F488661
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1033 | 370 | 2066 | 304 |
Family's Representative Sequence
| Representative Sequence | 3300025918|Ga0207662_10046832|Ga0207662_100468322 |
| Length | 361 |
| Sequence | MRRPGVHPWSRIKRQKLAPVLGFVAGDALAQLSDGQRAMLEAPLRKNRHMLPGVEWLNYHHLLYFWSVAKQGSIVRASEELHLAHPTISGQIHRLEEVLGEKLFVRRGRNLALTEAGRVAFRYADEIFSLGREFVDTLKGRASGKPLRLVVGVADVLPPSLVRRFLEPAFRLNEPVQVICRADKSVQEFLAELALHSVDVVIADGPAAAGVPVRAFNHPLGDCGTTFFATARLAAKLRRRFPRSLDAAPFLMPGAPSTVRRSLEQWFASEDIRPRVVAEMDDSALGKELGEDGLGVFAAPAVIEAEILDRYRVRVVGRSEAVRQQFYAISVERKIKHPAVVAICEAARQAIFATKTVPARP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 2 | 2162886011 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 4 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 5 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 6 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 7 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 15 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 17 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 19 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 31 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 45 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 51 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 54 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 61 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 63 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 64 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 65 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 66 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 67 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 68 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 69 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 70 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 71 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 72 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 73 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 74 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 75 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 76 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 77 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 78 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 79 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 80 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 81 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 82 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 83 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 84 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 85 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 86 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 88 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 89 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 90 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 91 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 92 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 93 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 94 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 95 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 96 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 98 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 111 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 129 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 196 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 200 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 201 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 202 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 203 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 204 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 205 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 206 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 207 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 208 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 209 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 210 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 211 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 212 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 213 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 214 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 215 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 216 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 217 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 218 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 219 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 220 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 221 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 222 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 223 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 224 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 225 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 226 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 227 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 228 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 229 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 230 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 231 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 232 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 233 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 234 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 235 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 236 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 237 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 238 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 239 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 240 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 241 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 242 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 243 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 244 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 245 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 246 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 247 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 248 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 249 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 250 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 251 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 252 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 253 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 254 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 255 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 256 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 257 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 258 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 259 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 260 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 261 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 262 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 263 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 264 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 265 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 266 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 267 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 268 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 300 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 301 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 302 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 303 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 304 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 305 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 306 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 307 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 308 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 309 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 310 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 311 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 312 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 313 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 314 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 315 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 316 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 317 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 318 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 319 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 320 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 321 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 322 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 323 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 324 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 325 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 326 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 327 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 328 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 329 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 330 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 331 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 332 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 333 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 334 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 335 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 336 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 337 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 338 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 339 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 340 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 341 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 342 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 343 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 344 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 345 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 346 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 347 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 348 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 349 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 350 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 351 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 352 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 353 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 354 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 355 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 356 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 357 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 358 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 359 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 360 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 361 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 362 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 364 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 365 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 366 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 367 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 368 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 369 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 370 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.65 |
| Nodule | 0 |
| Rhizoplane | 3.97 |
| Rhizosphere | 93.03 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 16.07 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0207662_10046832 | 3300025918 | Bacteria | 2560 |
| 2 | MRS1b_contig_6353489 | 2162886011 | Bacteria | 1221 |
| 3 | rootH2_10026227 | 3300003320 | Bacteria | 3857 |
| 4 | rootL2_10164218 | 3300003322 | Bacteria | 4637 |
| 5 | rootL2_10363563 | 3300003322 | Unclassified | 1676 |
| 6 | rootH1_10235514 | 3300003323 | Bacteria | 3037 |
| 7 | rootH1_10285765 | 3300003323 | Unclassified | 2741 |
| 8 | Ga0065712_10082993 | 3300005290 | Bacteria | 2862 |
| 9 | Ga0065707_10105478 | 3300005295 | Bacteria | 2642 |
| 10 | Ga0065707_10129487 | 3300005295 | Bacteria | 1947 |
| 11 | Ga0065707_10186024 | 3300005295 | Bacteria | 1388 |
| 12 | Ga0070658_10014537 | 3300005327 | Bacteria | 6317 |
| 13 | Ga0070658_10274244 | 3300005327 | Unclassified | 1435 |
| 14 | Ga0070676_10041158 | 3300005328 | Bacteria | 2678 |
| 15 | Ga0070676_10060806 | 3300005328 | Bacteria | 2244 |
| 16 | Ga0070676_10077444 | 3300005328 | Unclassified | 2010 |
| 17 | Ga0070676_10235163 | 3300005328 | Bacteria | 1216 |
| 18 | Ga0070683_100002980 | 3300005329 | Bacteria | 13578 |
| 19 | Ga0070683_100051921 | 3300005329 | Plasmid | 3797 |
| 20 | Ga0070683_100130358 | 3300005329 | Bacteria | 2379 |
| 21 | Ga0070683_100168200 | 3300005329 | Bacteria | 2080 |
| 22 | Ga0070690_100008915 | 3300005330 | Bacteria | 5792 |
| 23 | Ga0070690_100051159 | 3300005330 | Unclassified | 2636 |
| 24 | Ga0070690_100107497 | 3300005330 | Unclassified | 1857 |
| 25 | Ga0070670_100000551 | 3300005331 | Bacteria | 29820 |
| 26 | Ga0070670_100024055 | 3300005331 | Bacteria | 5240 |
| 27 | Ga0070670_100054747 | 3300005331 | Bacteria | 3425 |
| 28 | Ga0070670_100061754 | 3300005331 | Unclassified | 3216 |
| 29 | Ga0070670_100076255 | 3300005331 | Bacteria | 2881 |
| 30 | Ga0070677_10001876 | 3300005333 | Bacteria | 6649 |
| 31 | Ga0070677_10023051 | 3300005333 | Bacteria | 2301 |
| 32 | Ga0070677_10059898 | 3300005333 | Bacteria | 1567 |
| 33 | Ga0068869_100001326 | 3300005334 | Bacteria | 14673 |
| 34 | Ga0068869_100004523 | 3300005334 | Bacteria | 8653 |
| 35 | Ga0068869_100012842 | 3300005334 | Bacteria | 5544 |
| 36 | Ga0068869_100050168 | 3300005334 | Bacteria | 3024 |
| 37 | Ga0070666_10018322 | 3300005335 | Bacteria | 4499 |
| 38 | Ga0070666_10112735 | 3300005335 | Bacteria | 1881 |
| 39 | Ga0070680_100019142 | 3300005336 | Bacteria | 5422 |
| 40 | Ga0070680_100027953 | 3300005336 | Bacteria | 4521 |
| 41 | Ga0070680_100079759 | 3300005336 | Bacteria | 2699 |
| 42 | Ga0070680_100080984 | 3300005336 | Unclassified | 2678 |
| 43 | Ga0070680_100082008 | 3300005336 | Unclassified | 2661 |
| 44 | Ga0070680_100205792 | 3300005336 | Bacteria | 1660 |
| 45 | Ga0070680_100252826 | 3300005336 | Bacteria | 1490 |
| 46 | Ga0070682_100079979 | 3300005337 | Bacteria | 2112 |
| 47 | Ga0070682_100258345 | 3300005337 | Bacteria | 1259 |
| 48 | Ga0068868_100016527 | 3300005338 | Bacteria | 5483 |
| 49 | Ga0068868_100020637 | 3300005338 | Bacteria | 4954 |
| 50 | Ga0068868_100072417 | 3300005338 | Bacteria | 2749 |
| 51 | Ga0068868_100120907 | 3300005338 | Bacteria | 2136 |
| 52 | Ga0068868_100389802 | 3300005338 | Bacteria | 1200 |
| 53 | Ga0070689_100000007 | 3300005340 | Bacteria | 312944 |
| 54 | Ga0070689_100005960 | 3300005340 | Bacteria | 8385 |
| 55 | Ga0070689_100007606 | 3300005340 | Bacteria | 7589 |
| 56 | Ga0070689_100014298 | 3300005340 | Bacteria | 5763 |
| 57 | Ga0070689_100022551 | 3300005340 | Bacteria | 4702 |
| 58 | Ga0070689_100076094 | 3300005340 | Unclassified | 2629 |
| 59 | Ga0070689_100113731 | 3300005340 | Bacteria | 2155 |
| 60 | Ga0070689_100171269 | 3300005340 | Bacteria | 1759 |
| 61 | Ga0070689_100199188 | 3300005340 | Bacteria | 1634 |
| 62 | Ga0070691_10013119 | 3300005341 | Bacteria | 3796 |
| 63 | Ga0070687_100007099 | 3300005343 | Bacteria | 4639 |
| 64 | Ga0070687_100213725 | 3300005343 | Bacteria | 1176 |
| 65 | Ga0070661_100038853 | 3300005344 | Bacteria | 3466 |
| 66 | Ga0070661_100087148 | 3300005344 | Unclassified | 2309 |
| 67 | Ga0070661_100196825 | 3300005344 | Unclassified | 1539 |
| 68 | Ga0070692_10012085 | 3300005345 | Unclassified | 3984 |
| 69 | Ga0070668_100018067 | 3300005347 | Bacteria | 5289 |
| 70 | Ga0070668_100040743 | 3300005347 | Bacteria | 3555 |
| 71 | Ga0070668_100162468 | 3300005347 | Bacteria | 1813 |
| 72 | Ga0070669_100001207 | 3300005353 | Bacteria | 18811 |
| 73 | Ga0070669_100001973 | 3300005353 | Bacteria | 14826 |
| 74 | Ga0070669_100002718 | 3300005353 | Bacteria | 12762 |
| 75 | Ga0070669_100006126 | 3300005353 | Bacteria | 8683 |
| 76 | Ga0070669_100012721 | 3300005353 | Bacteria | 5974 |
| 77 | Ga0070669_100095422 | 3300005353 | Bacteria | 2236 |
| 78 | Ga0070675_100000890 | 3300005354 | Bacteria | 21218 |
| 79 | Ga0070675_100003302 | 3300005354 | Bacteria | 12232 |
| 80 | Ga0070675_100003354 | 3300005354 | Bacteria | 12130 |
| 81 | Ga0070675_100006236 | 3300005354 | Bacteria | 9147 |
| 82 | Ga0070675_100025127 | 3300005354 | Bacteria | 4774 |
| 83 | Ga0070675_100057387 | 3300005354 | Bacteria | 3209 |
| 84 | Ga0070675_100073761 | 3300005354 | Unclassified | 2833 |
| 85 | Ga0070675_100218793 | 3300005354 | Bacteria | 1658 |
| 86 | Ga0070671_100019858 | 3300005355 | Bacteria | 5475 |
| 87 | Ga0070671_100024511 | 3300005355 | Bacteria | 4939 |
| 88 | Ga0070674_100002134 | 3300005356 | Bacteria | 10864 |
| 89 | Ga0070674_100002918 | 3300005356 | Bacteria | 9474 |
| 90 | Ga0070674_100151587 | 3300005356 | Bacteria | 1750 |
| 91 | Ga0070673_100000370 | 3300005364 | Bacteria | 23557 |
| 92 | Ga0070673_100003840 | 3300005364 | Bacteria | 9429 |
| 93 | Ga0070673_100006729 | 3300005364 | Bacteria | 7498 |
| 94 | Ga0070673_100011969 | 3300005364 | Bacteria | 5940 |
| 95 | Ga0070673_100027846 | 3300005364 | Bacteria | 4194 |
| 96 | Ga0070673_100061519 | 3300005364 | Bacteria | 2979 |
| 97 | Ga0070673_100115147 | 3300005364 | Unclassified | 2235 |
| 98 | Ga0070673_100154029 | 3300005364 | Bacteria | 1949 |
| 99 | Ga0070673_100174746 | 3300005364 | Unclassified | 1835 |
| 100 | Ga0070673_100294229 | 3300005364 | Unclassified | 1428 |
| 101 | Ga0070673_100298163 | 3300005364 | Unclassified | 1418 |
| 102 | Ga0070688_100012782 | 3300005365 | Bacteria | 4714 |
| 103 | Ga0070688_100052402 | 3300005365 | Bacteria | 2549 |
| 104 | Ga0070688_100184966 | 3300005365 | Bacteria | 1447 |
| 105 | Ga0070688_100218236 | 3300005365 | Bacteria | 1343 |
| 106 | Ga0070659_100176226 | 3300005366 | Unclassified | 1753 |
| 107 | Ga0070659_100266151 | 3300005366 | Unclassified | 1423 |
| 108 | Ga0070659_100326464 | 3300005366 | Bacteria | 1283 |
| 109 | Ga0070659_100380579 | 3300005366 | Unclassified | 1189 |
| 110 | Ga0070667_100017750 | 3300005367 | Bacteria | 5898 |
| 111 | Ga0070667_100060350 | 3300005367 | Bacteria | 3209 |
| 112 | Ga0070667_100368476 | 3300005367 | Bacteria | 1303 |
| 113 | Ga0070667_100468044 | 3300005367 | Bacteria | 1153 |
| 114 | Ga0070709_10050050 | 3300005434 | Unclassified | 2616 |
| 115 | Ga0070714_100181719 | 3300005435 | Bacteria | 1914 |
| 116 | Ga0070713_100026419 | 3300005436 | Unclassified | 4557 |
| 117 | Ga0070713_100115800 | 3300005436 | Bacteria | 2343 |
| 118 | Ga0070710_10188405 | 3300005437 | Bacteria | 1296 |
| 119 | Ga0070701_10009533 | 3300005438 | Bacteria | 4257 |
| 120 | Ga0070701_10055123 | 3300005438 | Unclassified | 2075 |
| 121 | Ga0070701_10109861 | 3300005438 | Bacteria | 1539 |
| 122 | Ga0070700_100000744 | 3300005441 | Bacteria | 16029 |
| 123 | Ga0070700_100005721 | 3300005441 | Bacteria | 6599 |
| 124 | Ga0070700_100005745 | 3300005441 | Bacteria | 6584 |
| 125 | Ga0070700_100009761 | 3300005441 | Bacteria | 5276 |
| 126 | Ga0070700_100009763 | 3300005441 | Bacteria | 5276 |
| 127 | Ga0070694_100015477 | 3300005444 | Unclassified | 4793 |
| 128 | Ga0070694_100113231 | 3300005444 | Bacteria | 1935 |
| 129 | Ga0070663_100016596 | 3300005455 | Bacteria | 4788 |
| 130 | Ga0070663_100053978 | 3300005455 | Bacteria | 2871 |
| 131 | Ga0070678_100000511 | 3300005456 | Bacteria | 18758 |
| 132 | Ga0070678_100032605 | 3300005456 | Bacteria | 3607 |
| 133 | Ga0070678_100037944 | 3300005456 | Bacteria | 3388 |
| 134 | Ga0070678_100134359 | 3300005456 | Bacteria | 1971 |
| 135 | Ga0070678_100155158 | 3300005456 | Bacteria | 1849 |
| 136 | Ga0070678_100242212 | 3300005456 | Unclassified | 1508 |
| 137 | Ga0070662_100072074 | 3300005457 | Unclassified | 2549 |
| 138 | Ga0070681_10000309 | 3300005458 | Bacteria | 39572 |
| 139 | Ga0070681_10003682 | 3300005458 | Bacteria | 14382 |
| 140 | Ga0070681_10010073 | 3300005458 | Bacteria | 9317 |
| 141 | Ga0070681_10066157 | 3300005458 | Unclassified | 3583 |
| 142 | Ga0070681_10073770 | 3300005458 | Bacteria | 3374 |
| 143 | Ga0070681_10115496 | 3300005458 | Unclassified | 2622 |
| 144 | Ga0070681_10194209 | 3300005458 | Bacteria | 1949 |
| 145 | Ga0070681_10312616 | 3300005458 | Bacteria | 1480 |
| 146 | Ga0068867_100005810 | 3300005459 | Bacteria | 8756 |
| 147 | Ga0068867_100005825 | 3300005459 | Bacteria | 8740 |
| 148 | Ga0068867_100012100 | 3300005459 | Bacteria | 6094 |
| 149 | Ga0068867_100018293 | 3300005459 | Bacteria | 4980 |
| 150 | Ga0068867_100148801 | 3300005459 | Unclassified | 1837 |
| 151 | Ga0068867_100213036 | 3300005459 | Bacteria | 1553 |
| 152 | Ga0070685_10019361 | 3300005466 | Unclassified | 3671 |
| 153 | Ga0070685_10065230 | 3300005466 | Bacteria | 2143 |
| 154 | Ga0070706_100062732 | 3300005467 | Unclassified | 3434 |
| 155 | Ga0070706_100074264 | 3300005467 | Bacteria | 3147 |
| 156 | Ga0070707_100064275 | 3300005468 | Bacteria | 3524 |
| 157 | Ga0070707_100224930 | 3300005468 | Bacteria | 1827 |
| 158 | Ga0070698_100020520 | 3300005471 | Bacteria | 6927 |
| 159 | Ga0070698_100064477 | 3300005471 | Bacteria | 3691 |
| 160 | Ga0070698_100142586 | 3300005471 | Bacteria | 2346 |
| 161 | Ga0070699_100099253 | 3300005518 | Bacteria | 2551 |
| 162 | Ga0070699_100106293 | 3300005518 | Bacteria | 2462 |
| 163 | Ga0070699_100406714 | 3300005518 | Bacteria | 1231 |
| 164 | Ga0070679_100001350 | 3300005530 | Bacteria | 21674 |
| 165 | Ga0070679_100002948 | 3300005530 | Bacteria | 15503 |
| 166 | Ga0070679_100005418 | 3300005530 | Bacteria | 11822 |
| 167 | Ga0070679_100010515 | 3300005530 | Bacteria | 8778 |
| 168 | Ga0070679_100016724 | 3300005530 | Bacteria | 7087 |
| 169 | Ga0070679_100073734 | 3300005530 | Bacteria | 3404 |
| 170 | Ga0070679_100135470 | 3300005530 | Bacteria | 2444 |
| 171 | Ga0070679_100197549 | 3300005530 | Bacteria | 1978 |
| 172 | Ga0070679_100252896 | 3300005530 | Bacteria | 1718 |
| 173 | Ga0070679_100338790 | 3300005530 | Bacteria | 1452 |
| 174 | Ga0070684_100002830 | 3300005535 | Bacteria | 12888 |
| 175 | Ga0070684_100003300 | 3300005535 | Bacteria | 12085 |
| 176 | Ga0070684_100052352 | 3300005535 | Bacteria | 3551 |
| 177 | Ga0070684_100232303 | 3300005535 | Unclassified | 1684 |
| 178 | Ga0070697_100065425 | 3300005536 | Bacteria | 2971 |
| 179 | Ga0070697_100331173 | 3300005536 | Bacteria | 1313 |
| 180 | Ga0068853_100000300 | 3300005539 | Bacteria | 34560 |
| 181 | Ga0068853_100073678 | 3300005539 | Unclassified | 2978 |
| 182 | Ga0068853_100160935 | 3300005539 | Bacteria | 2026 |
| 183 | Ga0070672_100015454 | 3300005543 | Bacteria | 5435 |
| 184 | Ga0070672_100023216 | 3300005543 | Bacteria | 4569 |
| 185 | Ga0070672_100043645 | 3300005543 | Bacteria | 3459 |
| 186 | Ga0070672_100065199 | 3300005543 | Bacteria | 2880 |
| 187 | Ga0070672_100069262 | 3300005543 | Bacteria | 2800 |
| 188 | Ga0070672_100111694 | 3300005543 | Unclassified | 2228 |
| 189 | Ga0070672_100154339 | 3300005543 | Bacteria | 1901 |
| 190 | Ga0070672_100198978 | 3300005543 | Bacteria | 1675 |
| 191 | Ga0070686_100000642 | 3300005544 | Bacteria | 20406 |
| 192 | Ga0070686_100005637 | 3300005544 | Bacteria | 6936 |
| 193 | Ga0070686_100011225 | 3300005544 | Bacteria | 5075 |
| 194 | Ga0070686_100019575 | 3300005544 | Bacteria | 3991 |
| 195 | Ga0070686_100043680 | 3300005544 | Bacteria | 2813 |
| 196 | Ga0070686_100162892 | 3300005544 | Bacteria | 1572 |
| 197 | Ga0070695_100079239 | 3300005545 | Bacteria | 2168 |
| 198 | Ga0070696_100398818 | 3300005546 | Bacteria | 1076 |
| 199 | Ga0070665_100080454 | 3300005548 | Bacteria | 3264 |
| 200 | Ga0070665_100380697 | 3300005548 | Unclassified | 1418 |
| 201 | Ga0070704_100017654 | 3300005549 | Bacteria | 4543 |
| 202 | Ga0070704_100124127 | 3300005549 | Bacteria | 1989 |
| 203 | Ga0070704_100208322 | 3300005549 | Bacteria | 1583 |
| 204 | Ga0070704_100281037 | 3300005549 | Bacteria | 1379 |
| 205 | Ga0068855_100000281 | 3300005563 | Bacteria | 62765 |
| 206 | Ga0068855_100002270 | 3300005563 | Bacteria | 23737 |
| 207 | Ga0068855_100003646 | 3300005563 | Bacteria | 18831 |
| 208 | Ga0068855_100033765 | 3300005563 | Bacteria | 6103 |
| 209 | Ga0068855_100041518 | 3300005563 | Bacteria | 5451 |
| 210 | Ga0068855_100053654 | 3300005563 | Unclassified | 4741 |
| 211 | Ga0068855_100055539 | 3300005563 | Bacteria | 4650 |
| 212 | Ga0068855_100151606 | 3300005563 | Unclassified | 2636 |
| 213 | Ga0068855_100312790 | 3300005563 | Bacteria | 1737 |
| 214 | Ga0070664_100000556 | 3300005564 | Bacteria | 28544 |
| 215 | Ga0070664_100005141 | 3300005564 | Bacteria | 10500 |
| 216 | Ga0070664_100008742 | 3300005564 | Bacteria | 8200 |
| 217 | Ga0070664_100018808 | 3300005564 | Bacteria | 5681 |
| 218 | Ga0068857_100003854 | 3300005577 | Bacteria | 12624 |
| 219 | Ga0068857_100114611 | 3300005577 | Bacteria | 2424 |
| 220 | Ga0068854_100013717 | 3300005578 | Bacteria | 5325 |
| 221 | Ga0068854_100084887 | 3300005578 | Bacteria | 2344 |
| 222 | Ga0068856_100000402 | 3300005614 | Bacteria | 47399 |
| 223 | Ga0068856_100001321 | 3300005614 | Bacteria | 26127 |
| 224 | Ga0068856_100036179 | 3300005614 | Bacteria | 4841 |
| 225 | Ga0068856_100126327 | 3300005614 | Bacteria | 2561 |
| 226 | Ga0068856_100215362 | 3300005614 | Bacteria | 1936 |
| 227 | Ga0068852_100035367 | 3300005616 | Unclassified | 4166 |
| 228 | Ga0068852_100171123 | 3300005616 | Bacteria | 2036 |
| 229 | Ga0068852_100471042 | 3300005616 | Bacteria | 1247 |
| 230 | Ga0068859_100000856 | 3300005617 | Bacteria | 31020 |
| 231 | Ga0068859_100012549 | 3300005617 | Bacteria | 8525 |
| 232 | Ga0068859_100018726 | 3300005617 | Bacteria | 6956 |
| 233 | Ga0068859_100019300 | 3300005617 | Bacteria | 6850 |
| 234 | Ga0068859_100132432 | 3300005617 | Unclassified | 2565 |
| 235 | Ga0068859_100235306 | 3300005617 | Bacteria | 1920 |
| 236 | Ga0068859_100619043 | 3300005617 | Unclassified | 1175 |
| 237 | Ga0068864_100001103 | 3300005618 | Bacteria | 22587 |
| 238 | Ga0068864_100134216 | 3300005618 | Unclassified | 2227 |
| 239 | Ga0068864_100240219 | 3300005618 | Bacteria | 1678 |
| 240 | Ga0068866_10005957 | 3300005718 | Bacteria | 5070 |
| 241 | Ga0068866_10016670 | 3300005718 | Bacteria | 3290 |
| 242 | Ga0068861_100023075 | 3300005719 | Bacteria | 4487 |
| 243 | Ga0068861_100044916 | 3300005719 | Bacteria | 3324 |
| 244 | Ga0068861_100117173 | 3300005719 | Bacteria | 2143 |
| 245 | Ga0068861_100175478 | 3300005719 | Unclassified | 1779 |
| 246 | Ga0068851_10069760 | 3300005834 | Unclassified | 1816 |
| 247 | Ga0068870_10053582 | 3300005840 | Bacteria | 2143 |
| 248 | Ga0068863_100012313 | 3300005841 | Bacteria | 8256 |
| 249 | Ga0068863_100083549 | 3300005841 | Bacteria | 3026 |
| 250 | Ga0068863_100164915 | 3300005841 | Bacteria | 2124 |
| 251 | Ga0068863_100395790 | 3300005841 | Bacteria | 1350 |
| 252 | Ga0068863_100516564 | 3300005841 | Bacteria | 1177 |
| 253 | Ga0068858_100003292 | 3300005842 | Bacteria | 16084 |
| 254 | Ga0068858_100019810 | 3300005842 | Bacteria | 6289 |
| 255 | Ga0068858_100044424 | 3300005842 | Bacteria | 4118 |
| 256 | Ga0068858_100105653 | 3300005842 | Bacteria | 2628 |
| 257 | Ga0068858_100204594 | 3300005842 | Bacteria | 1868 |
| 258 | Ga0068858_100418925 | 3300005842 | Bacteria | 1288 |
| 259 | Ga0068860_100010802 | 3300005843 | Bacteria | 9013 |
| 260 | Ga0068860_100058809 | 3300005843 | Unclassified | 3655 |
| 261 | Ga0068860_100121725 | 3300005843 | Unclassified | 2499 |
| 262 | Ga0068860_100297248 | 3300005843 | Unclassified | 1581 |
| 263 | Ga0068862_100002166 | 3300005844 | Bacteria | 17665 |
| 264 | Ga0068862_100016110 | 3300005844 | Bacteria | 6218 |
| 265 | Ga0068862_100063425 | 3300005844 | Unclassified | 3179 |
| 266 | Ga0068862_100121132 | 3300005844 | Bacteria | 2306 |
| 267 | Ga0068862_100130796 | 3300005844 | Bacteria | 2220 |
| 268 | Ga0081455_10011250 | 3300005937 | Bacteria | 9003 |
| 269 | Ga0081455_10123295 | 3300005937 | Bacteria | 2039 |
| 270 | Ga0081538_10103929 | 3300005981 | Bacteria | 1419 |
| 271 | Ga0081540_1022235 | 3300005983 | Unclassified | 3747 |
| 272 | Ga0075365_10048028 | 3300006038 | Bacteria | 2808 |
| 273 | Ga0075363_100093458 | 3300006048 | Unclassified | 1658 |
| 274 | Ga0075364_10068722 | 3300006051 | Bacteria | 2330 |
| 275 | Ga0075364_10153554 | 3300006051 | Bacteria | 1552 |
| 276 | Ga0075362_10002309 | 3300006177 | Bacteria | 6375 |
| 277 | Ga0075367_10003335 | 3300006178 | Bacteria | 7627 |
| 278 | Ga0075367_10033685 | 3300006178 | Bacteria | 2954 |
| 279 | Ga0075427_10019963 | 3300006194 | Unclassified | 1059 |
| 280 | Ga0075366_10004550 | 3300006195 | Bacteria | 7447 |
| 281 | Ga0075366_10041277 | 3300006195 | Bacteria | 2731 |
| 282 | Ga0075366_10081794 | 3300006195 | Bacteria | 1930 |
| 283 | Ga0097621_100000113 | 3300006237 | Bacteria | 45891 |
| 284 | Ga0097621_100123720 | 3300006237 | Unclassified | 2196 |
| 285 | Ga0097621_100294847 | 3300006237 | Bacteria | 1431 |
| 286 | Ga0068871_100000132 | 3300006358 | Bacteria | 47573 |
| 287 | Ga0068871_100090132 | 3300006358 | Bacteria | 2553 |
| 288 | Ga0075428_100000319 | 3300006844 | Bacteria | 47598 |
| 289 | Ga0075428_100000346 | 3300006844 | Bacteria | 46086 |
| 290 | Ga0075428_100028997 | 3300006844 | Bacteria | 6125 |
| 291 | Ga0075428_100029578 | 3300006844 | Bacteria | 6061 |
| 292 | Ga0075428_100032898 | 3300006844 | Bacteria | 5726 |
| 293 | Ga0075428_100124274 | 3300006844 | Bacteria | 2808 |
| 294 | Ga0075428_100151928 | 3300006844 | Bacteria | 2515 |
| 295 | Ga0075428_100218732 | 3300006844 | Bacteria | 2057 |
| 296 | Ga0075430_100001453 | 3300006846 | Bacteria | 19243 |
| 297 | Ga0075430_100003185 | 3300006846 | Bacteria | 13749 |
| 298 | Ga0075430_100107415 | 3300006846 | Bacteria | 2328 |
| 299 | Ga0075430_100123743 | 3300006846 | Bacteria | 2156 |
| 300 | Ga0075430_100133457 | 3300006846 | Unclassified | 2069 |
| 301 | Ga0075430_100184345 | 3300006846 | Unclassified | 1736 |
| 302 | Ga0075430_100205098 | 3300006846 | Bacteria | 1636 |
| 303 | Ga0075430_100296658 | 3300006846 | Bacteria | 1337 |
| 304 | Ga0075430_100312001 | 3300006846 | Unclassified | 1301 |
| 305 | Ga0075431_100000161 | 3300006847 | Bacteria | 46914 |
| 306 | Ga0075431_100001791 | 3300006847 | Bacteria | 20283 |
| 307 | Ga0075431_100008623 | 3300006847 | Bacteria | 10210 |
| 308 | Ga0075431_100065763 | 3300006847 | Unclassified | 3743 |
| 309 | Ga0075431_100091196 | 3300006847 | Unclassified | 3145 |
| 310 | Ga0075431_100319711 | 3300006847 | Bacteria | 1565 |
| 311 | Ga0075433_10001814 | 3300006852 | Bacteria | 16049 |
| 312 | Ga0075433_10036715 | 3300006852 | Bacteria | 4223 |
| 313 | Ga0075434_100008279 | 3300006871 | Bacteria | 9659 |
| 314 | Ga0075434_100090797 | 3300006871 | Bacteria | 3056 |
| 315 | Ga0075434_100134714 | 3300006871 | Bacteria | 2490 |
| 316 | Ga0075429_100001822 | 3300006880 | Bacteria | 17635 |
| 317 | Ga0075429_100002325 | 3300006880 | Bacteria | 15963 |
| 318 | Ga0075429_100016697 | 3300006880 | Bacteria | 6358 |
| 319 | Ga0075429_100029457 | 3300006880 | Bacteria | 4768 |
| 320 | Ga0075429_100059547 | 3300006880 | Bacteria | 3326 |
| 321 | Ga0075429_100215850 | 3300006880 | Unclassified | 1681 |
| 322 | Ga0068865_100000579 | 3300006881 | Bacteria | 20505 |
| 323 | Ga0068865_100005964 | 3300006881 | Bacteria | 7423 |
| 324 | Ga0068865_100017297 | 3300006881 | Bacteria | 4635 |
| 325 | Ga0068865_100022492 | 3300006881 | Bacteria | 4113 |
| 326 | Ga0075436_100015446 | 3300006914 | Bacteria | 5228 |
| 327 | Ga0097620_100000856 | 3300006931 | Bacteria | 31020 |
| 328 | Ga0097620_100012549 | 3300006931 | Bacteria | 8525 |
| 329 | Ga0097620_100018726 | 3300006931 | Bacteria | 6956 |
| 330 | Ga0097620_100019300 | 3300006931 | Bacteria | 6850 |
| 331 | Ga0097620_100132431 | 3300006931 | Unclassified | 2565 |
| 332 | Ga0097620_100235302 | 3300006931 | Bacteria | 1920 |
| 333 | Ga0097620_100619033 | 3300006931 | Unclassified | 1175 |
| 334 | Ga0099794_10014319 | 3300007265 | Bacteria | 3473 |
| 335 | Ga0105240_10000541 | 3300009093 | Bacteria | 69900 |
| 336 | Ga0105240_10001087 | 3300009093 | Bacteria | 48005 |
| 337 | Ga0105240_10004530 | 3300009093 | Bacteria | 21111 |
| 338 | Ga0105240_10012416 | 3300009093 | Bacteria | 11760 |
| 339 | Ga0105240_10038183 | 3300009093 | Bacteria | 6163 |
| 340 | Ga0105240_10053890 | 3300009093 | Bacteria | 5045 |
| 341 | Ga0105240_10297839 | 3300009093 | Bacteria | 1846 |
| 342 | Ga0111539_10000393 | 3300009094 | Bacteria | 54202 |
| 343 | Ga0111539_10001372 | 3300009094 | Bacteria | 32379 |
| 344 | Ga0111539_10010838 | 3300009094 | Bacteria | 11475 |
| 345 | Ga0111539_10019777 | 3300009094 | Bacteria | 8303 |
| 346 | Ga0111539_10026117 | 3300009094 | Bacteria | 7149 |
| 347 | Ga0111539_10097778 | 3300009094 | Bacteria | 3448 |
| 348 | Ga0111539_10112150 | 3300009094 | Bacteria | 3199 |
| 349 | Ga0111539_10443008 | 3300009094 | Bacteria | 1512 |
| 350 | Ga0111539_10927415 | 3300009094 | Bacteria | 1013 |
| 351 | Ga0105245_10400703 | 3300009098 | Bacteria | 1371 |
| 352 | Ga0105247_10080947 | 3300009101 | Bacteria | 2047 |
| 353 | Ga0114129_10004036 | 3300009147 | Bacteria | 20725 |
| 354 | Ga0114129_10010683 | 3300009147 | Bacteria | 13096 |
| 355 | Ga0114129_10033825 | 3300009147 | Bacteria | 7220 |
| 356 | Ga0114129_10174071 | 3300009147 | Bacteria | 2932 |
| 357 | Ga0114129_10219599 | 3300009147 | Bacteria | 2565 |
| 358 | Ga0114129_10241299 | 3300009147 | Unclassified | 2429 |
| 359 | Ga0114129_10253434 | 3300009147 | Bacteria | 2362 |
| 360 | Ga0114129_10449309 | 3300009147 | Bacteria | 1690 |
| 361 | Ga0114129_10508249 | 3300009147 | Bacteria | 1573 |
| 362 | Ga0114129_10791088 | 3300009147 | Unclassified | 1211 |
| 363 | Ga0114129_10966353 | 3300009147 | Bacteria | 1075 |
| 364 | Ga0105243_10023274 | 3300009148 | Bacteria | 4715 |
| 365 | Ga0105243_10339168 | 3300009148 | Unclassified | 1376 |
| 366 | Ga0105241_10009684 | 3300009174 | Bacteria | 7081 |
| 367 | Ga0105242_10048514 | 3300009176 | Bacteria | 3451 |
| 368 | Ga0105248_10014040 | 3300009177 | Bacteria | 8814 |
| 369 | Ga0105248_10019197 | 3300009177 | Bacteria | 7563 |
| 370 | Ga0105248_10127513 | 3300009177 | Bacteria | 2871 |
| 371 | Ga0105248_10144702 | 3300009177 | Bacteria | 2682 |
| 372 | Ga0105248_10572315 | 3300009177 | Bacteria | 1275 |
| 373 | Ga0105237_10000069 | 3300009545 | Bacteria | 138459 |
| 374 | Ga0105237_10029942 | 3300009545 | Bacteria | 5530 |
| 375 | Ga0105237_10049101 | 3300009545 | Bacteria | 4243 |
| 376 | Ga0105237_10088986 | 3300009545 | Bacteria | 3077 |
| 377 | Ga0105237_10204570 | 3300009545 | Bacteria | 1974 |
| 378 | Ga0105238_10000471 | 3300009551 | Bacteria | 42403 |
| 379 | Ga0105238_10002524 | 3300009551 | Bacteria | 18289 |
| 380 | Ga0105238_10021516 | 3300009551 | Bacteria | 6568 |
| 381 | Ga0105238_10048789 | 3300009551 | Bacteria | 4266 |
| 382 | Ga0105238_10075974 | 3300009551 | Bacteria | 3351 |
| 383 | Ga0105238_10417713 | 3300009551 | Unclassified | 1336 |
| 384 | Ga0105238_10727659 | 3300009551 | Bacteria | 1005 |
| 385 | Ga0105249_10000242 | 3300009553 | Bacteria | 60635 |
| 386 | Ga0105249_10000698 | 3300009553 | Bacteria | 30441 |
| 387 | Ga0099796_10104281 | 3300010159 | Bacteria | 1071 |
| 388 | Ga0105239_10026435 | 3300010375 | Bacteria | 6388 |
| 389 | Ga0105239_10040792 | 3300010375 | Bacteria | 5086 |
| 390 | Ga0105239_10043362 | 3300010375 | Bacteria | 4931 |
| 391 | Ga0105239_10057747 | 3300010375 | Bacteria | 4257 |
| 392 | Ga0105239_10103695 | 3300010375 | Plasmid | 3148 |
| 393 | Ga0105239_10104531 | 3300010375 | Bacteria | 3136 |
| 394 | Ga0105239_10571554 | 3300010375 | Bacteria | 1288 |
| 395 | Ga0105239_10694452 | 3300010375 | Bacteria | 1163 |
| 396 | Ga0105246_10050712 | 3300011119 | Unclassified | 2847 |
| 397 | Ga0157373_10035476 | 3300013100 | Unclassified | 3580 |
| 398 | Ga0157371_10034224 | 3300013102 | Bacteria | 3645 |
| 399 | Ga0157370_10305102 | 3300013104 | Bacteria | 1469 |
| 400 | Ga0157370_10306750 | 3300013104 | Unclassified | 1465 |
| 401 | Ga0157369_10032693 | 3300013105 | Bacteria | 5718 |
| 402 | Ga0157369_10056937 | 3300013105 | Bacteria | 4218 |
| 403 | Ga0157369_10350427 | 3300013105 | Bacteria | 1533 |
| 404 | Ga0157374_10000400 | 3300013296 | Bacteria | 39330 |
| 405 | Ga0157374_10003194 | 3300013296 | Bacteria | 13770 |
| 406 | Ga0157374_10007030 | 3300013296 | Bacteria | 9580 |
| 407 | Ga0157374_10030098 | 3300013296 | Bacteria | 4926 |
| 408 | Ga0157374_10040945 | 3300013296 | Bacteria | 4268 |
| 409 | Ga0157374_10131803 | 3300013296 | Bacteria | 2419 |
| 410 | Ga0157378_10000195 | 3300013297 | Bacteria | 58873 |
| 411 | Ga0157378_10002056 | 3300013297 | Bacteria | 18023 |
| 412 | Ga0157378_10228170 | 3300013297 | Bacteria | 1773 |
| 413 | Ga0163162_10127051 | 3300013306 | Bacteria | 2657 |
| 414 | Ga0163162_10131779 | 3300013306 | Unclassified | 2608 |
| 415 | Ga0157372_10010834 | 3300013307 | Bacteria | 9707 |
| 416 | Ga0157372_10012124 | 3300013307 | Bacteria | 9182 |
| 417 | Ga0157372_10225468 | 3300013307 | Bacteria | 2173 |
| 418 | Ga0157372_10330656 | 3300013307 | Unclassified | 1774 |
| 419 | Ga0157372_10407741 | 3300013307 | Bacteria | 1584 |
| 420 | Ga0157372_10642025 | 3300013307 | Unclassified | 1236 |
| 421 | Ga0157375_10008227 | 3300013308 | Bacteria | 9129 |
| 422 | Ga0157375_10092448 | 3300013308 | Bacteria | 3089 |
| 423 | Ga0157375_10145358 | 3300013308 | Unclassified | 2502 |
| 424 | Ga0163163_10006750 | 3300014325 | Bacteria | 10060 |
| 425 | Ga0163163_10016449 | 3300014325 | Bacteria | 6876 |
| 426 | Ga0163163_10077529 | 3300014325 | Unclassified | 3318 |
| 427 | Ga0163163_10085273 | 3300014325 | Unclassified | 3166 |
| 428 | Ga0163163_10110157 | 3300014325 | Bacteria | 2781 |
| 429 | Ga0163163_10112503 | 3300014325 | Unclassified | 2752 |
| 430 | Ga0163163_10410149 | 3300014325 | Bacteria | 1413 |
| 431 | Ga0163163_10469432 | 3300014325 | Bacteria | 1319 |
| 432 | Ga0157380_10006495 | 3300014326 | Bacteria | 8243 |
| 433 | Ga0157380_10006953 | 3300014326 | Bacteria | 8005 |
| 434 | Ga0157380_10009368 | 3300014326 | Bacteria | 7014 |
| 435 | Ga0157380_10013500 | 3300014326 | Bacteria | 5958 |
| 436 | Ga0157380_10089855 | 3300014326 | Bacteria | 2532 |
| 437 | Ga0157380_10136088 | 3300014326 | Bacteria | 2103 |
| 438 | Ga0157380_10189502 | 3300014326 | Bacteria | 1814 |
| 439 | Ga0157380_10204864 | 3300014326 | Bacteria | 1753 |
| 440 | Ga0157380_10596084 | 3300014326 | Unclassified | 1092 |
| 441 | Ga0157377_10003190 | 3300014745 | Bacteria | 7397 |
| 442 | Ga0157379_10004863 | 3300014968 | Bacteria | 11538 |
| 443 | Ga0157376_10040921 | 3300014969 | Bacteria | 3791 |
| 444 | Ga0157376_10044377 | 3300014969 | Bacteria | 3654 |
| 445 | Ga0157376_10099262 | 3300014969 | Bacteria | 2540 |
| 446 | Ga0157376_10469038 | 3300014969 | Bacteria | 1231 |
| 447 | Ga0157376_10601042 | 3300014969 | Bacteria | 1095 |
| 448 | Ga0163161_10099645 | 3300017792 | Bacteria | 2161 |
| 449 | Ga0163161_10470081 | 3300017792 | Bacteria | 1019 |
| 450 | Ga0213876_10027399 | 3300021384 | Bacteria | 3007 |
| 451 | Ga0207697_10000122 | 3300025315 | Bacteria | 36998 |
| 452 | Ga0207697_10015818 | 3300025315 | Bacteria | 3112 |
| 453 | Ga0207697_10130646 | 3300025315 | Bacteria | 1085 |
| 454 | Ga0207656_10008865 | 3300025321 | Bacteria | 3721 |
| 455 | Ga0207682_10004257 | 3300025893 | Bacteria | 6041 |
| 456 | Ga0207682_10026430 | 3300025893 | Bacteria | 2307 |
| 457 | Ga0207682_10038096 | 3300025893 | Bacteria | 1949 |
| 458 | Ga0207682_10044278 | 3300025893 | Bacteria | 1824 |
| 459 | Ga0207642_10003249 | 3300025899 | Bacteria | 5108 |
| 460 | Ga0207688_10009098 | 3300025901 | Bacteria | 5404 |
| 461 | Ga0207680_10250275 | 3300025903 | Bacteria | 1224 |
| 462 | Ga0207680_10270344 | 3300025903 | Unclassified | 1179 |
| 463 | Ga0207647_10027025 | 3300025904 | Bacteria | 3746 |
| 464 | Ga0207647_10091925 | 3300025904 | Bacteria | 1809 |
| 465 | Ga0207699_10112740 | 3300025906 | Unclassified | 1746 |
| 466 | Ga0207645_10000742 | 3300025907 | Bacteria | 27179 |
| 467 | Ga0207645_10019155 | 3300025907 | Bacteria | 4493 |
| 468 | Ga0207645_10020677 | 3300025907 | Bacteria | 4304 |
| 469 | Ga0207645_10059086 | 3300025907 | Bacteria | 2449 |
| 470 | Ga0207643_10000360 | 3300025908 | Bacteria | 30533 |
| 471 | Ga0207643_10026346 | 3300025908 | Bacteria | 3218 |
| 472 | Ga0207643_10054218 | 3300025908 | Bacteria | 2279 |
| 473 | Ga0207643_10304359 | 3300025908 | Bacteria | 993 |
| 474 | Ga0207705_10015210 | 3300025909 | Bacteria | 5528 |
| 475 | Ga0207705_10242682 | 3300025909 | Unclassified | 1373 |
| 476 | Ga0207684_10032220 | 3300025910 | Bacteria | 4458 |
| 477 | Ga0207684_10200728 | 3300025910 | Bacteria | 1720 |
| 478 | Ga0207654_10010433 | 3300025911 | Bacteria | 4730 |
| 479 | Ga0207654_10034377 | 3300025911 | Unclassified | 2816 |
| 480 | Ga0207654_10075599 | 3300025911 | Unclassified | 2013 |
| 481 | Ga0207707_10001909 | 3300025912 | Bacteria | 18961 |
| 482 | Ga0207707_10060491 | 3300025912 | Unclassified | 3295 |
| 483 | Ga0207707_10125120 | 3300025912 | Bacteria | 2248 |
| 484 | Ga0207707_10163046 | 3300025912 | Bacteria | 1949 |
| 485 | Ga0207707_10217808 | 3300025912 | Unclassified | 1662 |
| 486 | Ga0207707_10227886 | 3300025912 | Bacteria | 1621 |
| 487 | Ga0207707_10255572 | 3300025912 | Bacteria | 1521 |
| 488 | Ga0207695_10002331 | 3300025913 | Bacteria | 28268 |
| 489 | Ga0207695_10015878 | 3300025913 | Bacteria | 8846 |
| 490 | Ga0207695_10016970 | 3300025913 | Bacteria | 8496 |
| 491 | Ga0207695_10047546 | 3300025913 | Bacteria | 4539 |
| 492 | Ga0207695_10316949 | 3300025913 | Bacteria | 1449 |
| 493 | Ga0207671_10000154 | 3300025914 | Bacteria | 106945 |
| 494 | Ga0207671_10049826 | 3300025914 | Unclassified | 3101 |
| 495 | Ga0207693_10187315 | 3300025915 | Bacteria | 1629 |
| 496 | Ga0207660_10009787 | 3300025917 | Bacteria | 6207 |
| 497 | Ga0207660_10052296 | 3300025917 | Unclassified | 2907 |
| 498 | Ga0207660_10124434 | 3300025917 | Bacteria | 1957 |
| 499 | Ga0207660_10176298 | 3300025917 | Unclassified | 1658 |
| 500 | Ga0207662_10000686 | 3300025918 | Bacteria | 15410 |
| 501 | Ga0207662_10005520 | 3300025918 | Bacteria | 6751 |
| 502 | Ga0207662_10052061 | 3300025918 | Bacteria | 2436 |
| 503 | Ga0207657_10256512 | 3300025919 | Unclassified | 1392 |
| 504 | Ga0207649_10120662 | 3300025920 | Unclassified | 1767 |
| 505 | Ga0207649_10215476 | 3300025920 | Unclassified | 1365 |
| 506 | Ga0207652_10001179 | 3300025921 | Bacteria | 23506 |
| 507 | Ga0207652_10001341 | 3300025921 | Bacteria | 21860 |
| 508 | Ga0207652_10003584 | 3300025921 | Bacteria | 12804 |
| 509 | Ga0207652_10008069 | 3300025921 | Bacteria | 8451 |
| 510 | Ga0207652_10044927 | 3300025921 | Bacteria | 3765 |
| 511 | Ga0207652_10060835 | 3300025921 | Bacteria | 3260 |
| 512 | Ga0207652_10086274 | 3300025921 | Bacteria | 2752 |
| 513 | Ga0207646_10479628 | 3300025922 | Bacteria | 1121 |
| 514 | Ga0207681_10000389 | 3300025923 | Bacteria | 30711 |
| 515 | Ga0207681_10001574 | 3300025923 | Bacteria | 14675 |
| 516 | Ga0207681_10015805 | 3300025923 | Bacteria | 4711 |
| 517 | Ga0207681_10052833 | 3300025923 | Bacteria | 2756 |
| 518 | Ga0207681_10270420 | 3300025923 | Bacteria | 1334 |
| 519 | Ga0207694_10000408 | 3300025924 | Bacteria | 40107 |
| 520 | Ga0207694_10011032 | 3300025924 | Bacteria | 6824 |
| 521 | Ga0207694_10029089 | 3300025924 | Bacteria | 4214 |
| 522 | Ga0207694_10038632 | 3300025924 | Bacteria | 3671 |
| 523 | Ga0207694_10170935 | 3300025924 | Unclassified | 1759 |
| 524 | Ga0207694_10430446 | 3300025924 | Bacteria | 1100 |
| 525 | Ga0207650_10001365 | 3300025925 | Bacteria | 17616 |
| 526 | Ga0207650_10082106 | 3300025925 | Bacteria | 2446 |
| 527 | Ga0207659_10003313 | 3300025926 | Bacteria | 9651 |
| 528 | Ga0207659_10006924 | 3300025926 | Bacteria | 6967 |
| 529 | Ga0207659_10008998 | 3300025926 | Bacteria | 6227 |
| 530 | Ga0207659_10010433 | 3300025926 | Bacteria | 5839 |
| 531 | Ga0207659_10017242 | 3300025926 | Bacteria | 4714 |
| 532 | Ga0207659_10167996 | 3300025926 | Unclassified | 1728 |
| 533 | Ga0207659_10257532 | 3300025926 | Unclassified | 1418 |
| 534 | Ga0207687_10346836 | 3300025927 | Bacteria | 1208 |
| 535 | Ga0207700_10050262 | 3300025928 | Bacteria | 3106 |
| 536 | Ga0207664_10183110 | 3300025929 | Bacteria | 1799 |
| 537 | Ga0207644_10180867 | 3300025931 | Bacteria | 1652 |
| 538 | Ga0207706_10003747 | 3300025933 | Bacteria | 14495 |
| 539 | Ga0207706_10013434 | 3300025933 | Bacteria | 7441 |
| 540 | Ga0207706_10094781 | 3300025933 | Bacteria | 2626 |
| 541 | Ga0207706_10261461 | 3300025933 | Bacteria | 1511 |
| 542 | Ga0207706_10343890 | 3300025933 | Unclassified | 1297 |
| 543 | Ga0207686_10186777 | 3300025934 | Bacteria | 1474 |
| 544 | Ga0207709_10004218 | 3300025935 | Bacteria | 8335 |
| 545 | Ga0207709_10048171 | 3300025935 | Unclassified | 2595 |
| 546 | Ga0207670_10000016 | 3300025936 | Bacteria | 166872 |
| 547 | Ga0207670_10004761 | 3300025936 | Bacteria | 7363 |
| 548 | Ga0207670_10005591 | 3300025936 | Bacteria | 6909 |
| 549 | Ga0207670_10015057 | 3300025936 | Bacteria | 4610 |
| 550 | Ga0207670_10022875 | 3300025936 | Bacteria | 3881 |
| 551 | Ga0207670_10110034 | 3300025936 | Unclassified | 1984 |
| 552 | Ga0207670_10112068 | 3300025936 | Bacteria | 1968 |
| 553 | Ga0207670_10138951 | 3300025936 | Bacteria | 1789 |
| 554 | Ga0207669_10001664 | 3300025937 | Bacteria | 9460 |
| 555 | Ga0207669_10003981 | 3300025937 | Bacteria | 6456 |
| 556 | Ga0207669_10039226 | 3300025937 | Bacteria | 2734 |
| 557 | Ga0207669_10067262 | 3300025937 | Bacteria | 2232 |
| 558 | Ga0207669_10225666 | 3300025937 | Bacteria | 1378 |
| 559 | Ga0207704_10003435 | 3300025938 | Bacteria | 7198 |
| 560 | Ga0207704_10018840 | 3300025938 | Bacteria | 3613 |
| 561 | Ga0207704_10018944 | 3300025938 | Bacteria | 3605 |
| 562 | Ga0207704_10175662 | 3300025938 | Bacteria | 1542 |
| 563 | Ga0207691_10002481 | 3300025940 | Bacteria | 18049 |
| 564 | Ga0207691_10007176 | 3300025940 | Bacteria | 10749 |
| 565 | Ga0207691_10018779 | 3300025940 | Bacteria | 6548 |
| 566 | Ga0207691_10035286 | 3300025940 | Bacteria | 4643 |
| 567 | Ga0207691_10040822 | 3300025940 | Bacteria | 4287 |
| 568 | Ga0207691_10049195 | 3300025940 | Bacteria | 3863 |
| 569 | Ga0207691_10071079 | 3300025940 | Bacteria | 3142 |
| 570 | Ga0207691_10072862 | 3300025940 | Bacteria | 3098 |
| 571 | Ga0207691_10082569 | 3300025940 | Bacteria | 2886 |
| 572 | Ga0207691_10093717 | 3300025940 | Bacteria | 2688 |
| 573 | Ga0207691_10110286 | 3300025940 | Bacteria | 2448 |
| 574 | Ga0207691_10178004 | 3300025940 | Bacteria | 1859 |
| 575 | Ga0207691_10322099 | 3300025940 | Bacteria | 1325 |
| 576 | Ga0207691_10471929 | 3300025940 | Bacteria | 1067 |
| 577 | Ga0207711_10034792 | 3300025941 | Bacteria | 4266 |
| 578 | Ga0207711_10056006 | 3300025941 | Bacteria | 3387 |
| 579 | Ga0207711_10093279 | 3300025941 | Bacteria | 2651 |
| 580 | Ga0207689_10010434 | 3300025942 | Bacteria | 7998 |
| 581 | Ga0207689_10010679 | 3300025942 | Bacteria | 7900 |
| 582 | Ga0207689_10116118 | 3300025942 | Bacteria | 2200 |
| 583 | Ga0207689_10283404 | 3300025942 | Unclassified | 1372 |
| 584 | Ga0207661_10000530 | 3300025944 | Bacteria | 24456 |
| 585 | Ga0207661_10003785 | 3300025944 | Bacteria | 10550 |
| 586 | Ga0207661_10053664 | 3300025944 | Plasmid | 3226 |
| 587 | Ga0207679_10000782 | 3300025945 | Bacteria | 20829 |
| 588 | Ga0207679_10008872 | 3300025945 | Bacteria | 6414 |
| 589 | Ga0207679_10097166 | 3300025945 | Bacteria | 2293 |
| 590 | Ga0207667_10000454 | 3300025949 | Bacteria | 54890 |
| 591 | Ga0207667_10000733 | 3300025949 | Bacteria | 42641 |
| 592 | Ga0207667_10012978 | 3300025949 | Bacteria | 9563 |
| 593 | Ga0207667_10097498 | 3300025949 | Bacteria | 3034 |
| 594 | Ga0207667_10269567 | 3300025949 | Unclassified | 1740 |
| 595 | Ga0207667_10412561 | 3300025949 | Unclassified | 1374 |
| 596 | Ga0207651_10006010 | 3300025960 | Bacteria | 6298 |
| 597 | Ga0207651_10007263 | 3300025960 | Bacteria | 5889 |
| 598 | Ga0207651_10007581 | 3300025960 | Bacteria | 5790 |
| 599 | Ga0207651_10007675 | 3300025960 | Bacteria | 5761 |
| 600 | Ga0207651_10019437 | 3300025960 | Bacteria | 4071 |
| 601 | Ga0207651_10061318 | 3300025960 | Bacteria | 2615 |
| 602 | Ga0207651_10179845 | 3300025960 | Unclassified | 1677 |
| 603 | Ga0207651_10216477 | 3300025960 | Bacteria | 1545 |
| 604 | Ga0207651_10217286 | 3300025960 | Bacteria | 1543 |
| 605 | Ga0207712_10019996 | 3300025961 | Bacteria | 4380 |
| 606 | Ga0207712_10179331 | 3300025961 | Bacteria | 1663 |
| 607 | Ga0207668_10004246 | 3300025972 | Bacteria | 8405 |
| 608 | Ga0207668_10028126 | 3300025972 | Bacteria | 3672 |
| 609 | Ga0207640_10007089 | 3300025981 | Bacteria | 6176 |
| 610 | Ga0207640_10030760 | 3300025981 | Bacteria | 3310 |
| 611 | Ga0207640_10055478 | 3300025981 | Bacteria | 2596 |
| 612 | Ga0207658_10137864 | 3300025986 | Bacteria | 1970 |
| 613 | Ga0207658_10142285 | 3300025986 | Bacteria | 1943 |
| 614 | Ga0207677_10010786 | 3300026023 | Bacteria | 5181 |
| 615 | Ga0207677_10119354 | 3300026023 | Bacteria | 1980 |
| 616 | Ga0207677_10520446 | 3300026023 | Bacteria | 1032 |
| 617 | Ga0207703_10022121 | 3300026035 | Bacteria | 4983 |
| 618 | Ga0207703_10087455 | 3300026035 | Bacteria | 2613 |
| 619 | Ga0207703_10219858 | 3300026035 | Bacteria | 1698 |
| 620 | Ga0207639_10000508 | 3300026041 | Bacteria | 26945 |
| 621 | Ga0207639_10009309 | 3300026041 | Bacteria | 6771 |
| 622 | Ga0207678_10028488 | 3300026067 | Bacteria | 4877 |
| 623 | Ga0207678_10307044 | 3300026067 | Bacteria | 1364 |
| 624 | Ga0207708_10009444 | 3300026075 | Bacteria | 7222 |
| 625 | Ga0207708_10010278 | 3300026075 | Bacteria | 6948 |
| 626 | Ga0207708_10016489 | 3300026075 | Bacteria | 5556 |
| 627 | Ga0207708_10087690 | 3300026075 | Unclassified | 2396 |
| 628 | Ga0207708_10107568 | 3300026075 | Bacteria | 2162 |
| 629 | Ga0207708_10130263 | 3300026075 | Bacteria | 1967 |
| 630 | Ga0207702_10000386 | 3300026078 | Bacteria | 50267 |
| 631 | Ga0207702_10040605 | 3300026078 | Unclassified | 3900 |
| 632 | Ga0207702_10054992 | 3300026078 | Bacteria | 3375 |
| 633 | Ga0207702_10255583 | 3300026078 | Bacteria | 1647 |
| 634 | Ga0207702_10449727 | 3300026078 | Bacteria | 1250 |
| 635 | Ga0207641_10077624 | 3300026088 | Unclassified | 2874 |
| 636 | Ga0207641_10151895 | 3300026088 | Bacteria | 2098 |
| 637 | Ga0207641_10267539 | 3300026088 | Unclassified | 1603 |
| 638 | Ga0207641_10377308 | 3300026088 | Bacteria | 1357 |
| 639 | Ga0207648_10004049 | 3300026089 | Bacteria | 15222 |
| 640 | Ga0207648_10006391 | 3300026089 | Bacteria | 11711 |
| 641 | Ga0207648_10010518 | 3300026089 | Bacteria | 8765 |
| 642 | Ga0207648_10019547 | 3300026089 | Bacteria | 6114 |
| 643 | Ga0207648_10055372 | 3300026089 | Bacteria | 3462 |
| 644 | Ga0207648_10056056 | 3300026089 | Unclassified | 3440 |
| 645 | Ga0207648_10136625 | 3300026089 | Unclassified | 2160 |
| 646 | Ga0207676_10012639 | 3300026095 | Bacteria | 6055 |
| 647 | Ga0207676_10522156 | 3300026095 | Unclassified | 1130 |
| 648 | Ga0207674_10000454 | 3300026116 | Bacteria | 53564 |
| 649 | Ga0207674_10007924 | 3300026116 | Bacteria | 12335 |
| 650 | Ga0207674_10142996 | 3300026116 | Bacteria | 2352 |
| 651 | Ga0207675_100032050 | 3300026118 | Bacteria | 4895 |
| 652 | Ga0207675_100075646 | 3300026118 | Bacteria | 3152 |
| 653 | Ga0207675_100101710 | 3300026118 | Unclassified | 2708 |
| 654 | Ga0207675_100154842 | 3300026118 | Bacteria | 2184 |
| 655 | Ga0207683_10002282 | 3300026121 | Bacteria | 16814 |
| 656 | Ga0207683_10006810 | 3300026121 | Bacteria | 9787 |
| 657 | Ga0207683_10009814 | 3300026121 | Bacteria | 8166 |
| 658 | Ga0207683_10029667 | 3300026121 | Bacteria | 4737 |
| 659 | Ga0207683_10056031 | 3300026121 | Bacteria | 3457 |
| 660 | Ga0207683_10059295 | 3300026121 | Bacteria | 3362 |
| 661 | Ga0207683_10154260 | 3300026121 | Bacteria | 2074 |
| 662 | Ga0207683_10423049 | 3300026121 | Bacteria | 1227 |
| 663 | Ga0207698_10065655 | 3300026142 | Unclassified | 2852 |
| 664 | Ga0207698_10203260 | 3300026142 | Bacteria | 1776 |
| 665 | Ga0207698_10449467 | 3300026142 | Bacteria | 1244 |
| 666 | Ga0209999_1009313 | 3300027543 | Bacteria | 1774 |
| 667 | Ga0209983_1021908 | 3300027665 | Bacteria | 1338 |
| 668 | Ga0209971_1001938 | 3300027682 | Bacteria | 5056 |
| 669 | Ga0209966_1005047 | 3300027695 | Bacteria | 2255 |
| 670 | Ga0209998_10005768 | 3300027717 | Unclassified | 2579 |
| 671 | Ga0209974_10002133 | 3300027876 | Bacteria | 7234 |
| 672 | Ga0209974_10003480 | 3300027876 | Bacteria | 5676 |
| 673 | Ga0209974_10020924 | 3300027876 | Bacteria | 2168 |
| 674 | Ga0207428_10001116 | 3300027907 | Bacteria | 29192 |
| 675 | Ga0207428_10004980 | 3300027907 | Bacteria | 12508 |
| 676 | Ga0207428_10039147 | 3300027907 | Bacteria | 3849 |
| 677 | Ga0207428_10052035 | 3300027907 | Bacteria | 3272 |
| 678 | Ga0207428_10067735 | 3300027907 | Bacteria | 2810 |
| 679 | Ga0207428_10328296 | 3300027907 | Bacteria | 1129 |
| 680 | Ga0268266_10024798 | 3300028379 | Bacteria | 5103 |
| 681 | Ga0268265_10485814 | 3300028380 | Unclassified | 1161 |
| 682 | Ga0268264_10008715 | 3300028381 | Bacteria | 8424 |
| 683 | Ga0268264_10158212 | 3300028381 | Unclassified | 2038 |
| 684 | Ga0268264_10555873 | 3300028381 | Unclassified | 1126 |
| 685 | Ga0265334_10023643 | 3300028573 | Bacteria | 2498 |
| 686 | Ga0265318_10000249 | 3300028577 | Bacteria | 46904 |
| 687 | Ga0265318_10026486 | 3300028577 | Bacteria | 2283 |
| 688 | Ga0265336_10002369 | 3300028666 | Bacteria | 7818 |
| 689 | Ga0307517_10126569 | 3300028786 | Bacteria | 1861 |
| 690 | Ga0265330_10001293 | 3300031235 | Bacteria | 14644 |
| 691 | Ga0265332_10012305 | 3300031238 | Bacteria | 3796 |
| 692 | Ga0265320_10008001 | 3300031240 | Bacteria | 6509 |
| 693 | Ga0265320_10016933 | 3300031240 | Bacteria | 4065 |
| 694 | Ga0265339_10007358 | 3300031249 | Bacteria | 7125 |
| 695 | Ga0265331_10002792 | 3300031250 | Bacteria | 11584 |
| 696 | Ga0265316_10002890 | 3300031344 | Bacteria | 17559 |
| 697 | Ga0307513_10131556 | 3300031456 | Bacteria | 2447 |
| 698 | Ga0307509_10073364 | 3300031507 | Bacteria | 3563 |
| 699 | Ga0265313_10007350 | 3300031595 | Bacteria | 7549 |
| 700 | Ga0265313_10010236 | 3300031595 | Bacteria | 5966 |
| 701 | Ga0265313_10016635 | 3300031595 | Bacteria | 4220 |
| 702 | Ga0265313_10068097 | 3300031595 | Bacteria | 1645 |
| 703 | Ga0307508_10006620 | 3300031616 | Bacteria | 10880 |
| 704 | Ga0265314_10011910 | 3300031711 | Bacteria | 7140 |
| 705 | Ga0265314_10152300 | 3300031711 | Bacteria | 1416 |
| 706 | Ga0265314_10190679 | 3300031711 | Bacteria | 1220 |
| 707 | Ga0265342_10000058 | 3300031712 | Bacteria | 118791 |
| 708 | Ga0265342_10000952 | 3300031712 | Bacteria | 28815 |
| 709 | Ga0265342_10034705 | 3300031712 | Unclassified | 3093 |
| 710 | Ga0265342_10113649 | 3300031712 | Bacteria | 1530 |
| 711 | Ga0316576_10197841 | 3300031727 | Unclassified | 1514 |
| 712 | Ga0316578_10231095 | 3300031728 | Bacteria | 1111 |
| 713 | Ga0307413_10006455 | 3300031824 | Bacteria | 5359 |
| 714 | Ga0307410_10012670 | 3300031852 | Bacteria | 4886 |
| 715 | Ga0307410_10057567 | 3300031852 | Bacteria | 2647 |
| 716 | Ga0307410_10135987 | 3300031852 | Bacteria | 1812 |
| 717 | Ga0307410_10322503 | 3300031852 | Unclassified | 1226 |
| 718 | Ga0307409_100161417 | 3300031995 | Bacteria | 1960 |
| 719 | Ga0307409_100189505 | 3300031995 | Bacteria | 1829 |
| 720 | Ga0307416_100180724 | 3300032002 | Unclassified | 1977 |
| 721 | Ga0307416_100310625 | 3300032002 | Bacteria | 1573 |
| 722 | Ga0307416_100410473 | 3300032002 | Unclassified | 1395 |
| 723 | Ga0307414_10058527 | 3300032004 | Bacteria | 2716 |
| 724 | Ga0307414_10215280 | 3300032004 | Unclassified | 1573 |
| 725 | Ga0307414_10255500 | 3300032004 | Bacteria | 1459 |
| 726 | Ga0307411_10001059 | 3300032005 | Bacteria | 10652 |
| 727 | Ga0307411_10007556 | 3300032005 | Bacteria | 5551 |
| 728 | Ga0307411_10321962 | 3300032005 | Bacteria | 1249 |
| 729 | Ga0307411_10356584 | 3300032005 | Bacteria | 1194 |
| 730 | Ga0307415_100277168 | 3300032126 | Bacteria | 1377 |
| 731 | Ga0373923_0080905 | 3300035111 | Bacteria | 1409 |
| 732 | Ga0373932_0039808 | 3300035112 | Unclassified | 1350 |
| 733 | Ga0373941_0012911 | 3300035115 | Bacteria | 2195 |
| 734 | Ga0373945_0068121 | 3300035116 | Bacteria | 1342 |
| 735 | Ga0373954_0035730 | 3300035118 | Bacteria | 2305 |
| 736 | Ga0373956_0165074 | 3300035119 | Bacteria | 1044 |
| 737 | Ga0373957_0034728 | 3300035120 | Bacteria | 1870 |
| 738 | Ga0373943_0004390 | 3300035170 | Bacteria | 6392 |
| 739 | Ga0373955_0192307 | 3300035172 | Bacteria | 1213 |
| 740 | Ga0373942_0060626 | 3300035207 | Unclassified | 1084 |
| 741 | Ga0316574_0109496 | 3300035398 | Unclassified | 1770 |
| 742 | Ga0373933_0000571 | 3300035724 | Bacteria | 23063 |
| 743 | Ga0373933_0075491 | 3300035724 | Bacteria | 2058 |
| 744 | Ga0373933_0150496 | 3300035724 | Bacteria | 1473 |
| 745 | Ga0373947_0071507 | 3300035725 | Bacteria | 2128 |
| 746 | Ga0373937_0015714 | 3300036401 | Bacteria | 6703 |
| 747 | Ga0373937_0059645 | 3300036401 | Bacteria | 3507 |
| 748 | Ga0373937_0150254 | 3300036401 | Bacteria | 2182 |
| 749 | Ga0316582_0234861 | 3300036647 | Bacteria | 1255 |
| 750 | Ga0316584_0367355 | 3300036712 | Bacteria | 1030 |
| 751 | Ga0373925_0211908 | 3300037068 | Bacteria | 1543 |
| 752 | Ga0395899_0003486 | 3300037312 | Bacteria | 12463 |
| 753 | Ga0395899_0131781 | 3300037312 | Bacteria | 1784 |
| 754 | Ga0395900_0039696 | 3300037418 | Unclassified | 4850 |
| 755 | Ga0395898_0119021 | 3300037466 | Bacteria | 2530 |
| 756 | Ga0395905_0008925 | 3300037471 | Bacteria | 9847 |
| 757 | Ga0395905_0126742 | 3300037471 | Bacteria | 2401 |
| 758 | Ga0436364_1364284 | 3300037853 | Bacteria | 2280 |
| 759 | Ga0395901_0100189 | 3300038443 | Bacteria | 3038 |
| 760 | Ga0395901_0125366 | 3300038443 | Bacteria | 2699 |
| 761 | Ga0436365_0315991 | 3300039437 | Bacteria | 4479 |
| 762 | Ga0436361_1194389 | 3300039447 | Bacteria | 4495 |
| 763 | Ga0436362_0113079 | 3300039453 | Bacteria | 3842 |
| 764 | Ga0451802_1119816 | 3300041460 | Bacteria | 2339 |
| 765 | Ga0451807_0323276 | 3300041486 | Bacteria | 8722 |
| 766 | Ga0451807_1842893 | 3300041486 | Unclassified | 1071 |
| 767 | Ga0451851_1349236 | 3300041507 | Bacteria | 1925 |
| 768 | Ga0439441_038890 | 3300042001 | Unclassified | 947 |
| 769 | Ga0439462_0010088 | 3300042015 | Bacteria | 2391 |
| 770 | Ga0439434_0072154 | 3300042435 | Unclassified | 1088 |
| 771 | Ga0439435_0002028 | 3300042436 | Bacteria | 3914 |
| 772 | Ga0439435_0072291 | 3300042436 | Bacteria | 1023 |
| 773 | Ga0439460_0069379 | 3300042461 | Unclassified | 1089 |
| 774 | Ga0451577_0000014 | 3300042876 | Bacteria | 546755 |
| 775 | Ga0451577_0004796 | 3300042876 | Bacteria | 14128 |
| 776 | Ga0451577_0033189 | 3300042876 | Bacteria | 4652 |
| 777 | Ga0451577_0214941 | 3300042876 | Bacteria | 1737 |
| 778 | Ga0451577_0221732 | 3300042876 | Bacteria | 1709 |
| 779 | Ga0451577_0269203 | 3300042876 | Bacteria | 1543 |
| 780 | Ga0439440_0013426 | 3300042993 | Bacteria | 1757 |
| 781 | Ga0453683_0034950 | 3300044673 | Bacteria | 3168 |
| 782 | Ga0466966_0235692 | 3300044684 | Bacteria | 1104 |
| 783 | Ga0466963_0008133 | 3300044694 | Bacteria | 6280 |
| 784 | Ga0453684_0000571 | 3300044712 | Bacteria | 137625 |
| 785 | Ga0453684_0021379 | 3300044712 | Bacteria | 9669 |
| 786 | Ga0453684_0068727 | 3300044712 | Bacteria | 4497 |
| 787 | Ga0453684_0086022 | 3300044712 | Bacteria | 3903 |
| 788 | Ga0453684_0109542 | 3300044712 | Unclassified | 3359 |
| 789 | Ga0453684_0167107 | 3300044712 | Bacteria | 2596 |
| 790 | Ga0453684_0632872 | 3300044712 | Bacteria | 1169 |
| 791 | Ga0466968_0084984 | 3300044735 | Unclassified | 1396 |
| 792 | Ga0466959_0302063 | 3300045049 | Unclassified | 1096 |
| 793 | Ga0451576_0004634 | 3300045051 | Bacteria | 17747 |
| 794 | Ga0451576_0010676 | 3300045051 | Bacteria | 10522 |
| 795 | Ga0451576_0027607 | 3300045051 | Bacteria | 6093 |
| 796 | Ga0451576_0045309 | 3300045051 | Bacteria | 4633 |
| 797 | Ga0451576_0085432 | 3300045051 | Bacteria | 3283 |
| 798 | Ga0451576_0100679 | 3300045051 | Bacteria | 3005 |
| 799 | Ga0451576_0214068 | 3300045051 | Unclassified | 2012 |
| 800 | Ga0451576_0360891 | 3300045051 | Bacteria | 1522 |
| 801 | Ga0451576_0791200 | 3300045051 | Viruses | 996 |
| 802 | Ga0451576_0869759 | 3300045051 | Bacteria | 946 |
| 803 | Ga0466967_0002498 | 3300045976 | Bacteria | 11486 |
| 804 | Ga0466967_0263358 | 3300045976 | Bacteria | 1650 |
| 805 | Ga0466967_0336842 | 3300045976 | Bacteria | 1458 |
| 806 | Ga0466967_0355419 | 3300045976 | Bacteria | 1419 |
| 807 | Ga0495629_0000013 | 3300046459 | Bacteria | 212317 |
| 808 | Ga0495638_0091498 | 3300046460 | Bacteria | 1832 |
| 809 | Ga0495641_0115740 | 3300046461 | Bacteria | 1196 |
| 810 | Ga0495651_0004108 | 3300046462 | Bacteria | 11143 |
| 811 | Ga0495580_0001294 | 3300046472 | Bacteria | 22084 |
| 812 | Ga0495580_0014860 | 3300046472 | Bacteria | 5899 |
| 813 | Ga0495580_0037990 | 3300046472 | Bacteria | 3452 |
| 814 | Ga0495580_0054275 | 3300046472 | Bacteria | 2827 |
| 815 | Ga0495582_0002525 | 3300046473 | Bacteria | 10182 |
| 816 | Ga0495639_0010666 | 3300046475 | Bacteria | 3956 |
| 817 | Ga0495662_0025870 | 3300046476 | Bacteria | 2835 |
| 818 | Ga0495664_0028187 | 3300046477 | Bacteria | 3279 |
| 819 | Ga0495594_0009877 | 3300046499 | Unclassified | 4945 |
| 820 | Ga0495640_0135137 | 3300046533 | Bacteria | 1593 |
| 821 | Ga0495586_0022185 | 3300046535 | Bacteria | 3388 |
| 822 | Ga0495587_0071760 | 3300046536 | Unclassified | 2014 |
| 823 | Ga0495667_0116708 | 3300046559 | Unclassified | 1724 |
| 824 | Ga0495656_0122938 | 3300046615 | Bacteria | 1227 |
| 825 | Ga0495634_0002195 | 3300046642 | Bacteria | 16385 |
| 826 | Ga0495635_0001297 | 3300046663 | Bacteria | 16706 |
| 827 | Ga0495635_0051124 | 3300046663 | Unclassified | 2848 |
| 828 | Ga0495588_0026363 | 3300046674 | Bacteria | 2901 |
| 829 | Ga0495657_0008498 | 3300046675 | Bacteria | 7850 |
| 830 | Ga0495646_0139043 | 3300046680 | Bacteria | 1360 |
| 831 | Ga0495658_0000018 | 3300046683 | Bacteria | 93319 |
| 832 | Ga0495658_0148559 | 3300046683 | Bacteria | 1438 |
| 833 | Ga0495613_0006193 | 3300046689 | Bacteria | 8952 |
| 834 | Ga0495613_0177286 | 3300046689 | Bacteria | 1510 |
| 835 | Ga0495581_0000031 | 3300047315 | Bacteria | 53247 |
| 836 | Ga0495581_0132604 | 3300047315 | Bacteria | 1452 |
| 837 | Ga0495674_0005609 | 3300047319 | Bacteria | 12035 |
| 838 | Ga0495676_0045929 | 3300047321 | Unclassified | 3551 |
| 839 | Ga0495680_0000427 | 3300047322 | Bacteria | 47237 |
| 840 | Ga0495680_0191373 | 3300047322 | Unclassified | 1472 |
| 841 | Ga0495675_0014622 | 3300047444 | Unclassified | 4959 |
| 842 | Ga0495675_0183902 | 3300047444 | Unclassified | 1278 |
| 843 | Ga0495684_0000439 | 3300047471 | Bacteria | 34058 |
| 844 | Ga0495593_0165024 | 3300047673 | Bacteria | 1117 |
| 845 | Ga0495602_0008476 | 3300048088 | Bacteria | 10737 |
| 846 | Ga0495614_0000561 | 3300048089 | Bacteria | 15437 |
| 847 | Ga0496100_0064629 | 3300048903 | Bacteria | 2422 |
| 848 | Ga0496101_0039221 | 3300048904 | Unclassified | 3367 |
| 849 | Ga0496101_0195110 | 3300048904 | Bacteria | 1564 |
| 850 | Ga0496102_0140971 | 3300048905 | Unclassified | 2260 |
| 851 | Ga0496104_0003039 | 3300048907 | Bacteria | 14448 |
| 852 | Ga0496104_0009068 | 3300048907 | Bacteria | 8844 |
| 853 | Ga0496104_0018588 | 3300048907 | Bacteria | 6344 |
| 854 | Ga0496104_0200747 | 3300048907 | Bacteria | 1906 |
| 855 | Ga0496105_0023290 | 3300048908 | Bacteria | 5020 |
| 856 | Ga0496105_0024825 | 3300048908 | Bacteria | 4872 |
| 857 | Ga0496105_0060082 | 3300048908 | Bacteria | 3136 |
| 858 | Ga0496106_0050352 | 3300048909 | Unclassified | 3140 |
| 859 | Ga0496107_0066938 | 3300048910 | Bacteria | 2605 |
| 860 | Ga0496108_0002286 | 3300048911 | Bacteria | 15349 |
| 861 | Ga0496108_0017200 | 3300048911 | Bacteria | 5915 |
| 862 | Ga0496108_0019818 | 3300048911 | Bacteria | 5527 |
| 863 | Ga0496108_0032535 | 3300048911 | Bacteria | 4332 |
| 864 | Ga0496109_0000608 | 3300048912 | Bacteria | 29912 |
| 865 | Ga0496109_0027391 | 3300048912 | Bacteria | 5087 |
| 866 | Ga0496109_0040390 | 3300048912 | Bacteria | 4226 |
| 867 | Ga0496109_0280053 | 3300048912 | Unclassified | 1572 |
| 868 | Ga0496109_0663527 | 3300048912 | Bacteria | 980 |
| 869 | Ga0496110_0000743 | 3300048913 | Bacteria | 22519 |
| 870 | Ga0496110_0399992 | 3300048913 | Bacteria | 1252 |
| 871 | Ga0496111_0021689 | 3300048914 | Bacteria | 4488 |
| 872 | Ga0496112_0020015 | 3300048915 | Bacteria | 6335 |
| 873 | Ga0496112_0040937 | 3300048915 | Bacteria | 4532 |
| 874 | Ga0496112_0049896 | 3300048915 | Bacteria | 4102 |
| 875 | Ga0496112_0109031 | 3300048915 | Bacteria | 2739 |
| 876 | Ga0496112_0135132 | 3300048915 | Bacteria | 2437 |
| 877 | Ga0496112_0320448 | 3300048915 | Bacteria | 1494 |
| 878 | Ga0496113_0015973 | 3300048916 | Bacteria | 5177 |
| 879 | Ga0496114_0000068 | 3300048917 | Bacteria | 75213 |
| 880 | Ga0496114_0000737 | 3300048917 | Bacteria | 24412 |
| 881 | Ga0496115_0040214 | 3300048918 | Bacteria | 3716 |
| 882 | Ga0496115_0060311 | 3300048918 | Bacteria | 3056 |
| 883 | Ga0496115_0124154 | 3300048918 | Unclassified | 2126 |
| 884 | Ga0496115_0239247 | 3300048918 | Bacteria | 1496 |
| 885 | Ga0496126_0000209 | 3300048929 | Bacteria | 131440 |
| 886 | Ga0501031_0010228 | 3300049568 | Bacteria | 6108 |
| 887 | Ga0501031_0523855 | 3300049568 | Unclassified | 764 |
| 888 | Ga0501033_0078628 | 3300049570 | Unclassified | 2420 |
| 889 | Ga0501034_0198011 | 3300049571 | Unclassified | 1968 |
| 890 | Ga0501036_0091226 | 3300049572 | Unclassified | 2574 |
| 891 | Ga0501036_0097038 | 3300049572 | Bacteria | 2492 |
| 892 | Ga0501036_0159125 | 3300049572 | Bacteria | 1904 |
| 893 | Ga0501037_0062907 | 3300049573 | Unclassified | 2706 |
| 894 | Ga0501038_0157840 | 3300049574 | Unclassified | 1846 |
| 895 | Ga0501038_0235675 | 3300049574 | Bacteria | 1455 |
| 896 | Ga0501040_0144301 | 3300049576 | Bacteria | 1677 |
| 897 | Ga0501040_0164808 | 3300049576 | Bacteria | 1568 |
| 898 | Ga0501040_0392366 | 3300049576 | Unclassified | 996 |
| 899 | Ga0501041_0125941 | 3300049577 | Bacteria | 1594 |
| 900 | Ga0501041_0162914 | 3300049577 | Bacteria | 1394 |
| 901 | Ga0501042_0023266 | 3300049578 | Bacteria | 4334 |
| 902 | Ga0501043_0004220 | 3300049579 | Bacteria | 11723 |
| 903 | Ga0501046_0004262 | 3300049580 | Bacteria | 13021 |
| 904 | Ga0501047_0001022 | 3300049581 | Bacteria | 28231 |
| 905 | Ga0501047_0005274 | 3300049581 | Bacteria | 12145 |
| 906 | Ga0501047_0099511 | 3300049581 | Unclassified | 2787 |
| 907 | Ga0501048_0281941 | 3300049582 | Bacteria | 1181 |
| 908 | Ga0501048_0305644 | 3300049582 | Bacteria | 1132 |
| 909 | Ga0501068_0001246 | 3300049584 | Bacteria | 13525 |
| 910 | Ga0501069_0061544 | 3300049585 | Bacteria | 2096 |
| 911 | Ga0501069_0169256 | 3300049585 | Unclassified | 1260 |
| 912 | Ga0501069_0243472 | 3300049585 | Bacteria | 1048 |
| 913 | Ga0501070_0000007 | 3300049586 | Bacteria | 219869 |
| 914 | Ga0501070_0022228 | 3300049586 | Bacteria | 5313 |
| 915 | Ga0501071_0006704 | 3300049587 | Bacteria | 7485 |
| 916 | Ga0501071_0047897 | 3300049587 | Bacteria | 3071 |
| 917 | Ga0501071_0147008 | 3300049587 | Bacteria | 1757 |
| 918 | Ga0501071_0324291 | 3300049587 | Unclassified | 1170 |
| 919 | Ga0501072_0005036 | 3300049588 | Bacteria | 10049 |
| 920 | Ga0501072_0148186 | 3300049588 | Bacteria | 1871 |
| 921 | Ga0501072_0263642 | 3300049588 | Bacteria | 1371 |
| 922 | Ga0501072_0304919 | 3300049588 | Bacteria | 1266 |
| 923 | Ga0501072_0400897 | 3300049588 | Bacteria | 1088 |
| 924 | Ga0501073_0002900 | 3300049589 | Bacteria | 12868 |
| 925 | Ga0501073_0027220 | 3300049589 | Bacteria | 4092 |
| 926 | Ga0501073_0167474 | 3300049589 | Bacteria | 1521 |
| 927 | Ga0501073_0334631 | 3300049589 | Bacteria | 1045 |
| 928 | Ga0501074_0201097 | 3300049590 | Bacteria | 1420 |
| 929 | Ga0501075_0016996 | 3300049591 | Bacteria | 5248 |
| 930 | Ga0501075_0050546 | 3300049591 | Bacteria | 3125 |
| 931 | Ga0501075_0128424 | 3300049591 | Bacteria | 1930 |
| 932 | Ga0501076_0007740 | 3300049592 | Bacteria | 7830 |
| 933 | Ga0501076_0065438 | 3300049592 | Bacteria | 2899 |
| 934 | Ga0501076_0068626 | 3300049592 | Bacteria | 2832 |
| 935 | Ga0501076_0188302 | 3300049592 | Bacteria | 1684 |
| 936 | Ga0501076_0199409 | 3300049592 | Bacteria | 1634 |
| 937 | Ga0501077_0171382 | 3300049593 | Bacteria | 1379 |
| 938 | Ga0501077_0301461 | 3300049593 | Unclassified | 1021 |
| 939 | Ga0501216_010906 | 3300049660 | Unclassified | 1468 |
| 940 | Ga0501217_003126 | 3300049661 | Unclassified | 3320 |
| 941 | Ga0501227_000547 | 3300049665 | Bacteria | 8164 |
| 942 | Ga0501233_004758 | 3300049668 | Bacteria | 2504 |
| 943 | Ga0501079_0026481 | 3300049741 | Bacteria | 4446 |
| 944 | Ga0501080_0006815 | 3300049742 | Bacteria | 10301 |
| 945 | Ga0501080_0076387 | 3300049742 | Unclassified | 3115 |
| 946 | Ga0501080_0130574 | 3300049742 | Bacteria | 2326 |
| 947 | Ga0501080_0149800 | 3300049742 | Bacteria | 2157 |
| 948 | Ga0501080_0310777 | 3300049742 | Bacteria | 1428 |
| 949 | Ga0501083_0002370 | 3300049744 | Bacteria | 12904 |
| 950 | Ga0501283_010840 | 3300049779 | Bacteria | 1347 |
| 951 | Ga0501035_0131011 | 3300049822 | Bacteria | 2186 |
| 952 | Ga0501035_0266233 | 3300049822 | Unclassified | 1451 |
| 953 | Ga0501035_0326077 | 3300049822 | Bacteria | 1289 |
| 954 | Ga0501035_0515237 | 3300049822 | Bacteria | 983 |
| 955 | Ga0501044_0003302 | 3300049823 | Bacteria | 18174 |
| 956 | Ga0501044_0128358 | 3300049823 | Bacteria | 2531 |
| 957 | Ga0501045_0176708 | 3300049824 | Bacteria | 1590 |
| 958 | Ga0501045_0208588 | 3300049824 | Bacteria | 1455 |
| 959 | Ga0501045_0260170 | 3300049824 | Unclassified | 1291 |
| 960 | Ga0501045_0356977 | 3300049824 | Bacteria | 1088 |
| 961 | nmdc:mga03683_7135_c1 | 3300050489 | Bacteria | 3865 |
| 962 | nmdc:mga00v17_155480_c1 | 3300050491 | Bacteria | 1470 |
| 963 | nmdc:mga00v17_57653_c1 | 3300050491 | Bacteria | 2377 |
| 964 | nmdc:mga0k408_55221_c1 | 3300050493 | Bacteria | 2303 |
| 965 | nmdc:mga06z11_112445_c1 | 3300050494 | Bacteria | 1510 |
| 966 | nmdc:mga05p37_148380_c1 | 3300050507 | Bacteria | 2870 |
| 967 | nmdc:mga05p37_214329_c1 | 3300050507 | Bacteria | 2326 |
| 968 | nmdc:mga05p37_3228_c1 | 3300050507 | Bacteria | 18999 |
| 969 | nmdc:mga05p37_562000_c1 | 3300050507 | Bacteria | 1296 |
| 970 | nmdc:mga05p37_664104_c1 | 3300050507 | Unclassified | 1165 |
| 971 | nmdc:mga05p37_696529_c1 | 3300050507 | Unclassified | 1129 |
| 972 | nmdc:mga05p37_82436_c1 | 3300050507 | Bacteria | 3963 |
| 973 | nmdc:mga05p37_91004_c1 | 3300050507 | Bacteria | 3760 |
| 974 | nmdc:mga09592_11107_c1 | 3300050508 | Bacteria | 7325 |
| 975 | nmdc:mga09592_13933_c1 | 3300050508 | Bacteria | 6566 |
| 976 | nmdc:mga09592_161_c1 | 3300050508 | Bacteria | 46835 |
| 977 | nmdc:mga09592_186268_c1 | 3300050508 | Bacteria | 1796 |
| 978 | nmdc:mga09592_228446_c1 | 3300050508 | Bacteria | 1612 |
| 979 | nmdc:mga09592_253805_c1 | 3300050508 | Unclassified | 1524 |
| 980 | nmdc:mga09592_26507_c1 | 3300050508 | Bacteria | 4802 |
| 981 | nmdc:mga09592_334283_c1 | 3300050508 | Unclassified | 1312 |
| 982 | nmdc:mga09592_5841_c1 | 3300050508 | Bacteria | 10035 |
| 983 | nmdc:mga09592_83899_c1 | 3300050508 | Bacteria | 2716 |
| 984 | nmdc:mga09592_97535_c1 | 3300050508 | Unclassified | 1444 |
| 985 | nmdc:mga0qj67_124819_c1 | 3300050509 | Unclassified | 2083 |
| 986 | nmdc:mga0qj67_231484_c1 | 3300050509 | Bacteria | 1499 |
| 987 | nmdc:mga0qj67_2542_c1 | 3300050509 | Bacteria | 13038 |
| 988 | nmdc:mga0qj67_2968_c1 | 3300050509 | Bacteria | 12166 |
| 989 | nmdc:mga0qj67_306236_c1 | 3300050509 | Bacteria | 1287 |
| 990 | nmdc:mga0qj67_6076_c1 | 3300050509 | Bacteria | 6557 |
| 991 | nmdc:mga0qj67_90573_c1 | 3300050509 | Bacteria | 2457 |
| 992 | nmdc:mga06r32_19503_c1 | 3300050510 | Bacteria | 6226 |
| 993 | nmdc:mga06r32_246957_c1 | 3300050510 | Bacteria | 1772 |
| 994 | nmdc:mga06r32_318_c1 | 3300050510 | Bacteria | 40308 |
| 995 | nmdc:mga06r32_4178_c1 | 3300050510 | Bacteria | 12934 |
| 996 | nmdc:mga06r32_80244_c1 | 3300050510 | Bacteria | 3175 |
| 997 | nmdc:mga08y16_11638_c1 | 3300050511 | Bacteria | 9244 |
| 998 | nmdc:mga08y16_116871_c1 | 3300050511 | Bacteria | 2777 |
| 999 | nmdc:mga08y16_205854_c1 | 3300050511 | Bacteria | 2039 |
| 1000 | nmdc:mga08y16_332116_c1 | 3300050511 | Bacteria | 1564 |
| 1001 | nmdc:mga08y16_38042_c1 | 3300050511 | Bacteria | 5052 |
| 1002 | nmdc:mga08y16_39559_c1 | 3300050511 | Bacteria | 4948 |
| 1003 | nmdc:mga08y16_399083_c1 | 3300050511 | Bacteria | 1408 |
| 1004 | nmdc:mga08y16_46794_c1 | 3300050511 | Bacteria | 4529 |
| 1005 | nmdc:mga08y16_496326_c1 | 3300050511 | Bacteria | 1241 |
| 1006 | nmdc:mga08y16_9259_c1 | 3300050511 | Bacteria | 10334 |
| 1007 | nmdc:mga0n895_110351_c1 | 3300050512 | Bacteria | 2767 |
| 1008 | nmdc:mga0n895_47542_c1 | 3300050512 | Unclassified | 4195 |
| 1009 | nmdc:mga0n895_504928_c1 | 3300050512 | Bacteria | 1218 |
| 1010 | nmdc:mga0rr50_255643_c1 | 3300050513 | Bacteria | 1456 |
| 1011 | nmdc:mga0rr50_9080_c1 | 3300050513 | Bacteria | 6224 |
| 1012 | nmdc:mga0rr50_93451_c1 | 3300050513 | Bacteria | 2346 |
| 1013 | nmdc:mga08x19_5547_c1 | 3300050514 | Bacteria | 7461 |
| 1014 | nmdc:mga0a205_2632_c1 | 3300050515 | Bacteria | 15853 |
| 1015 | nmdc:mga0a205_45613_c1 | 3300050515 | Bacteria | 4227 |
| 1016 | Ga0495619_0002715 | 3300053085 | Bacteria | 11563 |
| 1017 | Ga0495619_0141539 | 3300053085 | Bacteria | 1657 |
| 1018 | Ga0495619_0265807 | 3300053085 | Bacteria | 1189 |
| 1019 | Ga0500646_0009361 | 3300053090 | Bacteria | 2509 |
| 1020 | Ga0500555_040638 | 3300053103 | Bacteria | 1296 |
| 1021 | Ga0501084_0060429 | 3300054114 | Bacteria | 3173 |
| 1022 | Ga0501084_0071013 | 3300054114 | Bacteria | 2915 |
| 1023 | Ga0501084_0362110 | 3300054114 | Bacteria | 1225 |
| 1024 | Ga0501084_0383544 | 3300054114 | Unclassified | 1187 |
| 1025 | Ga0590071_006490 | 3300059421 | Bacteria | 2783 |
| 1026 | Ga0590074_004080 | 3300059423 | Bacteria | 2414 |
| 1027 | Ga0590075_000057 | 3300059424 | Bacteria | 28475 |
| 1028 | Ga0590077_000869 | 3300059426 | Bacteria | 7748 |
| 1029 | Ga0590077_042124 | 3300059426 | Bacteria | 1016 |
| 1030 | Ga0501082_0000052 | 3300060353 | Bacteria | 83141 |
| 1031 | Ga0501082_0042165 | 3300060353 | Bacteria | 3934 |
| 1032 | Ga0501082_0128458 | 3300060353 | Bacteria | 2199 |
| 1033 | Ga0501082_0300246 | 3300060353 | Bacteria | 1398 |
| 1034 | Ga0207662_10046832 | |||
| 1035 | MRS1b_contig_6353489 | |||
| 1036 | rootH2_10026227 | |||
| 1037 | rootL2_10164218 | |||
| 1038 | rootL2_10363563 | |||
| 1039 | rootH1_10235514 | |||
| 1040 | rootH1_10285765 | |||
| 1041 | Ga0065712_10082993 | |||
| 1042 | Ga0065707_10105478 | |||
| 1043 | Ga0065707_10129487 | |||
| 1044 | Ga0065707_10186024 | |||
| 1045 | Ga0070658_10014537 | |||
| 1046 | Ga0070658_10274244 | |||
| 1047 | Ga0070676_10041158 | |||
| 1048 | Ga0070676_10060806 | |||
| 1049 | Ga0070676_10077444 | |||
| 1050 | Ga0070676_10235163 | |||
| 1051 | Ga0070683_100002980 | |||
| 1052 | Ga0070683_100051921 | |||
| 1053 | Ga0070683_100130358 | |||
| 1054 | Ga0070683_100168200 | |||
| 1055 | Ga0070690_100008915 | |||
| 1056 | Ga0070690_100051159 | |||
| 1057 | Ga0070690_100107497 | |||
| 1058 | Ga0070670_100000551 | |||
| 1059 | Ga0070670_100024055 | |||
| 1060 | Ga0070670_100054747 | |||
| 1061 | Ga0070670_100061754 | |||
| 1062 | Ga0070670_100076255 | |||
| 1063 | Ga0070677_10001876 | |||
| 1064 | Ga0070677_10023051 | |||
| 1065 | Ga0070677_10059898 | |||
| 1066 | Ga0068869_100001326 | |||
| 1067 | Ga0068869_100004523 | |||
| 1068 | Ga0068869_100012842 | |||
| 1069 | Ga0068869_100050168 | |||
| 1070 | Ga0070666_10018322 | |||
| 1071 | Ga0070666_10112735 | |||
| 1072 | Ga0070680_100019142 | |||
| 1073 | Ga0070680_100027953 | |||
| 1074 | Ga0070680_100079759 | |||
| 1075 | Ga0070680_100080984 | |||
| 1076 | Ga0070680_100082008 | |||
| 1077 | Ga0070680_100205792 | |||
| 1078 | Ga0070680_100252826 | |||
| 1079 | Ga0070682_100079979 | |||
| 1080 | Ga0070682_100258345 | |||
| 1081 | Ga0068868_100016527 | |||
| 1082 | Ga0068868_100020637 | |||
| 1083 | Ga0068868_100072417 | |||
| 1084 | Ga0068868_100120907 | |||
| 1085 | Ga0068868_100389802 | |||
| 1086 | Ga0070689_100000007 | |||
| 1087 | Ga0070689_100005960 | |||
| 1088 | Ga0070689_100007606 | |||
| 1089 | Ga0070689_100014298 | |||
| 1090 | Ga0070689_100022551 | |||
| 1091 | Ga0070689_100076094 | |||
| 1092 | Ga0070689_100113731 | |||
| 1093 | Ga0070689_100171269 | |||
| 1094 | Ga0070689_100199188 | |||
| 1095 | Ga0070691_10013119 | |||
| 1096 | Ga0070687_100007099 | |||
| 1097 | Ga0070687_100213725 | |||
| 1098 | Ga0070661_100038853 | |||
| 1099 | Ga0070661_100087148 | |||
| 1100 | Ga0070661_100196825 | |||
| 1101 | Ga0070692_10012085 | |||
| 1102 | Ga0070668_100018067 | |||
| 1103 | Ga0070668_100040743 | |||
| 1104 | Ga0070668_100162468 | |||
| 1105 | Ga0070669_100001207 | |||
| 1106 | Ga0070669_100001973 | |||
| 1107 | Ga0070669_100002718 | |||
| 1108 | Ga0070669_100006126 | |||
| 1109 | Ga0070669_100012721 | |||
| 1110 | Ga0070669_100095422 | |||
| 1111 | Ga0070675_100000890 | |||
| 1112 | Ga0070675_100003302 | |||
| 1113 | Ga0070675_100003354 | |||
| 1114 | Ga0070675_100006236 | |||
| 1115 | Ga0070675_100025127 | |||
| 1116 | Ga0070675_100057387 | |||
| 1117 | Ga0070675_100073761 | |||
| 1118 | Ga0070675_100218793 | |||
| 1119 | Ga0070671_100019858 | |||
| 1120 | Ga0070671_100024511 | |||
| 1121 | Ga0070674_100002134 | |||
| 1122 | Ga0070674_100002918 | |||
| 1123 | Ga0070674_100151587 | |||
| 1124 | Ga0070673_100000370 | |||
| 1125 | Ga0070673_100003840 | |||
| 1126 | Ga0070673_100006729 | |||
| 1127 | Ga0070673_100011969 | |||
| 1128 | Ga0070673_100027846 | |||
| 1129 | Ga0070673_100061519 | |||
| 1130 | Ga0070673_100115147 | |||
| 1131 | Ga0070673_100154029 | |||
| 1132 | Ga0070673_100174746 | |||
| 1133 | Ga0070673_100294229 | |||
| 1134 | Ga0070673_100298163 | |||
| 1135 | Ga0070688_100012782 | |||
| 1136 | Ga0070688_100052402 | |||
| 1137 | Ga0070688_100184966 | |||
| 1138 | Ga0070688_100218236 | |||
| 1139 | Ga0070659_100176226 | |||
| 1140 | Ga0070659_100266151 | |||
| 1141 | Ga0070659_100326464 | |||
| 1142 | Ga0070659_100380579 | |||
| 1143 | Ga0070667_100017750 | |||
| 1144 | Ga0070667_100060350 | |||
| 1145 | Ga0070667_100368476 | |||
| 1146 | Ga0070667_100468044 | |||
| 1147 | Ga0070709_10050050 | |||
| 1148 | Ga0070714_100181719 | |||
| 1149 | Ga0070713_100026419 | |||
| 1150 | Ga0070713_100115800 | |||
| 1151 | Ga0070710_10188405 | |||
| 1152 | Ga0070701_10009533 | |||
| 1153 | Ga0070701_10055123 | |||
| 1154 | Ga0070701_10109861 | |||
| 1155 | Ga0070700_100000744 | |||
| 1156 | Ga0070700_100005721 | |||
| 1157 | Ga0070700_100005745 | |||
| 1158 | Ga0070700_100009761 | |||
| 1159 | Ga0070700_100009763 | |||
| 1160 | Ga0070694_100015477 | |||
| 1161 | Ga0070694_100113231 | |||
| 1162 | Ga0070663_100016596 | |||
| 1163 | Ga0070663_100053978 | |||
| 1164 | Ga0070678_100000511 | |||
| 1165 | Ga0070678_100032605 | |||
| 1166 | Ga0070678_100037944 | |||
| 1167 | Ga0070678_100134359 | |||
| 1168 | Ga0070678_100155158 | |||
| 1169 | Ga0070678_100242212 | |||
| 1170 | Ga0070662_100072074 | |||
| 1171 | Ga0070681_10000309 | |||
| 1172 | Ga0070681_10003682 | |||
| 1173 | Ga0070681_10010073 | |||
| 1174 | Ga0070681_10066157 | |||
| 1175 | Ga0070681_10073770 | |||
| 1176 | Ga0070681_10115496 | |||
| 1177 | Ga0070681_10194209 | |||
| 1178 | Ga0070681_10312616 | |||
| 1179 | Ga0068867_100005810 | |||
| 1180 | Ga0068867_100005825 | |||
| 1181 | Ga0068867_100012100 | |||
| 1182 | Ga0068867_100018293 | |||
| 1183 | Ga0068867_100148801 | |||
| 1184 | Ga0068867_100213036 | |||
| 1185 | Ga0070685_10019361 | |||
| 1186 | Ga0070685_10065230 | |||
| 1187 | Ga0070706_100062732 | |||
| 1188 | Ga0070706_100074264 | |||
| 1189 | Ga0070707_100064275 | |||
| 1190 | Ga0070707_100224930 | |||
| 1191 | Ga0070698_100020520 | |||
| 1192 | Ga0070698_100064477 | |||
| 1193 | Ga0070698_100142586 | |||
| 1194 | Ga0070699_100099253 | |||
| 1195 | Ga0070699_100106293 | |||
| 1196 | Ga0070699_100406714 | |||
| 1197 | Ga0070679_100001350 | |||
| 1198 | Ga0070679_100002948 | |||
| 1199 | Ga0070679_100005418 | |||
| 1200 | Ga0070679_100010515 | |||
| 1201 | Ga0070679_100016724 | |||
| 1202 | Ga0070679_100073734 | |||
| 1203 | Ga0070679_100135470 | |||
| 1204 | Ga0070679_100197549 | |||
| 1205 | Ga0070679_100252896 | |||
| 1206 | Ga0070679_100338790 | |||
| 1207 | Ga0070684_100002830 | |||
| 1208 | Ga0070684_100003300 | |||
| 1209 | Ga0070684_100052352 | |||
| 1210 | Ga0070684_100232303 | |||
| 1211 | Ga0070697_100065425 | |||
| 1212 | Ga0070697_100331173 | |||
| 1213 | Ga0068853_100000300 | |||
| 1214 | Ga0068853_100073678 | |||
| 1215 | Ga0068853_100160935 | |||
| 1216 | Ga0070672_100015454 | |||
| 1217 | Ga0070672_100023216 | |||
| 1218 | Ga0070672_100043645 | |||
| 1219 | Ga0070672_100065199 | |||
| 1220 | Ga0070672_100069262 | |||
| 1221 | Ga0070672_100111694 | |||
| 1222 | Ga0070672_100154339 | |||
| 1223 | Ga0070672_100198978 | |||
| 1224 | Ga0070686_100000642 | |||
| 1225 | Ga0070686_100005637 | |||
| 1226 | Ga0070686_100011225 | |||
| 1227 | Ga0070686_100019575 | |||
| 1228 | Ga0070686_100043680 | |||
| 1229 | Ga0070686_100162892 | |||
| 1230 | Ga0070695_100079239 | |||
| 1231 | Ga0070696_100398818 | |||
| 1232 | Ga0070665_100080454 | |||
| 1233 | Ga0070665_100380697 | |||
| 1234 | Ga0070704_100017654 | |||
| 1235 | Ga0070704_100124127 | |||
| 1236 | Ga0070704_100208322 | |||
| 1237 | Ga0070704_100281037 | |||
| 1238 | Ga0068855_100000281 | |||
| 1239 | Ga0068855_100002270 | |||
| 1240 | Ga0068855_100003646 | |||
| 1241 | Ga0068855_100033765 | |||
| 1242 | Ga0068855_100041518 | |||
| 1243 | Ga0068855_100053654 | |||
| 1244 | Ga0068855_100055539 | |||
| 1245 | Ga0068855_100151606 | |||
| 1246 | Ga0068855_100312790 | |||
| 1247 | Ga0070664_100000556 | |||
| 1248 | Ga0070664_100005141 | |||
| 1249 | Ga0070664_100008742 | |||
| 1250 | Ga0070664_100018808 | |||
| 1251 | Ga0068857_100003854 | |||
| 1252 | Ga0068857_100114611 | |||
| 1253 | Ga0068854_100013717 | |||
| 1254 | Ga0068854_100084887 | |||
| 1255 | Ga0068856_100000402 | |||
| 1256 | Ga0068856_100001321 | |||
| 1257 | Ga0068856_100036179 | |||
| 1258 | Ga0068856_100126327 | |||
| 1259 | Ga0068856_100215362 | |||
| 1260 | Ga0068852_100035367 | |||
| 1261 | Ga0068852_100171123 | |||
| 1262 | Ga0068852_100471042 | |||
| 1263 | Ga0068859_100000856 | |||
| 1264 | Ga0068859_100012549 | |||
| 1265 | Ga0068859_100018726 | |||
| 1266 | Ga0068859_100019300 | |||
| 1267 | Ga0068859_100132432 | |||
| 1268 | Ga0068859_100235306 | |||
| 1269 | Ga0068859_100619043 | |||
| 1270 | Ga0068864_100001103 | |||
| 1271 | Ga0068864_100134216 | |||
| 1272 | Ga0068864_100240219 | |||
| 1273 | Ga0068866_10005957 | |||
| 1274 | Ga0068866_10016670 | |||
| 1275 | Ga0068861_100023075 | |||
| 1276 | Ga0068861_100044916 | |||
| 1277 | Ga0068861_100117173 | |||
| 1278 | Ga0068861_100175478 | |||
| 1279 | Ga0068851_10069760 | |||
| 1280 | Ga0068870_10053582 | |||
| 1281 | Ga0068863_100012313 | |||
| 1282 | Ga0068863_100083549 | |||
| 1283 | Ga0068863_100164915 | |||
| 1284 | Ga0068863_100395790 | |||
| 1285 | Ga0068863_100516564 | |||
| 1286 | Ga0068858_100003292 | |||
| 1287 | Ga0068858_100019810 | |||
| 1288 | Ga0068858_100044424 | |||
| 1289 | Ga0068858_100105653 | |||
| 1290 | Ga0068858_100204594 | |||
| 1291 | Ga0068858_100418925 | |||
| 1292 | Ga0068860_100010802 | |||
| 1293 | Ga0068860_100058809 | |||
| 1294 | Ga0068860_100121725 | |||
| 1295 | Ga0068860_100297248 | |||
| 1296 | Ga0068862_100002166 | |||
| 1297 | Ga0068862_100016110 | |||
| 1298 | Ga0068862_100063425 | |||
| 1299 | Ga0068862_100121132 | |||
| 1300 | Ga0068862_100130796 | |||
| 1301 | Ga0081455_10011250 | |||
| 1302 | Ga0081455_10123295 | |||
| 1303 | Ga0081538_10103929 | |||
| 1304 | Ga0081540_1022235 | |||
| 1305 | Ga0075365_10048028 | |||
| 1306 | Ga0075363_100093458 | |||
| 1307 | Ga0075364_10068722 | |||
| 1308 | Ga0075364_10153554 | |||
| 1309 | Ga0075362_10002309 | |||
| 1310 | Ga0075367_10003335 | |||
| 1311 | Ga0075367_10033685 | |||
| 1312 | Ga0075427_10019963 | |||
| 1313 | Ga0075366_10004550 | |||
| 1314 | Ga0075366_10041277 | |||
| 1315 | Ga0075366_10081794 | |||
| 1316 | Ga0097621_100000113 | |||
| 1317 | Ga0097621_100123720 | |||
| 1318 | Ga0097621_100294847 | |||
| 1319 | Ga0068871_100000132 | |||
| 1320 | Ga0068871_100090132 | |||
| 1321 | Ga0075428_100000319 | |||
| 1322 | Ga0075428_100000346 | |||
| 1323 | Ga0075428_100028997 | |||
| 1324 | Ga0075428_100029578 | |||
| 1325 | Ga0075428_100032898 | |||
| 1326 | Ga0075428_100124274 | |||
| 1327 | Ga0075428_100151928 | |||
| 1328 | Ga0075428_100218732 | |||
| 1329 | Ga0075430_100001453 | |||
| 1330 | Ga0075430_100003185 | |||
| 1331 | Ga0075430_100107415 | |||
| 1332 | Ga0075430_100123743 | |||
| 1333 | Ga0075430_100133457 | |||
| 1334 | Ga0075430_100184345 | |||
| 1335 | Ga0075430_100205098 | |||
| 1336 | Ga0075430_100296658 | |||
| 1337 | Ga0075430_100312001 | |||
| 1338 | Ga0075431_100000161 | |||
| 1339 | Ga0075431_100001791 | |||
| 1340 | Ga0075431_100008623 | |||
| 1341 | Ga0075431_100065763 | |||
| 1342 | Ga0075431_100091196 | |||
| 1343 | Ga0075431_100319711 | |||
| 1344 | Ga0075433_10001814 | |||
| 1345 | Ga0075433_10036715 | |||
| 1346 | Ga0075434_100008279 | |||
| 1347 | Ga0075434_100090797 | |||
| 1348 | Ga0075434_100134714 | |||
| 1349 | Ga0075429_100001822 | |||
| 1350 | Ga0075429_100002325 | |||
| 1351 | Ga0075429_100016697 | |||
| 1352 | Ga0075429_100029457 | |||
| 1353 | Ga0075429_100059547 | |||
| 1354 | Ga0075429_100215850 | |||
| 1355 | Ga0068865_100000579 | |||
| 1356 | Ga0068865_100005964 | |||
| 1357 | Ga0068865_100017297 | |||
| 1358 | Ga0068865_100022492 | |||
| 1359 | Ga0075436_100015446 | |||
| 1360 | Ga0097620_100000856 | |||
| 1361 | Ga0097620_100012549 | |||
| 1362 | Ga0097620_100018726 | |||
| 1363 | Ga0097620_100019300 | |||
| 1364 | Ga0097620_100132431 | |||
| 1365 | Ga0097620_100235302 | |||
| 1366 | Ga0097620_100619033 | |||
| 1367 | Ga0099794_10014319 | |||
| 1368 | Ga0105240_10000541 | |||
| 1369 | Ga0105240_10001087 | |||
| 1370 | Ga0105240_10004530 | |||
| 1371 | Ga0105240_10012416 | |||
| 1372 | Ga0105240_10038183 | |||
| 1373 | Ga0105240_10053890 | |||
| 1374 | Ga0105240_10297839 | |||
| 1375 | Ga0111539_10000393 | |||
| 1376 | Ga0111539_10001372 | |||
| 1377 | Ga0111539_10010838 | |||
| 1378 | Ga0111539_10019777 | |||
| 1379 | Ga0111539_10026117 | |||
| 1380 | Ga0111539_10097778 | |||
| 1381 | Ga0111539_10112150 | |||
| 1382 | Ga0111539_10443008 | |||
| 1383 | Ga0111539_10927415 | |||
| 1384 | Ga0105245_10400703 | |||
| 1385 | Ga0105247_10080947 | |||
| 1386 | Ga0114129_10004036 | |||
| 1387 | Ga0114129_10010683 | |||
| 1388 | Ga0114129_10033825 | |||
| 1389 | Ga0114129_10174071 | |||
| 1390 | Ga0114129_10219599 | |||
| 1391 | Ga0114129_10241299 | |||
| 1392 | Ga0114129_10253434 | |||
| 1393 | Ga0114129_10449309 | |||
| 1394 | Ga0114129_10508249 | |||
| 1395 | Ga0114129_10791088 | |||
| 1396 | Ga0114129_10966353 | |||
| 1397 | Ga0105243_10023274 | |||
| 1398 | Ga0105243_10339168 | |||
| 1399 | Ga0105241_10009684 | |||
| 1400 | Ga0105242_10048514 | |||
| 1401 | Ga0105248_10014040 | |||
| 1402 | Ga0105248_10019197 | |||
| 1403 | Ga0105248_10127513 | |||
| 1404 | Ga0105248_10144702 | |||
| 1405 | Ga0105248_10572315 | |||
| 1406 | Ga0105237_10000069 | |||
| 1407 | Ga0105237_10029942 | |||
| 1408 | Ga0105237_10049101 | |||
| 1409 | Ga0105237_10088986 | |||
| 1410 | Ga0105237_10204570 | |||
| 1411 | Ga0105238_10000471 | |||
| 1412 | Ga0105238_10002524 | |||
| 1413 | Ga0105238_10021516 | |||
| 1414 | Ga0105238_10048789 | |||
| 1415 | Ga0105238_10075974 | |||
| 1416 | Ga0105238_10417713 | |||
| 1417 | Ga0105238_10727659 | |||
| 1418 | Ga0105249_10000242 | |||
| 1419 | Ga0105249_10000698 | |||
| 1420 | Ga0099796_10104281 | |||
| 1421 | Ga0105239_10026435 | |||
| 1422 | Ga0105239_10040792 | |||
| 1423 | Ga0105239_10043362 | |||
| 1424 | Ga0105239_10057747 | |||
| 1425 | Ga0105239_10103695 | |||
| 1426 | Ga0105239_10104531 | |||
| 1427 | Ga0105239_10571554 | |||
| 1428 | Ga0105239_10694452 | |||
| 1429 | Ga0105246_10050712 | |||
| 1430 | Ga0157373_10035476 | |||
| 1431 | Ga0157371_10034224 | |||
| 1432 | Ga0157370_10305102 | |||
| 1433 | Ga0157370_10306750 | |||
| 1434 | Ga0157369_10032693 | |||
| 1435 | Ga0157369_10056937 | |||
| 1436 | Ga0157369_10350427 | |||
| 1437 | Ga0157374_10000400 | |||
| 1438 | Ga0157374_10003194 | |||
| 1439 | Ga0157374_10007030 | |||
| 1440 | Ga0157374_10030098 | |||
| 1441 | Ga0157374_10040945 | |||
| 1442 | Ga0157374_10131803 | |||
| 1443 | Ga0157378_10000195 | |||
| 1444 | Ga0157378_10002056 | |||
| 1445 | Ga0157378_10228170 | |||
| 1446 | Ga0163162_10127051 | |||
| 1447 | Ga0163162_10131779 | |||
| 1448 | Ga0157372_10010834 | |||
| 1449 | Ga0157372_10012124 | |||
| 1450 | Ga0157372_10225468 | |||
| 1451 | Ga0157372_10330656 | |||
| 1452 | Ga0157372_10407741 | |||
| 1453 | Ga0157372_10642025 | |||
| 1454 | Ga0157375_10008227 | |||
| 1455 | Ga0157375_10092448 | |||
| 1456 | Ga0157375_10145358 | |||
| 1457 | Ga0163163_10006750 | |||
| 1458 | Ga0163163_10016449 | |||
| 1459 | Ga0163163_10077529 | |||
| 1460 | Ga0163163_10085273 | |||
| 1461 | Ga0163163_10110157 | |||
| 1462 | Ga0163163_10112503 | |||
| 1463 | Ga0163163_10410149 | |||
| 1464 | Ga0163163_10469432 | |||
| 1465 | Ga0157380_10006495 | |||
| 1466 | Ga0157380_10006953 | |||
| 1467 | Ga0157380_10009368 | |||
| 1468 | Ga0157380_10013500 | |||
| 1469 | Ga0157380_10089855 | |||
| 1470 | Ga0157380_10136088 | |||
| 1471 | Ga0157380_10189502 | |||
| 1472 | Ga0157380_10204864 | |||
| 1473 | Ga0157380_10596084 | |||
| 1474 | Ga0157377_10003190 | |||
| 1475 | Ga0157379_10004863 | |||
| 1476 | Ga0157376_10040921 | |||
| 1477 | Ga0157376_10044377 | |||
| 1478 | Ga0157376_10099262 | |||
| 1479 | Ga0157376_10469038 | |||
| 1480 | Ga0157376_10601042 | |||
| 1481 | Ga0163161_10099645 | |||
| 1482 | Ga0163161_10470081 | |||
| 1483 | Ga0213876_10027399 | |||
| 1484 | Ga0207697_10000122 | |||
| 1485 | Ga0207697_10015818 | |||
| 1486 | Ga0207697_10130646 | |||
| 1487 | Ga0207656_10008865 | |||
| 1488 | Ga0207682_10004257 | |||
| 1489 | Ga0207682_10026430 | |||
| 1490 | Ga0207682_10038096 | |||
| 1491 | Ga0207682_10044278 | |||
| 1492 | Ga0207642_10003249 | |||
| 1493 | Ga0207688_10009098 | |||
| 1494 | Ga0207680_10250275 | |||
| 1495 | Ga0207680_10270344 | |||
| 1496 | Ga0207647_10027025 | |||
| 1497 | Ga0207647_10091925 | |||
| 1498 | Ga0207699_10112740 | |||
| 1499 | Ga0207645_10000742 | |||
| 1500 | Ga0207645_10019155 | |||
| 1501 | Ga0207645_10020677 | |||
| 1502 | Ga0207645_10059086 | |||
| 1503 | Ga0207643_10000360 | |||
| 1504 | Ga0207643_10026346 | |||
| 1505 | Ga0207643_10054218 | |||
| 1506 | Ga0207643_10304359 | |||
| 1507 | Ga0207705_10015210 | |||
| 1508 | Ga0207705_10242682 | |||
| 1509 | Ga0207684_10032220 | |||
| 1510 | Ga0207684_10200728 | |||
| 1511 | Ga0207654_10010433 | |||
| 1512 | Ga0207654_10034377 | |||
| 1513 | Ga0207654_10075599 | |||
| 1514 | Ga0207707_10001909 | |||
| 1515 | Ga0207707_10060491 | |||
| 1516 | Ga0207707_10125120 | |||
| 1517 | Ga0207707_10163046 | |||
| 1518 | Ga0207707_10217808 | |||
| 1519 | Ga0207707_10227886 | |||
| 1520 | Ga0207707_10255572 | |||
| 1521 | Ga0207695_10002331 | |||
| 1522 | Ga0207695_10015878 | |||
| 1523 | Ga0207695_10016970 | |||
| 1524 | Ga0207695_10047546 | |||
| 1525 | Ga0207695_10316949 | |||
| 1526 | Ga0207671_10000154 | |||
| 1527 | Ga0207671_10049826 | |||
| 1528 | Ga0207693_10187315 | |||
| 1529 | Ga0207660_10009787 | |||
| 1530 | Ga0207660_10052296 | |||
| 1531 | Ga0207660_10124434 | |||
| 1532 | Ga0207660_10176298 | |||
| 1533 | Ga0207662_10000686 | |||
| 1534 | Ga0207662_10005520 | |||
| 1535 | Ga0207662_10052061 | |||
| 1536 | Ga0207657_10256512 | |||
| 1537 | Ga0207649_10120662 | |||
| 1538 | Ga0207649_10215476 | |||
| 1539 | Ga0207652_10001179 | |||
| 1540 | Ga0207652_10001341 | |||
| 1541 | Ga0207652_10003584 | |||
| 1542 | Ga0207652_10008069 | |||
| 1543 | Ga0207652_10044927 | |||
| 1544 | Ga0207652_10060835 | |||
| 1545 | Ga0207652_10086274 | |||
| 1546 | Ga0207646_10479628 | |||
| 1547 | Ga0207681_10000389 | |||
| 1548 | Ga0207681_10001574 | |||
| 1549 | Ga0207681_10015805 | |||
| 1550 | Ga0207681_10052833 | |||
| 1551 | Ga0207681_10270420 | |||
| 1552 | Ga0207694_10000408 | |||
| 1553 | Ga0207694_10011032 | |||
| 1554 | Ga0207694_10029089 | |||
| 1555 | Ga0207694_10038632 | |||
| 1556 | Ga0207694_10170935 | |||
| 1557 | Ga0207694_10430446 | |||
| 1558 | Ga0207650_10001365 | |||
| 1559 | Ga0207650_10082106 | |||
| 1560 | Ga0207659_10003313 | |||
| 1561 | Ga0207659_10006924 | |||
| 1562 | Ga0207659_10008998 | |||
| 1563 | Ga0207659_10010433 | |||
| 1564 | Ga0207659_10017242 | |||
| 1565 | Ga0207659_10167996 | |||
| 1566 | Ga0207659_10257532 | |||
| 1567 | Ga0207687_10346836 | |||
| 1568 | Ga0207700_10050262 | |||
| 1569 | Ga0207664_10183110 | |||
| 1570 | Ga0207644_10180867 | |||
| 1571 | Ga0207706_10003747 | |||
| 1572 | Ga0207706_10013434 | |||
| 1573 | Ga0207706_10094781 | |||
| 1574 | Ga0207706_10261461 | |||
| 1575 | Ga0207706_10343890 | |||
| 1576 | Ga0207686_10186777 | |||
| 1577 | Ga0207709_10004218 | |||
| 1578 | Ga0207709_10048171 | |||
| 1579 | Ga0207670_10000016 | |||
| 1580 | Ga0207670_10004761 | |||
| 1581 | Ga0207670_10005591 | |||
| 1582 | Ga0207670_10015057 | |||
| 1583 | Ga0207670_10022875 | |||
| 1584 | Ga0207670_10110034 | |||
| 1585 | Ga0207670_10112068 | |||
| 1586 | Ga0207670_10138951 | |||
| 1587 | Ga0207669_10001664 | |||
| 1588 | Ga0207669_10003981 | |||
| 1589 | Ga0207669_10039226 | |||
| 1590 | Ga0207669_10067262 | |||
| 1591 | Ga0207669_10225666 | |||
| 1592 | Ga0207704_10003435 | |||
| 1593 | Ga0207704_10018840 | |||
| 1594 | Ga0207704_10018944 | |||
| 1595 | Ga0207704_10175662 | |||
| 1596 | Ga0207691_10002481 | |||
| 1597 | Ga0207691_10007176 | |||
| 1598 | Ga0207691_10018779 | |||
| 1599 | Ga0207691_10035286 | |||
| 1600 | Ga0207691_10040822 | |||
| 1601 | Ga0207691_10049195 | |||
| 1602 | Ga0207691_10071079 | |||
| 1603 | Ga0207691_10072862 | |||
| 1604 | Ga0207691_10082569 | |||
| 1605 | Ga0207691_10093717 | |||
| 1606 | Ga0207691_10110286 | |||
| 1607 | Ga0207691_10178004 | |||
| 1608 | Ga0207691_10322099 | |||
| 1609 | Ga0207691_10471929 | |||
| 1610 | Ga0207711_10034792 | |||
| 1611 | Ga0207711_10056006 | |||
| 1612 | Ga0207711_10093279 | |||
| 1613 | Ga0207689_10010434 | |||
| 1614 | Ga0207689_10010679 | |||
| 1615 | Ga0207689_10116118 | |||
| 1616 | Ga0207689_10283404 | |||
| 1617 | Ga0207661_10000530 | |||
| 1618 | Ga0207661_10003785 | |||
| 1619 | Ga0207661_10053664 | |||
| 1620 | Ga0207679_10000782 | |||
| 1621 | Ga0207679_10008872 | |||
| 1622 | Ga0207679_10097166 | |||
| 1623 | Ga0207667_10000454 | |||
| 1624 | Ga0207667_10000733 | |||
| 1625 | Ga0207667_10012978 | |||
| 1626 | Ga0207667_10097498 | |||
| 1627 | Ga0207667_10269567 | |||
| 1628 | Ga0207667_10412561 | |||
| 1629 | Ga0207651_10006010 | |||
| 1630 | Ga0207651_10007263 | |||
| 1631 | Ga0207651_10007581 | |||
| 1632 | Ga0207651_10007675 | |||
| 1633 | Ga0207651_10019437 | |||
| 1634 | Ga0207651_10061318 | |||
| 1635 | Ga0207651_10179845 | |||
| 1636 | Ga0207651_10216477 | |||
| 1637 | Ga0207651_10217286 | |||
| 1638 | Ga0207712_10019996 | |||
| 1639 | Ga0207712_10179331 | |||
| 1640 | Ga0207668_10004246 | |||
| 1641 | Ga0207668_10028126 | |||
| 1642 | Ga0207640_10007089 | |||
| 1643 | Ga0207640_10030760 | |||
| 1644 | Ga0207640_10055478 | |||
| 1645 | Ga0207658_10137864 | |||
| 1646 | Ga0207658_10142285 | |||
| 1647 | Ga0207677_10010786 | |||
| 1648 | Ga0207677_10119354 | |||
| 1649 | Ga0207677_10520446 | |||
| 1650 | Ga0207703_10022121 | |||
| 1651 | Ga0207703_10087455 | |||
| 1652 | Ga0207703_10219858 | |||
| 1653 | Ga0207639_10000508 | |||
| 1654 | Ga0207639_10009309 | |||
| 1655 | Ga0207678_10028488 | |||
| 1656 | Ga0207678_10307044 | |||
| 1657 | Ga0207708_10009444 | |||
| 1658 | Ga0207708_10010278 | |||
| 1659 | Ga0207708_10016489 | |||
| 1660 | Ga0207708_10087690 | |||
| 1661 | Ga0207708_10107568 | |||
| 1662 | Ga0207708_10130263 | |||
| 1663 | Ga0207702_10000386 | |||
| 1664 | Ga0207702_10040605 | |||
| 1665 | Ga0207702_10054992 | |||
| 1666 | Ga0207702_10255583 | |||
| 1667 | Ga0207702_10449727 | |||
| 1668 | Ga0207641_10077624 | |||
| 1669 | Ga0207641_10151895 | |||
| 1670 | Ga0207641_10267539 | |||
| 1671 | Ga0207641_10377308 | |||
| 1672 | Ga0207648_10004049 | |||
| 1673 | Ga0207648_10006391 | |||
| 1674 | Ga0207648_10010518 | |||
| 1675 | Ga0207648_10019547 | |||
| 1676 | Ga0207648_10055372 | |||
| 1677 | Ga0207648_10056056 | |||
| 1678 | Ga0207648_10136625 | |||
| 1679 | Ga0207676_10012639 | |||
| 1680 | Ga0207676_10522156 | |||
| 1681 | Ga0207674_10000454 | |||
| 1682 | Ga0207674_10007924 | |||
| 1683 | Ga0207674_10142996 | |||
| 1684 | Ga0207675_100032050 | |||
| 1685 | Ga0207675_100075646 | |||
| 1686 | Ga0207675_100101710 | |||
| 1687 | Ga0207675_100154842 | |||
| 1688 | Ga0207683_10002282 | |||
| 1689 | Ga0207683_10006810 | |||
| 1690 | Ga0207683_10009814 | |||
| 1691 | Ga0207683_10029667 | |||
| 1692 | Ga0207683_10056031 | |||
| 1693 | Ga0207683_10059295 | |||
| 1694 | Ga0207683_10154260 | |||
| 1695 | Ga0207683_10423049 | |||
| 1696 | Ga0207698_10065655 | |||
| 1697 | Ga0207698_10203260 | |||
| 1698 | Ga0207698_10449467 | |||
| 1699 | Ga0209999_1009313 | |||
| 1700 | Ga0209983_1021908 | |||
| 1701 | Ga0209971_1001938 | |||
| 1702 | Ga0209966_1005047 | |||
| 1703 | Ga0209998_10005768 | |||
| 1704 | Ga0209974_10002133 | |||
| 1705 | Ga0209974_10003480 | |||
| 1706 | Ga0209974_10020924 | |||
| 1707 | Ga0207428_10001116 | |||
| 1708 | Ga0207428_10004980 | |||
| 1709 | Ga0207428_10039147 | |||
| 1710 | Ga0207428_10052035 | |||
| 1711 | Ga0207428_10067735 | |||
| 1712 | Ga0207428_10328296 | |||
| 1713 | Ga0268266_10024798 | |||
| 1714 | Ga0268265_10485814 | |||
| 1715 | Ga0268264_10008715 | |||
| 1716 | Ga0268264_10158212 | |||
| 1717 | Ga0268264_10555873 | |||
| 1718 | Ga0265334_10023643 | |||
| 1719 | Ga0265318_10000249 | |||
| 1720 | Ga0265318_10026486 | |||
| 1721 | Ga0265336_10002369 | |||
| 1722 | Ga0307517_10126569 | |||
| 1723 | Ga0265330_10001293 | |||
| 1724 | Ga0265332_10012305 | |||
| 1725 | Ga0265320_10008001 | |||
| 1726 | Ga0265320_10016933 | |||
| 1727 | Ga0265339_10007358 | |||
| 1728 | Ga0265331_10002792 | |||
| 1729 | Ga0265316_10002890 | |||
| 1730 | Ga0307513_10131556 | |||
| 1731 | Ga0307509_10073364 | |||
| 1732 | Ga0265313_10007350 | |||
| 1733 | Ga0265313_10010236 | |||
| 1734 | Ga0265313_10016635 | |||
| 1735 | Ga0265313_10068097 | |||
| 1736 | Ga0307508_10006620 | |||
| 1737 | Ga0265314_10011910 | |||
| 1738 | Ga0265314_10152300 | |||
| 1739 | Ga0265314_10190679 | |||
| 1740 | Ga0265342_10000058 | |||
| 1741 | Ga0265342_10000952 | |||
| 1742 | Ga0265342_10034705 | |||
| 1743 | Ga0265342_10113649 | |||
| 1744 | Ga0316576_10197841 | |||
| 1745 | Ga0316578_10231095 | |||
| 1746 | Ga0307413_10006455 | |||
| 1747 | Ga0307410_10012670 | |||
| 1748 | Ga0307410_10057567 | |||
| 1749 | Ga0307410_10135987 | |||
| 1750 | Ga0307410_10322503 | |||
| 1751 | Ga0307409_100161417 | |||
| 1752 | Ga0307409_100189505 | |||
| 1753 | Ga0307416_100180724 | |||
| 1754 | Ga0307416_100310625 | |||
| 1755 | Ga0307416_100410473 | |||
| 1756 | Ga0307414_10058527 | |||
| 1757 | Ga0307414_10215280 | |||
| 1758 | Ga0307414_10255500 | |||
| 1759 | Ga0307411_10001059 | |||
| 1760 | Ga0307411_10007556 | |||
| 1761 | Ga0307411_10321962 | |||
| 1762 | Ga0307411_10356584 | |||
| 1763 | Ga0307415_100277168 | |||
| 1764 | Ga0373923_0080905 | |||
| 1765 | Ga0373932_0039808 | |||
| 1766 | Ga0373941_0012911 | |||
| 1767 | Ga0373945_0068121 | |||
| 1768 | Ga0373954_0035730 | |||
| 1769 | Ga0373956_0165074 | |||
| 1770 | Ga0373957_0034728 | |||
| 1771 | Ga0373943_0004390 | |||
| 1772 | Ga0373955_0192307 | |||
| 1773 | Ga0373942_0060626 | |||
| 1774 | Ga0316574_0109496 | |||
| 1775 | Ga0373933_0000571 | |||
| 1776 | Ga0373933_0075491 | |||
| 1777 | Ga0373933_0150496 | |||
| 1778 | Ga0373947_0071507 | |||
| 1779 | Ga0373937_0015714 | |||
| 1780 | Ga0373937_0059645 | |||
| 1781 | Ga0373937_0150254 | |||
| 1782 | Ga0316582_0234861 | |||
| 1783 | Ga0316584_0367355 | |||
| 1784 | Ga0373925_0211908 | |||
| 1785 | Ga0395899_0003486 | |||
| 1786 | Ga0395899_0131781 | |||
| 1787 | Ga0395900_0039696 | |||
| 1788 | Ga0395898_0119021 | |||
| 1789 | Ga0395905_0008925 | |||
| 1790 | Ga0395905_0126742 | |||
| 1791 | Ga0436364_1364284 | |||
| 1792 | Ga0395901_0100189 | |||
| 1793 | Ga0395901_0125366 | |||
| 1794 | Ga0436365_0315991 | |||
| 1795 | Ga0436361_1194389 | |||
| 1796 | Ga0436362_0113079 | |||
| 1797 | Ga0451802_1119816 | |||
| 1798 | Ga0451807_0323276 | |||
| 1799 | Ga0451807_1842893 | |||
| 1800 | Ga0451851_1349236 | |||
| 1801 | Ga0439441_038890 | |||
| 1802 | Ga0439462_0010088 | |||
| 1803 | Ga0439434_0072154 | |||
| 1804 | Ga0439435_0002028 | |||
| 1805 | Ga0439435_0072291 | |||
| 1806 | Ga0439460_0069379 | |||
| 1807 | Ga0451577_0000014 | |||
| 1808 | Ga0451577_0004796 | |||
| 1809 | Ga0451577_0033189 | |||
| 1810 | Ga0451577_0214941 | |||
| 1811 | Ga0451577_0221732 | |||
| 1812 | Ga0451577_0269203 | |||
| 1813 | Ga0439440_0013426 | |||
| 1814 | Ga0453683_0034950 | |||
| 1815 | Ga0466966_0235692 | |||
| 1816 | Ga0466963_0008133 | |||
| 1817 | Ga0453684_0000571 | |||
| 1818 | Ga0453684_0021379 | |||
| 1819 | Ga0453684_0068727 | |||
| 1820 | Ga0453684_0086022 | |||
| 1821 | Ga0453684_0109542 | |||
| 1822 | Ga0453684_0167107 | |||
| 1823 | Ga0453684_0632872 | |||
| 1824 | Ga0466968_0084984 | |||
| 1825 | Ga0466959_0302063 | |||
| 1826 | Ga0451576_0004634 | |||
| 1827 | Ga0451576_0010676 | |||
| 1828 | Ga0451576_0027607 | |||
| 1829 | Ga0451576_0045309 | |||
| 1830 | Ga0451576_0085432 | |||
| 1831 | Ga0451576_0100679 | |||
| 1832 | Ga0451576_0214068 | |||
| 1833 | Ga0451576_0360891 | |||
| 1834 | Ga0451576_0791200 | |||
| 1835 | Ga0451576_0869759 | |||
| 1836 | Ga0466967_0002498 | |||
| 1837 | Ga0466967_0263358 | |||
| 1838 | Ga0466967_0336842 | |||
| 1839 | Ga0466967_0355419 | |||
| 1840 | Ga0495629_0000013 | |||
| 1841 | Ga0495638_0091498 | |||
| 1842 | Ga0495641_0115740 | |||
| 1843 | Ga0495651_0004108 | |||
| 1844 | Ga0495580_0001294 | |||
| 1845 | Ga0495580_0014860 | |||
| 1846 | Ga0495580_0037990 | |||
| 1847 | Ga0495580_0054275 | |||
| 1848 | Ga0495582_0002525 | |||
| 1849 | Ga0495639_0010666 | |||
| 1850 | Ga0495662_0025870 | |||
| 1851 | Ga0495664_0028187 | |||
| 1852 | Ga0495594_0009877 | |||
| 1853 | Ga0495640_0135137 | |||
| 1854 | Ga0495586_0022185 | |||
| 1855 | Ga0495587_0071760 | |||
| 1856 | Ga0495667_0116708 | |||
| 1857 | Ga0495656_0122938 | |||
| 1858 | Ga0495634_0002195 | |||
| 1859 | Ga0495635_0001297 | |||
| 1860 | Ga0495635_0051124 | |||
| 1861 | Ga0495588_0026363 | |||
| 1862 | Ga0495657_0008498 | |||
| 1863 | Ga0495646_0139043 | |||
| 1864 | Ga0495658_0000018 | |||
| 1865 | Ga0495658_0148559 | |||
| 1866 | Ga0495613_0006193 | |||
| 1867 | Ga0495613_0177286 | |||
| 1868 | Ga0495581_0000031 | |||
| 1869 | Ga0495581_0132604 | |||
| 1870 | Ga0495674_0005609 | |||
| 1871 | Ga0495676_0045929 | |||
| 1872 | Ga0495680_0000427 | |||
| 1873 | Ga0495680_0191373 | |||
| 1874 | Ga0495675_0014622 | |||
| 1875 | Ga0495675_0183902 | |||
| 1876 | Ga0495684_0000439 | |||
| 1877 | Ga0495593_0165024 | |||
| 1878 | Ga0495602_0008476 | |||
| 1879 | Ga0495614_0000561 | |||
| 1880 | Ga0496100_0064629 | |||
| 1881 | Ga0496101_0039221 | |||
| 1882 | Ga0496101_0195110 | |||
| 1883 | Ga0496102_0140971 | |||
| 1884 | Ga0496104_0003039 | |||
| 1885 | Ga0496104_0009068 | |||
| 1886 | Ga0496104_0018588 | |||
| 1887 | Ga0496104_0200747 | |||
| 1888 | Ga0496105_0023290 | |||
| 1889 | Ga0496105_0024825 | |||
| 1890 | Ga0496105_0060082 | |||
| 1891 | Ga0496106_0050352 | |||
| 1892 | Ga0496107_0066938 | |||
| 1893 | Ga0496108_0002286 | |||
| 1894 | Ga0496108_0017200 | |||
| 1895 | Ga0496108_0019818 | |||
| 1896 | Ga0496108_0032535 | |||
| 1897 | Ga0496109_0000608 | |||
| 1898 | Ga0496109_0027391 | |||
| 1899 | Ga0496109_0040390 | |||
| 1900 | Ga0496109_0280053 | |||
| 1901 | Ga0496109_0663527 | |||
| 1902 | Ga0496110_0000743 | |||
| 1903 | Ga0496110_0399992 | |||
| 1904 | Ga0496111_0021689 | |||
| 1905 | Ga0496112_0020015 | |||
| 1906 | Ga0496112_0040937 | |||
| 1907 | Ga0496112_0049896 | |||
| 1908 | Ga0496112_0109031 | |||
| 1909 | Ga0496112_0135132 | |||
| 1910 | Ga0496112_0320448 | |||
| 1911 | Ga0496113_0015973 | |||
| 1912 | Ga0496114_0000068 | |||
| 1913 | Ga0496114_0000737 | |||
| 1914 | Ga0496115_0040214 | |||
| 1915 | Ga0496115_0060311 | |||
| 1916 | Ga0496115_0124154 | |||
| 1917 | Ga0496115_0239247 | |||
| 1918 | Ga0496126_0000209 | |||
| 1919 | Ga0501031_0010228 | |||
| 1920 | Ga0501031_0523855 | |||
| 1921 | Ga0501033_0078628 | |||
| 1922 | Ga0501034_0198011 | |||
| 1923 | Ga0501036_0091226 | |||
| 1924 | Ga0501036_0097038 | |||
| 1925 | Ga0501036_0159125 | |||
| 1926 | Ga0501037_0062907 | |||
| 1927 | Ga0501038_0157840 | |||
| 1928 | Ga0501038_0235675 | |||
| 1929 | Ga0501040_0144301 | |||
| 1930 | Ga0501040_0164808 | |||
| 1931 | Ga0501040_0392366 | |||
| 1932 | Ga0501041_0125941 | |||
| 1933 | Ga0501041_0162914 | |||
| 1934 | Ga0501042_0023266 | |||
| 1935 | Ga0501043_0004220 | |||
| 1936 | Ga0501046_0004262 | |||
| 1937 | Ga0501047_0001022 | |||
| 1938 | Ga0501047_0005274 | |||
| 1939 | Ga0501047_0099511 | |||
| 1940 | Ga0501048_0281941 | |||
| 1941 | Ga0501048_0305644 | |||
| 1942 | Ga0501068_0001246 | |||
| 1943 | Ga0501069_0061544 | |||
| 1944 | Ga0501069_0169256 | |||
| 1945 | Ga0501069_0243472 | |||
| 1946 | Ga0501070_0000007 | |||
| 1947 | Ga0501070_0022228 | |||
| 1948 | Ga0501071_0006704 | |||
| 1949 | Ga0501071_0047897 | |||
| 1950 | Ga0501071_0147008 | |||
| 1951 | Ga0501071_0324291 | |||
| 1952 | Ga0501072_0005036 | |||
| 1953 | Ga0501072_0148186 | |||
| 1954 | Ga0501072_0263642 | |||
| 1955 | Ga0501072_0304919 | |||
| 1956 | Ga0501072_0400897 | |||
| 1957 | Ga0501073_0002900 | |||
| 1958 | Ga0501073_0027220 | |||
| 1959 | Ga0501073_0167474 | |||
| 1960 | Ga0501073_0334631 | |||
| 1961 | Ga0501074_0201097 | |||
| 1962 | Ga0501075_0016996 | |||
| 1963 | Ga0501075_0050546 | |||
| 1964 | Ga0501075_0128424 | |||
| 1965 | Ga0501076_0007740 | |||
| 1966 | Ga0501076_0065438 | |||
| 1967 | Ga0501076_0068626 | |||
| 1968 | Ga0501076_0188302 | |||
| 1969 | Ga0501076_0199409 | |||
| 1970 | Ga0501077_0171382 | |||
| 1971 | Ga0501077_0301461 | |||
| 1972 | Ga0501216_010906 | |||
| 1973 | Ga0501217_003126 | |||
| 1974 | Ga0501227_000547 | |||
| 1975 | Ga0501233_004758 | |||
| 1976 | Ga0501079_0026481 | |||
| 1977 | Ga0501080_0006815 | |||
| 1978 | Ga0501080_0076387 | |||
| 1979 | Ga0501080_0130574 | |||
| 1980 | Ga0501080_0149800 | |||
| 1981 | Ga0501080_0310777 | |||
| 1982 | Ga0501083_0002370 | |||
| 1983 | Ga0501283_010840 | |||
| 1984 | Ga0501035_0131011 | |||
| 1985 | Ga0501035_0266233 | |||
| 1986 | Ga0501035_0326077 | |||
| 1987 | Ga0501035_0515237 | |||
| 1988 | Ga0501044_0003302 | |||
| 1989 | Ga0501044_0128358 | |||
| 1990 | Ga0501045_0176708 | |||
| 1991 | Ga0501045_0208588 | |||
| 1992 | Ga0501045_0260170 | |||
| 1993 | Ga0501045_0356977 | |||
| 1994 | nmdc:mga03683_7135_c1 | |||
| 1995 | nmdc:mga00v17_155480_c1 | |||
| 1996 | nmdc:mga00v17_57653_c1 | |||
| 1997 | nmdc:mga0k408_55221_c1 | |||
| 1998 | nmdc:mga06z11_112445_c1 | |||
| 1999 | nmdc:mga05p37_148380_c1 | |||
| 2000 | nmdc:mga05p37_214329_c1 | |||
| 2001 | nmdc:mga05p37_3228_c1 | |||
| 2002 | nmdc:mga05p37_562000_c1 | |||
| 2003 | nmdc:mga05p37_664104_c1 | |||
| 2004 | nmdc:mga05p37_696529_c1 | |||
| 2005 | nmdc:mga05p37_82436_c1 | |||
| 2006 | nmdc:mga05p37_91004_c1 | |||
| 2007 | nmdc:mga09592_11107_c1 | |||
| 2008 | nmdc:mga09592_13933_c1 | |||
| 2009 | nmdc:mga09592_161_c1 | |||
| 2010 | nmdc:mga09592_186268_c1 | |||
| 2011 | nmdc:mga09592_228446_c1 | |||
| 2012 | nmdc:mga09592_253805_c1 | |||
| 2013 | nmdc:mga09592_26507_c1 | |||
| 2014 | nmdc:mga09592_334283_c1 | |||
| 2015 | nmdc:mga09592_5841_c1 | |||
| 2016 | nmdc:mga09592_83899_c1 | |||
| 2017 | nmdc:mga09592_97535_c1 | |||
| 2018 | nmdc:mga0qj67_124819_c1 | |||
| 2019 | nmdc:mga0qj67_231484_c1 | |||
| 2020 | nmdc:mga0qj67_2542_c1 | |||
| 2021 | nmdc:mga0qj67_2968_c1 | |||
| 2022 | nmdc:mga0qj67_306236_c1 | |||
| 2023 | nmdc:mga0qj67_6076_c1 | |||
| 2024 | nmdc:mga0qj67_90573_c1 | |||
| 2025 | nmdc:mga06r32_19503_c1 | |||
| 2026 | nmdc:mga06r32_246957_c1 | |||
| 2027 | nmdc:mga06r32_318_c1 | |||
| 2028 | nmdc:mga06r32_4178_c1 | |||
| 2029 | nmdc:mga06r32_80244_c1 | |||
| 2030 | nmdc:mga08y16_11638_c1 | |||
| 2031 | nmdc:mga08y16_116871_c1 | |||
| 2032 | nmdc:mga08y16_205854_c1 | |||
| 2033 | nmdc:mga08y16_332116_c1 | |||
| 2034 | nmdc:mga08y16_38042_c1 | |||
| 2035 | nmdc:mga08y16_39559_c1 | |||
| 2036 | nmdc:mga08y16_399083_c1 | |||
| 2037 | nmdc:mga08y16_46794_c1 | |||
| 2038 | nmdc:mga08y16_496326_c1 | |||
| 2039 | nmdc:mga08y16_9259_c1 | |||
| 2040 | nmdc:mga0n895_110351_c1 | |||
| 2041 | nmdc:mga0n895_47542_c1 | |||
| 2042 | nmdc:mga0n895_504928_c1 | |||
| 2043 | nmdc:mga0rr50_255643_c1 | |||
| 2044 | nmdc:mga0rr50_9080_c1 | |||
| 2045 | nmdc:mga0rr50_93451_c1 | |||
| 2046 | nmdc:mga08x19_5547_c1 | |||
| 2047 | nmdc:mga0a205_2632_c1 | |||
| 2048 | nmdc:mga0a205_45613_c1 | |||
| 2049 | Ga0495619_0002715 | |||
| 2050 | Ga0495619_0141539 | |||
| 2051 | Ga0495619_0265807 | |||
| 2052 | Ga0500646_0009361 | |||
| 2053 | Ga0500555_040638 | |||
| 2054 | Ga0501084_0060429 | |||
| 2055 | Ga0501084_0071013 | |||
| 2056 | Ga0501084_0362110 | |||
| 2057 | Ga0501084_0383544 | |||
| 2058 | Ga0590071_006490 | |||
| 2059 | Ga0590074_004080 | |||
| 2060 | Ga0590075_000057 | |||
| 2061 | Ga0590077_000869 | |||
| 2062 | Ga0590077_042124 | |||
| 2063 | Ga0501082_0000052 | |||
| 2064 | Ga0501082_0042165 | |||
| 2065 | Ga0501082_0128458 | |||
| 2066 | Ga0501082_0300246 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7trv-assembly1.cif.gz_B | crystal structure of the dna-binding domain of the lysr family transcriptional regulator yfba from yersinia pestis | 0.9434 | 3 | 86 |
| 4ihs-assembly1.cif.gz_A | crystal structure of benm_dbd/catb site 1 dna complex | 0.9417 | 4 | 87 |
| 4ihs-assembly3.cif.gz_C | crystal structure of benm_dbd/catb site 1 dna complex | 0.9414 | 4 | 87 |
| 7trv-assembly1.cif.gz_A | crystal structure of the dna-binding domain of the lysr family transcriptional regulator yfba from yersinia pestis | 0.9329 | 5 | 86 |
| 4iht-assembly1.cif.gz_A | crystal structure of benm_dbd/bena site 1 dna complex | 0.9306 | 4 | 87 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P0A9G2_1_86_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9857 | 1 | 83 | 1.10.10.10 |
| af_P0A9F6_3_89_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9784 | 3 | 86 | 1.10.10.10 |
| af_P67662_3_85_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9708 | 5 | 86 | 1.10.10.10 |
| af_Q57083_1_88_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9654 | 7 | 84 | 1.10.10.10 |
| af_P30864_1_87_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.958 | 1 | 87 | 1.10.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7C5R9H1-F1-model_v4 | LysR family transcriptional regulator | 0.9496 | 174 | 298 |
GO:0003677
GO:0003700 GO:2000142 |
| AF-A0A258CPL3-F1-model_v4 | LysR family transcriptional regulator | 0.9427 | 4 | 85 |
GO:0003700
GO:0006351 GO:0043565 |
| AF-A0A7C5R9H1-F1-model_v4 | LysR family transcriptional regulator | 0.9281 | 174 | 298 |
GO:0003677
GO:0003700 GO:2000142 |
| AF-A0A7W8W6C4-F1-model_v4 | DNA-binding transcriptional LysR family regulator | 0.9256 | 3 | 91 |
GO:0003677
GO:0003700 GO:2000142 |
| AF-A0A2M8V8B9-F1-model_v4 | deleted | 0.9166 | 3 | 87 |
|