRGAGDTGSPEVQIALLTARINGLTDHFKTHVKDHHSRRGLLKLVSQRRKMLDYLKRKDNGKYHELIEQLGLRK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2547132181 | Kosakonia sacchari SP1 | Isolate | Stem |
| 2 | 2547132416 | Enterobacter sp. MR1 | Isolate | Rhizoplane |
| 3 | 2561511199 | Enterobacter sp. R4-368 | Isolate | Nodule |
| 4 | 2599185169 | Klebsiella quasipneumoniae NFPP35 | Isolate | Rhizoplane |
| 5 | 2600255254 | Klebsiella quasipneumoniae NFIX15 | Isolate | Rhizoplane |
| 6 | 2600255255 | Klebsiella quasipneumoniae NFIX23 | Isolate | Rhizoplane |
| 7 | 2600255256 | Enterobacter sp. NFIX08 | Isolate | Rhizoplane |
| 8 | 2600255257 | Enterobacter sp. NFIX03 | Isolate | Rhizoplane |
| 9 | 2600255280 | Klebsiella quasipneumoniae NFIX42 | Isolate | Rhizoplane |
| 10 | 2600255281 | Klebsiella quasipneumoniae NFIX43 | Isolate | Rhizoplane |
| 11 | 2600255287 | Klebsiella quasipneumoniae NFIX11 | Isolate | Rhizoplane |
| 12 | 2600255288 | Klebsiella quasipneumoniae NFIX14 | Isolate | Rhizoplane |
| 13 | 2600255289 | Klebsiella quasipneumoniae NFIX16 | Isolate | Rhizoplane |
| 14 | 2600255290 | Klebsiella quasipneumoniae NFIX17 | Isolate | Rhizoplane |
| 15 | 2600255291 | Klebsiella quasipneumoniae NFIX19 | Isolate | Rhizoplane |
| 16 | 2600255298 | Klebsiella quasipneumoniae NFIX21 | Isolate | Rhizoplane |
| 17 | 2600255299 | Klebsiella quasipneumoniae NFIX22 | Isolate | Rhizoplane |
| 18 | 2600255300 | Klebsiella quasipneumoniae NFIX30 | Isolate | Rhizoplane |
| 19 | 2600255301 | Klebsiella quasipneumoniae NFIX33 | Isolate | Rhizoplane |
| 20 | 2600255302 | Klebsiella quasipneumoniae NFIX35 | Isolate | Rhizoplane |
| 21 | 2600255303 | Klebsiella quasipneumoniae NFIX36 | Isolate | Rhizoplane |
| 22 | 2600255304 | Klebsiella quasipneumoniae NFIX37 | Isolate | Rhizoplane |
| 23 | 2600255305 | Klebsiella quasipneumoniae NFIX41 | Isolate | Rhizoplane |
| 24 | 2600255306 | Klebsiella quasipneumoniae NFIX44 | Isolate | Rhizoplane |
| 25 | 2600255307 | Klebsiella quasipneumoniae NFIX56 | Isolate | Rhizoplane |
| 26 | 2600255309 | Klebsiella sp. NFIX53 | Isolate | Rhizoplane |
| 27 | 2600255310 | Enterobacter sp. NFIX06 | Isolate | Rhizoplane |
| 28 | 2600255311 | Enterobacter sp. NFIX04 | Isolate | Rhizoplane |
| 29 | 2600255392 | Klebsiella quasipneumoniae NFIX54 | Isolate | Rhizoplane |
| 30 | 2602042046 | Enterobacter sp. NFIX09 | Isolate | Rhizoplane |
| 31 | 2602042047 | Enterobacter sp. NFIX59 | Isolate | Rhizoplane |
| 32 | 2602042052 | Klebsiella quasipneumoniae NFIX18 | Isolate | Rhizoplane |
| 33 | 2602042053 | Klebsiella quasipneumoniae NFIX12 | Isolate | Rhizoplane |
| 34 | 2602042066 | Enterobacter sp. NFIX45 | Isolate | Rhizoplane |
| 35 | 2602042067 | Enterobacter sp. NFIX58 | Isolate | Rhizoplane |
| 36 | 2602042103 | Klebsiella quasipneumoniae NFIX29 | Isolate | Rhizoplane |
| 37 | 2602042104 | Klebsiella quasipneumoniae NFIX26 | Isolate | Rhizoplane |
| 38 | 2602042105 | Klebsiella quasipneumoniae NFIX25 | Isolate | Rhizoplane |
| 39 | 2602042106 | Klebsiella quasipneumoniae NFIX13 | Isolate | Rhizoplane |
| 40 | 2602042109 | Klebsiella aerogenes NFIX39 | Isolate | Rhizoplane |
| 41 | 2602042110 | Klebsiella quasipneumoniae NFIX40 | Isolate | Rhizoplane |
| 42 | 2602042111 | Klebsiella quasipneumoniae NFIX20 | Isolate | Rhizoplane |
| 43 | 2603880178 | Klebsiella quasipneumoniae NFIX34 | Isolate | Rhizoplane |
| 44 | 2603880184 | Klebsiella quasipneumoniae NFIX27 | Isolate | Rhizoplane |
| 45 | 2603880202 | Klebsiella quasipneumoniae NFIX38 | Isolate | Rhizoplane |
| 46 | 2603880211 | Klebsiella quasipneumoniae NFIX24 | Isolate | Rhizoplane |
| 47 | 2609459761 | Enterobacter sp. NFR05 | Isolate | Rhizoplane |
| 48 | 2636415599 | Klebsiella variicola DX120E | Isolate | Unclassified |
| 49 | 2643221541 | Sphingomonas sp. Root50 | Isolate | Unclassified |
| 50 | 2643221606 | Sphingomonas sp. Root720 | Isolate | Unclassified |
| 51 | 2643221671 | Sphingomonas sp. Root1294 | Isolate | Unclassified |
| 52 | 2667528172 | Enterobacteriaceae bacterium NFIX31 | Isolate | Rhizoplane |
| 53 | 2671180115 | Cedecea sp. NFIX57 | Isolate | Rhizoplane |
| 54 | 2675903046 | Klebsiella quasipneumoniae NFIX52 | Isolate | Rhizoplane |
| 55 | 2681812866 | Enterobacter asburiae NFIX55 | Isolate | Rhizoplane |
| 56 | 2681812869 | Enterobacter ludwigii NFPP41 | Isolate | Rhizoplane |
| 57 | 2706794495 | Dickeya zeae ZJU1202 | Isolate | Unclassified |
| 58 | 2711768156 | Atlantibacter hermannii DDE1 | Isolate | Unclassified |
| 59 | 2751185917 | Enterobacter sp. HK169 | Isolate | Unclassified |
| 60 | 2765235842 | Enterobacter ludwigii AA4 | Isolate | Unclassified |
| 61 | 2775506706 | Enterobacter asburiae 1216 | Isolate | Unclassified |
| 62 | 2775507074 | Klebsiella sp. D5A | Isolate | Unclassified |
| 63 | 2791354903 | Mangrovibacter phragmitis MP23 | Isolate | Unclassified |
| 64 | 2791355010 | Kosakonia pseudosacchari NN143 | Isolate | Unclassified |
| 65 | 2791355275 | Enterobacter sp. Sa187 | Isolate | Unclassified |
| 66 | 2811995292 | Kosakonia oryzae Ola 51 | Isolate | Unclassified |
| 67 | 2814123068 | Kosakonia radicincitans GXGL-4A | Isolate | Rhizosphere |
| 68 | 2821118458 | Enterobacter asburiae 609 | Isolate | Unclassified |
| 69 | 2823373977 | Enterobacter ludwigii NCR3 | Isolate | Rhizosphere |
| 70 | 2844425489 | Enterobacter cloacae SBP-8 | Isolate | Rhizosphere |
| 71 | 2846540461 | Photorhabdus luminescens HIM3 | Isolate | Rhizosphere |
| 72 | 2854601825 | Dickeya dianthicola SS70 | Isolate | Stem Tuber |
| 73 | 2855020534 | Paracoccus endophyticus SYSUP0003 | Isolate | Stem Tuber |
| 74 | 2876601092 | Pantoea endophytica 596 | Isolate | Unclassified |
| 75 | 2881714928 | Pseudidiomarina mangrovi ZQ330 | Isolate | Rhizosphere |
| 76 | 2884086401 | Kluyvera sp. PO2S7 | Isolate | Rhizosphere |
| 77 | 2891670763 | Buttiauxella sp. B2 | Isolate | Rhizosphere |
| 78 | 2904513164 | Klebsiella variicola 1431 | Isolate | Rhizosphere |
| 79 | 2919108558 | Klebsiella sp. 1400 | Isolate | Rhizosphere |
| 80 | 2923634449 | Enterobacter kobei SLBN-76 | Isolate | Rhizosphere |
| 81 | 2927833300 | Enterobacter sp. SLBN-59 | Isolate | Rhizosphere |
| 82 | 2935625433 | Kosakonia sp. 1610 | Isolate | Rhizosphere |
| 83 | 2937539931 | Pantoea sp. LS15 | Isolate | Unclassified |
| 84 | 2939568625 | Lelliottia sp. 489 | Isolate | Rhizosphere |
| 85 | 2939573065 | Citrobacter sp. 506 | Isolate | Rhizosphere |
| 86 | 2939602548 | Pantoea dispersa 1175 | Isolate | Rhizosphere |
| 87 | 2939607340 | Leclercia sp. 1548 | Isolate | Rhizosphere |
| 88 | 2939617950 | Kosakonia cowanii 2056 | Isolate | Rhizosphere |
| 89 | 2939642701 | Lelliottia nimipressuralis 2756 | Isolate | Rhizosphere |
| 90 | 2945874760 | Phytobacter diazotrophicus UAEU22 | Isolate | Rhizosphere |
| 91 | 2969079654 | Klebsiella variicola E57-7 | Isolate | Unclassified |
| 92 | 2971820967 | Klebsiella sp. MPUS7 | Isolate | Rhizosphere |
| 93 | 2974310843 | Enterobacter sp. SORGH_AS 287 | Isolate | Unclassified |
| 94 | 2974435778 | Kosakonia cowanii SORGH_AS 304 | Isolate | Unclassified |
| 95 | 2984559226 | Klebsiella variicola SORGH_AS834 | Isolate | Aerial Root |
| 96 | 2984595703 | Klebsiella variicola SORGH_AS1070 | Isolate | Aerial Root |
| 97 | 3000376612 | Enterobacteriaceae bacterium 4M9 | Isolate | Rhizosphere |
| 98 | 3300003163 | Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 99 | 3300003300 | Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_1 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 100 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 101 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 102 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 103 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 104 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 105 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 106 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 107 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 108 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 109 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 110 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 111 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 112 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 113 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 114 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 115 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 116 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 117 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 118 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 119 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 120 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 121 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 122 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 123 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 124 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 125 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 126 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 127 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 128 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 129 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 130 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 131 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 132 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 133 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 134 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 135 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 136 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 137 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 138 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 139 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 140 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 141 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 142 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 143 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 144 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 145 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 146 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 147 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 148 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 149 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 150 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 151 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 152 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 153 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 154 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 155 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 156 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 157 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 158 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 159 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 160 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 161 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 162 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 163 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 164 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 165 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 166 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 167 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 168 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 169 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 170 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 171 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 172 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 174 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 175 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 176 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 177 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 178 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 179 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 180 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 182 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 183 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 184 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 185 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 186 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 187 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 188 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 189 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 191 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 193 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 194 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 195 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 196 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 197 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 198 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 199 | 3300009986 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG | Metagenome | Rhizosphere |
| 200 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 201 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 202 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 203 | 3300012482 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.130510 | Metagenome | Rhizosphere |
| 204 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 205 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 206 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 207 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 208 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 209 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 210 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 211 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 212 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 213 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 214 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 215 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 216 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 217 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 218 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 219 | 3300015679 | Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.4_F08 | Metagenome | Unclassified |
| 220 | 3300015680 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.2_H03 | Metagenome | Rhizosphere |
| 221 | 3300015685 | Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 | Metagenome | Unclassified |
| 222 | 3300015687 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 | Metagenome | Rhizosphere |
| 223 | 3300016635 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 | Metagenome | Rhizosphere |
| 224 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 225 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 226 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 227 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 228 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 229 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 230 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 231 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 232 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 258 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 259 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 260 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 261 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 262 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 263 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 264 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 265 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 266 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 267 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 268 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 269 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 270 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 271 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 272 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 273 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 274 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 275 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 276 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 277 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 278 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 279 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 280 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 281 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 282 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 283 | 3300027252 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 284 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 285 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 286 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 287 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 288 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 289 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 290 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 291 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 292 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 293 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 294 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 295 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 296 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 297 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 298 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 299 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 300 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 301 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 302 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 303 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 304 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 305 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 306 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 307 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 308 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 309 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 310 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 311 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 312 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 313 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 314 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 315 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 316 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 317 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 318 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 319 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 320 | 3300033527 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 321 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 322 | 3300033529 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 323 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 324 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 325 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 326 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 327 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 328 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 329 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 330 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 331 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 332 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 333 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 334 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 335 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 336 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 337 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 338 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 339 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 340 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 341 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 342 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 343 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 344 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 345 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 346 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 347 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 348 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 349 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 350 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 351 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 352 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 353 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 354 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 355 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 356 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 357 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 358 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 359 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 360 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 361 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 362 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 363 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 364 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 365 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 366 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 367 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 368 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 369 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 370 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 371 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 372 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 373 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 374 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 375 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 376 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 422 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 423 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 424 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 425 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 426 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 427 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 428 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 429 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 430 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 431 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 432 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 433 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 434 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 435 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 436 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 437 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 438 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 439 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 440 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 441 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 442 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 443 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 444 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 445 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 446 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 447 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 448 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 449 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 450 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 451 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 452 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 453 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 454 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 455 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 456 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 457 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 458 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 459 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 460 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 461 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 462 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 463 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 464 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 465 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 466 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 467 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 468 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 469 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 470 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 471 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 472 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 473 | 3300049537 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 474 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 475 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 476 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 477 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 478 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 479 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 480 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 481 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 482 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 483 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 484 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 485 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 486 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 487 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 488 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 489 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 490 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 491 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 492 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 493 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 494 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 495 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 496 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 497 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 498 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 499 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 500 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 501 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 502 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 503 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 504 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 505 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 506 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 507 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 508 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 509 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 510 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 511 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 512 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 513 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 514 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 515 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 516 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 517 | 3300053126 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere | Metagenome | Endosphere |
| 518 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 519 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 520 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 521 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 522 | 3300059478 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 523 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 524 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 525 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 526 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 527 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 528 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 529 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 530 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 531 | 3300059507 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 532 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 533 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 534 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 535 | 3300059513 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 536 | 3300059604 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 537 | 3300059605 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 538 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 539 | 3300059624 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 540 | 3300059626 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 541 | 3300059627 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 542 | 3300059639 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 543 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 544 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 545 | 3300059642 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 546 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 547 | 3300059644 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 548 | 3300059646 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 549 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 550 | 3300059648 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 551 | 3300059654 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 148R_CW_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 552 | 3300059655 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 553 | 3300059656 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 153R_AW_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 554 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 555 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 556 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 557 | 8016733728 | Pantoea sp. SORGH_AS 659 | Isolate | Unclassified |
| 558 | 8018221730 | Enterobacter sp. CM29 | Isolate | Unclassified |
| 559 | 8018405270 | Enterobacter sp. 198 | Isolate | Rhizosphere |
| 560 | 8019499862 | Kluyvera sp. 1366 | Isolate | Rhizosphere |
| 561 | 8019504834 | Atlantibacter hermannii 1903 | Isolate | Rhizosphere |
| 562 | 8054357960 | Idiomarina rhizosphaerae M1R2S28 | Isolate | Rhizosphere |
| 563 | 8054844752 | Dryocola boscaweniae H18W14 | Isolate | Rhizosphere |
| 564 | 8054849141 | Dryocola clanedunensis H11S18 | Isolate | Rhizosphere |
| 565 | 8055087960 | Silvania hatchlandensis H19S6 | Isolate | Rhizosphere |
| 566 | 8055092621 | Silvania confinis H4N4 | Isolate | Rhizosphere |
| 567 | 8055097453 | Leclercia tamurae H6W5 | Isolate | Rhizosphere |
| 568 | 8055693939 | Hafnia alvei A23BA | Isolate | Rhizosphere |
| 569 | 8057304971 | Scandinavium manionii H17S15 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 82.69 |
| Metatranscriptomes | 6.73 |
| Isolates | 10.58 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.19 |
| Bulb | 0 |
| Endosphere | 2.12 |
| Nodule | 0.87 |
| Rhizoplane | 6.92 |
| Rhizosphere | 82.12 |
| Stem | 0.1 |
| Stem Tuber | 0.19 |
| Unclassified | 7.5 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0006759J45824_1058806 | 3300003163 | Bacteria | 881 |
| 2 | Ga0006758J48902_1012343 | 3300003300 | Bacteria | 669 |
| 3 | rootH2_10099991 | 3300003320 | Bacteria | 8309 |
| 4 | JGI25407J50210_10014098 | 3300003373 | Bacteria | 2059 |
| 5 | JGI25407J50210_10022505 | 3300003373 | Bacteria | 1638 |
| 6 | Ga0058692_1001828 | 3300003856 | Bacteria | 7486 |
| 7 | Ga0058692_1003718 | 3300003856 | Bacteria | 4654 |
| 8 | Ga0058692_1007337 | 3300003856 | Bacteria | 2935 |
| 9 | Ga0058692_1008844 | 3300003856 | Bacteria | 2580 |
| 10 | Ga0058863_11886113 | 3300004799 | Bacteria | 550 |
| 11 | Ga0058861_11616176 | 3300004800 | Bacteria | 554 |
| 12 | Ga0058861_11934168 | 3300004800 | Bacteria | 537 |
| 13 | Ga0065704_10079030 | 3300005289 | Bacteria | 4270 |
| 14 | Ga0065704_10192621 | 3300005289 | Bacteria | 1182 |
| 15 | Ga0065704_10668912 | 3300005289 | Bacteria | 574 |
| 16 | Ga0065712_10006792 | 3300005290 | Bacteria | 3153 |
| 17 | Ga0065715_10524455 | 3300005293 | Bacteria | 761 |
| 18 | Ga0070670_100000019 | 3300005331 | Bacteria | 215812 |
| 19 | Ga0070670_100994175 | 3300005331 | Bacteria | 763 |
| 20 | Ga0070670_101006352 | 3300005331 | Unclassified | 758 |
| 21 | Ga0070670_101210985 | 3300005331 | Bacteria | 690 |
| 22 | Ga0068869_100209344 | 3300005334 | Bacteria | 1541 |
| 23 | Ga0068869_101922093 | 3300005334 | Bacteria | 530 |
| 24 | Ga0070666_10074462 | 3300005335 | Bacteria | 2314 |
| 25 | Ga0070682_100621414 | 3300005337 | Bacteria | 856 |
| 26 | Ga0068868_100744812 | 3300005338 | Bacteria | 880 |
| 27 | Ga0070660_100809058 | 3300005339 | Bacteria | 788 |
| 28 | Ga0070689_101479796 | 3300005340 | Unclassified | 615 |
| 29 | Ga0070689_101969575 | 3300005340 | Bacteria | 534 |
| 30 | Ga0070691_10115008 | 3300005341 | Bacteria | 1349 |
| 31 | Ga0070687_101072020 | 3300005343 | Bacteria | 588 |
| 32 | Ga0070687_101205932 | 3300005343 | Bacteria | 558 |
| 33 | Ga0070661_100004365 | 3300005344 | Bacteria | 9757 |
| 34 | Ga0070668_100101690 | 3300005347 | Bacteria | 2278 |
| 35 | Ga0070669_100000695 | 3300005353 | Bacteria | 24614 |
| 36 | Ga0070675_101278470 | 3300005354 | Bacteria | 676 |
| 37 | Ga0070671_100000080 | 3300005355 | Bacteria | 60926 |
| 38 | Ga0070674_100005188 | 3300005356 | Bacteria | 7490 |
| 39 | Ga0070688_100032517 | 3300005365 | Bacteria | 3146 |
| 40 | Ga0070659_100094862 | 3300005366 | Bacteria | 2396 |
| 41 | Ga0070659_100162621 | 3300005366 | Bacteria | 1826 |
| 42 | Ga0070659_100675619 | 3300005366 | Bacteria | 892 |
| 43 | Ga0070659_101310826 | 3300005366 | Bacteria | 642 |
| 44 | Ga0070667_100000020 | 3300005367 | Bacteria | 215812 |
| 45 | Ga0070667_100020021 | 3300005367 | Bacteria | 5554 |
| 46 | Ga0070709_10384656 | 3300005434 | Bacteria | 1044 |
| 47 | Ga0070714_100014691 | 3300005435 | Bacteria | 6292 |
| 48 | Ga0070708_100084158 | 3300005445 | Bacteria | 2885 |
| 49 | Ga0070708_100147665 | 3300005445 | Bacteria | 2185 |
| 50 | Ga0070663_100133296 | 3300005455 | Bacteria | 1889 |
| 51 | Ga0070663_100279881 | 3300005455 | Bacteria | 1329 |
| 52 | Ga0070678_101391748 | 3300005456 | Bacteria | 655 |
| 53 | Ga0070662_100810496 | 3300005457 | Bacteria | 796 |
| 54 | Ga0070681_10020737 | 3300005458 | Bacteria | 6583 |
| 55 | Ga0068867_100147103 | 3300005459 | Bacteria | 1847 |
| 56 | Ga0068867_100440284 | 3300005459 | Bacteria | 1108 |
| 57 | Ga0068867_100566459 | 3300005459 | Bacteria | 986 |
| 58 | Ga0070685_10000015 | 3300005466 | Bacteria | 115963 |
| 59 | Ga0070706_100331957 | 3300005467 | Bacteria | 1418 |
| 60 | Ga0070706_101731440 | 3300005467 | Bacteria | 569 |
| 61 | Ga0070707_100320586 | 3300005468 | Bacteria | 1506 |
| 62 | Ga0070707_100552277 | 3300005468 | Bacteria | 1114 |
| 63 | Ga0070698_100588143 | 3300005471 | Unclassified | 1053 |
| 64 | Ga0070698_100903659 | 3300005471 | Bacteria | 829 |
| 65 | Ga0070699_100070624 | 3300005518 | Bacteria | 3036 |
| 66 | Ga0070699_100804801 | 3300005518 | Bacteria | 860 |
| 67 | Ga0070679_100029874 | 3300005530 | Bacteria | 5378 |
| 68 | Ga0070679_100490261 | 3300005530 | Bacteria | 1173 |
| 69 | Ga0070679_100512280 | 3300005530 | Bacteria | 1144 |
| 70 | Ga0070679_100971313 | 3300005530 | Bacteria | 793 |
| 71 | Ga0070684_100010844 | 3300005535 | Bacteria | 7240 |
| 72 | Ga0070684_101799832 | 3300005535 | Unclassified | 578 |
| 73 | Ga0070697_100103411 | 3300005536 | Bacteria | 2368 |
| 74 | Ga0070697_100360800 | 3300005536 | Bacteria | 1256 |
| 75 | Ga0070697_100390845 | 3300005536 | Bacteria | 1206 |
| 76 | Ga0068853_100146357 | 3300005539 | Bacteria | 2123 |
| 77 | Ga0068853_100645924 | 3300005539 | Bacteria | 1007 |
| 78 | Ga0068853_101785807 | 3300005539 | Bacteria | 596 |
| 79 | Ga0070686_100309541 | 3300005544 | Bacteria | 1174 |
| 80 | Ga0070696_100098489 | 3300005546 | Bacteria | 2092 |
| 81 | Ga0070696_100277229 | 3300005546 | Bacteria | 1277 |
| 82 | Ga0070693_100076511 | 3300005547 | Bacteria | 1984 |
| 83 | Ga0070693_101193623 | 3300005547 | Bacteria | 584 |
| 84 | Ga0070665_100000743 | 3300005548 | Bacteria | 43398 |
| 85 | Ga0070665_100010055 | 3300005548 | Bacteria | 9573 |
| 86 | Ga0070665_100111083 | 3300005548 | Bacteria | 2744 |
| 87 | Ga0070665_101562233 | 3300005548 | Bacteria | 668 |
| 88 | Ga0070704_100036945 | 3300005549 | Bacteria | 3332 |
| 89 | Ga0070704_100199961 | 3300005549 | Bacteria | 1612 |
| 90 | Ga0070704_100639706 | 3300005549 | Bacteria | 938 |
| 91 | Ga0070704_100757196 | 3300005549 | Bacteria | 865 |
| 92 | Ga0068855_100011893 | 3300005563 | Bacteria | 10523 |
| 93 | Ga0070664_100057429 | 3300005564 | Bacteria | 3308 |
| 94 | Ga0070664_100444857 | 3300005564 | Bacteria | 1189 |
| 95 | Ga0070664_100801220 | 3300005564 | Bacteria | 881 |
| 96 | Ga0070664_101763249 | 3300005564 | Bacteria | 587 |
| 97 | Ga0068857_100000067 | 3300005577 | Bacteria | 58903 |
| 98 | Ga0068857_100001500 | 3300005577 | Bacteria | 18598 |
| 99 | Ga0068854_100145626 | 3300005578 | Bacteria | 1822 |
| 100 | Ga0068854_101712014 | 3300005578 | Bacteria | 575 |
| 101 | Ga0068856_100154036 | 3300005614 | Bacteria | 2308 |
| 102 | Ga0070702_101744924 | 3300005615 | Bacteria | 518 |
| 103 | Ga0068852_100001033 | 3300005616 | Bacteria | 18283 |
| 104 | Ga0068859_100063249 | 3300005617 | Bacteria | 3731 |
| 105 | Ga0068859_100115845 | 3300005617 | Bacteria | 2744 |
| 106 | Ga0068859_100221937 | 3300005617 | Bacteria | 1978 |
| 107 | Ga0068859_101291674 | 3300005617 | Bacteria | 804 |
| 108 | Ga0068859_101334818 | 3300005617 | Bacteria | 791 |
| 109 | Ga0068859_102784201 | 3300005617 | Bacteria | 537 |
| 110 | Ga0068864_100000030 | 3300005618 | Bacteria | 215812 |
| 111 | Ga0068864_100161442 | 3300005618 | Bacteria | 2037 |
| 112 | Ga0068866_10474091 | 3300005718 | Bacteria | 823 |
| 113 | Ga0068866_10681168 | 3300005718 | Bacteria | 703 |
| 114 | Ga0068851_10007777 | 3300005834 | Bacteria | 4931 |
| 115 | Ga0068851_10026625 | 3300005834 | Bacteria | 2844 |
| 116 | Ga0068863_100050349 | 3300005841 | Bacteria | 3949 |
| 117 | Ga0068863_100210302 | 3300005841 | Bacteria | 1873 |
| 118 | Ga0068858_100030063 | 3300005842 | Bacteria | 5044 |
| 119 | Ga0068858_100534677 | 3300005842 | Bacteria | 1134 |
| 120 | Ga0068860_100005350 | 3300005843 | Bacteria | 13023 |
| 121 | Ga0068860_100012322 | 3300005843 | Bacteria | 8424 |
| 122 | Ga0068860_101296361 | 3300005843 | Bacteria | 749 |
| 123 | Ga0068862_100004594 | 3300005844 | Bacteria | 11632 |
| 124 | Ga0068862_100023696 | 3300005844 | Bacteria | 5144 |
| 125 | Ga0068862_100269434 | 3300005844 | Bacteria | 1557 |
| 126 | Ga0068862_100899789 | 3300005844 | Bacteria | 870 |
| 127 | Ga0068862_102159059 | 3300005844 | Bacteria | 568 |
| 128 | Ga0081455_10745870 | 3300005937 | Bacteria | 619 |
| 129 | Ga0081538_10000316 | 3300005981 | Bacteria | 55223 |
| 130 | Ga0081538_10000568 | 3300005981 | Bacteria | 40894 |
| 131 | Ga0081538_10011351 | 3300005981 | Bacteria | 7224 |
| 132 | Ga0070717_10395338 | 3300006028 | Bacteria | 1241 |
| 133 | Ga0070717_10909930 | 3300006028 | Bacteria | 801 |
| 134 | Ga0070717_11541774 | 3300006028 | Bacteria | 603 |
| 135 | Ga0075365_11300008 | 3300006038 | Bacteria | 511 |
| 136 | Ga0075368_10248206 | 3300006042 | Bacteria | 760 |
| 137 | Ga0075364_10592572 | 3300006051 | Bacteria | 757 |
| 138 | Ga0070715_10092670 | 3300006163 | Bacteria | 1393 |
| 139 | Ga0070716_100032327 | 3300006173 | Bacteria | 2853 |
| 140 | Ga0070716_100054495 | 3300006173 | Bacteria | 2284 |
| 141 | Ga0070716_100947520 | 3300006173 | Bacteria | 677 |
| 142 | Ga0075366_10002842 | 3300006195 | Bacteria | 8966 |
| 143 | Ga0075366_10623185 | 3300006195 | Bacteria | 669 |
| 144 | Ga0097621_100146214 | 3300006237 | Bacteria | 2024 |
| 145 | Ga0097621_101403989 | 3300006237 | Bacteria | 661 |
| 146 | Ga0068871_100137733 | 3300006358 | Bacteria | 2074 |
| 147 | Ga0068871_100268104 | 3300006358 | Bacteria | 1491 |
| 148 | Ga0068871_100946271 | 3300006358 | Bacteria | 800 |
| 149 | Ga0075431_101290581 | 3300006847 | Bacteria | 691 |
| 150 | Ga0075431_101461878 | 3300006847 | Unclassified | 642 |
| 151 | Ga0075431_101972585 | 3300006847 | Unclassified | 539 |
| 152 | Ga0075433_10125052 | 3300006852 | Bacteria | 2284 |
| 153 | Ga0075433_10869318 | 3300006852 | Bacteria | 787 |
| 154 | Ga0075433_11520870 | 3300006852 | Bacteria | 578 |
| 155 | Ga0075433_11829087 | 3300006852 | Bacteria | 522 |
| 156 | Ga0075434_100031638 | 3300006871 | Bacteria | 5217 |
| 157 | Ga0075434_100389043 | 3300006871 | Bacteria | 1415 |
| 158 | Ga0075434_101898296 | 3300006871 | Bacteria | 602 |
| 159 | Ga0075429_100041033 | 3300006880 | Bacteria | 4030 |
| 160 | Ga0075429_100677979 | 3300006880 | Bacteria | 903 |
| 161 | Ga0075429_101102091 | 3300006880 | Bacteria | 693 |
| 162 | Ga0068865_101429667 | 3300006881 | Bacteria | 618 |
| 163 | Ga0075436_100019903 | 3300006914 | Bacteria | 4603 |
| 164 | Ga0075436_100040846 | 3300006914 | Bacteria | 3200 |
| 165 | Ga0075436_100046672 | 3300006914 | Bacteria | 2987 |
| 166 | Ga0075436_100199794 | 3300006914 | Bacteria | 1416 |
| 167 | Ga0097620_100063253 | 3300006931 | Bacteria | 3731 |
| 168 | Ga0097620_100115855 | 3300006931 | Bacteria | 2744 |
| 169 | Ga0097620_100221926 | 3300006931 | Bacteria | 1978 |
| 170 | Ga0097620_101291610 | 3300006931 | Bacteria | 804 |
| 171 | Ga0097620_101334918 | 3300006931 | Bacteria | 791 |
| 172 | Ga0097620_102784747 | 3300006931 | Bacteria | 537 |
| 173 | Ga0079104_1002525 | 3300006946 | Bacteria | 9685 |
| 174 | Ga0079104_1005316 | 3300006946 | Bacteria | 5178 |
| 175 | Ga0075435_100156276 | 3300007076 | Bacteria | 1919 |
| 176 | Ga0075435_101016481 | 3300007076 | Bacteria | 724 |
| 177 | Ga0099794_10068445 | 3300007265 | Bacteria | 1736 |
| 178 | Ga0099794_10072242 | 3300007265 | Bacteria | 1691 |
| 179 | Ga0099794_10085643 | 3300007265 | Bacteria | 1560 |
| 180 | Ga0099795_10304542 | 3300007788 | Bacteria | 702 |
| 181 | Ga0105251_10006629 | 3300009011 | Bacteria | 7328 |
| 182 | Ga0105251_10098795 | 3300009011 | Bacteria | 1335 |
| 183 | Ga0105251_10123698 | 3300009011 | Bacteria | 1174 |
| 184 | Ga0105244_10000033 | 3300009036 | Bacteria | 172219 |
| 185 | Ga0105244_10001764 | 3300009036 | Bacteria | 16994 |
| 186 | Ga0105244_10007310 | 3300009036 | Bacteria | 7027 |
| 187 | Ga0105244_10019924 | 3300009036 | Bacteria | 3730 |
| 188 | Ga0105244_10028021 | 3300009036 | Bacteria | 3027 |
| 189 | Ga0105244_10035931 | 3300009036 | Bacteria | 2599 |
| 190 | Ga0105250_10000171 | 3300009092 | Bacteria | 56587 |
| 191 | Ga0105250_10000367 | 3300009092 | Bacteria | 33714 |
| 192 | Ga0105250_10002542 | 3300009092 | Bacteria | 9122 |
| 193 | Ga0105250_10004133 | 3300009092 | Bacteria | 6734 |
| 194 | Ga0105250_10015315 | 3300009092 | Bacteria | 3140 |
| 195 | Ga0105240_10004408 | 3300009093 | Bacteria | 21471 |
| 196 | Ga0111539_10004274 | 3300009094 | Bacteria | 18700 |
| 197 | Ga0111539_11900195 | 3300009094 | Bacteria | 690 |
| 198 | Ga0111539_12618092 | 3300009094 | Bacteria | 585 |
| 199 | Ga0105245_10724033 | 3300009098 | Bacteria | 1029 |
| 200 | Ga0105245_11648019 | 3300009098 | Bacteria | 693 |
| 201 | Ga0114129_10000835 | 3300009147 | Bacteria | 39878 |
| 202 | Ga0114129_10097411 | 3300009147 | Bacteria | 4072 |
| 203 | Ga0114129_10409703 | 3300009147 | Bacteria | 1785 |
| 204 | Ga0114129_13015265 | 3300009147 | Bacteria | 553 |
| 205 | Ga0114129_13438895 | 3300009147 | Bacteria | 508 |
| 206 | Ga0105243_10000946 | 3300009148 | Bacteria | 27191 |
| 207 | Ga0105243_10034677 | 3300009148 | Bacteria | 3909 |
| 208 | Ga0105243_10042550 | 3300009148 | Bacteria | 3556 |
| 209 | Ga0105243_10175145 | 3300009148 | Bacteria | 1861 |
| 210 | Ga0105243_11529111 | 3300009148 | Bacteria | 692 |
| 211 | Ga0105241_10013752 | 3300009174 | Bacteria | 5928 |
| 212 | Ga0105241_12315424 | 3300009174 | Bacteria | 535 |
| 213 | Ga0105242_10119392 | 3300009176 | Bacteria | 2260 |
| 214 | Ga0105242_10329362 | 3300009176 | Bacteria | 1404 |
| 215 | Ga0105242_10478764 | 3300009176 | Bacteria | 1179 |
| 216 | Ga0105242_10628096 | 3300009176 | Bacteria | 1042 |
| 217 | Ga0105242_10738312 | 3300009176 | Bacteria | 968 |
| 218 | Ga0105242_11090123 | 3300009176 | Bacteria | 812 |
| 219 | Ga0105242_12191000 | 3300009176 | Bacteria | 598 |
| 220 | Ga0105248_10120360 | 3300009177 | Bacteria | 2962 |
| 221 | Ga0105248_11473311 | 3300009177 | Bacteria | 770 |
| 222 | Ga0105237_10334099 | 3300009545 | Bacteria | 1520 |
| 223 | Ga0105237_10342305 | 3300009545 | Bacteria | 1500 |
| 224 | Ga0105237_11562069 | 3300009545 | Bacteria | 667 |
| 225 | Ga0105237_11815305 | 3300009545 | Bacteria | 617 |
| 226 | Ga0105237_11897824 | 3300009545 | Bacteria | 604 |
| 227 | Ga0105237_12612570 | 3300009545 | Bacteria | 516 |
| 228 | Ga0105238_10009119 | 3300009551 | Bacteria | 9930 |
| 229 | Ga0105249_10036609 | 3300009553 | Bacteria | 4452 |
| 230 | Ga0105249_10312258 | 3300009553 | Bacteria | 1581 |
| 231 | Ga0105249_10552453 | 3300009553 | Bacteria | 1202 |
| 232 | Ga0105249_11276104 | 3300009553 | Bacteria | 806 |
| 233 | Ga0105249_11605073 | 3300009553 | Bacteria | 723 |
| 234 | Ga0105033_122519 | 3300009986 | Bacteria | 576 |
| 235 | Ga0099796_10084423 | 3300010159 | Bacteria | 1170 |
| 236 | Ga0105239_10605920 | 3300010375 | Bacteria | 1249 |
| 237 | Ga0105239_10975641 | 3300010375 | Bacteria | 974 |
| 238 | Ga0105239_11356693 | 3300010375 | Bacteria | 820 |
| 239 | Ga0105246_10247296 | 3300011119 | Bacteria | 1413 |
| 240 | Ga0105246_10262157 | 3300011119 | Bacteria | 1377 |
| 241 | Ga0105246_10522491 | 3300011119 | Bacteria | 1012 |
| 242 | Ga0157318_1012286 | 3300012482 | Unclassified | 659 |
| 243 | Ga0157373_10005140 | 3300013100 | Bacteria | 9837 |
| 244 | Ga0157373_10006277 | 3300013100 | Bacteria | 8883 |
| 245 | Ga0157373_10086503 | 3300013100 | Bacteria | 2209 |
| 246 | Ga0157373_10096795 | 3300013100 | Bacteria | 2078 |
| 247 | Ga0157371_10003717 | 3300013102 | Bacteria | 13683 |
| 248 | Ga0157371_10006288 | 3300013102 | Bacteria | 9837 |
| 249 | Ga0157371_10110671 | 3300013102 | Bacteria | 1949 |
| 250 | Ga0157370_10020171 | 3300013104 | Bacteria | 6663 |
| 251 | Ga0157370_10040666 | 3300013104 | Bacteria | 4488 |
| 252 | Ga0157369_10000859 | 3300013105 | Bacteria | 38720 |
| 253 | Ga0157369_10813069 | 3300013105 | Bacteria | 960 |
| 254 | Ga0157374_10000041 | 3300013296 | Bacteria | 150386 |
| 255 | Ga0157374_10202007 | 3300013296 | Bacteria | 1946 |
| 256 | Ga0157378_10853802 | 3300013297 | Bacteria | 939 |
| 257 | Ga0157378_11302111 | 3300013297 | Bacteria | 768 |
| 258 | Ga0157378_11555733 | 3300013297 | Bacteria | 707 |
| 259 | Ga0163162_10032762 | 3300013306 | Bacteria | 5161 |
| 260 | Ga0163162_10079829 | 3300013306 | Bacteria | 3338 |
| 261 | Ga0163162_10081411 | 3300013306 | Bacteria | 3308 |
| 262 | Ga0157372_10000517 | 3300013307 | Bacteria | 42523 |
| 263 | Ga0157372_10005826 | 3300013307 | Bacteria | 13126 |
| 264 | Ga0157372_10033421 | 3300013307 | Bacteria | 5649 |
| 265 | Ga0157372_10080425 | 3300013307 | Bacteria | 3687 |
| 266 | Ga0157372_10140182 | 3300013307 | Bacteria | 2785 |
| 267 | Ga0157372_10519603 | 3300013307 | Bacteria | 1388 |
| 268 | Ga0157372_11133127 | 3300013307 | Bacteria | 905 |
| 269 | Ga0157375_10263011 | 3300013308 | Bacteria | 1887 |
| 270 | Ga0157375_11288226 | 3300013308 | Bacteria | 859 |
| 271 | Ga0157380_10421311 | 3300014326 | Bacteria | 1273 |
| 272 | Ga0157380_11021783 | 3300014326 | Bacteria | 861 |
| 273 | Ga0157380_11909416 | 3300014326 | Bacteria | 654 |
| 274 | Ga0157380_13338239 | 3300014326 | Bacteria | 513 |
| 275 | Ga0182008_10202502 | 3300014497 | Bacteria | 1010 |
| 276 | Ga0157377_11261080 | 3300014745 | Bacteria | 575 |
| 277 | Ga0157379_10044050 | 3300014968 | Bacteria | 3985 |
| 278 | Ga0157379_10425968 | 3300014968 | Bacteria | 1223 |
| 279 | Ga0157379_11063450 | 3300014968 | Bacteria | 774 |
| 280 | Ga0157376_10000279 | 3300014969 | Bacteria | 34619 |
| 281 | Ga0182007_10358591 | 3300015262 | Unclassified | 549 |
| 282 | Ga0183366_1002 | 3300015679 | Bacteria | 791639 |
| 283 | Ga0183370_1002 | 3300015680 | Bacteria | 791639 |
| 284 | Ga0183369_1002 | 3300015685 | Bacteria | 791621 |
| 285 | Ga0183368_1005 | 3300015687 | Bacteria | 791621 |
| 286 | Ga0183361_15145 | 3300016635 | Bacteria | 710 |
| 287 | Ga0163161_10310264 | 3300017792 | Bacteria | 1244 |
| 288 | Ga0206355_1691689 | 3300020076 | Bacteria | 705 |
| 289 | Ga0206351_10564155 | 3300020077 | Bacteria | 1254 |
| 290 | Ga0213872_10404087 | 3300021361 | Bacteria | 553 |
| 291 | Ga0213876_10000013 | 3300021384 | Bacteria | 342052 |
| 292 | Ga0224712_10275353 | 3300022467 | Bacteria | 782 |
| 293 | Ga0207425_1004532 | 3300025245 | Bacteria | 4134 |
| 294 | Ga0209129_1000010 | 3300025258 | Bacteria | 583357 |
| 295 | Ga0207656_10013864 | 3300025321 | Bacteria | 3092 |
| 296 | Ga0207696_1000102 | 3300025711 | Bacteria | 167962 |
| 297 | Ga0207696_1000137 | 3300025711 | Bacteria | 127683 |
| 298 | Ga0207696_1000272 | 3300025711 | Bacteria | 62222 |
| 299 | Ga0207696_1000356 | 3300025711 | Bacteria | 46221 |
| 300 | Ga0207696_1001421 | 3300025711 | Bacteria | 13043 |
| 301 | Ga0207655_1000024 | 3300025728 | Bacteria | 459774 |
| 302 | Ga0207655_1000065 | 3300025728 | Bacteria | 252767 |
| 303 | Ga0207655_1000072 | 3300025728 | Bacteria | 236536 |
| 304 | Ga0207655_1000186 | 3300025728 | Bacteria | 110125 |
| 305 | Ga0207655_1014327 | 3300025728 | Bacteria | 4488 |
| 306 | Ga0207655_1016739 | 3300025728 | Bacteria | 3995 |
| 307 | Ga0207655_1023983 | 3300025728 | Bacteria | 3005 |
| 308 | Ga0207713_1000019 | 3300025735 | Bacteria | 361225 |
| 309 | Ga0207713_1000157 | 3300025735 | Bacteria | 102471 |
| 310 | Ga0207713_1000300 | 3300025735 | Bacteria | 56459 |
| 311 | Ga0207713_1003240 | 3300025735 | Bacteria | 11227 |
| 312 | Ga0207713_1004405 | 3300025735 | Bacteria | 9139 |
| 313 | Ga0207713_1093261 | 3300025735 | Bacteria | 1053 |
| 314 | Ga0207642_10034211 | 3300025899 | Bacteria | 2158 |
| 315 | Ga0207710_10056669 | 3300025900 | Bacteria | 1769 |
| 316 | Ga0207680_10016832 | 3300025903 | Bacteria | 3849 |
| 317 | Ga0207685_10114787 | 3300025905 | Bacteria | 1173 |
| 318 | Ga0207699_10882658 | 3300025906 | Bacteria | 659 |
| 319 | Ga0207684_10443962 | 3300025910 | Bacteria | 1114 |
| 320 | Ga0207684_11413695 | 3300025910 | Bacteria | 569 |
| 321 | Ga0207654_10102010 | 3300025911 | Bacteria | 1769 |
| 322 | Ga0207707_10089282 | 3300025912 | Bacteria | 2693 |
| 323 | Ga0207707_10545442 | 3300025912 | Bacteria | 985 |
| 324 | Ga0207695_10164440 | 3300025913 | Bacteria | 2148 |
| 325 | Ga0207662_10926657 | 3300025918 | Bacteria | 617 |
| 326 | Ga0207657_10010093 | 3300025919 | Bacteria | 9441 |
| 327 | Ga0207649_10462963 | 3300025920 | Bacteria | 959 |
| 328 | Ga0207652_10082248 | 3300025921 | Bacteria | 2817 |
| 329 | Ga0207652_11360482 | 3300025921 | Bacteria | 613 |
| 330 | Ga0207646_10124778 | 3300025922 | Bacteria | 2315 |
| 331 | Ga0207646_10427501 | 3300025922 | Bacteria | 1195 |
| 332 | Ga0207681_10001475 | 3300025923 | Bacteria | 15155 |
| 333 | Ga0207681_10384258 | 3300025923 | Bacteria | 1131 |
| 334 | Ga0207694_10013370 | 3300025924 | Bacteria | 6181 |
| 335 | Ga0207650_10000034 | 3300025925 | Bacteria | 215826 |
| 336 | Ga0207650_11601334 | 3300025925 | Bacteria | 553 |
| 337 | Ga0207659_10363763 | 3300025926 | Bacteria | 1203 |
| 338 | Ga0207687_11372906 | 3300025927 | Bacteria | 607 |
| 339 | Ga0207644_10000554 | 3300025931 | Bacteria | 24219 |
| 340 | Ga0207690_10034322 | 3300025932 | Bacteria | 3268 |
| 341 | Ga0207690_10113459 | 3300025932 | Bacteria | 1956 |
| 342 | Ga0207706_11362368 | 3300025933 | Bacteria | 584 |
| 343 | Ga0207686_10146215 | 3300025934 | Bacteria | 1640 |
| 344 | Ga0207686_10219613 | 3300025934 | Bacteria | 1372 |
| 345 | Ga0207686_10409747 | 3300025934 | Bacteria | 1034 |
| 346 | Ga0207686_11681316 | 3300025934 | Bacteria | 525 |
| 347 | Ga0207709_10004416 | 3300025935 | Bacteria | 8140 |
| 348 | Ga0207709_10028321 | 3300025935 | Bacteria | 3239 |
| 349 | Ga0207709_10040659 | 3300025935 | Bacteria | 2785 |
| 350 | Ga0207709_10140124 | 3300025935 | Bacteria | 1661 |
| 351 | Ga0207670_10297155 | 3300025936 | Bacteria | 1263 |
| 352 | Ga0207670_11195146 | 3300025936 | Bacteria | 643 |
| 353 | Ga0207704_11265850 | 3300025938 | Bacteria | 630 |
| 354 | Ga0207704_11949122 | 3300025938 | Bacteria | 505 |
| 355 | Ga0207665_10013281 | 3300025939 | Bacteria | 5414 |
| 356 | Ga0207665_10048624 | 3300025939 | Bacteria | 2848 |
| 357 | Ga0207665_11214242 | 3300025939 | Bacteria | 601 |
| 358 | Ga0207711_10001883 | 3300025941 | Bacteria | 19121 |
| 359 | Ga0207711_10147279 | 3300025941 | Bacteria | 2122 |
| 360 | Ga0207689_10167430 | 3300025942 | Bacteria | 1811 |
| 361 | Ga0207689_10291749 | 3300025942 | Bacteria | 1351 |
| 362 | Ga0207689_10714172 | 3300025942 | Bacteria | 845 |
| 363 | Ga0207661_10114147 | 3300025944 | Bacteria | 2290 |
| 364 | Ga0207661_10972406 | 3300025944 | Bacteria | 782 |
| 365 | Ga0207679_10665972 | 3300025945 | Bacteria | 942 |
| 366 | Ga0207679_11065287 | 3300025945 | Bacteria | 741 |
| 367 | Ga0207712_10073913 | 3300025961 | Bacteria | 2460 |
| 368 | Ga0207712_10172929 | 3300025961 | Bacteria | 1690 |
| 369 | Ga0207712_10445966 | 3300025961 | Bacteria | 1097 |
| 370 | Ga0207712_10887116 | 3300025961 | Bacteria | 787 |
| 371 | Ga0207712_11369293 | 3300025961 | Bacteria | 633 |
| 372 | Ga0207668_10079704 | 3300025972 | Bacteria | 2370 |
| 373 | Ga0207640_11814113 | 3300025981 | Bacteria | 551 |
| 374 | Ga0207658_10000015 | 3300025986 | Bacteria | 215826 |
| 375 | Ga0207658_10089130 | 3300025986 | Bacteria | 2387 |
| 376 | Ga0207658_10756672 | 3300025986 | Bacteria | 880 |
| 377 | Ga0207703_10019954 | 3300026035 | Bacteria | 5238 |
| 378 | Ga0207639_10209170 | 3300026041 | Bacteria | 1678 |
| 379 | Ga0207639_10435721 | 3300026041 | Bacteria | 1187 |
| 380 | Ga0207678_10333724 | 3300026067 | Bacteria | 1306 |
| 381 | Ga0207708_11984966 | 3300026075 | Bacteria | 509 |
| 382 | Ga0207641_10013032 | 3300026088 | Bacteria | 6819 |
| 383 | Ga0207641_10212145 | 3300026088 | Bacteria | 1791 |
| 384 | Ga0207641_10631733 | 3300026088 | Bacteria | 1050 |
| 385 | Ga0207648_10066218 | 3300026089 | Bacteria | 3150 |
| 386 | Ga0207648_10241563 | 3300026089 | Bacteria | 1608 |
| 387 | Ga0207676_10000032 | 3300026095 | Bacteria | 215826 |
| 388 | Ga0207676_10045203 | 3300026095 | Bacteria | 3401 |
| 389 | Ga0207676_10173247 | 3300026095 | Bacteria | 1882 |
| 390 | Ga0207674_10000242 | 3300026116 | Bacteria | 67777 |
| 391 | Ga0207674_10001008 | 3300026116 | Bacteria | 36810 |
| 392 | Ga0207675_102275058 | 3300026118 | Bacteria | 556 |
| 393 | Ga0207683_10737361 | 3300026121 | Bacteria | 914 |
| 394 | Ga0207698_10164811 | 3300026142 | Bacteria | 1943 |
| 395 | Ga0207698_10665837 | 3300026142 | Bacteria | 1033 |
| 396 | Ga0209281_1000025 | 3300027111 | Bacteria | 488275 |
| 397 | Ga0209281_1000089 | 3300027111 | Bacteria | 243650 |
| 398 | Ga0209281_1000279 | 3300027111 | Bacteria | 96898 |
| 399 | Ga0209281_1000369 | 3300027111 | Bacteria | 73041 |
| 400 | Ga0209281_1000559 | 3300027111 | Bacteria | 45161 |
| 401 | Ga0209281_1003542 | 3300027111 | Bacteria | 5099 |
| 402 | Ga0209973_1085902 | 3300027252 | Bacteria | 503 |
| 403 | Ga0209371_1000013 | 3300027312 | Bacteria | 691516 |
| 404 | Ga0209371_1000019 | 3300027312 | Bacteria | 583561 |
| 405 | Ga0209371_1000149 | 3300027312 | Bacteria | 110455 |
| 406 | Ga0209371_1000346 | 3300027312 | Bacteria | 50802 |
| 407 | Ga0209371_1000430 | 3300027312 | Bacteria | 42665 |
| 408 | Ga0209371_1000649 | 3300027312 | Bacteria | 30391 |
| 409 | Ga0209371_1000701 | 3300027312 | Bacteria | 28374 |
| 410 | Ga0209371_1001333 | 3300027312 | Bacteria | 17187 |
| 411 | Ga0209371_1005086 | 3300027312 | Bacteria | 5394 |
| 412 | Ga0209371_1005550 | 3300027312 | Bacteria | 4973 |
| 413 | Ga0209371_1007231 | 3300027312 | Bacteria | 3910 |
| 414 | Ga0209371_1027476 | 3300027312 | Bacteria | 1280 |
| 415 | Ga0209969_1011685 | 3300027360 | Bacteria | 1262 |
| 416 | Ga0209967_1004221 | 3300027364 | Bacteria | 1902 |
| 417 | Ga0209967_1006222 | 3300027364 | Bacteria | 1616 |
| 418 | Ga0209981_1034326 | 3300027378 | Bacteria | 749 |
| 419 | Ga0210000_1014047 | 3300027462 | Bacteria | 1197 |
| 420 | Ga0210000_1073563 | 3300027462 | Bacteria | 558 |
| 421 | Ga0209995_1082834 | 3300027471 | Bacteria | 551 |
| 422 | Ga0209179_1031179 | 3300027512 | Bacteria | 1093 |
| 423 | Ga0209999_1038460 | 3300027543 | Bacteria | 895 |
| 424 | Ga0209999_1043159 | 3300027543 | Unclassified | 846 |
| 425 | Ga0210002_1051324 | 3300027617 | Bacteria | 711 |
| 426 | Ga0209983_1051643 | 3300027665 | Bacteria | 900 |
| 427 | Ga0209588_1069503 | 3300027671 | Bacteria | 1138 |
| 428 | Ga0209588_1118027 | 3300027671 | Bacteria | 850 |
| 429 | Ga0209588_1123610 | 3300027671 | Bacteria | 827 |
| 430 | Ga0209971_1006049 | 3300027682 | Bacteria | 2867 |
| 431 | Ga0209966_1157507 | 3300027695 | Bacteria | 530 |
| 432 | Ga0209998_10102751 | 3300027717 | Bacteria | 709 |
| 433 | Ga0209974_10002074 | 3300027876 | Bacteria | 7329 |
| 434 | Ga0209974_10147921 | 3300027876 | Bacteria | 846 |
| 435 | Ga0209974_10285719 | 3300027876 | Bacteria | 628 |
| 436 | Ga0207428_10051391 | 3300027907 | Bacteria | 3295 |
| 437 | Ga0207428_10834273 | 3300027907 | Bacteria | 654 |
| 438 | Ga0268266_10000142 | 3300028379 | Bacteria | 138183 |
| 439 | Ga0268266_10013140 | 3300028379 | Bacteria | 7139 |
| 440 | Ga0268266_11913141 | 3300028379 | Bacteria | 567 |
| 441 | Ga0268265_10003694 | 3300028380 | Bacteria | 10914 |
| 442 | Ga0268265_10178350 | 3300028380 | Bacteria | 1823 |
| 443 | Ga0268265_10975089 | 3300028380 | Bacteria | 836 |
| 444 | Ga0268265_11122145 | 3300028380 | Bacteria | 781 |
| 445 | Ga0268264_10000009 | 3300028381 | Bacteria | 724972 |
| 446 | Ga0268264_10200304 | 3300028381 | Bacteria | 1826 |
| 447 | Ga0268264_10614269 | 3300028381 | Bacteria | 1073 |
| 448 | Ga0268256_1000014 | 3300030500 | Bacteria | 691435 |
| 449 | Ga0268256_1000024 | 3300030500 | Bacteria | 488637 |
| 450 | Ga0268256_1000293 | 3300030500 | Bacteria | 50802 |
| 451 | Ga0268256_1000868 | 3300030500 | Bacteria | 21089 |
| 452 | Ga0268256_1002881 | 3300030500 | Bacteria | 8258 |
| 453 | Ga0268256_1004055 | 3300030500 | Bacteria | 6281 |
| 454 | Ga0268256_1004909 | 3300030500 | Bacteria | 5395 |
| 455 | Ga0268256_1004912 | 3300030500 | Bacteria | 5394 |
| 456 | Ga0268256_1005247 | 3300030500 | Bacteria | 5137 |
| 457 | Ga0268256_1007258 | 3300030500 | Bacteria | 3980 |
| 458 | Ga0268256_1021783 | 3300030500 | Bacteria | 1696 |
| 459 | Ga0268256_1031248 | 3300030500 | Bacteria | 1280 |
| 460 | Ga0265332_10002686 | 3300031238 | Bacteria | 8903 |
| 461 | Ga0265327_10126045 | 3300031251 | Bacteria | 1209 |
| 462 | Ga0307408_100047310 | 3300031548 | Bacteria | 3080 |
| 463 | Ga0265313_10311083 | 3300031595 | Bacteria | 631 |
| 464 | Ga0316575_10000197 | 3300031665 | Bacteria | 15992 |
| 465 | Ga0316579_10407697 | 3300031691 | Bacteria | 657 |
| 466 | Ga0316576_10063914 | 3300031727 | Bacteria | 2703 |
| 467 | Ga0316576_10147785 | 3300031727 | Bacteria | 1771 |
| 468 | Ga0307405_11107526 | 3300031731 | Bacteria | 681 |
| 469 | Ga0307406_11276624 | 3300031901 | Bacteria | 640 |
| 470 | Ga0307412_10131597 | 3300031911 | Bacteria | 1818 |
| 471 | Ga0307412_11417406 | 3300031911 | Bacteria | 629 |
| 472 | Ga0307409_100361700 | 3300031995 | Unclassified | 1373 |
| 473 | Ga0307409_101487959 | 3300031995 | Bacteria | 704 |
| 474 | Ga0307416_100916550 | 3300032002 | Bacteria | 977 |
| 475 | Ga0307416_101520757 | 3300032002 | Bacteria | 775 |
| 476 | Ga0307411_10384953 | 3300032005 | Bacteria | 1155 |
| 477 | Ga0307415_100583389 | 3300032126 | Bacteria | 992 |
| 478 | Ga0316583_10027512 | 3300032133 | Bacteria | 2030 |
| 479 | Ga0316593_10004458 | 3300032168 | Bacteria | 3597 |
| 480 | Ga0316593_10006857 | 3300032168 | Bacteria | 3100 |
| 481 | Ga0316593_10101388 | 3300032168 | Bacteria | 1021 |
| 482 | Ga0316586_1112115 | 3300033527 | Bacteria | 528 |
| 483 | Ga0316588_1170524 | 3300033528 | Bacteria | 563 |
| 484 | Ga0316587_1080659 | 3300033529 | Bacteria | 615 |
| 485 | Ga0316587_1094570 | 3300033529 | Bacteria | 572 |
| 486 | Ga0316587_1127523 | 3300033529 | Unclassified | 501 |
| 487 | Ga0316596_1132804 | 3300033541 | Bacteria | 680 |
| 488 | Ga0316596_1241947 | 3300033541 | Bacteria | 508 |
| 489 | Ga0373926_0142250 | 3300035083 | Bacteria | 911 |
| 490 | Ga0373934_0001761 | 3300035086 | Bacteria | 7959 |
| 491 | Ga0373934_0001842 | 3300035086 | Bacteria | 7796 |
| 492 | Ga0373923_0234769 | 3300035111 | Bacteria | 855 |
| 493 | Ga0373941_0479960 | 3300035115 | Bacteria | 526 |
| 494 | Ga0373945_0011097 | 3300035116 | Bacteria | 2974 |
| 495 | Ga0373953_0039043 | 3300035117 | Bacteria | 1880 |
| 496 | Ga0373953_0045113 | 3300035117 | Bacteria | 1765 |
| 497 | Ga0373954_0003250 | 3300035118 | Bacteria | 6861 |
| 498 | Ga0373954_0006306 | 3300035118 | Bacteria | 5168 |
| 499 | Ga0373954_0119326 | 3300035118 | Bacteria | 1279 |
| 500 | Ga0373956_0000012 | 3300035119 | Bacteria | 57485 |
| 501 | Ga0373957_0004992 | 3300035120 | Bacteria | 4089 |
| 502 | Ga0373957_0075454 | 3300035120 | Bacteria | 1324 |
| 503 | Ga0373957_0481802 | 3300035120 | Bacteria | 539 |
| 504 | Ga0373943_0536708 | 3300035170 | Bacteria | 686 |
| 505 | Ga0373946_0020618 | 3300035171 | Bacteria | 2549 |
| 506 | Ga0373955_0022269 | 3300035172 | Bacteria | 3212 |
| 507 | Ga0373955_0300230 | 3300035172 | Bacteria | 968 |
| 508 | Ga0373955_0306801 | 3300035172 | Bacteria | 957 |
| 509 | Ga0373924_0005709 | 3300035410 | Bacteria | 4418 |
| 510 | Ga0373931_0274859 | 3300035691 | Bacteria | 1032 |
| 511 | Ga0373935_0007523 | 3300035692 | Bacteria | 6521 |
| 512 | Ga0373935_0206669 | 3300035692 | Bacteria | 1359 |
| 513 | Ga0373927_0040170 | 3300035695 | Bacteria | 3036 |
| 514 | Ga0373933_0000489 | 3300035724 | Bacteria | 24730 |
| 515 | Ga0373933_0285071 | 3300035724 | Bacteria | 1067 |
| 516 | Ga0373947_0490721 | 3300035725 | Bacteria | 834 |
| 517 | Ga0373937_0001078 | 3300036401 | Bacteria | 23022 |
| 518 | Ga0373937_0028161 | 3300036401 | Bacteria | 5083 |
| 519 | Ga0373937_0110119 | 3300036401 | Bacteria | 2561 |
| 520 | Ga0373937_0226604 | 3300036401 | Bacteria | 1759 |
| 521 | Ga0373937_0634165 | 3300036401 | Bacteria | 1014 |
| 522 | Ga0316582_0110901 | 3300036647 | Bacteria | 1826 |
| 523 | Ga0316582_0290448 | 3300036647 | Bacteria | 1123 |
| 524 | Ga0316582_0958278 | 3300036647 | Unclassified | 585 |
| 525 | Ga0316584_0685043 | 3300036712 | Bacteria | 704 |
| 526 | Ga0373925_0007488 | 3300037068 | Bacteria | 7961 |
| 527 | Ga0395899_0071185 | 3300037312 | Bacteria | 2545 |
| 528 | Ga0395899_0222985 | 3300037312 | Bacteria | 1305 |
| 529 | Ga0395899_0708613 | 3300037312 | Bacteria | 630 |
| 530 | Ga0395900_0052173 | 3300037418 | Bacteria | 4210 |
| 531 | Ga0395900_0200350 | 3300037418 | Bacteria | 2020 |
| 532 | Ga0395900_1047588 | 3300037418 | Bacteria | 734 |
| 533 | Ga0395900_1103261 | 3300037418 | Bacteria | 711 |
| 534 | Ga0395898_0081015 | 3300037466 | Bacteria | 3131 |
| 535 | Ga0395898_0150819 | 3300037466 | Bacteria | 2224 |
| 536 | Ga0395898_0719478 | 3300037466 | Bacteria | 940 |
| 537 | Ga0395905_0037515 | 3300037471 | Bacteria | 4549 |
| 538 | Ga0395905_0746529 | 3300037471 | Bacteria | 881 |
| 539 | Ga0395905_1011183 | 3300037471 | Bacteria | 734 |
| 540 | Ga0395901_0123522 | 3300038443 | Bacteria | 2720 |
| 541 | Ga0395901_0348549 | 3300038443 | Bacteria | 1528 |
| 542 | Ga0395901_1066242 | 3300038443 | Bacteria | 780 |
| 543 | Ga0400490_06112 | 3300038726 | Bacteria | 5203 |
| 544 | Ga0242420_090756 | 3300038996 | Bacteria | 641 |
| 545 | Ga0400483_215647 | 3300039062 | Bacteria | 2630 |
| 546 | Ga0436365_0315664 | 3300039437 | Bacteria | 663 |
| 547 | Ga0436365_0471682 | 3300039437 | Bacteria | 352256 |
| 548 | Ga0436360_0425236 | 3300039438 | Bacteria | 1795 |
| 549 | Ga0436360_1083522 | 3300039438 | Bacteria | 612 |
| 550 | Ga0436361_1050827 | 3300039447 | Bacteria | 2216 |
| 551 | Ga0436363_1096406 | 3300039450 | Bacteria | 547 |
| 552 | Ga0439438_000003 | 3300041405 | Bacteria | 464587 |
| 553 | Ga0439438_001217 | 3300041405 | Bacteria | 11409 |
| 554 | Ga0439438_002463 | 3300041405 | Bacteria | 7872 |
| 555 | Ga0439439_0156978 | 3300041406 | Bacteria | 648 |
| 556 | Ga0439447_001374 | 3300041407 | Bacteria | 8900 |
| 557 | Ga0439447_006949 | 3300041407 | Bacteria | 3629 |
| 558 | Ga0451789_0815379 | 3300041443 | Bacteria | 731 |
| 559 | Ga0451807_1802159 | 3300041486 | Bacteria | 502 |
| 560 | Ga0451851_0983120 | 3300041507 | Bacteria | 620 |
| 561 | Ga0451853_2078609 | 3300041512 | Bacteria | 2086 |
| 562 | Ga0439432_010449 | 3300042006 | Bacteria | 3212 |
| 563 | Ga0439432_013582 | 3300042006 | Bacteria | 2768 |
| 564 | Ga0439432_153023 | 3300042006 | Bacteria | 676 |
| 565 | Ga0439432_218898 | 3300042006 | Bacteria | 550 |
| 566 | Ga0439452_000006 | 3300042010 | Bacteria | 645083 |
| 567 | Ga0439452_000011 | 3300042010 | Bacteria | 428451 |
| 568 | Ga0439452_004096 | 3300042010 | Bacteria | 4955 |
| 569 | Ga0439434_0279246 | 3300042435 | Bacteria | 575 |
| 570 | Ga0439464_0007335 | 3300042439 | Bacteria | 2882 |
| 571 | Ga0451577_0032270 | 3300042876 | Bacteria | 4719 |
| 572 | Ga0451577_0161487 | 3300042876 | Bacteria | 2018 |
| 573 | Ga0466972_0522066 | 3300044658 | Bacteria | 559 |
| 574 | Ga0453683_0687554 | 3300044673 | Bacteria | 670 |
| 575 | Ga0466963_0516298 | 3300044694 | Bacteria | 844 |
| 576 | Ga0453684_0072303 | 3300044712 | Bacteria | 4355 |
| 577 | Ga0453684_0374116 | 3300044712 | Bacteria | 1601 |
| 578 | Ga0453684_1699961 | 3300044712 | Bacteria | 645 |
| 579 | Ga0451576_0007360 | 3300045051 | Bacteria | 13193 |
| 580 | Ga0451576_2125887 | 3300045051 | Bacteria | 577 |
| 581 | Ga0466967_0328006 | 3300045976 | Bacteria | 1478 |
| 582 | Ga0495617_066705 | 3300046452 | Bacteria | 1185 |
| 583 | Ga0495592_0014092 | 3300046454 | Bacteria | 6073 |
| 584 | Ga0495592_0017267 | 3300046454 | Bacteria | 5481 |
| 585 | Ga0495592_0116005 | 3300046454 | Bacteria | 1890 |
| 586 | Ga0495592_0708128 | 3300046454 | Bacteria | 605 |
| 587 | Ga0495603_0094613 | 3300046455 | Bacteria | 1745 |
| 588 | Ga0495603_0744530 | 3300046455 | Bacteria | 560 |
| 589 | Ga0495591_000010 | 3300046458 | Bacteria | 327794 |
| 590 | Ga0495591_000411 | 3300046458 | Bacteria | 35586 |
| 591 | Ga0495591_000777 | 3300046458 | Bacteria | 22942 |
| 592 | Ga0495591_013135 | 3300046458 | Bacteria | 3047 |
| 593 | Ga0495629_0000050 | 3300046459 | Bacteria | 107147 |
| 594 | Ga0495629_0098574 | 3300046459 | Bacteria | 2039 |
| 595 | Ga0495638_0080060 | 3300046460 | Bacteria | 1985 |
| 596 | Ga0495641_0042009 | 3300046461 | Bacteria | 2121 |
| 597 | Ga0495651_0000085 | 3300046462 | Bacteria | 68214 |
| 598 | Ga0495651_0014818 | 3300046462 | Bacteria | 6029 |
| 599 | Ga0495653_0010312 | 3300046463 | Bacteria | 7644 |
| 600 | Ga0495653_0427184 | 3300046463 | Bacteria | 837 |
| 601 | Ga0495653_0805546 | 3300046463 | Bacteria | 564 |
| 602 | Ga0495650_0000008 | 3300046471 | Bacteria | 688246 |
| 603 | Ga0495650_0000040 | 3300046471 | Bacteria | 366254 |
| 604 | Ga0495650_0045630 | 3300046471 | Bacteria | 1844 |
| 605 | Ga0495582_0043522 | 3300046473 | Bacteria | 2473 |
| 606 | Ga0495605_0032390 | 3300046474 | Bacteria | 2660 |
| 607 | Ga0495639_0001499 | 3300046475 | Bacteria | 10412 |
| 608 | Ga0495639_0038817 | 3300046475 | Bacteria | 2139 |
| 609 | Ga0495662_0041525 | 3300046476 | Bacteria | 2220 |
| 610 | Ga0495662_0150273 | 3300046476 | Bacteria | 1147 |
| 611 | Ga0495664_0004079 | 3300046477 | Bacteria | 7965 |
| 612 | Ga0495584_0000811 | 3300046491 | Bacteria | 20557 |
| 613 | Ga0495594_0037887 | 3300046499 | Bacteria | 2632 |
| 614 | Ga0495594_0144215 | 3300046499 | Bacteria | 1351 |
| 615 | Ga0495607_0010549 | 3300046501 | Bacteria | 6206 |
| 616 | Ga0495606_0000966 | 3300046507 | Bacteria | 42048 |
| 617 | Ga0495608_0008762 | 3300046511 | Bacteria | 7076 |
| 618 | Ga0495608_0315308 | 3300046511 | Bacteria | 967 |
| 619 | Ga0495616_0041166 | 3300046513 | Bacteria | 2358 |
| 620 | Ga0495616_0166109 | 3300046513 | Bacteria | 989 |
| 621 | Ga0495618_0011792 | 3300046514 | Bacteria | 5303 |
| 622 | Ga0495620_0022016 | 3300046515 | Bacteria | 3081 |
| 623 | Ga0495628_0010586 | 3300046516 | Bacteria | 7826 |
| 624 | Ga0495628_0027653 | 3300046516 | Bacteria | 4612 |
| 625 | Ga0495628_0031313 | 3300046516 | Bacteria | 4303 |
| 626 | Ga0495628_0390873 | 3300046516 | Bacteria | 1017 |
| 627 | Ga0495630_0001044 | 3300046517 | Bacteria | 19075 |
| 628 | Ga0495630_0077499 | 3300046517 | Bacteria | 2506 |
| 629 | Ga0495643_0271986 | 3300046522 | Bacteria | 783 |
| 630 | Ga0495644_0010576 | 3300046523 | Bacteria | 3556 |
| 631 | Ga0495648_0002943 | 3300046524 | Bacteria | 15281 |
| 632 | Ga0495666_0007265 | 3300046526 | Bacteria | 5557 |
| 633 | Ga0495652_0019967 | 3300046529 | Bacteria | 5958 |
| 634 | Ga0495652_0218806 | 3300046529 | Bacteria | 1432 |
| 635 | Ga0495652_0268818 | 3300046529 | Bacteria | 1254 |
| 636 | Ga0495654_0000031 | 3300046530 | Bacteria | 206800 |
| 637 | Ga0495654_0000089 | 3300046530 | Bacteria | 102765 |
| 638 | Ga0495640_0029552 | 3300046533 | Bacteria | 3934 |
| 639 | Ga0495640_0286804 | 3300046533 | Bacteria | 1024 |
| 640 | Ga0495640_0505436 | 3300046533 | Bacteria | 735 |
| 641 | Ga0495586_0012489 | 3300046535 | Bacteria | 4505 |
| 642 | Ga0495587_0004041 | 3300046536 | Bacteria | 9721 |
| 643 | Ga0495597_0004073 | 3300046542 | Bacteria | 8169 |
| 644 | Ga0495645_0014068 | 3300046543 | Bacteria | 5670 |
| 645 | Ga0495645_0114980 | 3300046543 | Bacteria | 1901 |
| 646 | Ga0495622_0151327 | 3300046557 | Bacteria | 1050 |
| 647 | Ga0495667_0064631 | 3300046559 | Bacteria | 2393 |
| 648 | Ga0495667_0106079 | 3300046559 | Bacteria | 1816 |
| 649 | Ga0495667_0299619 | 3300046559 | Bacteria | 1018 |
| 650 | Ga0495668_0043831 | 3300046616 | Bacteria | 2487 |
| 651 | Ga0495634_0123409 | 3300046642 | Bacteria | 1657 |
| 652 | Ga0495634_0242652 | 3300046642 | Bacteria | 1104 |
| 653 | Ga0495611_0075933 | 3300046648 | Bacteria | 1540 |
| 654 | Ga0495625_0016265 | 3300046660 | Bacteria | 5860 |
| 655 | Ga0495635_0004071 | 3300046663 | Bacteria | 10150 |
| 656 | Ga0495635_0009364 | 3300046663 | Bacteria | 6845 |
| 657 | Ga0495635_0023162 | 3300046663 | Bacteria | 4328 |
| 658 | Ga0495661_0514755 | 3300046665 | Bacteria | 569 |
| 659 | Ga0495588_0033862 | 3300046674 | Bacteria | 2583 |
| 660 | Ga0495657_0004414 | 3300046675 | Bacteria | 11226 |
| 661 | Ga0495657_0044070 | 3300046675 | Bacteria | 3038 |
| 662 | Ga0495657_0170064 | 3300046675 | Bacteria | 1343 |
| 663 | Ga0495599_0005051 | 3300046678 | Bacteria | 7851 |
| 664 | Ga0495599_0015150 | 3300046678 | Bacteria | 4781 |
| 665 | Ga0495599_0101320 | 3300046678 | Bacteria | 1795 |
| 666 | Ga0495623_0627986 | 3300046679 | Bacteria | 556 |
| 667 | Ga0495647_0324062 | 3300046681 | Bacteria | 698 |
| 668 | Ga0495647_0419455 | 3300046681 | Bacteria | 616 |
| 669 | Ga0495658_0000628 | 3300046683 | Bacteria | 19169 |
| 670 | Ga0495658_0015072 | 3300046683 | Bacteria | 3961 |
| 671 | Ga0495658_0274040 | 3300046683 | Bacteria | 1064 |
| 672 | Ga0495613_0012456 | 3300046689 | Bacteria | 6320 |
| 673 | Ga0495613_0548915 | 3300046689 | Bacteria | 773 |
| 674 | Ga0495624_0291624 | 3300046690 | Bacteria | 984 |
| 675 | Ga0495624_0425656 | 3300046690 | Bacteria | 796 |
| 676 | Ga0495671_0001988 | 3300046692 | Bacteria | 13137 |
| 677 | Ga0495649_0043412 | 3300046694 | Bacteria | 2454 |
| 678 | Ga0495649_0055527 | 3300046694 | Bacteria | 2139 |
| 679 | Ga0495589_0041517 | 3300046794 | Bacteria | 2295 |
| 680 | Ga0495600_0018687 | 3300046809 | Bacteria | 4419 |
| 681 | Ga0495660_0000184 | 3300046810 | Bacteria | 67383 |
| 682 | Ga0495581_0003831 | 3300047315 | Bacteria | 8649 |
| 683 | Ga0495581_0613341 | 3300047315 | Bacteria | 630 |
| 684 | Ga0495604_0028106 | 3300047317 | Bacteria | 4474 |
| 685 | Ga0495636_0272095 | 3300047318 | Bacteria | 787 |
| 686 | Ga0495674_0010947 | 3300047319 | Bacteria | 8569 |
| 687 | Ga0495674_0193637 | 3300047319 | Bacteria | 1689 |
| 688 | Ga0495672_0000003 | 3300047320 | Bacteria | 728845 |
| 689 | Ga0495672_0000082 | 3300047320 | Bacteria | 159422 |
| 690 | Ga0495680_0100224 | 3300047322 | Bacteria | 2158 |
| 691 | Ga0495680_0252804 | 3300047322 | Bacteria | 1249 |
| 692 | Ga0495680_0796429 | 3300047322 | Bacteria | 617 |
| 693 | Ga0495680_0959366 | 3300047322 | Bacteria | 549 |
| 694 | Ga0495675_0003667 | 3300047444 | Bacteria | 9280 |
| 695 | Ga0495675_0405458 | 3300047444 | Bacteria | 794 |
| 696 | Ga0495679_000059 | 3300047446 | Bacteria | 109922 |
| 697 | Ga0495679_034458 | 3300047446 | Bacteria | 1611 |
| 698 | Ga0495679_094751 | 3300047446 | Bacteria | 834 |
| 699 | Ga0495673_0000011 | 3300047469 | Bacteria | 674140 |
| 700 | Ga0495673_0000117 | 3300047469 | Bacteria | 148662 |
| 701 | Ga0495681_0050350 | 3300047470 | Bacteria | 1964 |
| 702 | Ga0495684_0025150 | 3300047471 | Bacteria | 4578 |
| 703 | Ga0495593_0080675 | 3300047673 | Bacteria | 1683 |
| 704 | Ga0495602_0054829 | 3300048088 | Bacteria | 3516 |
| 705 | Ga0495602_0388662 | 3300048088 | Bacteria | 998 |
| 706 | Ga0495614_0045025 | 3300048089 | Bacteria | 1892 |
| 707 | Ga0496100_0159656 | 3300048903 | Bacteria | 1615 |
| 708 | Ga0496101_0000144 | 3300048904 | Bacteria | 63019 |
| 709 | Ga0496101_0106694 | 3300048904 | Bacteria | 2103 |
| 710 | Ga0496102_0067100 | 3300048905 | Bacteria | 3290 |
| 711 | Ga0496102_1854620 | 3300048905 | Bacteria | 520 |
| 712 | Ga0496103_0622336 | 3300048906 | Bacteria | 687 |
| 713 | Ga0496104_0188756 | 3300048907 | Bacteria | 1972 |
| 714 | Ga0496104_0353648 | 3300048907 | Bacteria | 1382 |
| 715 | Ga0496106_0128267 | 3300048909 | Bacteria | 1988 |
| 716 | Ga0496106_0513142 | 3300048909 | Bacteria | 963 |
| 717 | Ga0496106_1572538 | 3300048909 | Bacteria | 504 |
| 718 | Ga0496108_0329617 | 3300048911 | Bacteria | 1331 |
| 719 | Ga0496109_0152471 | 3300048912 | Bacteria | 2164 |
| 720 | Ga0496109_1045946 | 3300048912 | Bacteria | 754 |
| 721 | Ga0496110_0480424 | 3300048913 | Bacteria | 1132 |
| 722 | Ga0496110_1213064 | 3300048913 | Bacteria | 663 |
| 723 | Ga0496111_0818000 | 3300048914 | Bacteria | 674 |
| 724 | Ga0496112_0190813 | 3300048915 | Bacteria | 2011 |
| 725 | Ga0496113_0978838 | 3300048916 | Bacteria | 667 |
| 726 | Ga0496114_0844450 | 3300048917 | Bacteria | 796 |
| 727 | Ga0496116_0008711 | 3300048919 | Bacteria | 8761 |
| 728 | Ga0496116_0030592 | 3300048919 | Bacteria | 3864 |
| 729 | Ga0496116_0123723 | 3300048919 | Bacteria | 1490 |
| 730 | Ga0496117_0074056 | 3300048920 | Bacteria | 2269 |
| 731 | Ga0496117_0192360 | 3300048920 | Bacteria | 1160 |
| 732 | Ga0496117_0220973 | 3300048920 | Bacteria | 1054 |
| 733 | Ga0496118_0086857 | 3300048921 | Bacteria | 2171 |
| 734 | Ga0496118_0105054 | 3300048921 | Bacteria | 1894 |
| 735 | Ga0496118_0167214 | 3300048921 | Bacteria | 1349 |
| 736 | Ga0496118_0182307 | 3300048921 | Bacteria | 1267 |
| 737 | Ga0496119_0000096 | 3300048922 | Bacteria | 129464 |
| 738 | Ga0496119_0043543 | 3300048922 | Bacteria | 2834 |
| 739 | Ga0496119_0141017 | 3300048922 | Bacteria | 1301 |
| 740 | Ga0496120_0000068 | 3300048923 | Bacteria | 166108 |
| 741 | Ga0496120_0001484 | 3300048923 | Bacteria | 27899 |
| 742 | Ga0496120_0012013 | 3300048923 | Bacteria | 5917 |
| 743 | Ga0496120_0037924 | 3300048923 | Bacteria | 2855 |
| 744 | Ga0496122_0015833 | 3300048925 | Bacteria | 7183 |
| 745 | Ga0496122_0036749 | 3300048925 | Bacteria | 3954 |
| 746 | Ga0496122_0041854 | 3300048925 | Bacteria | 3613 |
| 747 | Ga0496122_0091384 | 3300048925 | Bacteria | 2072 |
| 748 | Ga0496122_0106151 | 3300048925 | Bacteria | 1860 |
| 749 | Ga0496122_0110038 | 3300048925 | Bacteria | 1811 |
| 750 | Ga0496123_0000017 | 3300048926 | Bacteria | 415261 |
| 751 | Ga0496123_0003747 | 3300048926 | Bacteria | 16670 |
| 752 | Ga0496123_0003886 | 3300048926 | Bacteria | 16250 |
| 753 | Ga0496123_0047025 | 3300048926 | Bacteria | 2920 |
| 754 | Ga0496123_0081909 | 3300048926 | Bacteria | 1958 |
| 755 | Ga0496124_0002686 | 3300048927 | Bacteria | 22780 |
| 756 | Ga0496124_0007846 | 3300048927 | Bacteria | 11258 |
| 757 | Ga0496124_0014571 | 3300048927 | Bacteria | 7595 |
| 758 | Ga0496124_0112980 | 3300048927 | Bacteria | 2183 |
| 759 | Ga0496124_0129821 | 3300048927 | Bacteria | 2003 |
| 760 | Ga0496124_0132795 | 3300048927 | Bacteria | 1975 |
| 761 | Ga0496124_0426659 | 3300048927 | Bacteria | 911 |
| 762 | Ga0496125_0000257 | 3300048928 | Bacteria | 109544 |
| 763 | Ga0496125_0062599 | 3300048928 | Bacteria | 2973 |
| 764 | Ga0496125_0378314 | 3300048928 | Bacteria | 835 |
| 765 | Ga0496125_0423078 | 3300048928 | Bacteria | 771 |
| 766 | Ga0496126_0026967 | 3300048929 | Bacteria | 5498 |
| 767 | Ga0496126_0121308 | 3300048929 | Bacteria | 2266 |
| 768 | Ga0496126_0223284 | 3300048929 | Bacteria | 1581 |
| 769 | Ga0496126_0278353 | 3300048929 | Bacteria | 1386 |
| 770 | Ga0496126_0538184 | 3300048929 | Bacteria | 928 |
| 771 | Ga0496126_0578795 | 3300048929 | Bacteria | 887 |
| 772 | Ga0501309_064336 | 3300049129 | Bacteria | 594 |
| 773 | Ga0495678_000142 | 3300049459 | Bacteria | 86788 |
| 774 | Ga0495682_0000034 | 3300049460 | Bacteria | 131806 |
| 775 | Ga0501321_064068 | 3300049537 | Bacteria | 561 |
| 776 | Ga0501031_0834514 | 3300049568 | Bacteria | 591 |
| 777 | Ga0501031_0890105 | 3300049568 | Bacteria | 570 |
| 778 | Ga0501036_0123130 | 3300049572 | Bacteria | 2190 |
| 779 | Ga0501036_0404512 | 3300049572 | Bacteria | 1139 |
| 780 | Ga0501036_0790560 | 3300049572 | Bacteria | 782 |
| 781 | Ga0501037_1073158 | 3300049573 | Bacteria | 522 |
| 782 | Ga0501038_1365656 | 3300049574 | Bacteria | 510 |
| 783 | Ga0501039_0730678 | 3300049575 | Bacteria | 774 |
| 784 | Ga0501040_0000689 | 3300049576 | Bacteria | 20856 |
| 785 | Ga0501040_0035854 | 3300049576 | Bacteria | 3365 |
| 786 | Ga0501040_0379717 | 3300049576 | Bacteria | 1014 |
| 787 | Ga0501041_0081307 | 3300049577 | Bacteria | 1995 |
| 788 | Ga0501041_0208653 | 3300049577 | Bacteria | 1225 |
| 789 | Ga0501041_0813086 | 3300049577 | Bacteria | 599 |
| 790 | Ga0501041_0929675 | 3300049577 | Bacteria | 559 |
| 791 | Ga0501042_0001376 | 3300049578 | Bacteria | 14274 |
| 792 | Ga0501042_0182779 | 3300049578 | Bacteria | 1513 |
| 793 | Ga0501042_0451370 | 3300049578 | Bacteria | 932 |
| 794 | Ga0501046_0137026 | 3300049580 | Bacteria | 1854 |
| 795 | Ga0501046_0998607 | 3300049580 | Bacteria | 581 |
| 796 | Ga0501048_0077675 | 3300049582 | Bacteria | 2343 |
| 797 | Ga0501048_0525545 | 3300049582 | Bacteria | 849 |
| 798 | Ga0501067_0018036 | 3300049583 | Bacteria | 3908 |
| 799 | Ga0501067_0151956 | 3300049583 | Bacteria | 1290 |
| 800 | Ga0501069_0058259 | 3300049585 | Bacteria | 2154 |
| 801 | Ga0501069_0179463 | 3300049585 | Bacteria | 1224 |
| 802 | Ga0501069_0616401 | 3300049585 | Bacteria | 652 |
| 803 | Ga0501071_0126574 | 3300049587 | Bacteria | 1896 |
| 804 | Ga0501071_0279281 | 3300049587 | Bacteria | 1264 |
| 805 | Ga0501071_0533925 | 3300049587 | Bacteria | 900 |
| 806 | Ga0501071_0569203 | 3300049587 | Bacteria | 871 |
| 807 | Ga0501071_0905556 | 3300049587 | Bacteria | 681 |
| 808 | Ga0501072_0185035 | 3300049588 | Bacteria | 1662 |
| 809 | Ga0501072_0227978 | 3300049588 | Bacteria | 1484 |
| 810 | Ga0501072_1542066 | 3300049588 | Bacteria | 512 |
| 811 | Ga0501073_1188386 | 3300049589 | Bacteria | 524 |
| 812 | Ga0501074_0189973 | 3300049590 | Bacteria | 1465 |
| 813 | Ga0501075_0083830 | 3300049591 | Bacteria | 2414 |
| 814 | Ga0501075_0104718 | 3300049591 | Bacteria | 2150 |
| 815 | Ga0501075_1358960 | 3300049591 | Bacteria | 538 |
| 816 | Ga0501076_0142777 | 3300049592 | Bacteria | 1946 |
| 817 | Ga0501076_0178315 | 3300049592 | Bacteria | 1732 |
| 818 | Ga0501076_0262777 | 3300049592 | Bacteria | 1413 |
| 819 | Ga0501076_0373776 | 3300049592 | Bacteria | 1171 |
| 820 | Ga0501077_0152455 | 3300049593 | Bacteria | 1467 |
| 821 | Ga0501077_0728935 | 3300049593 | Bacteria | 637 |
| 822 | Ga0501079_0016757 | 3300049741 | Bacteria | 5597 |
| 823 | Ga0501079_0441297 | 3300049741 | Bacteria | 1022 |
| 824 | Ga0501081_0137179 | 3300049743 | Bacteria | 1752 |
| 825 | Ga0501081_0680257 | 3300049743 | Bacteria | 772 |
| 826 | Ga0501268_108178 | 3300049765 | Bacteria | 604 |
| 827 | Ga0501044_1184625 | 3300049823 | Bacteria | 632 |
| 828 | Ga0501045_0018929 | 3300049824 | Bacteria | 4903 |
| 829 | Ga0501045_0384123 | 3300049824 | Bacteria | 1045 |
| 830 | nmdc:mga03n38_933098_c1 | 3300050490 | Bacteria | 511 |
| 831 | nmdc:mga00v17_103934_c1 | 3300050491 | Bacteria | 1796 |
| 832 | nmdc:mga00v17_428050_c1 | 3300050491 | Bacteria | 860 |
| 833 | nmdc:mga00v17_4898_c1 | 3300050491 | Bacteria | 7017 |
| 834 | nmdc:mga00v17_7754_c1 | 3300050491 | Bacteria | 5751 |
| 835 | nmdc:mga0k408_724843_c1 | 3300050493 | Bacteria | 582 |
| 836 | nmdc:mga05p37_12536_c1 | 3300050507 | Bacteria | 10122 |
| 837 | nmdc:mga05p37_333447_c1 | 3300050507 | Bacteria | 1791 |
| 838 | nmdc:mga09592_364608_c1 | 3300050508 | Bacteria | 1250 |
| 839 | nmdc:mga06r32_1243223_c1 | 3300050510 | Bacteria | 690 |
| 840 | nmdc:mga06r32_608563_c1 | 3300050510 | Bacteria | 1063 |
| 841 | nmdc:mga08y16_325473_c1 | 3300050511 | Bacteria | 1582 |
| 842 | nmdc:mga08y16_710939_c1 | 3300050511 | Bacteria | 1004 |
| 843 | nmdc:mga0n895_131003_c1 | 3300050512 | Bacteria | 2533 |
| 844 | nmdc:mga0n895_1375284_c1 | 3300050512 | Bacteria | 675 |
| 845 | nmdc:mga0n895_1596768_c1 | 3300050512 | Bacteria | 617 |
| 846 | nmdc:mga0n895_172295_c1 | 3300050512 | Bacteria | 2196 |
| 847 | nmdc:mga0n895_539572_c1 | 3300050512 | Bacteria | 1173 |
| 848 | nmdc:mga0n895_633293_c1 | 3300050512 | Bacteria | 1069 |
| 849 | nmdc:mga0rr50_1461385_c1 | 3300050513 | Bacteria | 578 |
| 850 | nmdc:mga0rr50_342789_c1 | 3300050513 | Bacteria | 1256 |
| 851 | nmdc:mga0rr50_903011_c1 | 3300050513 | Bacteria | 753 |
| 852 | nmdc:mga0rr50_999897_c1 | 3300050513 | Bacteria | 712 |
| 853 | nmdc:mga08x19_169150_c1 | 3300050514 | Bacteria | 1488 |
| 854 | nmdc:mga08x19_2213_c1 | 3300050514 | Bacteria | 11886 |
| 855 | nmdc:mga08x19_253604_c1 | 3300050514 | Bacteria | 1215 |
| 856 | nmdc:mga0a205_1018053_c1 | 3300050515 | Bacteria | 675 |
| 857 | nmdc:mga0a205_1114950_c1 | 3300050515 | Bacteria | 636 |
| 858 | nmdc:mga0a205_1436397_c1 | 3300050515 | Bacteria | 538 |
| 859 | nmdc:mga0a205_20518_c1 | 3300050515 | Bacteria | 6237 |
| 860 | Ga0495601_0030814 | 3300053077 | Bacteria | 3332 |
| 861 | Ga0495601_0062156 | 3300053077 | Bacteria | 2371 |
| 862 | Ga0495601_0145275 | 3300053077 | Bacteria | 1548 |
| 863 | Ga0495601_0862894 | 3300053077 | Bacteria | 573 |
| 864 | Ga0495595_0005704 | 3300053084 | Bacteria | 5040 |
| 865 | Ga0495619_0009495 | 3300053085 | Bacteria | 6136 |
| 866 | Ga0495619_0845462 | 3300053085 | Bacteria | 617 |
| 867 | Ga0500643_091563 | 3300053087 | Bacteria | 829 |
| 868 | Ga0500651_0331508 | 3300053093 | Bacteria | 867 |
| 869 | Ga0500566_0151491 | 3300053094 | Bacteria | 1219 |
| 870 | Ga0500650_0000042 | 3300053098 | Bacteria | 45991 |
| 871 | Ga0500650_0169634 | 3300053098 | Bacteria | 1004 |
| 872 | Ga0500556_0000982 | 3300053104 | Bacteria | 15104 |
| 873 | Ga0500621_000010 | 3300053126 | Bacteria | 169537 |
| 874 | Ga0500616_0006500 | 3300053153 | Bacteria | 7646 |
| 875 | Ga0500599_005452 | 3300053736 | Bacteria | 1598 |
| 876 | Ga0501084_0189534 | 3300054114 | Bacteria | 1735 |
| 877 | Ga0587084_004200 | 3300059477 | Bacteria | 1636 |
| 878 | Ga0587084_006709 | 3300059477 | Bacteria | 1407 |
| 879 | Ga0587093_028911 | 3300059478 | Bacteria | 787 |
| 880 | Ga0587066_010059 | 3300059490 | Bacteria | 1355 |
| 881 | Ga0587066_173776 | 3300059490 | Unclassified | 550 |
| 882 | Ga0587070_048654 | 3300059491 | Bacteria | 839 |
| 883 | Ga0587073_0042409 | 3300059492 | Bacteria | 998 |
| 884 | Ga0587073_0173368 | 3300059492 | Bacteria | 628 |
| 885 | Ga0587077_063206 | 3300059493 | Bacteria | 808 |
| 886 | Ga0587077_188075 | 3300059493 | Bacteria | 564 |
| 887 | Ga0587080_019861 | 3300059503 | Bacteria | 1092 |
| 888 | Ga0587082_094100 | 3300059504 | Bacteria | 644 |
| 889 | Ga0587083_0101259 | 3300059505 | Bacteria | 718 |
| 890 | Ga0587085_018762 | 3300059506 | Bacteria | 1029 |
| 891 | Ga0587085_170550 | 3300059506 | Bacteria | 515 |
| 892 | Ga0587086_018610 | 3300059507 | Bacteria | 927 |
| 893 | Ga0587086_053610 | 3300059507 | Bacteria | 656 |
| 894 | Ga0587088_025139 | 3300059508 | Bacteria | 1026 |
| 895 | Ga0587090_031596 | 3300059510 | Bacteria | 888 |
| 896 | Ga0587091_011222 | 3300059511 | Bacteria | 1393 |
| 897 | Ga0587094_024100 | 3300059513 | Bacteria | 904 |
| 898 | Ga0587098_062939 | 3300059604 | Bacteria | 586 |
| 899 | Ga0587106_044632 | 3300059605 | Bacteria | 765 |
| 900 | Ga0587101_005837 | 3300059623 | Bacteria | 1385 |
| 901 | Ga0587101_018117 | 3300059623 | Bacteria | 984 |
| 902 | Ga0587109_022371 | 3300059624 | Bacteria | 1138 |
| 903 | Ga0587109_060844 | 3300059624 | Bacteria | 795 |
| 904 | Ga0587109_076277 | 3300059624 | Bacteria | 733 |
| 905 | Ga0587109_223183 | 3300059624 | Bacteria | 500 |
| 906 | Ga0587115_072543 | 3300059626 | Bacteria | 597 |
| 907 | Ga0587117_008158 | 3300059627 | Bacteria | 1222 |
| 908 | Ga0587062_005914 | 3300059639 | Bacteria | 1370 |
| 909 | Ga0587062_072607 | 3300059639 | Bacteria | 625 |
| 910 | Ga0587062_106812 | 3300059639 | Bacteria | 551 |
| 911 | Ga0587067_210518 | 3300059640 | Bacteria | 522 |
| 912 | Ga0587068_007153 | 3300059641 | Bacteria | 1584 |
| 913 | Ga0587068_007869 | 3300059641 | Bacteria | 1530 |
| 914 | Ga0587068_126083 | 3300059641 | Bacteria | 560 |
| 915 | Ga0587069_006520 | 3300059642 | Bacteria | 1406 |
| 916 | Ga0587072_053091 | 3300059643 | Bacteria | 817 |
| 917 | Ga0587075_107564 | 3300059644 | Bacteria | 564 |
| 918 | Ga0587078_003122 | 3300059646 | Bacteria | 1653 |
| 919 | Ga0587079_096896 | 3300059647 | Bacteria | 699 |
| 920 | Ga0587100_004513 | 3300059648 | Bacteria | 1001 |
| 921 | Ga0587110_010347 | 3300059654 | Bacteria | 930 |
| 922 | Ga0587114_054034 | 3300059655 | Bacteria | 688 |
| 923 | Ga0587116_06544 | 3300059656 | Bacteria | 721 |
| 924 | Ga0587111_0015439 | 3300060346 | Bacteria | 1396 |
| 925 | Ga0587111_0063890 | 3300060346 | Bacteria | 844 |
| 926 | Ga0587111_0104283 | 3300060346 | Bacteria | 710 |
| 927 | Ga0501082_0055023 | 3300060353 | Bacteria | 3429 |
| 928 | Ga0501082_0834776 | 3300060353 | Bacteria | 806 |
| 929 | Ga0530510_0028513 | 3300061734 | Bacteria | 4004 |
| 930 | Ga0530510_1373887 | 3300061734 | Bacteria | 542 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300009094 | Ga0111539_10004274 | Ga0111539_100042747 | 76 |
| 2 | 3300009545 | Ga0105237_11562069 | Ga0105237_115620691 | 76 |
| 3 | 3300014326 | Ga0157380_11909416 | Ga0157380_119094162 | 76 |
| 4 | 3300028381 | Ga0268264_10614269 | Ga0268264_106142692 | 76 |
| 5 | 3300050511 | nmdc:mga08y16_325473_c1 | nmdc:mga08y16_325473_c1_372_653 | 76 |
| 6 | 3300050512 | nmdc:mga0n895_539572_c1 | nmdc:mga0n895_539572_c1_170_451 | 76 |
| 7 | 3300006358 | Ga0068871_100268104 | Ga0068871_1002681042 | 77 |
| 8 | 3300009148 | Ga0105243_11529111 | Ga0105243_115291111 | 77 |
| 9 | 3300013296 | Ga0157374_10000041 | Ga0157374_10000041110 | 77 |
| 10 | 3300014745 | Ga0157377_11261080 | Ga0157377_112610801 | 77 |
| 11 | 3300014969 | Ga0157376_10000279 | Ga0157376_1000027930 | 77 |
| 12 | 3300009098 | Ga0105245_11648019 | Ga0105245_116480192 | 78 |
| 13 | 3300003373 | JGI25407J50210_10014098 | JGI25407J50210_100140982 | 80 |
| 14 | 3300003373 | JGI25407J50210_10022505 | JGI25407J50210_100225052 | 80 |
| 15 | 3300005289 | Ga0065704_10192621 | Ga0065704_101926211 | 80 |
| 16 | 3300005334 | Ga0068869_101922093 | Ga0068869_1019220931 | 80 |
| 17 | 3300005338 | Ga0068868_100744812 | Ga0068868_1007448122 | 80 |
| 18 | 3300005344 | Ga0070661_100004365 | Ga0070661_1000043652 | 80 |
| 19 | 3300005356 | Ga0070674_100005188 | Ga0070674_1000051885 | 80 |
| 20 | 3300005366 | Ga0070659_100162621 | Ga0070659_1001626212 | 80 |
| 21 | 3300005366 | Ga0070659_100675619 | Ga0070659_1006756192 | 80 |
| 22 | 3300005366 | Ga0070659_101310826 | Ga0070659_1013108261 | 80 |
| 23 | 3300005455 | Ga0070663_100133296 | Ga0070663_1001332962 | 80 |
| 24 | 3300005455 | Ga0070663_100279881 | Ga0070663_1002798812 | 80 |
| 25 | 3300005456 | Ga0070678_101391748 | Ga0070678_1013917481 | 80 |
| 26 | 3300005458 | Ga0070681_10020737 | Ga0070681_100207375 | 80 |
| 27 | 3300005459 | Ga0068867_100440284 | Ga0068867_1004402841 | 80 |
| 28 | 3300005459 | Ga0068867_100566459 | Ga0068867_1005664592 | 80 |
| 29 | 3300005535 | Ga0070684_100010844 | Ga0070684_1000108446 | 80 |
| 30 | 3300005536 | Ga0070697_100103411 | Ga0070697_1001034112 | 80 |
| 31 | 3300005544 | Ga0070686_100309541 | Ga0070686_1003095412 | 80 |
| 32 | 3300005546 | Ga0070696_100098489 | Ga0070696_1000984893 | 80 |
| 33 | 3300005549 | Ga0070704_100036945 | Ga0070704_1000369452 | 80 |
| 34 | 3300005549 | Ga0070704_100757196 | Ga0070704_1007571962 | 80 |
| 35 | 3300005564 | Ga0070664_100801220 | Ga0070664_1008012202 | 80 |
| 36 | 3300005577 | Ga0068857_100001500 | Ga0068857_10000150016 | 80 |
| 37 | 3300005614 | Ga0068856_100154036 | Ga0068856_1001540362 | 80 |
| 38 | 3300005616 | Ga0068852_100001033 | Ga0068852_10000103317 | 80 |
| 39 | 3300005617 | Ga0068859_102784201 | Ga0068859_1027842012 | 80 |
| 40 | 3300005718 | Ga0068866_10474091 | Ga0068866_104740912 | 80 |
| 41 | 3300005834 | Ga0068851_10026625 | Ga0068851_100266252 | 80 |
| 42 | 3300005844 | Ga0068862_100269434 | Ga0068862_1002694342 | 80 |
| 43 | 3300005981 | Ga0081538_10000316 | Ga0081538_1000031646 | 80 |
| 44 | 3300005981 | Ga0081538_10000568 | Ga0081538_1000056835 | 80 |
| 45 | 3300005981 | Ga0081538_10011351 | Ga0081538_100113515 | 80 |
| 46 | 3300006028 | Ga0070717_10395338 | Ga0070717_103953382 | 80 |
| 47 | 3300006028 | Ga0070717_10909930 | Ga0070717_109099302 | 80 |
| 48 | 3300006038 | Ga0075365_11300008 | Ga0075365_113000082 | 80 |
| 49 | 3300006042 | Ga0075368_10248206 | Ga0075368_102482062 | 80 |
| 50 | 3300006847 | Ga0075431_101290581 | Ga0075431_1012905812 | 80 |
| 51 | 3300006852 | Ga0075433_10125052 | Ga0075433_101250522 | 80 |
| 52 | 3300006871 | Ga0075434_100031638 | Ga0075434_1000316383 | 80 |
| 53 | 3300006871 | Ga0075434_101898296 | Ga0075434_1018982962 | 80 |
| 54 | 3300006931 | Ga0097620_102784747 | Ga0097620_1027847472 | 80 |
| 55 | 3300007076 | Ga0075435_100156276 | Ga0075435_1001562762 | 80 |
| 56 | 3300009098 | Ga0105245_10724033 | Ga0105245_107240332 | 80 |
| 57 | 3300009147 | Ga0114129_10000835 | Ga0114129_1000083525 | 80 |
| 58 | 3300009147 | Ga0114129_13438895 | Ga0114129_134388951 | 80 |
| 59 | 3300009148 | Ga0105243_10034677 | Ga0105243_100346774 | 80 |
| 60 | 3300009148 | Ga0105243_10042550 | Ga0105243_100425503 | 80 |
| 61 | 3300009148 | Ga0105243_10175145 | Ga0105243_101751453 | 80 |
| 62 | 3300009174 | Ga0105241_10013752 | Ga0105241_100137522 | 80 |
| 63 | 3300009176 | Ga0105242_10329362 | Ga0105242_103293622 | 80 |
| 64 | 3300009176 | Ga0105242_10738312 | Ga0105242_107383122 | 80 |
| 65 | 3300009176 | Ga0105242_11090123 | Ga0105242_110901231 | 80 |
| 66 | 3300009545 | Ga0105237_10334099 | Ga0105237_103340992 | 80 |
| 67 | 3300009545 | Ga0105237_11897824 | Ga0105237_118978242 | 80 |
| 68 | 3300009553 | Ga0105249_10552453 | Ga0105249_105524532 | 80 |
| 69 | 3300010375 | Ga0105239_11356693 | Ga0105239_113566932 | 80 |
| 70 | 3300013100 | Ga0157373_10086503 | Ga0157373_100865032 | 80 |
| 71 | 3300013104 | Ga0157370_10020171 | Ga0157370_100201716 | 80 |
| 72 | 3300013105 | Ga0157369_10813069 | Ga0157369_108130691 | 80 |
| 73 | 3300013306 | Ga0163162_10081411 | Ga0163162_100814114 | 80 |
| 74 | 3300013307 | Ga0157372_10033421 | Ga0157372_100334215 | 80 |
| 75 | 3300014326 | Ga0157380_13338239 | Ga0157380_133382392 | 80 |
| 76 | 3300014968 | Ga0157379_11063450 | Ga0157379_110634502 | 80 |
| 77 | 3300025899 | Ga0207642_10034211 | Ga0207642_100342113 | 80 |
| 78 | 3300025911 | Ga0207654_10102010 | Ga0207654_101020102 | 80 |
| 79 | 3300025912 | Ga0207707_10089282 | Ga0207707_100892823 | 80 |
| 80 | 3300025919 | Ga0207657_10010093 | Ga0207657_100100939 | 80 |
| 81 | 3300025927 | Ga0207687_11372906 | Ga0207687_113729061 | 80 |
| 82 | 3300025932 | Ga0207690_10113459 | Ga0207690_101134592 | 80 |
| 83 | 3300025934 | Ga0207686_10409747 | Ga0207686_104097472 | 80 |
| 84 | 3300025935 | Ga0207709_10040659 | Ga0207709_100406593 | 80 |
| 85 | 3300025935 | Ga0207709_10140124 | Ga0207709_101401242 | 80 |
| 86 | 3300025938 | Ga0207704_11949122 | Ga0207704_119491221 | 80 |
| 87 | 3300025942 | Ga0207689_10167430 | Ga0207689_101674302 | 80 |
| 88 | 3300025944 | Ga0207661_10114147 | Ga0207661_101141472 | 80 |
| 89 | 3300025944 | Ga0207661_10972406 | Ga0207661_109724061 | 80 |
| 90 | 3300025945 | Ga0207679_11065287 | Ga0207679_110652872 | 80 |
| 91 | 3300026041 | Ga0207639_10209170 | Ga0207639_102091702 | 80 |
| 92 | 3300026067 | Ga0207678_10333724 | Ga0207678_103337242 | 80 |
| 93 | 3300026075 | Ga0207708_11984966 | Ga0207708_119849661 | 80 |
| 94 | 3300026089 | Ga0207648_10241563 | Ga0207648_102415632 | 80 |
| 95 | 3300026118 | Ga0207675_102275058 | Ga0207675_1022750582 | 80 |
| 96 | 3300026121 | Ga0207683_10737361 | Ga0207683_107373612 | 80 |
| 97 | 3300026142 | Ga0207698_10164811 | Ga0207698_101648112 | 80 |
| 98 | 3300032002 | Ga0307416_101520757 | Ga0307416_1015207572 | 80 |
| 99 | 3300037418 | Ga0395900_1103261 | Ga0395900_1103261_46_324 | 80 |
| 100 | 3300037466 | Ga0395898_0719478 | Ga0395898_0719478_25_303 | 80 |
| 101 | 3300038443 | Ga0395901_1066242 | Ga0395901_1066242_354_623 | 80 |
| 102 | 3300046455 | Ga0495603_0094613 | Ga0495603_0094613_29_298 | 80 |
| 103 | 3300046683 | Ga0495658_0274040 | Ga0495658_0274040_381_650 | 80 |
| 104 | 3300046690 | Ga0495624_0425656 | Ga0495624_0425656_15_284 | 80 |
| 105 | 3300048905 | Ga0496102_0067100 | Ga0496102_0067100_1270_1539 | 80 |
| 106 | 3300048906 | Ga0496103_0622336 | Ga0496103_0622336_118_387 | 80 |
| 107 | 3300048907 | Ga0496104_0353648 | Ga0496104_0353648_1037_1306 | 80 |
| 108 | 3300048909 | Ga0496106_0128267 | Ga0496106_0128267_781_1050 | 80 |
| 109 | 3300048909 | Ga0496106_0513142 | Ga0496106_0513142_525_794 | 80 |
| 110 | 3300048912 | Ga0496109_1045946 | Ga0496109_1045946_473_742 | 80 |
| 111 | 3300048913 | Ga0496110_1213064 | Ga0496110_1213064_294_563 | 80 |
| 112 | 3300049583 | Ga0501067_0151956 | Ga0501067_0151956_692_961 | 80 |
| 113 | 3300049585 | Ga0501069_0179463 | Ga0501069_0179463_455_724 | 80 |
| 114 | 3300049585 | Ga0501069_0616401 | Ga0501069_0616401_221_490 | 80 |
| 115 | 3300050490 | nmdc:mga03n38_933098_c1 | nmdc:mga03n38_933098_c1_196_465 | 80 |
| 116 | 3300050507 | nmdc:mga05p37_12536_c1 | nmdc:mga05p37_12536_c1_5891_6160 | 80 |
| 117 | 3300050510 | nmdc:mga06r32_1243223_c1 | nmdc:mga06r32_1243223_c1_268_537 | 80 |
| 118 | 3300050512 | nmdc:mga0n895_131003_c1 | nmdc:mga0n895_131003_c1_1456_1725 | 80 |
| 119 | 3300050512 | nmdc:mga0n895_1596768_c1 | nmdc:mga0n895_1596768_c1_31_300 | 80 |
| 120 | 3300050513 | nmdc:mga0rr50_342789_c1 | nmdc:mga0rr50_342789_c1_879_1148 | 80 |
| 121 | 3300050515 | nmdc:mga0a205_20518_c1 | nmdc:mga0a205_20518_c1_5113_5382 | 80 |
| 122 | 3300053104 | Ga0500556_0000982 | Ga0500556_0000982_4825_5094 | 80 |
| 123 | 3300053153 | Ga0500616_0006500 | Ga0500616_0006500_5009_5278 | 80 |
| 124 | 3300053736 | Ga0500599_005452 | Ga0500599_005452_867_1136 | 80 |
| 125 | 3300005341 | Ga0070691_10115008 | Ga0070691_101150082 | 81 |
| 126 | 3300005435 | Ga0070714_100014691 | Ga0070714_1000146912 | 81 |
| 127 | 3300005530 | Ga0070679_100029874 | Ga0070679_1000298742 | 81 |
| 128 | 3300005539 | Ga0068853_100146357 | Ga0068853_1001463573 | 81 |
| 129 | 3300005563 | Ga0068855_100011893 | Ga0068855_1000118936 | 81 |
| 130 | 3300005564 | Ga0070664_100057429 | Ga0070664_1000574294 | 81 |
| 131 | 3300005578 | Ga0068854_100145626 | Ga0068854_1001456262 | 81 |
| 132 | 3300009093 | Ga0105240_10004408 | Ga0105240_1000440816 | 81 |
| 133 | 3300009551 | Ga0105238_10009119 | Ga0105238_100091195 | 81 |
| 134 | 3300013102 | Ga0157371_10110671 | Ga0157371_101106712 | 81 |
| 135 | 3300013296 | Ga0157374_10202007 | Ga0157374_102020072 | 81 |
| 136 | 3300014497 | Ga0182008_10202502 | Ga0182008_102025022 | 81 |
| 137 | 3300025921 | Ga0207652_10082248 | Ga0207652_100822482 | 81 |
| 138 | 3300025924 | Ga0207694_10013370 | Ga0207694_100133704 | 81 |
| 139 | 3300026116 | Ga0207674_10000242 | Ga0207674_1000024239 | 81 |
| 140 | 3300041443 | Ga0451789_0815379 | Ga0451789_0815379_345_680 | 81 |
| 141 | 3300050512 | nmdc:mga0n895_633293_c1 | nmdc:mga0n895_633293_c1_740_1009 | 82 |
| 142 | 3300036647 | Ga0316582_0958278 | Ga0316582_0958278_116_385 | 83 |
| 143 | 3300033529 | Ga0316587_1094570 | Ga0316587_10945702 | 84 |
| 144 | 3300042435 | Ga0439434_0279246 | Ga0439434_0279246_63_317 | 84 |
| 145 | 3300041406 | Ga0439439_0156978 | Ga0439439_0156978_96_353 | 85 |
| 146 | 3300048914 | Ga0496111_0818000 | Ga0496111_0818000_366_623 | 85 |
| 147 | iso_pu_bacteria | 2547132181 | 2547696016 | 85 |
| 148 | iso_pu_bacteria | 2547132416 | 2548649188 | 85 |
| 149 | iso_pu_bacteria | 2561511199 | 2562464593 | 85 |
| 150 | iso_pu_bacteria | 2599185169 | 2599410267 | 85 |
| 151 | iso_pu_bacteria | 2600255254 | 2601523479 | 85 |
| 152 | iso_pu_bacteria | 2600255255 | 2601528638 | 85 |
| 153 | iso_pu_bacteria | 2600255256 | 2601534406 | 85 |
| 154 | iso_pu_bacteria | 2600255257 | 2601538815 | 85 |
| 155 | iso_pu_bacteria | 2600255280 | 2601615471 | 85 |
| 156 | iso_pu_bacteria | 2600255281 | 2601619603 | 85 |
| 157 | iso_pu_bacteria | 2600255287 | 2601643982 | 85 |
| 158 | iso_pu_bacteria | 2600255288 | 2601648008 | 85 |
| 159 | iso_pu_bacteria | 2600255289 | 2601653523 | 85 |
| 160 | iso_pu_bacteria | 2600255290 | 2601658356 | 85 |
| 161 | iso_pu_bacteria | 2600255291 | 2601663807 | 85 |
| 162 | iso_pu_bacteria | 2600255298 | 2601696312 | 85 |
| 163 | iso_pu_bacteria | 2600255299 | 2601701439 | 85 |
| 164 | iso_pu_bacteria | 2600255300 | 2601706178 | 85 |
| 165 | iso_pu_bacteria | 2600255301 | 2601711763 | 85 |
| 166 | iso_pu_bacteria | 2600255302 | 2601716781 | 85 |
| 167 | iso_pu_bacteria | 2600255303 | 2601721336 | 85 |
| 168 | iso_pu_bacteria | 2600255304 | 2601727187 | 85 |
| 169 | iso_pu_bacteria | 2600255305 | 2601731727 | 85 |
| 170 | iso_pu_bacteria | 2600255306 | 2601736739 | 85 |
| 171 | iso_pu_bacteria | 2600255307 | 2601740295 | 85 |
| 172 | iso_pu_bacteria | 2600255309 | 2601751232 | 85 |
| 173 | iso_pu_bacteria | 2600255310 | 2601757164 | 85 |
| 174 | iso_pu_bacteria | 2600255311 | 2601762235 | 85 |
| 175 | iso_pu_bacteria | 2600255392 | 2602018908 | 85 |
| 176 | iso_pu_bacteria | 2602042046 | 2603639513 | 85 |
| 177 | iso_pu_bacteria | 2602042047 | 2603644309 | 85 |
| 178 | iso_pu_bacteria | 2602042052 | 2603661195 | 85 |
| 179 | iso_pu_bacteria | 2602042053 | 2603666470 | 85 |
| 180 | iso_pu_bacteria | 2602042066 | 2603701167 | 85 |
| 181 | iso_pu_bacteria | 2602042067 | 2603704916 | 85 |
| 182 | iso_pu_bacteria | 2602042103 | 2603839124 | 85 |
| 183 | iso_pu_bacteria | 2602042104 | 2603843616 | 85 |
| 184 | iso_pu_bacteria | 2602042105 | 2603849281 | 85 |
| 185 | iso_pu_bacteria | 2602042106 | 2603854351 | 85 |
| 186 | iso_pu_bacteria | 2602042109 | 2603865690 | 85 |
| 187 | iso_pu_bacteria | 2602042110 | 2603872406 | 85 |
| 188 | iso_pu_bacteria | 2602042111 | 2603877282 | 85 |
| 189 | iso_pu_bacteria | 2603880178 | 2606049587 | 85 |
| 190 | iso_pu_bacteria | 2603880184 | 2606070902 | 85 |
| 191 | iso_pu_bacteria | 2603880202 | 2606147271 | 85 |
| 192 | iso_pu_bacteria | 2603880211 | 2606176996 | 85 |
| 193 | iso_pu_bacteria | 2609459761 | 2609911431 | 85 |
| 194 | iso_pu_bacteria | 2636415599 | 2637223171 | 85 |
| 195 | iso_pu_bacteria | 2643221541 | 2643728030 | 85 |
| 196 | iso_pu_bacteria | 2643221606 | 2644043020 | 85 |
| 197 | iso_pu_bacteria | 2643221671 | 2644395549 | 85 |
| 198 | iso_pu_bacteria | 2667528172 | 2671104565 | 85 |
| 199 | iso_pu_bacteria | 2671180115 | 2671586100 | 85 |
| 200 | iso_pu_bacteria | 2675903046 | 2676408638 | 85 |
| 201 | iso_pu_bacteria | 2681812866 | 2681998073 | 85 |
| 202 | iso_pu_bacteria | 2681812869 | 2682008193 | 85 |
| 203 | iso_pu_bacteria | 2706794495 | 2707101911 | 85 |
| 204 | iso_pu_bacteria | 2711768156 | 2712471273 | 85 |
| 205 | iso_pu_bacteria | 2751185917 | 2753857705 | 85 |
| 206 | iso_pu_bacteria | 2765235842 | 2765590821 | 85 |
| 207 | iso_pu_bacteria | 2775506706 | 2775540377 | 85 |
| 208 | iso_pu_bacteria | 2775507074 | 2777019495 | 85 |
| 209 | iso_pu_bacteria | 2791354903 | 2791925271 | 85 |
| 210 | iso_pu_bacteria | 2791355010 | 2792312601 | 85 |
| 211 | iso_pu_bacteria | 2791355275 | 2793403895 | 85 |
| 212 | iso_pu_bacteria | 2811995292 | 2813726799 | 85 |
| 213 | iso_pu_bacteria | 2814123068 | 2814694172 | 85 |
| 214 | iso_pu_bacteria | 2821118458 | 2821120703 | 85 |
| 215 | iso_pu_bacteria | 2823373977 | 2823376581 | 85 |
| 216 | iso_pu_bacteria | 2844425489 | 2844429194 | 85 |
| 217 | iso_pu_bacteria | 2846540461 | 2846544675 | 85 |
| 218 | iso_pu_bacteria | 2854601825 | 2854603105 | 85 |
| 219 | iso_pu_bacteria | 2855020534 | 2855021257 | 85 |
| 220 | iso_pu_bacteria | 2876601092 | 2876605843 | 85 |
| 221 | iso_pu_bacteria | 2881714928 | 2881716442 | 85 |
| 222 | iso_pu_bacteria | 2884086401 | 2884087048 | 85 |
| 223 | iso_pu_bacteria | 2891670763 | 2891675539 | 85 |
| 224 | iso_pu_bacteria | 2904513164 | 2904517086 | 85 |
| 225 | iso_pu_bacteria | 2919108558 | 2919113459 | 85 |
| 226 | iso_pu_bacteria | 2923634449 | 2923636711 | 85 |
| 227 | iso_pu_bacteria | 2927833300 | 2927836828 | 85 |
| 228 | iso_pu_bacteria | 2935625433 | 2935629480 | 85 |
| 229 | iso_pu_bacteria | 2937539931 | 2937544092 | 85 |
| 230 | iso_pu_bacteria | 2939568625 | 2939572395 | 85 |
| 231 | iso_pu_bacteria | 2939573065 | 2939576567 | 85 |
| 232 | iso_pu_bacteria | 2939602548 | 2939605923 | 85 |
| 233 | iso_pu_bacteria | 2939607340 | 2939610536 | 85 |
| 234 | iso_pu_bacteria | 2939617950 | 2939620543 | 85 |
| 235 | iso_pu_bacteria | 2939642701 | 2939645606 | 85 |
| 236 | iso_pu_bacteria | 2945874760 | 2945875862 | 85 |
| 237 | iso_pu_bacteria | 2969079654 | 2969080203 | 85 |
| 238 | iso_pu_bacteria | 2971820967 | 2971821547 | 85 |
| 239 | iso_pu_bacteria | 2974310843 | 2974314951 | 85 |
| 240 | iso_pu_bacteria | 2974435778 | 2974440276 | 85 |
| 241 | iso_pu_bacteria | 2984559226 | 2984562658 | 85 |
| 242 | iso_pu_bacteria | 2984595703 | 2984600718 | 85 |
| 243 | iso_pu_bacteria | 3000376612 | 3000377510 | 85 |
| 244 | iso_pu_bacteria | 8016733728 | 8016737383 | 85 |
| 245 | iso_pu_bacteria | 8018221730 | 8018226351 | 85 |
| 246 | iso_pu_bacteria | 8018405270 | 8018407059 | 85 |
| 247 | iso_pu_bacteria | 8019499862 | 8019502611 | 85 |
| 248 | iso_pu_bacteria | 8019504834 | 8019507500 | 85 |
| 249 | iso_pu_bacteria | 8054357960 | 8054359826 | 85 |
| 250 | iso_pu_bacteria | 8054844752 | 8054848216 | 85 |
| 251 | iso_pu_bacteria | 8054849141 | 8054853632 | 85 |
| 252 | iso_pu_bacteria | 8055087960 | 8055089559 | 85 |
| 253 | iso_pu_bacteria | 8055092621 | 8055095956 | 85 |
| 254 | iso_pu_bacteria | 8055097453 | 8055101700 | 85 |
| 255 | iso_pu_bacteria | 8055693939 | 8055694489 | 85 |
| 256 | iso_pu_bacteria | 8057304971 | 8057308436 | 85 |
| 257 | 3300014326 | Ga0157380_11021783 | Ga0157380_110217832 | 86 |
| 258 | 3300032133 | Ga0316583_10027512 | Ga0316583_100275122 | 87 |
| 259 | 3300044712 | Ga0453684_1699961 | Ga0453684_1699961_47_310 | 87 |
| 260 | 3300004800 | Ga0058861_11934168 | Ga0058861_119341681 | 88 |
| 261 | 3300005290 | Ga0065712_10006792 | Ga0065712_100067922 | 88 |
| 262 | 3300005293 | Ga0065715_10524455 | Ga0065715_105244551 | 88 |
| 263 | 3300005331 | Ga0070670_100994175 | Ga0070670_1009941752 | 88 |
| 264 | 3300005337 | Ga0070682_100621414 | Ga0070682_1006214141 | 88 |
| 265 | 3300005343 | Ga0070687_101072020 | Ga0070687_1010720201 | 88 |
| 266 | 3300005354 | Ga0070675_101278470 | Ga0070675_1012784702 | 88 |
| 267 | 3300005457 | Ga0070662_100810496 | Ga0070662_1008104961 | 88 |
| 268 | 3300005530 | Ga0070679_100512280 | Ga0070679_1005122802 | 88 |
| 269 | 3300005530 | Ga0070679_100971313 | Ga0070679_1009713132 | 88 |
| 270 | 3300005539 | Ga0068853_100645924 | Ga0068853_1006459242 | 88 |
| 271 | 3300005547 | Ga0070693_100076511 | Ga0070693_1000765113 | 88 |
| 272 | 3300005564 | Ga0070664_101763249 | Ga0070664_1017632492 | 88 |
| 273 | 3300005617 | Ga0068859_100221937 | Ga0068859_1002219372 | 88 |
| 274 | 3300005617 | Ga0068859_101334818 | Ga0068859_1013348182 | 88 |
| 275 | 3300006880 | Ga0075429_101102091 | Ga0075429_1011020912 | 88 |
| 276 | 3300006931 | Ga0097620_100221926 | Ga0097620_1002219262 | 88 |
| 277 | 3300006931 | Ga0097620_101334918 | Ga0097620_1013349182 | 88 |
| 278 | 3300009094 | Ga0111539_11900195 | Ga0111539_119001951 | 88 |
| 279 | 3300009094 | Ga0111539_12618092 | Ga0111539_126180921 | 88 |
| 280 | 3300009553 | Ga0105249_11276104 | Ga0105249_112761041 | 88 |
| 281 | 3300014326 | Ga0157380_10421311 | Ga0157380_104213112 | 88 |
| 282 | 3300015262 | Ga0182007_10358591 | Ga0182007_103585912 | 88 |
| 283 | 3300025912 | Ga0207707_10545442 | Ga0207707_105454422 | 88 |
| 284 | 3300025921 | Ga0207652_11360482 | Ga0207652_113604822 | 88 |
| 285 | 3300025923 | Ga0207681_10384258 | Ga0207681_103842581 | 88 |
| 286 | 3300025926 | Ga0207659_10363763 | Ga0207659_103637631 | 88 |
| 287 | 3300025932 | Ga0207690_10034322 | Ga0207690_100343222 | 88 |
| 288 | 3300025933 | Ga0207706_11362368 | Ga0207706_113623682 | 88 |
| 289 | 3300025936 | Ga0207670_11195146 | Ga0207670_111951461 | 88 |
| 290 | 3300025938 | Ga0207704_11265850 | Ga0207704_112658501 | 88 |
| 291 | 3300025961 | Ga0207712_10887116 | Ga0207712_108871162 | 88 |
| 292 | 3300025986 | Ga0207658_10756672 | Ga0207658_107566722 | 88 |
| 293 | 3300026041 | Ga0207639_10435721 | Ga0207639_104357212 | 88 |
| 294 | 3300027876 | Ga0209974_10147921 | Ga0209974_101479212 | 88 |
| 295 | 3300027907 | Ga0207428_10051391 | Ga0207428_100513913 | 88 |
| 296 | 3300027907 | Ga0207428_10834273 | Ga0207428_108342731 | 88 |
| 297 | 3300035170 | Ga0373943_0536708 | Ga0373943_0536708_106_372 | 88 |
| 298 | 3300035692 | Ga0373935_0206669 | Ga0373935_0206669_285_551 | 88 |
| 299 | 3300036401 | Ga0373937_0028161 | Ga0373937_0028161_1427_1693 | 88 |
| 300 | 3300036401 | Ga0373937_0634165 | Ga0373937_0634165_338_604 | 88 |
| 301 | 3300045051 | Ga0451576_2125887 | Ga0451576_2125887_113_379 | 88 |
| 302 | 3300046459 | Ga0495629_0000050 | Ga0495629_0000050_7646_7912 | 88 |
| 303 | 3300046475 | Ga0495639_0038817 | Ga0495639_0038817_1692_1958 | 88 |
| 304 | 3300046476 | Ga0495662_0150273 | Ga0495662_0150273_463_729 | 88 |
| 305 | 3300046499 | Ga0495594_0144215 | Ga0495594_0144215_1013_1279 | 88 |
| 306 | 3300046533 | Ga0495640_0505436 | Ga0495640_0505436_15_281 | 88 |
| 307 | 3300046642 | Ga0495634_0123409 | Ga0495634_0123409_180_446 | 88 |
| 308 | 3300046663 | Ga0495635_0004071 | Ga0495635_0004071_5093_5359 | 88 |
| 309 | 3300046681 | Ga0495647_0324062 | Ga0495647_0324062_265_531 | 88 |
| 310 | 3300046683 | Ga0495658_0000628 | Ga0495658_0000628_18005_18271 | 88 |
| 311 | 3300046689 | Ga0495613_0012456 | Ga0495613_0012456_4455_4721 | 88 |
| 312 | 3300047315 | Ga0495581_0003831 | Ga0495581_0003831_5750_6016 | 88 |
| 313 | 3300047322 | Ga0495680_0100224 | Ga0495680_0100224_60_326 | 88 |
| 314 | 3300048089 | Ga0495614_0045025 | Ga0495614_0045025_542_808 | 88 |
| 315 | 3300048905 | Ga0496102_1854620 | Ga0496102_1854620_217_483 | 88 |
| 316 | 3300048909 | Ga0496106_1572538 | Ga0496106_1572538_142_408 | 88 |
| 317 | 3300048911 | Ga0496108_0329617 | Ga0496108_0329617_613_879 | 88 |
| 318 | 3300048912 | Ga0496109_0152471 | Ga0496109_0152471_1862_2128 | 88 |
| 319 | 3300048915 | Ga0496112_0190813 | Ga0496112_0190813_1325_1591 | 88 |
| 320 | 3300049572 | Ga0501036_0123130 | Ga0501036_0123130_24_290 | 88 |
| 321 | 3300049576 | Ga0501040_0035854 | Ga0501040_0035854_1630_1896 | 88 |
| 322 | 3300049576 | Ga0501040_0379717 | Ga0501040_0379717_53_319 | 88 |
| 323 | 3300049577 | Ga0501041_0208653 | Ga0501041_0208653_151_417 | 88 |
| 324 | 3300049578 | Ga0501042_0451370 | Ga0501042_0451370_157_423 | 88 |
| 325 | 3300049580 | Ga0501046_0137026 | Ga0501046_0137026_584_850 | 88 |
| 326 | 3300049582 | Ga0501048_0077675 | Ga0501048_0077675_1666_1932 | 88 |
| 327 | 3300049583 | Ga0501067_0018036 | Ga0501067_0018036_1219_1485 | 88 |
| 328 | 3300049585 | Ga0501069_0058259 | Ga0501069_0058259_1444_1710 | 88 |
| 329 | 3300049587 | Ga0501071_0126574 | Ga0501071_0126574_706_972 | 88 |
| 330 | 3300049587 | Ga0501071_0533925 | Ga0501071_0533925_537_803 | 88 |
| 331 | 3300049588 | Ga0501072_1542066 | Ga0501072_1542066_72_338 | 88 |
| 332 | 3300049591 | Ga0501075_0083830 | Ga0501075_0083830_805_1071 | 88 |
| 333 | 3300049591 | Ga0501075_0104718 | Ga0501075_0104718_527_793 | 88 |
| 334 | 3300049592 | Ga0501076_0178315 | Ga0501076_0178315_110_376 | 88 |
| 335 | 3300049592 | Ga0501076_0262777 | Ga0501076_0262777_187_453 | 88 |
| 336 | 3300049741 | Ga0501079_0016757 | Ga0501079_0016757_33_299 | 88 |
| 337 | 3300049743 | Ga0501081_0137179 | Ga0501081_0137179_683_949 | 88 |
| 338 | 3300049743 | Ga0501081_0680257 | Ga0501081_0680257_363_629 | 88 |
| 339 | 3300049824 | Ga0501045_0018929 | Ga0501045_0018929_56_322 | 88 |
| 340 | 3300049824 | Ga0501045_0384123 | Ga0501045_0384123_291_557 | 88 |
| 341 | 3300050511 | nmdc:mga08y16_710939_c1 | nmdc:mga08y16_710939_c1_655_921 | 88 |
| 342 | 3300050512 | nmdc:mga0n895_1375284_c1 | nmdc:mga0n895_1375284_c1_238_504 | 88 |
| 343 | 3300050513 | nmdc:mga0rr50_1461385_c1 | nmdc:mga0rr50_1461385_c1_163_429 | 88 |
| 344 | 3300053085 | Ga0495619_0009495 | Ga0495619_0009495_4316_4582 | 88 |
| 345 | 3300059492 | Ga0587073_0173368 | Ga0587073_0173368_104_370 | 88 |
| 346 | 3300059506 | Ga0587085_170550 | Ga0587085_170550_88_354 | 88 |
| 347 | 3300059624 | Ga0587109_223183 | Ga0587109_223183_57_323 | 88 |
| 348 | 3300059639 | Ga0587062_072607 | Ga0587062_072607_278_544 | 88 |
| 349 | 3300059641 | Ga0587068_126083 | Ga0587068_126083_243_509 | 88 |
| 350 | 3300059655 | Ga0587114_054034 | Ga0587114_054034_279_545 | 88 |
| 351 | 3300060353 | Ga0501082_0055023 | Ga0501082_0055023_1957_2223 | 88 |
| 352 | 3300061734 | Ga0530510_0028513 | Ga0530510_0028513_2125_2391 | 88 |
| 353 | 3300003163 | Ga0006759J45824_1058806 | Ga0006759J45824_10588062 | 89 |
| 354 | 3300003300 | Ga0006758J48902_1012343 | Ga0006758J48902_10123432 | 89 |
| 355 | 3300003320 | rootH2_10099991 | rootH2_100999914 | 89 |
| 356 | 3300003856 | Ga0058692_1001828 | Ga0058692_10018284 | 89 |
| 357 | 3300003856 | Ga0058692_1003718 | Ga0058692_10037184 | 89 |
| 358 | 3300003856 | Ga0058692_1007337 | Ga0058692_10073372 | 89 |
| 359 | 3300003856 | Ga0058692_1008844 | Ga0058692_10088444 | 89 |
| 360 | 3300004799 | Ga0058863_11886113 | Ga0058863_118861131 | 89 |
| 361 | 3300004800 | Ga0058861_11616176 | Ga0058861_116161761 | 89 |
| 362 | 3300005289 | Ga0065704_10079030 | Ga0065704_100790303 | 89 |
| 363 | 3300005289 | Ga0065704_10668912 | Ga0065704_106689121 | 89 |
| 364 | 3300005331 | Ga0070670_100000019 | Ga0070670_1000000199 | 89 |
| 365 | 3300005331 | Ga0070670_101006352 | Ga0070670_1010063521 | 89 |
| 366 | 3300005331 | Ga0070670_101210985 | Ga0070670_1012109851 | 89 |
| 367 | 3300005334 | Ga0068869_100209344 | Ga0068869_1002093442 | 89 |
| 368 | 3300005335 | Ga0070666_10074462 | Ga0070666_100744622 | 89 |
| 369 | 3300005339 | Ga0070660_100809058 | Ga0070660_1008090582 | 89 |
| 370 | 3300005340 | Ga0070689_101479796 | Ga0070689_1014797961 | 89 |
| 371 | 3300005340 | Ga0070689_101969575 | Ga0070689_1019695751 | 89 |
| 372 | 3300005343 | Ga0070687_101205932 | Ga0070687_1012059321 | 89 |
| 373 | 3300005347 | Ga0070668_100101690 | Ga0070668_1001016902 | 89 |
| 374 | 3300005353 | Ga0070669_100000695 | Ga0070669_10000069516 | 89 |
| 375 | 3300005355 | Ga0070671_100000080 | Ga0070671_1000000809 | 89 |
| 376 | 3300005365 | Ga0070688_100032517 | Ga0070688_1000325172 | 89 |
| 377 | 3300005366 | Ga0070659_100094862 | Ga0070659_1000948622 | 89 |
| 378 | 3300005367 | Ga0070667_100000020 | Ga0070667_1000000209 | 89 |
| 379 | 3300005367 | Ga0070667_100020021 | Ga0070667_1000200211 | 89 |
| 380 | 3300005434 | Ga0070709_10384656 | Ga0070709_103846562 | 89 |
| 381 | 3300005445 | Ga0070708_100084158 | Ga0070708_1000841583 | 89 |
| 382 | 3300005445 | Ga0070708_100147665 | Ga0070708_1001476652 | 89 |
| 383 | 3300005459 | Ga0068867_100147103 | Ga0068867_1001471032 | 89 |
| 384 | 3300005466 | Ga0070685_10000015 | Ga0070685_10000015113 | 89 |
| 385 | 3300005467 | Ga0070706_100331957 | Ga0070706_1003319572 | 89 |
| 386 | 3300005467 | Ga0070706_101731440 | Ga0070706_1017314402 | 89 |
| 387 | 3300005468 | Ga0070707_100320586 | Ga0070707_1003205862 | 89 |
| 388 | 3300005468 | Ga0070707_100552277 | Ga0070707_1005522772 | 89 |
| 389 | 3300005471 | Ga0070698_100588143 | Ga0070698_1005881432 | 89 |
| 390 | 3300005471 | Ga0070698_100903659 | Ga0070698_1009036592 | 89 |
| 391 | 3300005518 | Ga0070699_100070624 | Ga0070699_1000706241 | 89 |
| 392 | 3300005518 | Ga0070699_100804801 | Ga0070699_1008048011 | 89 |
| 393 | 3300005530 | Ga0070679_100490261 | Ga0070679_1004902612 | 89 |
| 394 | 3300005535 | Ga0070684_101799832 | Ga0070684_1017998321 | 89 |
| 395 | 3300005536 | Ga0070697_100360800 | Ga0070697_1003608002 | 89 |
| 396 | 3300005536 | Ga0070697_100390845 | Ga0070697_1003908452 | 89 |
| 397 | 3300005539 | Ga0068853_101785807 | Ga0068853_1017858072 | 89 |
| 398 | 3300005546 | Ga0070696_100277229 | Ga0070696_1002772292 | 89 |
| 399 | 3300005547 | Ga0070693_101193623 | Ga0070693_1011936231 | 89 |
| 400 | 3300005548 | Ga0070665_100000743 | Ga0070665_10000074338 | 89 |
| 401 | 3300005548 | Ga0070665_100010055 | Ga0070665_1000100554 | 89 |
| 402 | 3300005548 | Ga0070665_100111083 | Ga0070665_1001110832 | 89 |
| 403 | 3300005548 | Ga0070665_101562233 | Ga0070665_1015622331 | 89 |
| 404 | 3300005549 | Ga0070704_100199961 | Ga0070704_1001999611 | 89 |
| 405 | 3300005549 | Ga0070704_100639706 | Ga0070704_1006397062 | 89 |
| 406 | 3300005564 | Ga0070664_100444857 | Ga0070664_1004448572 | 89 |
| 407 | 3300005577 | Ga0068857_100000067 | Ga0068857_10000006721 | 89 |
| 408 | 3300005578 | Ga0068854_101712014 | Ga0068854_1017120142 | 89 |
| 409 | 3300005615 | Ga0070702_101744924 | Ga0070702_1017449241 | 89 |
| 410 | 3300005617 | Ga0068859_100063249 | Ga0068859_1000632492 | 89 |
| 411 | 3300005617 | Ga0068859_100115845 | Ga0068859_1001158452 | 89 |
| 412 | 3300005617 | Ga0068859_101291674 | Ga0068859_1012916741 | 89 |
| 413 | 3300005618 | Ga0068864_100000030 | Ga0068864_10000003010 | 89 |
| 414 | 3300005618 | Ga0068864_100161442 | Ga0068864_1001614422 | 89 |
| 415 | 3300005718 | Ga0068866_10681168 | Ga0068866_106811682 | 89 |
| 416 | 3300005834 | Ga0068851_10007777 | Ga0068851_100077774 | 89 |
| 417 | 3300005841 | Ga0068863_100050349 | Ga0068863_1000503492 | 89 |
| 418 | 3300005841 | Ga0068863_100210302 | Ga0068863_1002103022 | 89 |
| 419 | 3300005842 | Ga0068858_100030063 | Ga0068858_1000300635 | 89 |
| 420 | 3300005842 | Ga0068858_100534677 | Ga0068858_1005346772 | 89 |
| 421 | 3300005843 | Ga0068860_100005350 | Ga0068860_1000053502 | 89 |
| 422 | 3300005843 | Ga0068860_100012322 | Ga0068860_1000123222 | 89 |
| 423 | 3300005843 | Ga0068860_101296361 | Ga0068860_1012963612 | 89 |
| 424 | 3300005844 | Ga0068862_100004594 | Ga0068862_1000045944 | 89 |
| 425 | 3300005844 | Ga0068862_100023696 | Ga0068862_1000236965 | 89 |
| 426 | 3300005844 | Ga0068862_100899789 | Ga0068862_1008997891 | 89 |
| 427 | 3300005844 | Ga0068862_102159059 | Ga0068862_1021590592 | 89 |
| 428 | 3300005937 | Ga0081455_10745870 | Ga0081455_107458701 | 89 |
| 429 | 3300006028 | Ga0070717_11541774 | Ga0070717_115417741 | 89 |
| 430 | 3300006051 | Ga0075364_10592572 | Ga0075364_105925721 | 89 |
| 431 | 3300006163 | Ga0070715_10092670 | Ga0070715_100926702 | 89 |
| 432 | 3300006173 | Ga0070716_100032327 | Ga0070716_1000323273 | 89 |
| 433 | 3300006173 | Ga0070716_100054495 | Ga0070716_1000544951 | 89 |
| 434 | 3300006173 | Ga0070716_100947520 | Ga0070716_1009475202 | 89 |
| 435 | 3300006195 | Ga0075366_10002842 | Ga0075366_100028424 | 89 |
| 436 | 3300006195 | Ga0075366_10623185 | Ga0075366_106231851 | 89 |
| 437 | 3300006237 | Ga0097621_100146214 | Ga0097621_1001462142 | 89 |
| 438 | 3300006237 | Ga0097621_101403989 | Ga0097621_1014039891 | 89 |
| 439 | 3300006358 | Ga0068871_100137733 | Ga0068871_1001377332 | 89 |
| 440 | 3300006358 | Ga0068871_100946271 | Ga0068871_1009462711 | 89 |
| 441 | 3300006847 | Ga0075431_101461878 | Ga0075431_1014618782 | 89 |
| 442 | 3300006847 | Ga0075431_101972585 | Ga0075431_1019725851 | 89 |
| 443 | 3300006852 | Ga0075433_10869318 | Ga0075433_108693182 | 89 |
| 444 | 3300006852 | Ga0075433_11520870 | Ga0075433_115208701 | 89 |
| 445 | 3300006852 | Ga0075433_11829087 | Ga0075433_118290871 | 89 |
| 446 | 3300006871 | Ga0075434_100389043 | Ga0075434_1003890432 | 89 |
| 447 | 3300006880 | Ga0075429_100041033 | Ga0075429_1000410335 | 89 |
| 448 | 3300006880 | Ga0075429_100677979 | Ga0075429_1006779791 | 89 |
| 449 | 3300006881 | Ga0068865_101429667 | Ga0068865_1014296671 | 89 |
| 450 | 3300006914 | Ga0075436_100019903 | Ga0075436_1000199032 | 89 |
| 451 | 3300006914 | Ga0075436_100040846 | Ga0075436_1000408463 | 89 |
| 452 | 3300006914 | Ga0075436_100046672 | Ga0075436_1000466722 | 89 |
| 453 | 3300006914 | Ga0075436_100199794 | Ga0075436_1001997941 | 89 |
| 454 | 3300006931 | Ga0097620_100063253 | Ga0097620_1000632532 | 89 |
| 455 | 3300006931 | Ga0097620_100115855 | Ga0097620_1001158552 | 89 |
| 456 | 3300006931 | Ga0097620_101291610 | Ga0097620_1012916101 | 89 |
| 457 | 3300006946 | Ga0079104_1002525 | Ga0079104_10025253 | 89 |
| 458 | 3300006946 | Ga0079104_1005316 | Ga0079104_10053164 | 89 |
| 459 | 3300007076 | Ga0075435_101016481 | Ga0075435_1010164812 | 89 |
| 460 | 3300007265 | Ga0099794_10068445 | Ga0099794_100684452 | 89 |
| 461 | 3300007265 | Ga0099794_10072242 | Ga0099794_100722423 | 89 |
| 462 | 3300007265 | Ga0099794_10085643 | Ga0099794_100856432 | 89 |
| 463 | 3300007788 | Ga0099795_10304542 | Ga0099795_103045422 | 89 |
| 464 | 3300009011 | Ga0105251_10006629 | Ga0105251_100066292 | 89 |
| 465 | 3300009011 | Ga0105251_10098795 | Ga0105251_100987952 | 89 |
| 466 | 3300009011 | Ga0105251_10123698 | Ga0105251_101236982 | 89 |
| 467 | 3300009036 | Ga0105244_10000033 | Ga0105244_10000033142 | 89 |
| 468 | 3300009036 | Ga0105244_10001764 | Ga0105244_1000176416 | 89 |
| 469 | 3300009036 | Ga0105244_10007310 | Ga0105244_100073104 | 89 |
| 470 | 3300009036 | Ga0105244_10019924 | Ga0105244_100199243 | 89 |
| 471 | 3300009036 | Ga0105244_10028021 | Ga0105244_100280214 | 89 |
| 472 | 3300009036 | Ga0105244_10035931 | Ga0105244_100359314 | 89 |
| 473 | 3300009092 | Ga0105250_10000171 | Ga0105250_1000017123 | 89 |
| 474 | 3300009092 | Ga0105250_10000367 | Ga0105250_1000036732 | 89 |
| 475 | 3300009092 | Ga0105250_10002542 | Ga0105250_100025424 | 89 |
| 476 | 3300009092 | Ga0105250_10004133 | Ga0105250_100041333 | 89 |
| 477 | 3300009092 | Ga0105250_10015315 | Ga0105250_100153154 | 89 |
| 478 | 3300009147 | Ga0114129_10097411 | Ga0114129_100974112 | 89 |
| 479 | 3300009147 | Ga0114129_10409703 | Ga0114129_104097032 | 89 |
| 480 | 3300009147 | Ga0114129_13015265 | Ga0114129_130152651 | 89 |
| 481 | 3300009148 | Ga0105243_10000946 | Ga0105243_100009462 | 89 |
| 482 | 3300009174 | Ga0105241_12315424 | Ga0105241_123154241 | 89 |
| 483 | 3300009176 | Ga0105242_10119392 | Ga0105242_101193922 | 89 |
| 484 | 3300009176 | Ga0105242_10478764 | Ga0105242_104787642 | 89 |
| 485 | 3300009176 | Ga0105242_10628096 | Ga0105242_106280962 | 89 |
| 486 | 3300009176 | Ga0105242_12191000 | Ga0105242_121910002 | 89 |
| 487 | 3300009177 | Ga0105248_10120360 | Ga0105248_101203602 | 89 |
| 488 | 3300009177 | Ga0105248_11473311 | Ga0105248_114733111 | 89 |
| 489 | 3300009545 | Ga0105237_10342305 | Ga0105237_103423052 | 89 |
| 490 | 3300009545 | Ga0105237_11815305 | Ga0105237_118153052 | 89 |
| 491 | 3300009545 | Ga0105237_12612570 | Ga0105237_126125702 | 89 |
| 492 | 3300009553 | Ga0105249_10036609 | Ga0105249_100366092 | 89 |
| 493 | 3300009553 | Ga0105249_10312258 | Ga0105249_103122582 | 89 |
| 494 | 3300009553 | Ga0105249_11605073 | Ga0105249_116050731 | 89 |
| 495 | 3300009986 | Ga0105033_122519 | Ga0105033_1225191 | 89 |
| 496 | 3300010159 | Ga0099796_10084423 | Ga0099796_100844232 | 89 |
| 497 | 3300010375 | Ga0105239_10605920 | Ga0105239_106059202 | 89 |
| 498 | 3300010375 | Ga0105239_10975641 | Ga0105239_109756411 | 89 |
| 499 | 3300011119 | Ga0105246_10247296 | Ga0105246_102472962 | 89 |
| 500 | 3300011119 | Ga0105246_10262157 | Ga0105246_102621572 | 89 |
| 501 | 3300011119 | Ga0105246_10522491 | Ga0105246_105224912 | 89 |
| 502 | 3300012482 | Ga0157318_1012286 | Ga0157318_10122862 | 89 |
| 503 | 3300013100 | Ga0157373_10005140 | Ga0157373_100051407 | 89 |
| 504 | 3300013100 | Ga0157373_10006277 | Ga0157373_100062775 | 89 |
| 505 | 3300013100 | Ga0157373_10096795 | Ga0157373_100967952 | 89 |
| 506 | 3300013102 | Ga0157371_10003717 | Ga0157371_100037177 | 89 |
| 507 | 3300013102 | Ga0157371_10006288 | Ga0157371_100062887 | 89 |
| 508 | 3300013104 | Ga0157370_10040666 | Ga0157370_100406662 | 89 |
| 509 | 3300013105 | Ga0157369_10000859 | Ga0157369_100008595 | 89 |
| 510 | 3300013297 | Ga0157378_10853802 | Ga0157378_108538022 | 89 |
| 511 | 3300013297 | Ga0157378_11302111 | Ga0157378_113021111 | 89 |
| 512 | 3300013297 | Ga0157378_11555733 | Ga0157378_115557331 | 89 |
| 513 | 3300013306 | Ga0163162_10032762 | Ga0163162_100327622 | 89 |
| 514 | 3300013306 | Ga0163162_10079829 | Ga0163162_100798292 | 89 |
| 515 | 3300013307 | Ga0157372_10000517 | Ga0157372_1000051745 | 89 |
| 516 | 3300013307 | Ga0157372_10005826 | Ga0157372_100058265 | 89 |
| 517 | 3300013307 | Ga0157372_10080425 | Ga0157372_100804254 | 89 |
| 518 | 3300013307 | Ga0157372_10140182 | Ga0157372_101401822 | 89 |
| 519 | 3300013307 | Ga0157372_10519603 | Ga0157372_105196032 | 89 |
| 520 | 3300013307 | Ga0157372_11133127 | Ga0157372_111331272 | 89 |
| 521 | 3300013308 | Ga0157375_10263011 | Ga0157375_102630112 | 89 |
| 522 | 3300013308 | Ga0157375_11288226 | Ga0157375_112882261 | 89 |
| 523 | 3300014968 | Ga0157379_10044050 | Ga0157379_100440503 | 89 |
| 524 | 3300014968 | Ga0157379_10425968 | Ga0157379_104259682 | 89 |
| 525 | 3300015679 | Ga0183366_1002 | Ga0183366_1002661 | 89 |
| 526 | 3300015680 | Ga0183370_1002 | Ga0183370_1002661 | 89 |
| 527 | 3300015685 | Ga0183369_1002 | Ga0183369_1002661 | 89 |
| 528 | 3300015687 | Ga0183368_1005 | Ga0183368_1005661 | 89 |
| 529 | 3300016635 | Ga0183361_15145 | Ga0183361_151452 | 89 |
| 530 | 3300017792 | Ga0163161_10310264 | Ga0163161_103102641 | 89 |
| 531 | 3300020076 | Ga0206355_1691689 | Ga0206355_16916891 | 89 |
| 532 | 3300020077 | Ga0206351_10564155 | Ga0206351_105641552 | 89 |
| 533 | 3300021361 | Ga0213872_10404087 | Ga0213872_104040872 | 89 |
| 534 | 3300021384 | Ga0213876_10000013 | Ga0213876_10000013234 | 89 |
| 535 | 3300022467 | Ga0224712_10275353 | Ga0224712_102753531 | 89 |
| 536 | 3300025245 | Ga0207425_1004532 | Ga0207425_10045323 | 89 |
| 537 | 3300025258 | Ga0209129_1000010 | Ga0209129_100001096 | 89 |
| 538 | 3300025321 | Ga0207656_10013864 | Ga0207656_100138644 | 89 |
| 539 | 3300025711 | Ga0207696_1000102 | Ga0207696_1000102158 | 89 |
| 540 | 3300025711 | Ga0207696_1000137 | Ga0207696_100013735 | 89 |
| 541 | 3300025711 | Ga0207696_1000272 | Ga0207696_10002723 | 89 |
| 542 | 3300025711 | Ga0207696_1000356 | Ga0207696_100035647 | 89 |
| 543 | 3300025711 | Ga0207696_1001421 | Ga0207696_10014214 | 89 |
| 544 | 3300025728 | Ga0207655_1000024 | Ga0207655_1000024242 | 89 |
| 545 | 3300025728 | Ga0207655_1000065 | Ga0207655_1000065118 | 89 |
| 546 | 3300025728 | Ga0207655_1000072 | Ga0207655_1000072101 | 89 |
| 547 | 3300025728 | Ga0207655_1000186 | Ga0207655_10001863 | 89 |
| 548 | 3300025728 | Ga0207655_1014327 | Ga0207655_10143272 | 89 |
| 549 | 3300025728 | Ga0207655_1016739 | Ga0207655_10167393 | 89 |
| 550 | 3300025728 | Ga0207655_1023983 | Ga0207655_10239833 | 89 |
| 551 | 3300025735 | Ga0207713_1000019 | Ga0207713_1000019109 | 89 |
| 552 | 3300025735 | Ga0207713_1000157 | Ga0207713_10001572 | 89 |
| 553 | 3300025735 | Ga0207713_1000300 | Ga0207713_10003002 | 89 |
| 554 | 3300025735 | Ga0207713_1003240 | Ga0207713_10032408 | 89 |
| 555 | 3300025735 | Ga0207713_1004405 | Ga0207713_10044055 | 89 |
| 556 | 3300025735 | Ga0207713_1093261 | Ga0207713_10932612 | 89 |
| 557 | 3300025900 | Ga0207710_10056669 | Ga0207710_100566692 | 89 |
| 558 | 3300025903 | Ga0207680_10016832 | Ga0207680_100168324 | 89 |
| 559 | 3300025905 | Ga0207685_10114787 | Ga0207685_101147872 | 89 |
| 560 | 3300025906 | Ga0207699_10882658 | Ga0207699_108826581 | 89 |
| 561 | 3300025910 | Ga0207684_10443962 | Ga0207684_104439621 | 89 |
| 562 | 3300025910 | Ga0207684_11413695 | Ga0207684_114136951 | 89 |
| 563 | 3300025913 | Ga0207695_10164440 | Ga0207695_101644403 | 89 |
| 564 | 3300025918 | Ga0207662_10926657 | Ga0207662_109266571 | 89 |
| 565 | 3300025920 | Ga0207649_10462963 | Ga0207649_104629631 | 89 |
| 566 | 3300025922 | Ga0207646_10124778 | Ga0207646_101247782 | 89 |
| 567 | 3300025922 | Ga0207646_10427501 | Ga0207646_104275012 | 89 |
| 568 | 3300025923 | Ga0207681_10001475 | Ga0207681_100014758 | 89 |
| 569 | 3300025925 | Ga0207650_10000034 | Ga0207650_10000034207 | 89 |
| 570 | 3300025925 | Ga0207650_11601334 | Ga0207650_116013341 | 89 |
| 571 | 3300025931 | Ga0207644_10000554 | Ga0207644_100005548 | 89 |
| 572 | 3300025934 | Ga0207686_10146215 | Ga0207686_101462152 | 89 |
| 573 | 3300025934 | Ga0207686_10219613 | Ga0207686_102196132 | 89 |
| 574 | 3300025934 | Ga0207686_11681316 | Ga0207686_116813161 | 89 |
| 575 | 3300025935 | Ga0207709_10004416 | Ga0207709_100044166 | 89 |
| 576 | 3300025935 | Ga0207709_10028321 | Ga0207709_100283214 | 89 |
| 577 | 3300025936 | Ga0207670_10297155 | Ga0207670_102971552 | 89 |
| 578 | 3300025939 | Ga0207665_10013281 | Ga0207665_100132816 | 89 |
| 579 | 3300025939 | Ga0207665_10048624 | Ga0207665_100486243 | 89 |
| 580 | 3300025939 | Ga0207665_11214242 | Ga0207665_112142421 | 89 |
| 581 | 3300025941 | Ga0207711_10001883 | Ga0207711_100018834 | 89 |
| 582 | 3300025941 | Ga0207711_10147279 | Ga0207711_101472792 | 89 |
| 583 | 3300025942 | Ga0207689_10291749 | Ga0207689_102917492 | 89 |
| 584 | 3300025942 | Ga0207689_10714172 | Ga0207689_107141722 | 89 |
| 585 | 3300025945 | Ga0207679_10665972 | Ga0207679_106659721 | 89 |
| 586 | 3300025961 | Ga0207712_10073913 | Ga0207712_100739132 | 89 |
| 587 | 3300025961 | Ga0207712_10172929 | Ga0207712_101729292 | 89 |
| 588 | 3300025961 | Ga0207712_10445966 | Ga0207712_104459661 | 89 |
| 589 | 3300025961 | Ga0207712_11369293 | Ga0207712_113692932 | 89 |
| 590 | 3300025972 | Ga0207668_10079704 | Ga0207668_100797042 | 89 |
| 591 | 3300025981 | Ga0207640_11814113 | Ga0207640_118141131 | 89 |
| 592 | 3300025986 | Ga0207658_10000015 | Ga0207658_10000015207 | 89 |
| 593 | 3300025986 | Ga0207658_10089130 | Ga0207658_100891302 | 89 |
| 594 | 3300026035 | Ga0207703_10019954 | Ga0207703_100199542 | 89 |
| 595 | 3300026088 | Ga0207641_10013032 | Ga0207641_100130325 | 89 |
| 596 | 3300026088 | Ga0207641_10212145 | Ga0207641_102121452 | 89 |
| 597 | 3300026088 | Ga0207641_10631733 | Ga0207641_106317332 | 89 |
| 598 | 3300026089 | Ga0207648_10066218 | Ga0207648_100662182 | 89 |
| 599 | 3300026095 | Ga0207676_10000032 | Ga0207676_10000032207 | 89 |
| 600 | 3300026095 | Ga0207676_10045203 | Ga0207676_100452032 | 89 |
| 601 | 3300026095 | Ga0207676_10173247 | Ga0207676_101732473 | 89 |
| 602 | 3300026116 | Ga0207674_10001008 | Ga0207674_1000100817 | 89 |
| 603 | 3300026142 | Ga0207698_10665837 | Ga0207698_106658372 | 89 |
| 604 | 3300027111 | Ga0209281_1000025 | Ga0209281_1000025112 | 89 |
| 605 | 3300027111 | Ga0209281_1000089 | Ga0209281_100008920 | 89 |
| 606 | 3300027111 | Ga0209281_1000279 | Ga0209281_10002793 | 89 |
| 607 | 3300027111 | Ga0209281_1000369 | Ga0209281_100036971 | 89 |
| 608 | 3300027111 | Ga0209281_1000559 | Ga0209281_10005595 | 89 |
| 609 | 3300027111 | Ga0209281_1003542 | Ga0209281_10035424 | 89 |
| 610 | 3300027252 | Ga0209973_1085902 | Ga0209973_10859021 | 89 |
| 611 | 3300027312 | Ga0209371_1000013 | Ga0209371_1000013564 | 89 |
| 612 | 3300027312 | Ga0209371_1000019 | Ga0209371_1000019447 | 89 |
| 613 | 3300027312 | Ga0209371_1000149 | Ga0209371_100014933 | 89 |
| 614 | 3300027312 | Ga0209371_1000346 | Ga0209371_10003463 | 89 |
| 615 | 3300027312 | Ga0209371_1000430 | Ga0209371_100043031 | 89 |
| 616 | 3300027312 | Ga0209371_1000649 | Ga0209371_100064924 | 89 |
| 617 | 3300027312 | Ga0209371_1000701 | Ga0209371_10007012 | 89 |
| 618 | 3300027312 | Ga0209371_1001333 | Ga0209371_10013334 | 89 |
| 619 | 3300027312 | Ga0209371_1005086 | Ga0209371_10050862 | 89 |
| 620 | 3300027312 | Ga0209371_1005550 | Ga0209371_10055504 | 89 |
| 621 | 3300027312 | Ga0209371_1007231 | Ga0209371_10072313 | 89 |
| 622 | 3300027312 | Ga0209371_1027476 | Ga0209371_10274761 | 89 |
| 623 | 3300027360 | Ga0209969_1011685 | Ga0209969_10116852 | 89 |
| 624 | 3300027364 | Ga0209967_1004221 | Ga0209967_10042212 | 89 |
| 625 | 3300027364 | Ga0209967_1006222 | Ga0209967_10062222 | 89 |
| 626 | 3300027378 | Ga0209981_1034326 | Ga0209981_10343262 | 89 |
| 627 | 3300027462 | Ga0210000_1014047 | Ga0210000_10140472 | 89 |
| 628 | 3300027462 | Ga0210000_1073563 | Ga0210000_10735631 | 89 |
| 629 | 3300027471 | Ga0209995_1082834 | Ga0209995_10828341 | 89 |
| 630 | 3300027512 | Ga0209179_1031179 | Ga0209179_10311792 | 89 |
| 631 | 3300027543 | Ga0209999_1038460 | Ga0209999_10384602 | 89 |
| 632 | 3300027543 | Ga0209999_1043159 | Ga0209999_10431591 | 89 |
| 633 | 3300027617 | Ga0210002_1051324 | Ga0210002_10513241 | 89 |
| 634 | 3300027665 | Ga0209983_1051643 | Ga0209983_10516432 | 89 |
| 635 | 3300027671 | Ga0209588_1069503 | Ga0209588_10695032 | 89 |
| 636 | 3300027671 | Ga0209588_1118027 | Ga0209588_11180272 | 89 |
| 637 | 3300027671 | Ga0209588_1123610 | Ga0209588_11236101 | 89 |
| 638 | 3300027682 | Ga0209971_1006049 | Ga0209971_10060495 | 89 |
| 639 | 3300027695 | Ga0209966_1157507 | Ga0209966_11575072 | 89 |
| 640 | 3300027717 | Ga0209998_10102751 | Ga0209998_101027512 | 89 |
| 641 | 3300027876 | Ga0209974_10002074 | Ga0209974_100020748 | 89 |
| 642 | 3300027876 | Ga0209974_10285719 | Ga0209974_102857192 | 89 |
| 643 | 3300028379 | Ga0268266_10000142 | Ga0268266_1000014234 | 89 |
| 644 | 3300028379 | Ga0268266_10013140 | Ga0268266_100131403 | 89 |
| 645 | 3300028379 | Ga0268266_11913141 | Ga0268266_119131411 | 89 |
| 646 | 3300028380 | Ga0268265_10003694 | Ga0268265_100036946 | 89 |
| 647 | 3300028380 | Ga0268265_10178350 | Ga0268265_101783502 | 89 |
| 648 | 3300028380 | Ga0268265_10975089 | Ga0268265_109750892 | 89 |
| 649 | 3300028380 | Ga0268265_11122145 | Ga0268265_111221452 | 89 |
| 650 | 3300028381 | Ga0268264_10000009 | Ga0268264_10000009651 | 89 |
| 651 | 3300028381 | Ga0268264_10200304 | Ga0268264_102003042 | 89 |
| 652 | 3300030500 | Ga0268256_1000014 | Ga0268256_1000014114 | 89 |
| 653 | 3300030500 | Ga0268256_1000024 | Ga0268256_100002478 | 89 |
| 654 | 3300030500 | Ga0268256_1000293 | Ga0268256_10002933 | 89 |
| 655 | 3300030500 | Ga0268256_1000868 | Ga0268256_10008683 | 89 |
| 656 | 3300030500 | Ga0268256_1002881 | Ga0268256_10028814 | 89 |
| 657 | 3300030500 | Ga0268256_1004055 | Ga0268256_10040553 | 89 |
| 658 | 3300030500 | Ga0268256_1004909 | Ga0268256_10049092 | 89 |
| 659 | 3300030500 | Ga0268256_1004912 | Ga0268256_10049124 | 89 |
| 660 | 3300030500 | Ga0268256_1005247 | Ga0268256_10052474 | 89 |
| 661 | 3300030500 | Ga0268256_1007258 | Ga0268256_10072583 | 89 |
| 662 | 3300030500 | Ga0268256_1021783 | Ga0268256_10217831 | 89 |
| 663 | 3300030500 | Ga0268256_1031248 | Ga0268256_10312482 | 89 |
| 664 | 3300031238 | Ga0265332_10002686 | Ga0265332_100026863 | 89 |
| 665 | 3300031251 | Ga0265327_10126045 | Ga0265327_101260452 | 89 |
| 666 | 3300031548 | Ga0307408_100047310 | Ga0307408_1000473102 | 89 |
| 667 | 3300031595 | Ga0265313_10311083 | Ga0265313_103110832 | 89 |
| 668 | 3300031665 | Ga0316575_10000197 | Ga0316575_1000019720 | 89 |
| 669 | 3300031691 | Ga0316579_10407697 | Ga0316579_104076971 | 89 |
| 670 | 3300031727 | Ga0316576_10063914 | Ga0316576_100639142 | 89 |
| 671 | 3300031727 | Ga0316576_10147785 | Ga0316576_101477852 | 89 |
| 672 | 3300031731 | Ga0307405_11107526 | Ga0307405_111075261 | 89 |
| 673 | 3300031901 | Ga0307406_11276624 | Ga0307406_112766241 | 89 |
| 674 | 3300031911 | Ga0307412_10131597 | Ga0307412_101315972 | 89 |
| 675 | 3300031911 | Ga0307412_11417406 | Ga0307412_114174061 | 89 |
| 676 | 3300031995 | Ga0307409_100361700 | Ga0307409_1003617002 | 89 |
| 677 | 3300031995 | Ga0307409_101487959 | Ga0307409_1014879592 | 89 |
| 678 | 3300032002 | Ga0307416_100916550 | Ga0307416_1009165501 | 89 |
| 679 | 3300032005 | Ga0307411_10384953 | Ga0307411_103849532 | 89 |
| 680 | 3300032126 | Ga0307415_100583389 | Ga0307415_1005833892 | 89 |
| 681 | 3300032168 | Ga0316593_10004458 | Ga0316593_100044584 | 89 |
| 682 | 3300032168 | Ga0316593_10006857 | Ga0316593_100068572 | 89 |
| 683 | 3300032168 | Ga0316593_10101388 | Ga0316593_101013882 | 89 |
| 684 | 3300033527 | Ga0316586_1112115 | Ga0316586_11121151 | 89 |
| 685 | 3300033528 | Ga0316588_1170524 | Ga0316588_11705241 | 89 |
| 686 | 3300033529 | Ga0316587_1080659 | Ga0316587_10806592 | 89 |
| 687 | 3300033529 | Ga0316587_1127523 | Ga0316587_11275231 | 89 |
| 688 | 3300033541 | Ga0316596_1132804 | Ga0316596_11328041 | 89 |
| 689 | 3300033541 | Ga0316596_1241947 | Ga0316596_12419471 | 89 |
| 690 | 3300035083 | Ga0373926_0142250 | Ga0373926_0142250_73_342 | 89 |
| 691 | 3300035086 | Ga0373934_0001761 | Ga0373934_0001761_1499_1768 | 89 |
| 692 | 3300035086 | Ga0373934_0001842 | Ga0373934_0001842_4089_4358 | 89 |
| 693 | 3300035111 | Ga0373923_0234769 | Ga0373923_0234769_568_837 | 89 |
| 694 | 3300035115 | Ga0373941_0479960 | Ga0373941_0479960_48_317 | 89 |
| 695 | 3300035116 | Ga0373945_0011097 | Ga0373945_0011097_1651_1920 | 89 |
| 696 | 3300035117 | Ga0373953_0039043 | Ga0373953_0039043_1115_1384 | 89 |
| 697 | 3300035117 | Ga0373953_0045113 | Ga0373953_0045113_184_453 | 89 |
| 698 | 3300035118 | Ga0373954_0003250 | Ga0373954_0003250_6523_6792 | 89 |
| 699 | 3300035118 | Ga0373954_0006306 | Ga0373954_0006306_4292_4561 | 89 |
| 700 | 3300035118 | Ga0373954_0119326 | Ga0373954_0119326_31_300 | 89 |
| 701 | 3300035119 | Ga0373956_0000012 | Ga0373956_0000012_53966_54235 | 89 |
| 702 | 3300035120 | Ga0373957_0004992 | Ga0373957_0004992_1709_1978 | 89 |
| 703 | 3300035120 | Ga0373957_0075454 | Ga0373957_0075454_256_525 | 89 |
| 704 | 3300035120 | Ga0373957_0481802 | Ga0373957_0481802_210_479 | 89 |
| 705 | 3300035171 | Ga0373946_0020618 | Ga0373946_0020618_699_968 | 89 |
| 706 | 3300035172 | Ga0373955_0022269 | Ga0373955_0022269_1032_1301 | 89 |
| 707 | 3300035172 | Ga0373955_0300230 | Ga0373955_0300230_651_920 | 89 |
| 708 | 3300035172 | Ga0373955_0306801 | Ga0373955_0306801_19_288 | 89 |
| 709 | 3300035410 | Ga0373924_0005709 | Ga0373924_0005709_1488_1757 | 89 |
| 710 | 3300035691 | Ga0373931_0274859 | Ga0373931_0274859_60_329 | 89 |
| 711 | 3300035692 | Ga0373935_0007523 | Ga0373935_0007523_5064_5333 | 89 |
| 712 | 3300035695 | Ga0373927_0040170 | Ga0373927_0040170_1661_1930 | 89 |
| 713 | 3300035724 | Ga0373933_0000489 | Ga0373933_0000489_3050_3319 | 89 |
| 714 | 3300035724 | Ga0373933_0285071 | Ga0373933_0285071_138_407 | 89 |
| 715 | 3300035725 | Ga0373947_0490721 | Ga0373947_0490721_479_748 | 89 |
| 716 | 3300036401 | Ga0373937_0001078 | Ga0373937_0001078_2247_2516 | 89 |
| 717 | 3300036401 | Ga0373937_0110119 | Ga0373937_0110119_1076_1345 | 89 |
| 718 | 3300036401 | Ga0373937_0226604 | Ga0373937_0226604_202_471 | 89 |
| 719 | 3300036647 | Ga0316582_0110901 | Ga0316582_0110901_301_570 | 89 |
| 720 | 3300036647 | Ga0316582_0290448 | Ga0316582_0290448_761_1030 | 89 |
| 721 | 3300036712 | Ga0316584_0685043 | Ga0316584_0685043_348_617 | 89 |
| 722 | 3300037068 | Ga0373925_0007488 | Ga0373925_0007488_2836_3105 | 89 |
| 723 | 3300037312 | Ga0395899_0071185 | Ga0395899_0071185_2225_2494 | 89 |
| 724 | 3300037312 | Ga0395899_0222985 | Ga0395899_0222985_977_1246 | 89 |
| 725 | 3300037312 | Ga0395899_0708613 | Ga0395899_0708613_310_579 | 89 |
| 726 | 3300037418 | Ga0395900_0052173 | Ga0395900_0052173_1816_2085 | 89 |
| 727 | 3300037418 | Ga0395900_0200350 | Ga0395900_0200350_887_1156 | 89 |
| 728 | 3300037418 | Ga0395900_1047588 | Ga0395900_1047588_50_319 | 89 |
| 729 | 3300037466 | Ga0395898_0081015 | Ga0395898_0081015_2745_3014 | 89 |
| 730 | 3300037466 | Ga0395898_0150819 | Ga0395898_0150819_998_1267 | 89 |
| 731 | 3300037471 | Ga0395905_0037515 | Ga0395905_0037515_3280_3549 | 89 |
| 732 | 3300037471 | Ga0395905_0746529 | Ga0395905_0746529_12_293 | 89 |
| 733 | 3300037471 | Ga0395905_1011183 | Ga0395905_1011183_145_414 | 89 |
| 734 | 3300038443 | Ga0395901_0123522 | Ga0395901_0123522_1253_1522 | 89 |
| 735 | 3300038443 | Ga0395901_0348549 | Ga0395901_0348549_1087_1356 | 89 |
| 736 | 3300038726 | Ga0400490_06112 | Ga0400490_06112_2291_2560 | 89 |
| 737 | 3300038996 | Ga0242420_090756 | Ga0242420_090756_154_423 | 89 |
| 738 | 3300039062 | Ga0400483_215647 | Ga0400483_215647_634_903 | 89 |
| 739 | 3300039437 | Ga0436365_0315664 | Ga0436365_0315664_98_373 | 89 |
| 740 | 3300039437 | Ga0436365_0471682 | Ga0436365_0471682_98920_99189 | 89 |
| 741 | 3300039438 | Ga0436360_0425236 | Ga0436360_0425236_929_1198 | 89 |
| 742 | 3300039438 | Ga0436360_1083522 | Ga0436360_1083522_203_472 | 89 |
| 743 | 3300039447 | Ga0436361_1050827 | Ga0436361_1050827_1020_1289 | 89 |
| 744 | 3300039450 | Ga0436363_1096406 | Ga0436363_1096406_187_456 | 89 |
| 745 | 3300041405 | Ga0439438_000003 | Ga0439438_000003_359353_359622 | 89 |
| 746 | 3300041405 | Ga0439438_001217 | Ga0439438_001217_10046_10315 | 89 |
| 747 | 3300041405 | Ga0439438_002463 | Ga0439438_002463_6548_6817 | 89 |
| 748 | 3300041407 | Ga0439447_001374 | Ga0439447_001374_1401_1670 | 89 |
| 749 | 3300041407 | Ga0439447_006949 | Ga0439447_006949_2557_2826 | 89 |
| 750 | 3300041486 | Ga0451807_1802159 | Ga0451807_1802159_130_405 | 89 |
| 751 | 3300041507 | Ga0451851_0983120 | Ga0451851_0983120_202_471 | 89 |
| 752 | 3300041512 | Ga0451853_2078609 | Ga0451853_2078609_1435_1704 | 89 |
| 753 | 3300042006 | Ga0439432_010449 | Ga0439432_010449_1915_2184 | 89 |
| 754 | 3300042006 | Ga0439432_013582 | Ga0439432_013582_405_674 | 89 |
| 755 | 3300042006 | Ga0439432_153023 | Ga0439432_153023_317_586 | 89 |
| 756 | 3300042006 | Ga0439432_218898 | Ga0439432_218898_250_519 | 89 |
| 757 | 3300042010 | Ga0439452_000006 | Ga0439452_000006_13205_13474 | 89 |
| 758 | 3300042010 | Ga0439452_000011 | Ga0439452_000011_124672_124941 | 89 |
| 759 | 3300042010 | Ga0439452_004096 | Ga0439452_004096_2543_2812 | 89 |
| 760 | 3300042439 | Ga0439464_0007335 | Ga0439464_0007335_2136_2405 | 89 |
| 761 | 3300042876 | Ga0451577_0032270 | Ga0451577_0032270_4331_4612 | 89 |
| 762 | 3300042876 | Ga0451577_0161487 | Ga0451577_0161487_1027_1296 | 89 |
| 763 | 3300044658 | Ga0466972_0522066 | Ga0466972_0522066_206_475 | 89 |
| 764 | 3300044673 | Ga0453683_0687554 | Ga0453683_0687554_321_590 | 89 |
| 765 | 3300044694 | Ga0466963_0516298 | Ga0466963_0516298_11_280 | 89 |
| 766 | 3300044712 | Ga0453684_0072303 | Ga0453684_0072303_961_1230 | 89 |
| 767 | 3300044712 | Ga0453684_0374116 | Ga0453684_0374116_765_1034 | 89 |
| 768 | 3300045051 | Ga0451576_0007360 | Ga0451576_0007360_12677_12946 | 89 |
| 769 | 3300045976 | Ga0466967_0328006 | Ga0466967_0328006_707_976 | 89 |
| 770 | 3300046452 | Ga0495617_066705 | Ga0495617_066705_494_763 | 89 |
| 771 | 3300046454 | Ga0495592_0014092 | Ga0495592_0014092_2943_3212 | 89 |
| 772 | 3300046454 | Ga0495592_0017267 | Ga0495592_0017267_313_582 | 89 |
| 773 | 3300046454 | Ga0495592_0116005 | Ga0495592_0116005_497_766 | 89 |
| 774 | 3300046454 | Ga0495592_0708128 | Ga0495592_0708128_306_575 | 89 |
| 775 | 3300046455 | Ga0495603_0744530 | Ga0495603_0744530_35_304 | 89 |
| 776 | 3300046458 | Ga0495591_000010 | Ga0495591_000010_287103_287372 | 89 |
| 777 | 3300046458 | Ga0495591_000411 | Ga0495591_000411_33176_33445 | 89 |
| 778 | 3300046458 | Ga0495591_000777 | Ga0495591_000777_16208_16477 | 89 |
| 779 | 3300046458 | Ga0495591_013135 | Ga0495591_013135_2075_2344 | 89 |
| 780 | 3300046459 | Ga0495629_0098574 | Ga0495629_0098574_471_740 | 89 |
| 781 | 3300046460 | Ga0495638_0080060 | Ga0495638_0080060_1166_1435 | 89 |
| 782 | 3300046461 | Ga0495641_0042009 | Ga0495641_0042009_1539_1808 | 89 |
| 783 | 3300046462 | Ga0495651_0000085 | Ga0495651_0000085_21541_21810 | 89 |
| 784 | 3300046462 | Ga0495651_0014818 | Ga0495651_0014818_3670_3939 | 89 |
| 785 | 3300046463 | Ga0495653_0010312 | Ga0495653_0010312_6576_6845 | 89 |
| 786 | 3300046463 | Ga0495653_0427184 | Ga0495653_0427184_436_705 | 89 |
| 787 | 3300046463 | Ga0495653_0805546 | Ga0495653_0805546_119_388 | 89 |
| 788 | 3300046471 | Ga0495650_0000008 | Ga0495650_0000008_94354_94623 | 89 |
| 789 | 3300046471 | Ga0495650_0000040 | Ga0495650_0000040_118286_118555 | 89 |
| 790 | 3300046471 | Ga0495650_0045630 | Ga0495650_0045630_867_1136 | 89 |
| 791 | 3300046473 | Ga0495582_0043522 | Ga0495582_0043522_1503_1772 | 89 |
| 792 | 3300046474 | Ga0495605_0032390 | Ga0495605_0032390_2241_2510 | 89 |
| 793 | 3300046475 | Ga0495639_0001499 | Ga0495639_0001499_465_734 | 89 |
| 794 | 3300046476 | Ga0495662_0041525 | Ga0495662_0041525_1161_1430 | 89 |
| 795 | 3300046477 | Ga0495664_0004079 | Ga0495664_0004079_7369_7638 | 89 |
| 796 | 3300046491 | Ga0495584_0000811 | Ga0495584_0000811_12594_12863 | 89 |
| 797 | 3300046499 | Ga0495594_0037887 | Ga0495594_0037887_459_728 | 89 |
| 798 | 3300046501 | Ga0495607_0010549 | Ga0495607_0010549_5328_5597 | 89 |
| 799 | 3300046507 | Ga0495606_0000966 | Ga0495606_0000966_36638_36907 | 89 |
| 800 | 3300046511 | Ga0495608_0008762 | Ga0495608_0008762_5655_5924 | 89 |
| 801 | 3300046511 | Ga0495608_0315308 | Ga0495608_0315308_323_592 | 89 |
| 802 | 3300046513 | Ga0495616_0041166 | Ga0495616_0041166_55_324 | 89 |
| 803 | 3300046513 | Ga0495616_0166109 | Ga0495616_0166109_128_397 | 89 |
| 804 | 3300046514 | Ga0495618_0011792 | Ga0495618_0011792_217_486 | 89 |
| 805 | 3300046515 | Ga0495620_0022016 | Ga0495620_0022016_2124_2393 | 89 |
| 806 | 3300046516 | Ga0495628_0010586 | Ga0495628_0010586_5242_5511 | 89 |
| 807 | 3300046516 | Ga0495628_0027653 | Ga0495628_0027653_2474_2743 | 89 |
| 808 | 3300046516 | Ga0495628_0031313 | Ga0495628_0031313_1812_2081 | 89 |
| 809 | 3300046516 | Ga0495628_0390873 | Ga0495628_0390873_203_472 | 89 |
| 810 | 3300046517 | Ga0495630_0001044 | Ga0495630_0001044_6172_6441 | 89 |
| 811 | 3300046517 | Ga0495630_0077499 | Ga0495630_0077499_1295_1564 | 89 |
| 812 | 3300046522 | Ga0495643_0271986 | Ga0495643_0271986_498_767 | 89 |
| 813 | 3300046523 | Ga0495644_0010576 | Ga0495644_0010576_2276_2545 | 89 |
| 814 | 3300046524 | Ga0495648_0002943 | Ga0495648_0002943_7482_7751 | 89 |
| 815 | 3300046526 | Ga0495666_0007265 | Ga0495666_0007265_3898_4167 | 89 |
| 816 | 3300046529 | Ga0495652_0019967 | Ga0495652_0019967_2953_3222 | 89 |
| 817 | 3300046529 | Ga0495652_0218806 | Ga0495652_0218806_28_297 | 89 |
| 818 | 3300046529 | Ga0495652_0268818 | Ga0495652_0268818_665_934 | 89 |
| 819 | 3300046530 | Ga0495654_0000031 | Ga0495654_0000031_165798_166067 | 89 |
| 820 | 3300046530 | Ga0495654_0000089 | Ga0495654_0000089_8093_8362 | 89 |
| 821 | 3300046533 | Ga0495640_0029552 | Ga0495640_0029552_2391_2660 | 89 |
| 822 | 3300046533 | Ga0495640_0286804 | Ga0495640_0286804_571_840 | 89 |
| 823 | 3300046535 | Ga0495586_0012489 | Ga0495586_0012489_4148_4417 | 89 |
| 824 | 3300046536 | Ga0495587_0004041 | Ga0495587_0004041_4540_4809 | 89 |
| 825 | 3300046542 | Ga0495597_0004073 | Ga0495597_0004073_2166_2435 | 89 |
| 826 | 3300046543 | Ga0495645_0014068 | Ga0495645_0014068_288_557 | 89 |
| 827 | 3300046543 | Ga0495645_0114980 | Ga0495645_0114980_540_809 | 89 |
| 828 | 3300046557 | Ga0495622_0151327 | Ga0495622_0151327_459_728 | 89 |
| 829 | 3300046559 | Ga0495667_0064631 | Ga0495667_0064631_1399_1668 | 89 |
| 830 | 3300046559 | Ga0495667_0106079 | Ga0495667_0106079_15_284 | 89 |
| 831 | 3300046559 | Ga0495667_0299619 | Ga0495667_0299619_661_930 | 89 |
| 832 | 3300046616 | Ga0495668_0043831 | Ga0495668_0043831_2145_2414 | 89 |
| 833 | 3300046642 | Ga0495634_0242652 | Ga0495634_0242652_36_305 | 89 |
| 834 | 3300046648 | Ga0495611_0075933 | Ga0495611_0075933_1061_1330 | 89 |
| 835 | 3300046660 | Ga0495625_0016265 | Ga0495625_0016265_1854_2123 | 89 |
| 836 | 3300046663 | Ga0495635_0009364 | Ga0495635_0009364_5780_6049 | 89 |
| 837 | 3300046663 | Ga0495635_0023162 | Ga0495635_0023162_2118_2387 | 89 |
| 838 | 3300046665 | Ga0495661_0514755 | Ga0495661_0514755_145_414 | 89 |
| 839 | 3300046674 | Ga0495588_0033862 | Ga0495588_0033862_1392_1661 | 89 |
| 840 | 3300046675 | Ga0495657_0004414 | Ga0495657_0004414_8789_9058 | 89 |
| 841 | 3300046675 | Ga0495657_0044070 | Ga0495657_0044070_1480_1749 | 89 |
| 842 | 3300046675 | Ga0495657_0170064 | Ga0495657_0170064_295_564 | 89 |
| 843 | 3300046678 | Ga0495599_0005051 | Ga0495599_0005051_1601_1870 | 89 |
| 844 | 3300046678 | Ga0495599_0015150 | Ga0495599_0015150_1534_1803 | 89 |
| 845 | 3300046678 | Ga0495599_0101320 | Ga0495599_0101320_45_314 | 89 |
| 846 | 3300046679 | Ga0495623_0627986 | Ga0495623_0627986_103_372 | 89 |
| 847 | 3300046681 | Ga0495647_0419455 | Ga0495647_0419455_35_304 | 89 |
| 848 | 3300046683 | Ga0495658_0015072 | Ga0495658_0015072_2429_2698 | 89 |
| 849 | 3300046689 | Ga0495613_0548915 | Ga0495613_0548915_185_454 | 89 |
| 850 | 3300046690 | Ga0495624_0291624 | Ga0495624_0291624_336_605 | 89 |
| 851 | 3300046692 | Ga0495671_0001988 | Ga0495671_0001988_858_1127 | 89 |
| 852 | 3300046694 | Ga0495649_0043412 | Ga0495649_0043412_903_1172 | 89 |
| 853 | 3300046694 | Ga0495649_0055527 | Ga0495649_0055527_1163_1432 | 89 |
| 854 | 3300046794 | Ga0495589_0041517 | Ga0495589_0041517_1254_1523 | 89 |
| 855 | 3300046809 | Ga0495600_0018687 | Ga0495600_0018687_4011_4280 | 89 |
| 856 | 3300046810 | Ga0495660_0000184 | Ga0495660_0000184_64874_65143 | 89 |
| 857 | 3300047315 | Ga0495581_0613341 | Ga0495581_0613341_300_569 | 89 |
| 858 | 3300047317 | Ga0495604_0028106 | Ga0495604_0028106_3567_3836 | 89 |
| 859 | 3300047318 | Ga0495636_0272095 | Ga0495636_0272095_156_425 | 89 |
| 860 | 3300047319 | Ga0495674_0010947 | Ga0495674_0010947_4540_4809 | 89 |
| 861 | 3300047319 | Ga0495674_0193637 | Ga0495674_0193637_1364_1633 | 89 |
| 862 | 3300047320 | Ga0495672_0000003 | Ga0495672_0000003_634138_634407 | 89 |
| 863 | 3300047320 | Ga0495672_0000082 | Ga0495672_0000082_94595_94864 | 89 |
| 864 | 3300047322 | Ga0495680_0252804 | Ga0495680_0252804_904_1173 | 89 |
| 865 | 3300047322 | Ga0495680_0796429 | Ga0495680_0796429_36_305 | 89 |
| 866 | 3300047322 | Ga0495680_0959366 | Ga0495680_0959366_103_372 | 89 |
| 867 | 3300047444 | Ga0495675_0003667 | Ga0495675_0003667_1288_1557 | 89 |
| 868 | 3300047444 | Ga0495675_0405458 | Ga0495675_0405458_267_536 | 89 |
| 869 | 3300047446 | Ga0495679_000059 | Ga0495679_000059_95889_96158 | 89 |
| 870 | 3300047446 | Ga0495679_034458 | Ga0495679_034458_1055_1324 | 89 |
| 871 | 3300047446 | Ga0495679_094751 | Ga0495679_094751_95_364 | 89 |
| 872 | 3300047469 | Ga0495673_0000011 | Ga0495673_0000011_94618_94887 | 89 |
| 873 | 3300047469 | Ga0495673_0000117 | Ga0495673_0000117_118772_119041 | 89 |
| 874 | 3300047470 | Ga0495681_0050350 | Ga0495681_0050350_900_1169 | 89 |
| 875 | 3300047471 | Ga0495684_0025150 | Ga0495684_0025150_571_840 | 89 |
| 876 | 3300047673 | Ga0495593_0080675 | Ga0495593_0080675_98_367 | 89 |
| 877 | 3300048088 | Ga0495602_0054829 | Ga0495602_0054829_1188_1457 | 89 |
| 878 | 3300048088 | Ga0495602_0388662 | Ga0495602_0388662_489_758 | 89 |
| 879 | 3300048903 | Ga0496100_0159656 | Ga0496100_0159656_862_1131 | 89 |
| 880 | 3300048904 | Ga0496101_0000144 | Ga0496101_0000144_62180_62449 | 89 |
| 881 | 3300048904 | Ga0496101_0106694 | Ga0496101_0106694_67_336 | 89 |
| 882 | 3300048907 | Ga0496104_0188756 | Ga0496104_0188756_560_829 | 89 |
| 883 | 3300048913 | Ga0496110_0480424 | Ga0496110_0480424_850_1119 | 89 |
| 884 | 3300048916 | Ga0496113_0978838 | Ga0496113_0978838_20_289 | 89 |
| 885 | 3300048917 | Ga0496114_0844450 | Ga0496114_0844450_123_392 | 89 |
| 886 | 3300048919 | Ga0496116_0008711 | Ga0496116_0008711_3511_3780 | 89 |
| 887 | 3300048919 | Ga0496116_0030592 | Ga0496116_0030592_3266_3535 | 89 |
| 888 | 3300048919 | Ga0496116_0123723 | Ga0496116_0123723_1052_1321 | 89 |
| 889 | 3300048920 | Ga0496117_0074056 | Ga0496117_0074056_336_605 | 89 |
| 890 | 3300048920 | Ga0496117_0192360 | Ga0496117_0192360_695_964 | 89 |
| 891 | 3300048920 | Ga0496117_0220973 | Ga0496117_0220973_610_879 | 89 |
| 892 | 3300048921 | Ga0496118_0086857 | Ga0496118_0086857_1185_1454 | 89 |
| 893 | 3300048921 | Ga0496118_0105054 | Ga0496118_0105054_364_633 | 89 |
| 894 | 3300048921 | Ga0496118_0167214 | Ga0496118_0167214_884_1153 | 89 |
| 895 | 3300048921 | Ga0496118_0182307 | Ga0496118_0182307_118_387 | 89 |
| 896 | 3300048922 | Ga0496119_0000096 | Ga0496119_0000096_96152_96421 | 89 |
| 897 | 3300048922 | Ga0496119_0043543 | Ga0496119_0043543_1853_2122 | 89 |
| 898 | 3300048922 | Ga0496119_0141017 | Ga0496119_0141017_209_478 | 89 |
| 899 | 3300048923 | Ga0496120_0000068 | Ga0496120_0000068_36180_36449 | 89 |
| 900 | 3300048923 | Ga0496120_0001484 | Ga0496120_0001484_6501_6770 | 89 |
| 901 | 3300048923 | Ga0496120_0012013 | Ga0496120_0012013_1853_2122 | 89 |
| 902 | 3300048923 | Ga0496120_0037924 | Ga0496120_0037924_1788_2057 | 89 |
| 903 | 3300048925 | Ga0496122_0015833 | Ga0496122_0015833_2533_2802 | 89 |
| 904 | 3300048925 | Ga0496122_0036749 | Ga0496122_0036749_1909_2178 | 89 |
| 905 | 3300048925 | Ga0496122_0041854 | Ga0496122_0041854_2087_2356 | 89 |
| 906 | 3300048925 | Ga0496122_0091384 | Ga0496122_0091384_448_717 | 89 |
| 907 | 3300048925 | Ga0496122_0106151 | Ga0496122_0106151_1359_1628 | 89 |
| 908 | 3300048925 | Ga0496122_0110038 | Ga0496122_0110038_1068_1337 | 89 |
| 909 | 3300048926 | Ga0496123_0000017 | Ga0496123_0000017_42697_42966 | 89 |
| 910 | 3300048926 | Ga0496123_0003747 | Ga0496123_0003747_3047_3316 | 89 |
| 911 | 3300048926 | Ga0496123_0003886 | Ga0496123_0003886_13381_13650 | 89 |
| 912 | 3300048926 | Ga0496123_0047025 | Ga0496123_0047025_1858_2127 | 89 |
| 913 | 3300048926 | Ga0496123_0081909 | Ga0496123_0081909_820_1089 | 89 |
| 914 | 3300048927 | Ga0496124_0002686 | Ga0496124_0002686_2144_2413 | 89 |
| 915 | 3300048927 | Ga0496124_0007846 | Ga0496124_0007846_7885_8154 | 89 |
| 916 | 3300048927 | Ga0496124_0014571 | Ga0496124_0014571_3044_3313 | 89 |
| 917 | 3300048927 | Ga0496124_0112980 | Ga0496124_0112980_552_821 | 89 |
| 918 | 3300048927 | Ga0496124_0129821 | Ga0496124_0129821_1614_1883 | 89 |
| 919 | 3300048927 | Ga0496124_0132795 | Ga0496124_0132795_197_466 | 89 |
| 920 | 3300048927 | Ga0496124_0426659 | Ga0496124_0426659_313_582 | 89 |
| 921 | 3300048928 | Ga0496125_0000257 | Ga0496125_0000257_91872_92141 | 89 |
| 922 | 3300048928 | Ga0496125_0062599 | Ga0496125_0062599_1857_2126 | 89 |
| 923 | 3300048928 | Ga0496125_0378314 | Ga0496125_0378314_515_784 | 89 |
| 924 | 3300048928 | Ga0496125_0423078 | Ga0496125_0423078_63_332 | 89 |
| 925 | 3300048929 | Ga0496126_0026967 | Ga0496126_0026967_982_1251 | 89 |
| 926 | 3300048929 | Ga0496126_0121308 | Ga0496126_0121308_419_688 | 89 |
| 927 | 3300048929 | Ga0496126_0223284 | Ga0496126_0223284_208_477 | 89 |
| 928 | 3300048929 | Ga0496126_0278353 | Ga0496126_0278353_910_1179 | 89 |
| 929 | 3300048929 | Ga0496126_0538184 | Ga0496126_0538184_647_916 | 89 |
| 930 | 3300048929 | Ga0496126_0578795 | Ga0496126_0578795_37_306 | 89 |
| 931 | 3300049129 | Ga0501309_064336 | Ga0501309_064336_307_576 | 89 |
| 932 | 3300049459 | Ga0495678_000142 | Ga0495678_000142_2898_3167 | 89 |
| 933 | 3300049460 | Ga0495682_0000034 | Ga0495682_0000034_37152_37421 | 89 |
| 934 | 3300049537 | Ga0501321_064068 | Ga0501321_064068_234_503 | 89 |
| 935 | 3300049568 | Ga0501031_0834514 | Ga0501031_0834514_185_454 | 89 |
| 936 | 3300049568 | Ga0501031_0890105 | Ga0501031_0890105_76_345 | 89 |
| 937 | 3300049572 | Ga0501036_0404512 | Ga0501036_0404512_28_297 | 89 |
| 938 | 3300049572 | Ga0501036_0790560 | Ga0501036_0790560_221_490 | 89 |
| 939 | 3300049573 | Ga0501037_1073158 | Ga0501037_1073158_100_369 | 89 |
| 940 | 3300049574 | Ga0501038_1365656 | Ga0501038_1365656_127_396 | 89 |
| 941 | 3300049575 | Ga0501039_0730678 | Ga0501039_0730678_151_420 | 89 |
| 942 | 3300049576 | Ga0501040_0000689 | Ga0501040_0000689_18780_19049 | 89 |
| 943 | 3300049577 | Ga0501041_0081307 | Ga0501041_0081307_284_553 | 89 |
| 944 | 3300049577 | Ga0501041_0813086 | Ga0501041_0813086_38_307 | 89 |
| 945 | 3300049577 | Ga0501041_0929675 | Ga0501041_0929675_86_391 | 89 |
| 946 | 3300049578 | Ga0501042_0001376 | Ga0501042_0001376_12486_12755 | 89 |
| 947 | 3300049578 | Ga0501042_0182779 | Ga0501042_0182779_1140_1409 | 89 |
| 948 | 3300049580 | Ga0501046_0998607 | Ga0501046_0998607_174_443 | 89 |
| 949 | 3300049582 | Ga0501048_0525545 | Ga0501048_0525545_40_309 | 89 |
| 950 | 3300049587 | Ga0501071_0279281 | Ga0501071_0279281_550_855 | 89 |
| 951 | 3300049587 | Ga0501071_0569203 | Ga0501071_0569203_218_487 | 89 |
| 952 | 3300049587 | Ga0501071_0905556 | Ga0501071_0905556_151_420 | 89 |
| 953 | 3300049588 | Ga0501072_0185035 | Ga0501072_0185035_1023_1328 | 89 |
| 954 | 3300049588 | Ga0501072_0227978 | Ga0501072_0227978_1151_1420 | 89 |
| 955 | 3300049589 | Ga0501073_1188386 | Ga0501073_1188386_192_461 | 89 |
| 956 | 3300049590 | Ga0501074_0189973 | Ga0501074_0189973_200_505 | 89 |
| 957 | 3300049591 | Ga0501075_1358960 | Ga0501075_1358960_99_368 | 89 |
| 958 | 3300049592 | Ga0501076_0142777 | Ga0501076_0142777_541_846 | 89 |
| 959 | 3300049592 | Ga0501076_0373776 | Ga0501076_0373776_852_1121 | 89 |
| 960 | 3300049593 | Ga0501077_0152455 | Ga0501077_0152455_1025_1294 | 89 |
| 961 | 3300049593 | Ga0501077_0728935 | Ga0501077_0728935_245_550 | 89 |
| 962 | 3300049741 | Ga0501079_0441297 | Ga0501079_0441297_170_439 | 89 |
| 963 | 3300049765 | Ga0501268_108178 | Ga0501268_108178_28_297 | 89 |
| 964 | 3300049823 | Ga0501044_1184625 | Ga0501044_1184625_288_557 | 89 |
| 965 | 3300050491 | nmdc:mga00v17_103934_c1 | nmdc:mga00v17_103934_c1_655_924 | 89 |
| 966 | 3300050491 | nmdc:mga00v17_428050_c1 | nmdc:mga00v17_428050_c1_460_729 | 89 |
| 967 | 3300050491 | nmdc:mga00v17_4898_c1 | nmdc:mga00v17_4898_c1_4654_4923 | 89 |
| 968 | 3300050491 | nmdc:mga00v17_7754_c1 | nmdc:mga00v17_7754_c1_5446_5715 | 89 |
| 969 | 3300050493 | nmdc:mga0k408_724843_c1 | nmdc:mga0k408_724843_c1_94_363 | 89 |
| 970 | 3300050507 | nmdc:mga05p37_333447_c1 | nmdc:mga05p37_333447_c1_1440_1709 | 89 |
| 971 | 3300050508 | nmdc:mga09592_364608_c1 | nmdc:mga09592_364608_c1_252_521 | 89 |
| 972 | 3300050510 | nmdc:mga06r32_608563_c1 | nmdc:mga06r32_608563_c1_462_731 | 89 |
| 973 | 3300050512 | nmdc:mga0n895_172295_c1 | nmdc:mga0n895_172295_c1_468_737 | 89 |
| 974 | 3300050513 | nmdc:mga0rr50_903011_c1 | nmdc:mga0rr50_903011_c1_23_292 | 89 |
| 975 | 3300050513 | nmdc:mga0rr50_999897_c1 | nmdc:mga0rr50_999897_c1_311_580 | 89 |
| 976 | 3300050514 | nmdc:mga08x19_169150_c1 | nmdc:mga08x19_169150_c1_1054_1323 | 89 |
| 977 | 3300050514 | nmdc:mga08x19_2213_c1 | nmdc:mga08x19_2213_c1_416_685 | 89 |
| 978 | 3300050514 | nmdc:mga08x19_253604_c1 | nmdc:mga08x19_253604_c1_82_351 | 89 |
| 979 | 3300050515 | nmdc:mga0a205_1018053_c1 | nmdc:mga0a205_1018053_c1_224_493 | 89 |
| 980 | 3300050515 | nmdc:mga0a205_1114950_c1 | nmdc:mga0a205_1114950_c1_306_575 | 89 |
| 981 | 3300050515 | nmdc:mga0a205_1436397_c1 | nmdc:mga0a205_1436397_c1_178_447 | 89 |
| 982 | 3300053077 | Ga0495601_0030814 | Ga0495601_0030814_2952_3221 | 89 |
| 983 | 3300053077 | Ga0495601_0062156 | Ga0495601_0062156_1550_1819 | 89 |
| 984 | 3300053077 | Ga0495601_0145275 | Ga0495601_0145275_209_478 | 89 |
| 985 | 3300053077 | Ga0495601_0862894 | Ga0495601_0862894_162_431 | 89 |
| 986 | 3300053084 | Ga0495595_0005704 | Ga0495595_0005704_3665_3934 | 89 |
| 987 | 3300053085 | Ga0495619_0845462 | Ga0495619_0845462_36_305 | 89 |
| 988 | 3300053087 | Ga0500643_091563 | Ga0500643_091563_288_557 | 89 |
| 989 | 3300053093 | Ga0500651_0331508 | Ga0500651_0331508_442_711 | 89 |
| 990 | 3300053094 | Ga0500566_0151491 | Ga0500566_0151491_789_1058 | 89 |
| 991 | 3300053098 | Ga0500650_0000042 | Ga0500650_0000042_34818_35087 | 89 |
| 992 | 3300053098 | Ga0500650_0169634 | Ga0500650_0169634_194_463 | 89 |
| 993 | 3300053126 | Ga0500621_000010 | Ga0500621_000010_74975_75244 | 89 |
| 994 | 3300054114 | Ga0501084_0189534 | Ga0501084_0189534_216_485 | 89 |
| 995 | 3300059477 | Ga0587084_004200 | Ga0587084_004200_267_536 | 89 |
| 996 | 3300059477 | Ga0587084_006709 | Ga0587084_006709_176_445 | 89 |
| 997 | 3300059478 | Ga0587093_028911 | Ga0587093_028911_359_628 | 89 |
| 998 | 3300059490 | Ga0587066_010059 | Ga0587066_010059_181_450 | 89 |
| 999 | 3300059490 | Ga0587066_173776 | Ga0587066_173776_130_399 | 89 |
| 1000 | 3300059491 | Ga0587070_048654 | Ga0587070_048654_176_445 | 89 |
| 1001 | 3300059492 | Ga0587073_0042409 | Ga0587073_0042409_542_811 | 89 |
| 1002 | 3300059493 | Ga0587077_063206 | Ga0587077_063206_273_542 | 89 |
| 1003 | 3300059493 | Ga0587077_188075 | Ga0587077_188075_188_457 | 89 |
| 1004 | 3300059503 | Ga0587080_019861 | Ga0587080_019861_665_934 | 89 |
| 1005 | 3300059504 | Ga0587082_094100 | Ga0587082_094100_112_381 | 89 |
| 1006 | 3300059505 | Ga0587083_0101259 | Ga0587083_0101259_355_624 | 89 |
| 1007 | 3300059506 | Ga0587085_018762 | Ga0587085_018762_186_455 | 89 |
| 1008 | 3300059507 | Ga0587086_018610 | Ga0587086_018610_355_624 | 89 |
| 1009 | 3300059507 | Ga0587086_053610 | Ga0587086_053610_124_393 | 89 |
| 1010 | 3300059508 | Ga0587088_025139 | Ga0587088_025139_187_456 | 89 |
| 1011 | 3300059510 | Ga0587090_031596 | Ga0587090_031596_355_624 | 89 |
| 1012 | 3300059511 | Ga0587091_011222 | Ga0587091_011222_246_515 | 89 |
| 1013 | 3300059513 | Ga0587094_024100 | Ga0587094_024100_191_460 | 89 |
| 1014 | 3300059604 | Ga0587098_062939 | Ga0587098_062939_129_398 | 89 |
| 1015 | 3300059605 | Ga0587106_044632 | Ga0587106_044632_355_624 | 89 |
| 1016 | 3300059623 | Ga0587101_005837 | Ga0587101_005837_848_1117 | 89 |
| 1017 | 3300059623 | Ga0587101_018117 | Ga0587101_018117_412_681 | 89 |
| 1018 | 3300059624 | Ga0587109_022371 | Ga0587109_022371_255_524 | 89 |
| 1019 | 3300059624 | Ga0587109_060844 | Ga0587109_060844_371_640 | 89 |
| 1020 | 3300059624 | Ga0587109_076277 | Ga0587109_076277_36_305 | 89 |
| 1021 | 3300059626 | Ga0587115_072543 | Ga0587115_072543_119_388 | 89 |
| 1022 | 3300059627 | Ga0587117_008158 | Ga0587117_008158_275_544 | 89 |
| 1023 | 3300059639 | Ga0587062_005914 | Ga0587062_005914_896_1165 | 89 |
| 1024 | 3300059639 | Ga0587062_106812 | Ga0587062_106812_266_535 | 89 |
| 1025 | 3300059640 | Ga0587067_210518 | Ga0587067_210518_136_405 | 89 |
| 1026 | 3300059641 | Ga0587068_007153 | Ga0587068_007153_267_536 | 89 |
| 1027 | 3300059641 | Ga0587068_007869 | Ga0587068_007869_263_532 | 89 |
| 1028 | 3300059642 | Ga0587069_006520 | Ga0587069_006520_937_1206 | 89 |
| 1029 | 3300059643 | Ga0587072_053091 | Ga0587072_053091_355_624 | 89 |
| 1030 | 3300059644 | Ga0587075_107564 | Ga0587075_107564_17_286 | 89 |
| 1031 | 3300059646 | Ga0587078_003122 | Ga0587078_003122_267_536 | 89 |
| 1032 | 3300059647 | Ga0587079_096896 | Ga0587079_096896_187_456 | 89 |
| 1033 | 3300059648 | Ga0587100_004513 | Ga0587100_004513_473_742 | 89 |
| 1034 | 3300059654 | Ga0587110_010347 | Ga0587110_010347_294_563 | 89 |
| 1035 | 3300059656 | Ga0587116_06544 | Ga0587116_06544_188_457 | 89 |
| 1036 | 3300060346 | Ga0587111_0015439 | Ga0587111_0015439_264_533 | 89 |
| 1037 | 3300060346 | Ga0587111_0063890 | Ga0587111_0063890_215_484 | 89 |
| 1038 | 3300060346 | Ga0587111_0104283 | Ga0587111_0104283_406_675 | 89 |
| 1039 | 3300060353 | Ga0501082_0834776 | Ga0501082_0834776_99_368 | 89 |
| 1040 | 3300061734 | Ga0530510_1373887 | Ga0530510_1373887_76_345 | 89 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6th6-assembly1.cif.gz_Aq | cryo-em structure of t. kodakarensis 70s ribosome | 0.9977 | 29 | 74 |
| 7zag-assembly1.cif.gz_Q | cryo-em structure of a pyrococcus abyssi 30s bound to met-initiator trna,mrna, aif1a and the c-terminal domain of aif5b. | 0.9967 | 29 | 73 |
| 8cdu-assembly1.cif.gz_O | rnase r bound to a 30s degradation intermediate (main state) | 0.9965 | 4 | 88 |
| 7qv2-assembly1.cif.gz_o | bacillus subtilis collided disome (collided 70s) | 0.9955 | 4 | 88 |
| 7nhn-assembly1.cif.gz_p | vgal, an antibiotic resistance abcf, in complex with 70s ribosome from listeria monocytogenes | 0.9921 | 3 | 88 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 6g18N02 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins;S15/NS1, RNA-binding | 0.987 | 29 | 73 | 1.10.287.10 |
| 3u5gN02 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins;S15/NS1, RNA-binding | 0.9828 | 29 | 74 | 1.10.287.10 |
| 4bpeO02 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins;S15/NS1, RNA-binding | 0.9818 | 29 | 73 | 1.10.287.10 |
| 5xyiN02 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins;S15/NS1, RNA-binding | 0.9811 | 29 | 73 | 1.10.287.10 |
| 5ll6Y02 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins;S15/NS1, RNA-binding | 0.9805 | 29 | 72 | 1.10.287.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2U9SB23-F1-model_v4 | Small ribosomal subunit protein uS15 | 1.003 | 1 | 89 |
GO:0003735
GO:0006412 GO:0019843 GO:0022627 |
| AF-A0A2U1VDM4-F1-model_v4 | Small ribosomal subunit protein uS15 | 1.003 | 1 | 89 |
GO:0003735
GO:0006412 GO:0019843 GO:0022627 |
| AF-A0A1I4HU16-F1-model_v4 | Small ribosomal subunit protein uS15 | 1.002 | 1 | 89 |
GO:0003735
GO:0006412 GO:0019843 GO:0022627 |
| AF-A0A7V2YZ13-F1-model_v4 | Small ribosomal subunit protein uS15 | 1.002 | 1 | 89 |
GO:0003735
GO:0006412 GO:0019843 GO:0022627 |
| AF-A0A0G0LSJ6-F1-model_v4 | Small ribosomal subunit protein uS15 | 1.002 | 3 | 88 |
GO:0003735
GO:0005737 GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar