F488661

General Info

Members Datasets Scaffolds Average Seq Length
1033 370 2066 304

Family's Representative Sequence

Representative Sequence 3300025918|Ga0207662_10046832|Ga0207662_100468322
Length 361
Sequence MRRPGVHPWSRIKRQKLAPVLGFVAGDALAQLSDGQRAMLEAPLRKNRHMLPGVEWLNYHHLLYFWSVAKQGSIVRASEELHLAHPTISGQIHRLEEVLGEKLFVRRGRNLALTEAGRVAFRYADEIFSLGREFVDTLKGRASGKPLRLVVGVADVLPPSLVRRFLEPAFRLNEPVQVICRADKSVQEFLAELALHSVDVVIADGPAAAGVPVRAFNHPLGDCGTTFFATARLAAKLRRRFPRSLDAAPFLMPGAPSTVRRSLEQWFASEDIRPRVVAEMDDSALGKELGEDGLGVFAAPAVIEAEILDRYRVRVVGRSEAVRQQFYAISVERKIKHPAVVAICEAARQAIFATKTVPARP

Samples

Sample ID Description Type Environment
1 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
34 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
35 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
36 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
37 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
38 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
39 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
46 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
47 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
48 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
49 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
50 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
51 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
52 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
53 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
54 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
55 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
56 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
57 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
58 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
59 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
60 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
61 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
62 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
63 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
64 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
65 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
66 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
67 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
68 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
69 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
70 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
71 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
72 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
73 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
74 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
75 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
76 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
77 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
78 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
79 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
80 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
81 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
82 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
83 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
84 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
85 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
86 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
88 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
89 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
90 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
91 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
92 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
93 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
94 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
95 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
96 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
97 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
98 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
99 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
100 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
101 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
102 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
103 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
104 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
105 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
106 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
107 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
108 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
109 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
110 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
111 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
112 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
113 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
114 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
115 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
116 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
117 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
118 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
119 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
120 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
121 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
122 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
123 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
124 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
125 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
126 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
127 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
128 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
129 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
190 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
191 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
192 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
193 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
194 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
195 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
196 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
200 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
201 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
202 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
203 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
204 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
205 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
206 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
207 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
208 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
209 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
210 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
211 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
212 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
213 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
214 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
215 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
216 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
217 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
218 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
219 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
220 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
221 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
222 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
223 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
224 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
225 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
226 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
227 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
228 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
229 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
230 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
231 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
232 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
233 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
234 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
235 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
236 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
237 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
238 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
239 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
240 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
241 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
242 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
243 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
244 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
245 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
246 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
247 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
248 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
249 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
250 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
251 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
252 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
253 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
254 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
255 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
256 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
257 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
258 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
259 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
260 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
261 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
262 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
263 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
264 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
265 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
266 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
267 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
268 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
269 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
270 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
271 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
272 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
273 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
274 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
275 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
276 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
277 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
278 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
279 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
280 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
281 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
282 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
283 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
284 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
285 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
286 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
287 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
288 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
289 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
290 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
291 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
292 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
293 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
294 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
295 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
296 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
297 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
298 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
299 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
300 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
301 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
302 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
303 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
304 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
305 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
306 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
307 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
308 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
309 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
310 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
311 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
312 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
313 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
314 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
315 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
316 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
317 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
318 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
319 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
320 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
321 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
322 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
323 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
324 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
325 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
326 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
327 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
328 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
329 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
330 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
331 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
332 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
333 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
334 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
335 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
336 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
337 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
338 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
339 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
340 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
341 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
342 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
343 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
344 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
345 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
346 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
347 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
348 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
349 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
350 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
351 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
352 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
353 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
354 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
355 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
356 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
357 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
358 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
359 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
360 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
361 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
362 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
363 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
364 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
365 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
366 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
367 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
368 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
369 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
370 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.65
Nodule 0
Rhizoplane 3.97
Rhizosphere 93.03
Stem 0
Stem Tuber 0
Unclassified 16.07

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207662_10046832 3300025918 Bacteria 2560
2 MRS1b_contig_6353489 2162886011 Bacteria 1221
3 rootH2_10026227 3300003320 Bacteria 3857
4 rootL2_10164218 3300003322 Bacteria 4637
5 rootL2_10363563 3300003322 Unclassified 1676
6 rootH1_10235514 3300003323 Bacteria 3037
7 rootH1_10285765 3300003323 Unclassified 2741
8 Ga0065712_10082993 3300005290 Bacteria 2862
9 Ga0065707_10105478 3300005295 Bacteria 2642
10 Ga0065707_10129487 3300005295 Bacteria 1947
11 Ga0065707_10186024 3300005295 Bacteria 1388
12 Ga0070658_10014537 3300005327 Bacteria 6317
13 Ga0070658_10274244 3300005327 Unclassified 1435
14 Ga0070676_10041158 3300005328 Bacteria 2678
15 Ga0070676_10060806 3300005328 Bacteria 2244
16 Ga0070676_10077444 3300005328 Unclassified 2010
17 Ga0070676_10235163 3300005328 Bacteria 1216
18 Ga0070683_100002980 3300005329 Bacteria 13578
19 Ga0070683_100051921 3300005329 Plasmid 3797
20 Ga0070683_100130358 3300005329 Bacteria 2379
21 Ga0070683_100168200 3300005329 Bacteria 2080
22 Ga0070690_100008915 3300005330 Bacteria 5792
23 Ga0070690_100051159 3300005330 Unclassified 2636
24 Ga0070690_100107497 3300005330 Unclassified 1857
25 Ga0070670_100000551 3300005331 Bacteria 29820
26 Ga0070670_100024055 3300005331 Bacteria 5240
27 Ga0070670_100054747 3300005331 Bacteria 3425
28 Ga0070670_100061754 3300005331 Unclassified 3216
29 Ga0070670_100076255 3300005331 Bacteria 2881
30 Ga0070677_10001876 3300005333 Bacteria 6649
31 Ga0070677_10023051 3300005333 Bacteria 2301
32 Ga0070677_10059898 3300005333 Bacteria 1567
33 Ga0068869_100001326 3300005334 Bacteria 14673
34 Ga0068869_100004523 3300005334 Bacteria 8653
35 Ga0068869_100012842 3300005334 Bacteria 5544
36 Ga0068869_100050168 3300005334 Bacteria 3024
37 Ga0070666_10018322 3300005335 Bacteria 4499
38 Ga0070666_10112735 3300005335 Bacteria 1881
39 Ga0070680_100019142 3300005336 Bacteria 5422
40 Ga0070680_100027953 3300005336 Bacteria 4521
41 Ga0070680_100079759 3300005336 Bacteria 2699
42 Ga0070680_100080984 3300005336 Unclassified 2678
43 Ga0070680_100082008 3300005336 Unclassified 2661
44 Ga0070680_100205792 3300005336 Bacteria 1660
45 Ga0070680_100252826 3300005336 Bacteria 1490
46 Ga0070682_100079979 3300005337 Bacteria 2112
47 Ga0070682_100258345 3300005337 Bacteria 1259
48 Ga0068868_100016527 3300005338 Bacteria 5483
49 Ga0068868_100020637 3300005338 Bacteria 4954
50 Ga0068868_100072417 3300005338 Bacteria 2749
51 Ga0068868_100120907 3300005338 Bacteria 2136
52 Ga0068868_100389802 3300005338 Bacteria 1200
53 Ga0070689_100000007 3300005340 Bacteria 312944
54 Ga0070689_100005960 3300005340 Bacteria 8385
55 Ga0070689_100007606 3300005340 Bacteria 7589
56 Ga0070689_100014298 3300005340 Bacteria 5763
57 Ga0070689_100022551 3300005340 Bacteria 4702
58 Ga0070689_100076094 3300005340 Unclassified 2629
59 Ga0070689_100113731 3300005340 Bacteria 2155
60 Ga0070689_100171269 3300005340 Bacteria 1759
61 Ga0070689_100199188 3300005340 Bacteria 1634
62 Ga0070691_10013119 3300005341 Bacteria 3796
63 Ga0070687_100007099 3300005343 Bacteria 4639
64 Ga0070687_100213725 3300005343 Bacteria 1176
65 Ga0070661_100038853 3300005344 Bacteria 3466
66 Ga0070661_100087148 3300005344 Unclassified 2309
67 Ga0070661_100196825 3300005344 Unclassified 1539
68 Ga0070692_10012085 3300005345 Unclassified 3984
69 Ga0070668_100018067 3300005347 Bacteria 5289
70 Ga0070668_100040743 3300005347 Bacteria 3555
71 Ga0070668_100162468 3300005347 Bacteria 1813
72 Ga0070669_100001207 3300005353 Bacteria 18811
73 Ga0070669_100001973 3300005353 Bacteria 14826
74 Ga0070669_100002718 3300005353 Bacteria 12762
75 Ga0070669_100006126 3300005353 Bacteria 8683
76 Ga0070669_100012721 3300005353 Bacteria 5974
77 Ga0070669_100095422 3300005353 Bacteria 2236
78 Ga0070675_100000890 3300005354 Bacteria 21218
79 Ga0070675_100003302 3300005354 Bacteria 12232
80 Ga0070675_100003354 3300005354 Bacteria 12130
81 Ga0070675_100006236 3300005354 Bacteria 9147
82 Ga0070675_100025127 3300005354 Bacteria 4774
83 Ga0070675_100057387 3300005354 Bacteria 3209
84 Ga0070675_100073761 3300005354 Unclassified 2833
85 Ga0070675_100218793 3300005354 Bacteria 1658
86 Ga0070671_100019858 3300005355 Bacteria 5475
87 Ga0070671_100024511 3300005355 Bacteria 4939
88 Ga0070674_100002134 3300005356 Bacteria 10864
89 Ga0070674_100002918 3300005356 Bacteria 9474
90 Ga0070674_100151587 3300005356 Bacteria 1750
91 Ga0070673_100000370 3300005364 Bacteria 23557
92 Ga0070673_100003840 3300005364 Bacteria 9429
93 Ga0070673_100006729 3300005364 Bacteria 7498
94 Ga0070673_100011969 3300005364 Bacteria 5940
95 Ga0070673_100027846 3300005364 Bacteria 4194
96 Ga0070673_100061519 3300005364 Bacteria 2979
97 Ga0070673_100115147 3300005364 Unclassified 2235
98 Ga0070673_100154029 3300005364 Bacteria 1949
99 Ga0070673_100174746 3300005364 Unclassified 1835
100 Ga0070673_100294229 3300005364 Unclassified 1428
101 Ga0070673_100298163 3300005364 Unclassified 1418
102 Ga0070688_100012782 3300005365 Bacteria 4714
103 Ga0070688_100052402 3300005365 Bacteria 2549
104 Ga0070688_100184966 3300005365 Bacteria 1447
105 Ga0070688_100218236 3300005365 Bacteria 1343
106 Ga0070659_100176226 3300005366 Unclassified 1753
107 Ga0070659_100266151 3300005366 Unclassified 1423
108 Ga0070659_100326464 3300005366 Bacteria 1283
109 Ga0070659_100380579 3300005366 Unclassified 1189
110 Ga0070667_100017750 3300005367 Bacteria 5898
111 Ga0070667_100060350 3300005367 Bacteria 3209
112 Ga0070667_100368476 3300005367 Bacteria 1303
113 Ga0070667_100468044 3300005367 Bacteria 1153
114 Ga0070709_10050050 3300005434 Unclassified 2616
115 Ga0070714_100181719 3300005435 Bacteria 1914
116 Ga0070713_100026419 3300005436 Unclassified 4557
117 Ga0070713_100115800 3300005436 Bacteria 2343
118 Ga0070710_10188405 3300005437 Bacteria 1296
119 Ga0070701_10009533 3300005438 Bacteria 4257
120 Ga0070701_10055123 3300005438 Unclassified 2075
121 Ga0070701_10109861 3300005438 Bacteria 1539
122 Ga0070700_100000744 3300005441 Bacteria 16029
123 Ga0070700_100005721 3300005441 Bacteria 6599
124 Ga0070700_100005745 3300005441 Bacteria 6584
125 Ga0070700_100009761 3300005441 Bacteria 5276
126 Ga0070700_100009763 3300005441 Bacteria 5276
127 Ga0070694_100015477 3300005444 Unclassified 4793
128 Ga0070694_100113231 3300005444 Bacteria 1935
129 Ga0070663_100016596 3300005455 Bacteria 4788
130 Ga0070663_100053978 3300005455 Bacteria 2871
131 Ga0070678_100000511 3300005456 Bacteria 18758
132 Ga0070678_100032605 3300005456 Bacteria 3607
133 Ga0070678_100037944 3300005456 Bacteria 3388
134 Ga0070678_100134359 3300005456 Bacteria 1971
135 Ga0070678_100155158 3300005456 Bacteria 1849
136 Ga0070678_100242212 3300005456 Unclassified 1508
137 Ga0070662_100072074 3300005457 Unclassified 2549
138 Ga0070681_10000309 3300005458 Bacteria 39572
139 Ga0070681_10003682 3300005458 Bacteria 14382
140 Ga0070681_10010073 3300005458 Bacteria 9317
141 Ga0070681_10066157 3300005458 Unclassified 3583
142 Ga0070681_10073770 3300005458 Bacteria 3374
143 Ga0070681_10115496 3300005458 Unclassified 2622
144 Ga0070681_10194209 3300005458 Bacteria 1949
145 Ga0070681_10312616 3300005458 Bacteria 1480
146 Ga0068867_100005810 3300005459 Bacteria 8756
147 Ga0068867_100005825 3300005459 Bacteria 8740
148 Ga0068867_100012100 3300005459 Bacteria 6094
149 Ga0068867_100018293 3300005459 Bacteria 4980
150 Ga0068867_100148801 3300005459 Unclassified 1837
151 Ga0068867_100213036 3300005459 Bacteria 1553
152 Ga0070685_10019361 3300005466 Unclassified 3671
153 Ga0070685_10065230 3300005466 Bacteria 2143
154 Ga0070706_100062732 3300005467 Unclassified 3434
155 Ga0070706_100074264 3300005467 Bacteria 3147
156 Ga0070707_100064275 3300005468 Bacteria 3524
157 Ga0070707_100224930 3300005468 Bacteria 1827
158 Ga0070698_100020520 3300005471 Bacteria 6927
159 Ga0070698_100064477 3300005471 Bacteria 3691
160 Ga0070698_100142586 3300005471 Bacteria 2346
161 Ga0070699_100099253 3300005518 Bacteria 2551
162 Ga0070699_100106293 3300005518 Bacteria 2462
163 Ga0070699_100406714 3300005518 Bacteria 1231
164 Ga0070679_100001350 3300005530 Bacteria 21674
165 Ga0070679_100002948 3300005530 Bacteria 15503
166 Ga0070679_100005418 3300005530 Bacteria 11822
167 Ga0070679_100010515 3300005530 Bacteria 8778
168 Ga0070679_100016724 3300005530 Bacteria 7087
169 Ga0070679_100073734 3300005530 Bacteria 3404
170 Ga0070679_100135470 3300005530 Bacteria 2444
171 Ga0070679_100197549 3300005530 Bacteria 1978
172 Ga0070679_100252896 3300005530 Bacteria 1718
173 Ga0070679_100338790 3300005530 Bacteria 1452
174 Ga0070684_100002830 3300005535 Bacteria 12888
175 Ga0070684_100003300 3300005535 Bacteria 12085
176 Ga0070684_100052352 3300005535 Bacteria 3551
177 Ga0070684_100232303 3300005535 Unclassified 1684
178 Ga0070697_100065425 3300005536 Bacteria 2971
179 Ga0070697_100331173 3300005536 Bacteria 1313
180 Ga0068853_100000300 3300005539 Bacteria 34560
181 Ga0068853_100073678 3300005539 Unclassified 2978
182 Ga0068853_100160935 3300005539 Bacteria 2026
183 Ga0070672_100015454 3300005543 Bacteria 5435
184 Ga0070672_100023216 3300005543 Bacteria 4569
185 Ga0070672_100043645 3300005543 Bacteria 3459
186 Ga0070672_100065199 3300005543 Bacteria 2880
187 Ga0070672_100069262 3300005543 Bacteria 2800
188 Ga0070672_100111694 3300005543 Unclassified 2228
189 Ga0070672_100154339 3300005543 Bacteria 1901
190 Ga0070672_100198978 3300005543 Bacteria 1675
191 Ga0070686_100000642 3300005544 Bacteria 20406
192 Ga0070686_100005637 3300005544 Bacteria 6936
193 Ga0070686_100011225 3300005544 Bacteria 5075
194 Ga0070686_100019575 3300005544 Bacteria 3991
195 Ga0070686_100043680 3300005544 Bacteria 2813
196 Ga0070686_100162892 3300005544 Bacteria 1572
197 Ga0070695_100079239 3300005545 Bacteria 2168
198 Ga0070696_100398818 3300005546 Bacteria 1076
199 Ga0070665_100080454 3300005548 Bacteria 3264
200 Ga0070665_100380697 3300005548 Unclassified 1418
201 Ga0070704_100017654 3300005549 Bacteria 4543
202 Ga0070704_100124127 3300005549 Bacteria 1989
203 Ga0070704_100208322 3300005549 Bacteria 1583
204 Ga0070704_100281037 3300005549 Bacteria 1379
205 Ga0068855_100000281 3300005563 Bacteria 62765
206 Ga0068855_100002270 3300005563 Bacteria 23737
207 Ga0068855_100003646 3300005563 Bacteria 18831
208 Ga0068855_100033765 3300005563 Bacteria 6103
209 Ga0068855_100041518 3300005563 Bacteria 5451
210 Ga0068855_100053654 3300005563 Unclassified 4741
211 Ga0068855_100055539 3300005563 Bacteria 4650
212 Ga0068855_100151606 3300005563 Unclassified 2636
213 Ga0068855_100312790 3300005563 Bacteria 1737
214 Ga0070664_100000556 3300005564 Bacteria 28544
215 Ga0070664_100005141 3300005564 Bacteria 10500
216 Ga0070664_100008742 3300005564 Bacteria 8200
217 Ga0070664_100018808 3300005564 Bacteria 5681
218 Ga0068857_100003854 3300005577 Bacteria 12624
219 Ga0068857_100114611 3300005577 Bacteria 2424
220 Ga0068854_100013717 3300005578 Bacteria 5325
221 Ga0068854_100084887 3300005578 Bacteria 2344
222 Ga0068856_100000402 3300005614 Bacteria 47399
223 Ga0068856_100001321 3300005614 Bacteria 26127
224 Ga0068856_100036179 3300005614 Bacteria 4841
225 Ga0068856_100126327 3300005614 Bacteria 2561
226 Ga0068856_100215362 3300005614 Bacteria 1936
227 Ga0068852_100035367 3300005616 Unclassified 4166
228 Ga0068852_100171123 3300005616 Bacteria 2036
229 Ga0068852_100471042 3300005616 Bacteria 1247
230 Ga0068859_100000856 3300005617 Bacteria 31020
231 Ga0068859_100012549 3300005617 Bacteria 8525
232 Ga0068859_100018726 3300005617 Bacteria 6956
233 Ga0068859_100019300 3300005617 Bacteria 6850
234 Ga0068859_100132432 3300005617 Unclassified 2565
235 Ga0068859_100235306 3300005617 Bacteria 1920
236 Ga0068859_100619043 3300005617 Unclassified 1175
237 Ga0068864_100001103 3300005618 Bacteria 22587
238 Ga0068864_100134216 3300005618 Unclassified 2227
239 Ga0068864_100240219 3300005618 Bacteria 1678
240 Ga0068866_10005957 3300005718 Bacteria 5070
241 Ga0068866_10016670 3300005718 Bacteria 3290
242 Ga0068861_100023075 3300005719 Bacteria 4487
243 Ga0068861_100044916 3300005719 Bacteria 3324
244 Ga0068861_100117173 3300005719 Bacteria 2143
245 Ga0068861_100175478 3300005719 Unclassified 1779
246 Ga0068851_10069760 3300005834 Unclassified 1816
247 Ga0068870_10053582 3300005840 Bacteria 2143
248 Ga0068863_100012313 3300005841 Bacteria 8256
249 Ga0068863_100083549 3300005841 Bacteria 3026
250 Ga0068863_100164915 3300005841 Bacteria 2124
251 Ga0068863_100395790 3300005841 Bacteria 1350
252 Ga0068863_100516564 3300005841 Bacteria 1177
253 Ga0068858_100003292 3300005842 Bacteria 16084
254 Ga0068858_100019810 3300005842 Bacteria 6289
255 Ga0068858_100044424 3300005842 Bacteria 4118
256 Ga0068858_100105653 3300005842 Bacteria 2628
257 Ga0068858_100204594 3300005842 Bacteria 1868
258 Ga0068858_100418925 3300005842 Bacteria 1288
259 Ga0068860_100010802 3300005843 Bacteria 9013
260 Ga0068860_100058809 3300005843 Unclassified 3655
261 Ga0068860_100121725 3300005843 Unclassified 2499
262 Ga0068860_100297248 3300005843 Unclassified 1581
263 Ga0068862_100002166 3300005844 Bacteria 17665
264 Ga0068862_100016110 3300005844 Bacteria 6218
265 Ga0068862_100063425 3300005844 Unclassified 3179
266 Ga0068862_100121132 3300005844 Bacteria 2306
267 Ga0068862_100130796 3300005844 Bacteria 2220
268 Ga0081455_10011250 3300005937 Bacteria 9003
269 Ga0081455_10123295 3300005937 Bacteria 2039
270 Ga0081538_10103929 3300005981 Bacteria 1419
271 Ga0081540_1022235 3300005983 Unclassified 3747
272 Ga0075365_10048028 3300006038 Bacteria 2808
273 Ga0075363_100093458 3300006048 Unclassified 1658
274 Ga0075364_10068722 3300006051 Bacteria 2330
275 Ga0075364_10153554 3300006051 Bacteria 1552
276 Ga0075362_10002309 3300006177 Bacteria 6375
277 Ga0075367_10003335 3300006178 Bacteria 7627
278 Ga0075367_10033685 3300006178 Bacteria 2954
279 Ga0075427_10019963 3300006194 Unclassified 1059
280 Ga0075366_10004550 3300006195 Bacteria 7447
281 Ga0075366_10041277 3300006195 Bacteria 2731
282 Ga0075366_10081794 3300006195 Bacteria 1930
283 Ga0097621_100000113 3300006237 Bacteria 45891
284 Ga0097621_100123720 3300006237 Unclassified 2196
285 Ga0097621_100294847 3300006237 Bacteria 1431
286 Ga0068871_100000132 3300006358 Bacteria 47573
287 Ga0068871_100090132 3300006358 Bacteria 2553
288 Ga0075428_100000319 3300006844 Bacteria 47598
289 Ga0075428_100000346 3300006844 Bacteria 46086
290 Ga0075428_100028997 3300006844 Bacteria 6125
291 Ga0075428_100029578 3300006844 Bacteria 6061
292 Ga0075428_100032898 3300006844 Bacteria 5726
293 Ga0075428_100124274 3300006844 Bacteria 2808
294 Ga0075428_100151928 3300006844 Bacteria 2515
295 Ga0075428_100218732 3300006844 Bacteria 2057
296 Ga0075430_100001453 3300006846 Bacteria 19243
297 Ga0075430_100003185 3300006846 Bacteria 13749
298 Ga0075430_100107415 3300006846 Bacteria 2328
299 Ga0075430_100123743 3300006846 Bacteria 2156
300 Ga0075430_100133457 3300006846 Unclassified 2069
301 Ga0075430_100184345 3300006846 Unclassified 1736
302 Ga0075430_100205098 3300006846 Bacteria 1636
303 Ga0075430_100296658 3300006846 Bacteria 1337
304 Ga0075430_100312001 3300006846 Unclassified 1301
305 Ga0075431_100000161 3300006847 Bacteria 46914
306 Ga0075431_100001791 3300006847 Bacteria 20283
307 Ga0075431_100008623 3300006847 Bacteria 10210
308 Ga0075431_100065763 3300006847 Unclassified 3743
309 Ga0075431_100091196 3300006847 Unclassified 3145
310 Ga0075431_100319711 3300006847 Bacteria 1565
311 Ga0075433_10001814 3300006852 Bacteria 16049
312 Ga0075433_10036715 3300006852 Bacteria 4223
313 Ga0075434_100008279 3300006871 Bacteria 9659
314 Ga0075434_100090797 3300006871 Bacteria 3056
315 Ga0075434_100134714 3300006871 Bacteria 2490
316 Ga0075429_100001822 3300006880 Bacteria 17635
317 Ga0075429_100002325 3300006880 Bacteria 15963
318 Ga0075429_100016697 3300006880 Bacteria 6358
319 Ga0075429_100029457 3300006880 Bacteria 4768
320 Ga0075429_100059547 3300006880 Bacteria 3326
321 Ga0075429_100215850 3300006880 Unclassified 1681
322 Ga0068865_100000579 3300006881 Bacteria 20505
323 Ga0068865_100005964 3300006881 Bacteria 7423
324 Ga0068865_100017297 3300006881 Bacteria 4635
325 Ga0068865_100022492 3300006881 Bacteria 4113
326 Ga0075436_100015446 3300006914 Bacteria 5228
327 Ga0097620_100000856 3300006931 Bacteria 31020
328 Ga0097620_100012549 3300006931 Bacteria 8525
329 Ga0097620_100018726 3300006931 Bacteria 6956
330 Ga0097620_100019300 3300006931 Bacteria 6850
331 Ga0097620_100132431 3300006931 Unclassified 2565
332 Ga0097620_100235302 3300006931 Bacteria 1920
333 Ga0097620_100619033 3300006931 Unclassified 1175
334 Ga0099794_10014319 3300007265 Bacteria 3473
335 Ga0105240_10000541 3300009093 Bacteria 69900
336 Ga0105240_10001087 3300009093 Bacteria 48005
337 Ga0105240_10004530 3300009093 Bacteria 21111
338 Ga0105240_10012416 3300009093 Bacteria 11760
339 Ga0105240_10038183 3300009093 Bacteria 6163
340 Ga0105240_10053890 3300009093 Bacteria 5045
341 Ga0105240_10297839 3300009093 Bacteria 1846
342 Ga0111539_10000393 3300009094 Bacteria 54202
343 Ga0111539_10001372 3300009094 Bacteria 32379
344 Ga0111539_10010838 3300009094 Bacteria 11475
345 Ga0111539_10019777 3300009094 Bacteria 8303
346 Ga0111539_10026117 3300009094 Bacteria 7149
347 Ga0111539_10097778 3300009094 Bacteria 3448
348 Ga0111539_10112150 3300009094 Bacteria 3199
349 Ga0111539_10443008 3300009094 Bacteria 1512
350 Ga0111539_10927415 3300009094 Bacteria 1013
351 Ga0105245_10400703 3300009098 Bacteria 1371
352 Ga0105247_10080947 3300009101 Bacteria 2047
353 Ga0114129_10004036 3300009147 Bacteria 20725
354 Ga0114129_10010683 3300009147 Bacteria 13096
355 Ga0114129_10033825 3300009147 Bacteria 7220
356 Ga0114129_10174071 3300009147 Bacteria 2932
357 Ga0114129_10219599 3300009147 Bacteria 2565
358 Ga0114129_10241299 3300009147 Unclassified 2429
359 Ga0114129_10253434 3300009147 Bacteria 2362
360 Ga0114129_10449309 3300009147 Bacteria 1690
361 Ga0114129_10508249 3300009147 Bacteria 1573
362 Ga0114129_10791088 3300009147 Unclassified 1211
363 Ga0114129_10966353 3300009147 Bacteria 1075
364 Ga0105243_10023274 3300009148 Bacteria 4715
365 Ga0105243_10339168 3300009148 Unclassified 1376
366 Ga0105241_10009684 3300009174 Bacteria 7081
367 Ga0105242_10048514 3300009176 Bacteria 3451
368 Ga0105248_10014040 3300009177 Bacteria 8814
369 Ga0105248_10019197 3300009177 Bacteria 7563
370 Ga0105248_10127513 3300009177 Bacteria 2871
371 Ga0105248_10144702 3300009177 Bacteria 2682
372 Ga0105248_10572315 3300009177 Bacteria 1275
373 Ga0105237_10000069 3300009545 Bacteria 138459
374 Ga0105237_10029942 3300009545 Bacteria 5530
375 Ga0105237_10049101 3300009545 Bacteria 4243
376 Ga0105237_10088986 3300009545 Bacteria 3077
377 Ga0105237_10204570 3300009545 Bacteria 1974
378 Ga0105238_10000471 3300009551 Bacteria 42403
379 Ga0105238_10002524 3300009551 Bacteria 18289
380 Ga0105238_10021516 3300009551 Bacteria 6568
381 Ga0105238_10048789 3300009551 Bacteria 4266
382 Ga0105238_10075974 3300009551 Bacteria 3351
383 Ga0105238_10417713 3300009551 Unclassified 1336
384 Ga0105238_10727659 3300009551 Bacteria 1005
385 Ga0105249_10000242 3300009553 Bacteria 60635
386 Ga0105249_10000698 3300009553 Bacteria 30441
387 Ga0099796_10104281 3300010159 Bacteria 1071
388 Ga0105239_10026435 3300010375 Bacteria 6388
389 Ga0105239_10040792 3300010375 Bacteria 5086
390 Ga0105239_10043362 3300010375 Bacteria 4931
391 Ga0105239_10057747 3300010375 Bacteria 4257
392 Ga0105239_10103695 3300010375 Plasmid 3148
393 Ga0105239_10104531 3300010375 Bacteria 3136
394 Ga0105239_10571554 3300010375 Bacteria 1288
395 Ga0105239_10694452 3300010375 Bacteria 1163
396 Ga0105246_10050712 3300011119 Unclassified 2847
397 Ga0157373_10035476 3300013100 Unclassified 3580
398 Ga0157371_10034224 3300013102 Bacteria 3645
399 Ga0157370_10305102 3300013104 Bacteria 1469
400 Ga0157370_10306750 3300013104 Unclassified 1465
401 Ga0157369_10032693 3300013105 Bacteria 5718
402 Ga0157369_10056937 3300013105 Bacteria 4218
403 Ga0157369_10350427 3300013105 Bacteria 1533
404 Ga0157374_10000400 3300013296 Bacteria 39330
405 Ga0157374_10003194 3300013296 Bacteria 13770
406 Ga0157374_10007030 3300013296 Bacteria 9580
407 Ga0157374_10030098 3300013296 Bacteria 4926
408 Ga0157374_10040945 3300013296 Bacteria 4268
409 Ga0157374_10131803 3300013296 Bacteria 2419
410 Ga0157378_10000195 3300013297 Bacteria 58873
411 Ga0157378_10002056 3300013297 Bacteria 18023
412 Ga0157378_10228170 3300013297 Bacteria 1773
413 Ga0163162_10127051 3300013306 Bacteria 2657
414 Ga0163162_10131779 3300013306 Unclassified 2608
415 Ga0157372_10010834 3300013307 Bacteria 9707
416 Ga0157372_10012124 3300013307 Bacteria 9182
417 Ga0157372_10225468 3300013307 Bacteria 2173
418 Ga0157372_10330656 3300013307 Unclassified 1774
419 Ga0157372_10407741 3300013307 Bacteria 1584
420 Ga0157372_10642025 3300013307 Unclassified 1236
421 Ga0157375_10008227 3300013308 Bacteria 9129
422 Ga0157375_10092448 3300013308 Bacteria 3089
423 Ga0157375_10145358 3300013308 Unclassified 2502
424 Ga0163163_10006750 3300014325 Bacteria 10060
425 Ga0163163_10016449 3300014325 Bacteria 6876
426 Ga0163163_10077529 3300014325 Unclassified 3318
427 Ga0163163_10085273 3300014325 Unclassified 3166
428 Ga0163163_10110157 3300014325 Bacteria 2781
429 Ga0163163_10112503 3300014325 Unclassified 2752
430 Ga0163163_10410149 3300014325 Bacteria 1413
431 Ga0163163_10469432 3300014325 Bacteria 1319
432 Ga0157380_10006495 3300014326 Bacteria 8243
433 Ga0157380_10006953 3300014326 Bacteria 8005
434 Ga0157380_10009368 3300014326 Bacteria 7014
435 Ga0157380_10013500 3300014326 Bacteria 5958
436 Ga0157380_10089855 3300014326 Bacteria 2532
437 Ga0157380_10136088 3300014326 Bacteria 2103
438 Ga0157380_10189502 3300014326 Bacteria 1814
439 Ga0157380_10204864 3300014326 Bacteria 1753
440 Ga0157380_10596084 3300014326 Unclassified 1092
441 Ga0157377_10003190 3300014745 Bacteria 7397
442 Ga0157379_10004863 3300014968 Bacteria 11538
443 Ga0157376_10040921 3300014969 Bacteria 3791
444 Ga0157376_10044377 3300014969 Bacteria 3654
445 Ga0157376_10099262 3300014969 Bacteria 2540
446 Ga0157376_10469038 3300014969 Bacteria 1231
447 Ga0157376_10601042 3300014969 Bacteria 1095
448 Ga0163161_10099645 3300017792 Bacteria 2161
449 Ga0163161_10470081 3300017792 Bacteria 1019
450 Ga0213876_10027399 3300021384 Bacteria 3007
451 Ga0207697_10000122 3300025315 Bacteria 36998
452 Ga0207697_10015818 3300025315 Bacteria 3112
453 Ga0207697_10130646 3300025315 Bacteria 1085
454 Ga0207656_10008865 3300025321 Bacteria 3721
455 Ga0207682_10004257 3300025893 Bacteria 6041
456 Ga0207682_10026430 3300025893 Bacteria 2307
457 Ga0207682_10038096 3300025893 Bacteria 1949
458 Ga0207682_10044278 3300025893 Bacteria 1824
459 Ga0207642_10003249 3300025899 Bacteria 5108
460 Ga0207688_10009098 3300025901 Bacteria 5404
461 Ga0207680_10250275 3300025903 Bacteria 1224
462 Ga0207680_10270344 3300025903 Unclassified 1179
463 Ga0207647_10027025 3300025904 Bacteria 3746
464 Ga0207647_10091925 3300025904 Bacteria 1809
465 Ga0207699_10112740 3300025906 Unclassified 1746
466 Ga0207645_10000742 3300025907 Bacteria 27179
467 Ga0207645_10019155 3300025907 Bacteria 4493
468 Ga0207645_10020677 3300025907 Bacteria 4304
469 Ga0207645_10059086 3300025907 Bacteria 2449
470 Ga0207643_10000360 3300025908 Bacteria 30533
471 Ga0207643_10026346 3300025908 Bacteria 3218
472 Ga0207643_10054218 3300025908 Bacteria 2279
473 Ga0207643_10304359 3300025908 Bacteria 993
474 Ga0207705_10015210 3300025909 Bacteria 5528
475 Ga0207705_10242682 3300025909 Unclassified 1373
476 Ga0207684_10032220 3300025910 Bacteria 4458
477 Ga0207684_10200728 3300025910 Bacteria 1720
478 Ga0207654_10010433 3300025911 Bacteria 4730
479 Ga0207654_10034377 3300025911 Unclassified 2816
480 Ga0207654_10075599 3300025911 Unclassified 2013
481 Ga0207707_10001909 3300025912 Bacteria 18961
482 Ga0207707_10060491 3300025912 Unclassified 3295
483 Ga0207707_10125120 3300025912 Bacteria 2248
484 Ga0207707_10163046 3300025912 Bacteria 1949
485 Ga0207707_10217808 3300025912 Unclassified 1662
486 Ga0207707_10227886 3300025912 Bacteria 1621
487 Ga0207707_10255572 3300025912 Bacteria 1521
488 Ga0207695_10002331 3300025913 Bacteria 28268
489 Ga0207695_10015878 3300025913 Bacteria 8846
490 Ga0207695_10016970 3300025913 Bacteria 8496
491 Ga0207695_10047546 3300025913 Bacteria 4539
492 Ga0207695_10316949 3300025913 Bacteria 1449
493 Ga0207671_10000154 3300025914 Bacteria 106945
494 Ga0207671_10049826 3300025914 Unclassified 3101
495 Ga0207693_10187315 3300025915 Bacteria 1629
496 Ga0207660_10009787 3300025917 Bacteria 6207
497 Ga0207660_10052296 3300025917 Unclassified 2907
498 Ga0207660_10124434 3300025917 Bacteria 1957
499 Ga0207660_10176298 3300025917 Unclassified 1658
500 Ga0207662_10000686 3300025918 Bacteria 15410
501 Ga0207662_10005520 3300025918 Bacteria 6751
502 Ga0207662_10052061 3300025918 Bacteria 2436
503 Ga0207657_10256512 3300025919 Unclassified 1392
504 Ga0207649_10120662 3300025920 Unclassified 1767
505 Ga0207649_10215476 3300025920 Unclassified 1365
506 Ga0207652_10001179 3300025921 Bacteria 23506
507 Ga0207652_10001341 3300025921 Bacteria 21860
508 Ga0207652_10003584 3300025921 Bacteria 12804
509 Ga0207652_10008069 3300025921 Bacteria 8451
510 Ga0207652_10044927 3300025921 Bacteria 3765
511 Ga0207652_10060835 3300025921 Bacteria 3260
512 Ga0207652_10086274 3300025921 Bacteria 2752
513 Ga0207646_10479628 3300025922 Bacteria 1121
514 Ga0207681_10000389 3300025923 Bacteria 30711
515 Ga0207681_10001574 3300025923 Bacteria 14675
516 Ga0207681_10015805 3300025923 Bacteria 4711
517 Ga0207681_10052833 3300025923 Bacteria 2756
518 Ga0207681_10270420 3300025923 Bacteria 1334
519 Ga0207694_10000408 3300025924 Bacteria 40107
520 Ga0207694_10011032 3300025924 Bacteria 6824
521 Ga0207694_10029089 3300025924 Bacteria 4214
522 Ga0207694_10038632 3300025924 Bacteria 3671
523 Ga0207694_10170935 3300025924 Unclassified 1759
524 Ga0207694_10430446 3300025924 Bacteria 1100
525 Ga0207650_10001365 3300025925 Bacteria 17616
526 Ga0207650_10082106 3300025925 Bacteria 2446
527 Ga0207659_10003313 3300025926 Bacteria 9651
528 Ga0207659_10006924 3300025926 Bacteria 6967
529 Ga0207659_10008998 3300025926 Bacteria 6227
530 Ga0207659_10010433 3300025926 Bacteria 5839
531 Ga0207659_10017242 3300025926 Bacteria 4714
532 Ga0207659_10167996 3300025926 Unclassified 1728
533 Ga0207659_10257532 3300025926 Unclassified 1418
534 Ga0207687_10346836 3300025927 Bacteria 1208
535 Ga0207700_10050262 3300025928 Bacteria 3106
536 Ga0207664_10183110 3300025929 Bacteria 1799
537 Ga0207644_10180867 3300025931 Bacteria 1652
538 Ga0207706_10003747 3300025933 Bacteria 14495
539 Ga0207706_10013434 3300025933 Bacteria 7441
540 Ga0207706_10094781 3300025933 Bacteria 2626
541 Ga0207706_10261461 3300025933 Bacteria 1511
542 Ga0207706_10343890 3300025933 Unclassified 1297
543 Ga0207686_10186777 3300025934 Bacteria 1474
544 Ga0207709_10004218 3300025935 Bacteria 8335
545 Ga0207709_10048171 3300025935 Unclassified 2595
546 Ga0207670_10000016 3300025936 Bacteria 166872
547 Ga0207670_10004761 3300025936 Bacteria 7363
548 Ga0207670_10005591 3300025936 Bacteria 6909
549 Ga0207670_10015057 3300025936 Bacteria 4610
550 Ga0207670_10022875 3300025936 Bacteria 3881
551 Ga0207670_10110034 3300025936 Unclassified 1984
552 Ga0207670_10112068 3300025936 Bacteria 1968
553 Ga0207670_10138951 3300025936 Bacteria 1789
554 Ga0207669_10001664 3300025937 Bacteria 9460
555 Ga0207669_10003981 3300025937 Bacteria 6456
556 Ga0207669_10039226 3300025937 Bacteria 2734
557 Ga0207669_10067262 3300025937 Bacteria 2232
558 Ga0207669_10225666 3300025937 Bacteria 1378
559 Ga0207704_10003435 3300025938 Bacteria 7198
560 Ga0207704_10018840 3300025938 Bacteria 3613
561 Ga0207704_10018944 3300025938 Bacteria 3605
562 Ga0207704_10175662 3300025938 Bacteria 1542
563 Ga0207691_10002481 3300025940 Bacteria 18049
564 Ga0207691_10007176 3300025940 Bacteria 10749
565 Ga0207691_10018779 3300025940 Bacteria 6548
566 Ga0207691_10035286 3300025940 Bacteria 4643
567 Ga0207691_10040822 3300025940 Bacteria 4287
568 Ga0207691_10049195 3300025940 Bacteria 3863
569 Ga0207691_10071079 3300025940 Bacteria 3142
570 Ga0207691_10072862 3300025940 Bacteria 3098
571 Ga0207691_10082569 3300025940 Bacteria 2886
572 Ga0207691_10093717 3300025940 Bacteria 2688
573 Ga0207691_10110286 3300025940 Bacteria 2448
574 Ga0207691_10178004 3300025940 Bacteria 1859
575 Ga0207691_10322099 3300025940 Bacteria 1325
576 Ga0207691_10471929 3300025940 Bacteria 1067
577 Ga0207711_10034792 3300025941 Bacteria 4266
578 Ga0207711_10056006 3300025941 Bacteria 3387
579 Ga0207711_10093279 3300025941 Bacteria 2651
580 Ga0207689_10010434 3300025942 Bacteria 7998
581 Ga0207689_10010679 3300025942 Bacteria 7900
582 Ga0207689_10116118 3300025942 Bacteria 2200
583 Ga0207689_10283404 3300025942 Unclassified 1372
584 Ga0207661_10000530 3300025944 Bacteria 24456
585 Ga0207661_10003785 3300025944 Bacteria 10550
586 Ga0207661_10053664 3300025944 Plasmid 3226
587 Ga0207679_10000782 3300025945 Bacteria 20829
588 Ga0207679_10008872 3300025945 Bacteria 6414
589 Ga0207679_10097166 3300025945 Bacteria 2293
590 Ga0207667_10000454 3300025949 Bacteria 54890
591 Ga0207667_10000733 3300025949 Bacteria 42641
592 Ga0207667_10012978 3300025949 Bacteria 9563
593 Ga0207667_10097498 3300025949 Bacteria 3034
594 Ga0207667_10269567 3300025949 Unclassified 1740
595 Ga0207667_10412561 3300025949 Unclassified 1374
596 Ga0207651_10006010 3300025960 Bacteria 6298
597 Ga0207651_10007263 3300025960 Bacteria 5889
598 Ga0207651_10007581 3300025960 Bacteria 5790
599 Ga0207651_10007675 3300025960 Bacteria 5761
600 Ga0207651_10019437 3300025960 Bacteria 4071
601 Ga0207651_10061318 3300025960 Bacteria 2615
602 Ga0207651_10179845 3300025960 Unclassified 1677
603 Ga0207651_10216477 3300025960 Bacteria 1545
604 Ga0207651_10217286 3300025960 Bacteria 1543
605 Ga0207712_10019996 3300025961 Bacteria 4380
606 Ga0207712_10179331 3300025961 Bacteria 1663
607 Ga0207668_10004246 3300025972 Bacteria 8405
608 Ga0207668_10028126 3300025972 Bacteria 3672
609 Ga0207640_10007089 3300025981 Bacteria 6176
610 Ga0207640_10030760 3300025981 Bacteria 3310
611 Ga0207640_10055478 3300025981 Bacteria 2596
612 Ga0207658_10137864 3300025986 Bacteria 1970
613 Ga0207658_10142285 3300025986 Bacteria 1943
614 Ga0207677_10010786 3300026023 Bacteria 5181
615 Ga0207677_10119354 3300026023 Bacteria 1980
616 Ga0207677_10520446 3300026023 Bacteria 1032
617 Ga0207703_10022121 3300026035 Bacteria 4983
618 Ga0207703_10087455 3300026035 Bacteria 2613
619 Ga0207703_10219858 3300026035 Bacteria 1698
620 Ga0207639_10000508 3300026041 Bacteria 26945
621 Ga0207639_10009309 3300026041 Bacteria 6771
622 Ga0207678_10028488 3300026067 Bacteria 4877
623 Ga0207678_10307044 3300026067 Bacteria 1364
624 Ga0207708_10009444 3300026075 Bacteria 7222
625 Ga0207708_10010278 3300026075 Bacteria 6948
626 Ga0207708_10016489 3300026075 Bacteria 5556
627 Ga0207708_10087690 3300026075 Unclassified 2396
628 Ga0207708_10107568 3300026075 Bacteria 2162
629 Ga0207708_10130263 3300026075 Bacteria 1967
630 Ga0207702_10000386 3300026078 Bacteria 50267
631 Ga0207702_10040605 3300026078 Unclassified 3900
632 Ga0207702_10054992 3300026078 Bacteria 3375
633 Ga0207702_10255583 3300026078 Bacteria 1647
634 Ga0207702_10449727 3300026078 Bacteria 1250
635 Ga0207641_10077624 3300026088 Unclassified 2874
636 Ga0207641_10151895 3300026088 Bacteria 2098
637 Ga0207641_10267539 3300026088 Unclassified 1603
638 Ga0207641_10377308 3300026088 Bacteria 1357
639 Ga0207648_10004049 3300026089 Bacteria 15222
640 Ga0207648_10006391 3300026089 Bacteria 11711
641 Ga0207648_10010518 3300026089 Bacteria 8765
642 Ga0207648_10019547 3300026089 Bacteria 6114
643 Ga0207648_10055372 3300026089 Bacteria 3462
644 Ga0207648_10056056 3300026089 Unclassified 3440
645 Ga0207648_10136625 3300026089 Unclassified 2160
646 Ga0207676_10012639 3300026095 Bacteria 6055
647 Ga0207676_10522156 3300026095 Unclassified 1130
648 Ga0207674_10000454 3300026116 Bacteria 53564
649 Ga0207674_10007924 3300026116 Bacteria 12335
650 Ga0207674_10142996 3300026116 Bacteria 2352
651 Ga0207675_100032050 3300026118 Bacteria 4895
652 Ga0207675_100075646 3300026118 Bacteria 3152
653 Ga0207675_100101710 3300026118 Unclassified 2708
654 Ga0207675_100154842 3300026118 Bacteria 2184
655 Ga0207683_10002282 3300026121 Bacteria 16814
656 Ga0207683_10006810 3300026121 Bacteria 9787
657 Ga0207683_10009814 3300026121 Bacteria 8166
658 Ga0207683_10029667 3300026121 Bacteria 4737
659 Ga0207683_10056031 3300026121 Bacteria 3457
660 Ga0207683_10059295 3300026121 Bacteria 3362
661 Ga0207683_10154260 3300026121 Bacteria 2074
662 Ga0207683_10423049 3300026121 Bacteria 1227
663 Ga0207698_10065655 3300026142 Unclassified 2852
664 Ga0207698_10203260 3300026142 Bacteria 1776
665 Ga0207698_10449467 3300026142 Bacteria 1244
666 Ga0209999_1009313 3300027543 Bacteria 1774
667 Ga0209983_1021908 3300027665 Bacteria 1338
668 Ga0209971_1001938 3300027682 Bacteria 5056
669 Ga0209966_1005047 3300027695 Bacteria 2255
670 Ga0209998_10005768 3300027717 Unclassified 2579
671 Ga0209974_10002133 3300027876 Bacteria 7234
672 Ga0209974_10003480 3300027876 Bacteria 5676
673 Ga0209974_10020924 3300027876 Bacteria 2168
674 Ga0207428_10001116 3300027907 Bacteria 29192
675 Ga0207428_10004980 3300027907 Bacteria 12508
676 Ga0207428_10039147 3300027907 Bacteria 3849
677 Ga0207428_10052035 3300027907 Bacteria 3272
678 Ga0207428_10067735 3300027907 Bacteria 2810
679 Ga0207428_10328296 3300027907 Bacteria 1129
680 Ga0268266_10024798 3300028379 Bacteria 5103
681 Ga0268265_10485814 3300028380 Unclassified 1161
682 Ga0268264_10008715 3300028381 Bacteria 8424
683 Ga0268264_10158212 3300028381 Unclassified 2038
684 Ga0268264_10555873 3300028381 Unclassified 1126
685 Ga0265334_10023643 3300028573 Bacteria 2498
686 Ga0265318_10000249 3300028577 Bacteria 46904
687 Ga0265318_10026486 3300028577 Bacteria 2283
688 Ga0265336_10002369 3300028666 Bacteria 7818
689 Ga0307517_10126569 3300028786 Bacteria 1861
690 Ga0265330_10001293 3300031235 Bacteria 14644
691 Ga0265332_10012305 3300031238 Bacteria 3796
692 Ga0265320_10008001 3300031240 Bacteria 6509
693 Ga0265320_10016933 3300031240 Bacteria 4065
694 Ga0265339_10007358 3300031249 Bacteria 7125
695 Ga0265331_10002792 3300031250 Bacteria 11584
696 Ga0265316_10002890 3300031344 Bacteria 17559
697 Ga0307513_10131556 3300031456 Bacteria 2447
698 Ga0307509_10073364 3300031507 Bacteria 3563
699 Ga0265313_10007350 3300031595 Bacteria 7549
700 Ga0265313_10010236 3300031595 Bacteria 5966
701 Ga0265313_10016635 3300031595 Bacteria 4220
702 Ga0265313_10068097 3300031595 Bacteria 1645
703 Ga0307508_10006620 3300031616 Bacteria 10880
704 Ga0265314_10011910 3300031711 Bacteria 7140
705 Ga0265314_10152300 3300031711 Bacteria 1416
706 Ga0265314_10190679 3300031711 Bacteria 1220
707 Ga0265342_10000058 3300031712 Bacteria 118791
708 Ga0265342_10000952 3300031712 Bacteria 28815
709 Ga0265342_10034705 3300031712 Unclassified 3093
710 Ga0265342_10113649 3300031712 Bacteria 1530
711 Ga0316576_10197841 3300031727 Unclassified 1514
712 Ga0316578_10231095 3300031728 Bacteria 1111
713 Ga0307413_10006455 3300031824 Bacteria 5359
714 Ga0307410_10012670 3300031852 Bacteria 4886
715 Ga0307410_10057567 3300031852 Bacteria 2647
716 Ga0307410_10135987 3300031852 Bacteria 1812
717 Ga0307410_10322503 3300031852 Unclassified 1226
718 Ga0307409_100161417 3300031995 Bacteria 1960
719 Ga0307409_100189505 3300031995 Bacteria 1829
720 Ga0307416_100180724 3300032002 Unclassified 1977
721 Ga0307416_100310625 3300032002 Bacteria 1573
722 Ga0307416_100410473 3300032002 Unclassified 1395
723 Ga0307414_10058527 3300032004 Bacteria 2716
724 Ga0307414_10215280 3300032004 Unclassified 1573
725 Ga0307414_10255500 3300032004 Bacteria 1459
726 Ga0307411_10001059 3300032005 Bacteria 10652
727 Ga0307411_10007556 3300032005 Bacteria 5551
728 Ga0307411_10321962 3300032005 Bacteria 1249
729 Ga0307411_10356584 3300032005 Bacteria 1194
730 Ga0307415_100277168 3300032126 Bacteria 1377
731 Ga0373923_0080905 3300035111 Bacteria 1409
732 Ga0373932_0039808 3300035112 Unclassified 1350
733 Ga0373941_0012911 3300035115 Bacteria 2195
734 Ga0373945_0068121 3300035116 Bacteria 1342
735 Ga0373954_0035730 3300035118 Bacteria 2305
736 Ga0373956_0165074 3300035119 Bacteria 1044
737 Ga0373957_0034728 3300035120 Bacteria 1870
738 Ga0373943_0004390 3300035170 Bacteria 6392
739 Ga0373955_0192307 3300035172 Bacteria 1213
740 Ga0373942_0060626 3300035207 Unclassified 1084
741 Ga0316574_0109496 3300035398 Unclassified 1770
742 Ga0373933_0000571 3300035724 Bacteria 23063
743 Ga0373933_0075491 3300035724 Bacteria 2058
744 Ga0373933_0150496 3300035724 Bacteria 1473
745 Ga0373947_0071507 3300035725 Bacteria 2128
746 Ga0373937_0015714 3300036401 Bacteria 6703
747 Ga0373937_0059645 3300036401 Bacteria 3507
748 Ga0373937_0150254 3300036401 Bacteria 2182
749 Ga0316582_0234861 3300036647 Bacteria 1255
750 Ga0316584_0367355 3300036712 Bacteria 1030
751 Ga0373925_0211908 3300037068 Bacteria 1543
752 Ga0395899_0003486 3300037312 Bacteria 12463
753 Ga0395899_0131781 3300037312 Bacteria 1784
754 Ga0395900_0039696 3300037418 Unclassified 4850
755 Ga0395898_0119021 3300037466 Bacteria 2530
756 Ga0395905_0008925 3300037471 Bacteria 9847
757 Ga0395905_0126742 3300037471 Bacteria 2401
758 Ga0436364_1364284 3300037853 Bacteria 2280
759 Ga0395901_0100189 3300038443 Bacteria 3038
760 Ga0395901_0125366 3300038443 Bacteria 2699
761 Ga0436365_0315991 3300039437 Bacteria 4479
762 Ga0436361_1194389 3300039447 Bacteria 4495
763 Ga0436362_0113079 3300039453 Bacteria 3842
764 Ga0451802_1119816 3300041460 Bacteria 2339
765 Ga0451807_0323276 3300041486 Bacteria 8722
766 Ga0451807_1842893 3300041486 Unclassified 1071
767 Ga0451851_1349236 3300041507 Bacteria 1925
768 Ga0439441_038890 3300042001 Unclassified 947
769 Ga0439462_0010088 3300042015 Bacteria 2391
770 Ga0439434_0072154 3300042435 Unclassified 1088
771 Ga0439435_0002028 3300042436 Bacteria 3914
772 Ga0439435_0072291 3300042436 Bacteria 1023
773 Ga0439460_0069379 3300042461 Unclassified 1089
774 Ga0451577_0000014 3300042876 Bacteria 546755
775 Ga0451577_0004796 3300042876 Bacteria 14128
776 Ga0451577_0033189 3300042876 Bacteria 4652
777 Ga0451577_0214941 3300042876 Bacteria 1737
778 Ga0451577_0221732 3300042876 Bacteria 1709
779 Ga0451577_0269203 3300042876 Bacteria 1543
780 Ga0439440_0013426 3300042993 Bacteria 1757
781 Ga0453683_0034950 3300044673 Bacteria 3168
782 Ga0466966_0235692 3300044684 Bacteria 1104
783 Ga0466963_0008133 3300044694 Bacteria 6280
784 Ga0453684_0000571 3300044712 Bacteria 137625
785 Ga0453684_0021379 3300044712 Bacteria 9669
786 Ga0453684_0068727 3300044712 Bacteria 4497
787 Ga0453684_0086022 3300044712 Bacteria 3903
788 Ga0453684_0109542 3300044712 Unclassified 3359
789 Ga0453684_0167107 3300044712 Bacteria 2596
790 Ga0453684_0632872 3300044712 Bacteria 1169
791 Ga0466968_0084984 3300044735 Unclassified 1396
792 Ga0466959_0302063 3300045049 Unclassified 1096
793 Ga0451576_0004634 3300045051 Bacteria 17747
794 Ga0451576_0010676 3300045051 Bacteria 10522
795 Ga0451576_0027607 3300045051 Bacteria 6093
796 Ga0451576_0045309 3300045051 Bacteria 4633
797 Ga0451576_0085432 3300045051 Bacteria 3283
798 Ga0451576_0100679 3300045051 Bacteria 3005
799 Ga0451576_0214068 3300045051 Unclassified 2012
800 Ga0451576_0360891 3300045051 Bacteria 1522
801 Ga0451576_0791200 3300045051 Viruses 996
802 Ga0451576_0869759 3300045051 Bacteria 946
803 Ga0466967_0002498 3300045976 Bacteria 11486
804 Ga0466967_0263358 3300045976 Bacteria 1650
805 Ga0466967_0336842 3300045976 Bacteria 1458
806 Ga0466967_0355419 3300045976 Bacteria 1419
807 Ga0495629_0000013 3300046459 Bacteria 212317
808 Ga0495638_0091498 3300046460 Bacteria 1832
809 Ga0495641_0115740 3300046461 Bacteria 1196
810 Ga0495651_0004108 3300046462 Bacteria 11143
811 Ga0495580_0001294 3300046472 Bacteria 22084
812 Ga0495580_0014860 3300046472 Bacteria 5899
813 Ga0495580_0037990 3300046472 Bacteria 3452
814 Ga0495580_0054275 3300046472 Bacteria 2827
815 Ga0495582_0002525 3300046473 Bacteria 10182
816 Ga0495639_0010666 3300046475 Bacteria 3956
817 Ga0495662_0025870 3300046476 Bacteria 2835
818 Ga0495664_0028187 3300046477 Bacteria 3279
819 Ga0495594_0009877 3300046499 Unclassified 4945
820 Ga0495640_0135137 3300046533 Bacteria 1593
821 Ga0495586_0022185 3300046535 Bacteria 3388
822 Ga0495587_0071760 3300046536 Unclassified 2014
823 Ga0495667_0116708 3300046559 Unclassified 1724
824 Ga0495656_0122938 3300046615 Bacteria 1227
825 Ga0495634_0002195 3300046642 Bacteria 16385
826 Ga0495635_0001297 3300046663 Bacteria 16706
827 Ga0495635_0051124 3300046663 Unclassified 2848
828 Ga0495588_0026363 3300046674 Bacteria 2901
829 Ga0495657_0008498 3300046675 Bacteria 7850
830 Ga0495646_0139043 3300046680 Bacteria 1360
831 Ga0495658_0000018 3300046683 Bacteria 93319
832 Ga0495658_0148559 3300046683 Bacteria 1438
833 Ga0495613_0006193 3300046689 Bacteria 8952
834 Ga0495613_0177286 3300046689 Bacteria 1510
835 Ga0495581_0000031 3300047315 Bacteria 53247
836 Ga0495581_0132604 3300047315 Bacteria 1452
837 Ga0495674_0005609 3300047319 Bacteria 12035
838 Ga0495676_0045929 3300047321 Unclassified 3551
839 Ga0495680_0000427 3300047322 Bacteria 47237
840 Ga0495680_0191373 3300047322 Unclassified 1472
841 Ga0495675_0014622 3300047444 Unclassified 4959
842 Ga0495675_0183902 3300047444 Unclassified 1278
843 Ga0495684_0000439 3300047471 Bacteria 34058
844 Ga0495593_0165024 3300047673 Bacteria 1117
845 Ga0495602_0008476 3300048088 Bacteria 10737
846 Ga0495614_0000561 3300048089 Bacteria 15437
847 Ga0496100_0064629 3300048903 Bacteria 2422
848 Ga0496101_0039221 3300048904 Unclassified 3367
849 Ga0496101_0195110 3300048904 Bacteria 1564
850 Ga0496102_0140971 3300048905 Unclassified 2260
851 Ga0496104_0003039 3300048907 Bacteria 14448
852 Ga0496104_0009068 3300048907 Bacteria 8844
853 Ga0496104_0018588 3300048907 Bacteria 6344
854 Ga0496104_0200747 3300048907 Bacteria 1906
855 Ga0496105_0023290 3300048908 Bacteria 5020
856 Ga0496105_0024825 3300048908 Bacteria 4872
857 Ga0496105_0060082 3300048908 Bacteria 3136
858 Ga0496106_0050352 3300048909 Unclassified 3140
859 Ga0496107_0066938 3300048910 Bacteria 2605
860 Ga0496108_0002286 3300048911 Bacteria 15349
861 Ga0496108_0017200 3300048911 Bacteria 5915
862 Ga0496108_0019818 3300048911 Bacteria 5527
863 Ga0496108_0032535 3300048911 Bacteria 4332
864 Ga0496109_0000608 3300048912 Bacteria 29912
865 Ga0496109_0027391 3300048912 Bacteria 5087
866 Ga0496109_0040390 3300048912 Bacteria 4226
867 Ga0496109_0280053 3300048912 Unclassified 1572
868 Ga0496109_0663527 3300048912 Bacteria 980
869 Ga0496110_0000743 3300048913 Bacteria 22519
870 Ga0496110_0399992 3300048913 Bacteria 1252
871 Ga0496111_0021689 3300048914 Bacteria 4488
872 Ga0496112_0020015 3300048915 Bacteria 6335
873 Ga0496112_0040937 3300048915 Bacteria 4532
874 Ga0496112_0049896 3300048915 Bacteria 4102
875 Ga0496112_0109031 3300048915 Bacteria 2739
876 Ga0496112_0135132 3300048915 Bacteria 2437
877 Ga0496112_0320448 3300048915 Bacteria 1494
878 Ga0496113_0015973 3300048916 Bacteria 5177
879 Ga0496114_0000068 3300048917 Bacteria 75213
880 Ga0496114_0000737 3300048917 Bacteria 24412
881 Ga0496115_0040214 3300048918 Bacteria 3716
882 Ga0496115_0060311 3300048918 Bacteria 3056
883 Ga0496115_0124154 3300048918 Unclassified 2126
884 Ga0496115_0239247 3300048918 Bacteria 1496
885 Ga0496126_0000209 3300048929 Bacteria 131440
886 Ga0501031_0010228 3300049568 Bacteria 6108
887 Ga0501031_0523855 3300049568 Unclassified 764
888 Ga0501033_0078628 3300049570 Unclassified 2420
889 Ga0501034_0198011 3300049571 Unclassified 1968
890 Ga0501036_0091226 3300049572 Unclassified 2574
891 Ga0501036_0097038 3300049572 Bacteria 2492
892 Ga0501036_0159125 3300049572 Bacteria 1904
893 Ga0501037_0062907 3300049573 Unclassified 2706
894 Ga0501038_0157840 3300049574 Unclassified 1846
895 Ga0501038_0235675 3300049574 Bacteria 1455
896 Ga0501040_0144301 3300049576 Bacteria 1677
897 Ga0501040_0164808 3300049576 Bacteria 1568
898 Ga0501040_0392366 3300049576 Unclassified 996
899 Ga0501041_0125941 3300049577 Bacteria 1594
900 Ga0501041_0162914 3300049577 Bacteria 1394
901 Ga0501042_0023266 3300049578 Bacteria 4334
902 Ga0501043_0004220 3300049579 Bacteria 11723
903 Ga0501046_0004262 3300049580 Bacteria 13021
904 Ga0501047_0001022 3300049581 Bacteria 28231
905 Ga0501047_0005274 3300049581 Bacteria 12145
906 Ga0501047_0099511 3300049581 Unclassified 2787
907 Ga0501048_0281941 3300049582 Bacteria 1181
908 Ga0501048_0305644 3300049582 Bacteria 1132
909 Ga0501068_0001246 3300049584 Bacteria 13525
910 Ga0501069_0061544 3300049585 Bacteria 2096
911 Ga0501069_0169256 3300049585 Unclassified 1260
912 Ga0501069_0243472 3300049585 Bacteria 1048
913 Ga0501070_0000007 3300049586 Bacteria 219869
914 Ga0501070_0022228 3300049586 Bacteria 5313
915 Ga0501071_0006704 3300049587 Bacteria 7485
916 Ga0501071_0047897 3300049587 Bacteria 3071
917 Ga0501071_0147008 3300049587 Bacteria 1757
918 Ga0501071_0324291 3300049587 Unclassified 1170
919 Ga0501072_0005036 3300049588 Bacteria 10049
920 Ga0501072_0148186 3300049588 Bacteria 1871
921 Ga0501072_0263642 3300049588 Bacteria 1371
922 Ga0501072_0304919 3300049588 Bacteria 1266
923 Ga0501072_0400897 3300049588 Bacteria 1088
924 Ga0501073_0002900 3300049589 Bacteria 12868
925 Ga0501073_0027220 3300049589 Bacteria 4092
926 Ga0501073_0167474 3300049589 Bacteria 1521
927 Ga0501073_0334631 3300049589 Bacteria 1045
928 Ga0501074_0201097 3300049590 Bacteria 1420
929 Ga0501075_0016996 3300049591 Bacteria 5248
930 Ga0501075_0050546 3300049591 Bacteria 3125
931 Ga0501075_0128424 3300049591 Bacteria 1930
932 Ga0501076_0007740 3300049592 Bacteria 7830
933 Ga0501076_0065438 3300049592 Bacteria 2899
934 Ga0501076_0068626 3300049592 Bacteria 2832
935 Ga0501076_0188302 3300049592 Bacteria 1684
936 Ga0501076_0199409 3300049592 Bacteria 1634
937 Ga0501077_0171382 3300049593 Bacteria 1379
938 Ga0501077_0301461 3300049593 Unclassified 1021
939 Ga0501216_010906 3300049660 Unclassified 1468
940 Ga0501217_003126 3300049661 Unclassified 3320
941 Ga0501227_000547 3300049665 Bacteria 8164
942 Ga0501233_004758 3300049668 Bacteria 2504
943 Ga0501079_0026481 3300049741 Bacteria 4446
944 Ga0501080_0006815 3300049742 Bacteria 10301
945 Ga0501080_0076387 3300049742 Unclassified 3115
946 Ga0501080_0130574 3300049742 Bacteria 2326
947 Ga0501080_0149800 3300049742 Bacteria 2157
948 Ga0501080_0310777 3300049742 Bacteria 1428
949 Ga0501083_0002370 3300049744 Bacteria 12904
950 Ga0501283_010840 3300049779 Bacteria 1347
951 Ga0501035_0131011 3300049822 Bacteria 2186
952 Ga0501035_0266233 3300049822 Unclassified 1451
953 Ga0501035_0326077 3300049822 Bacteria 1289
954 Ga0501035_0515237 3300049822 Bacteria 983
955 Ga0501044_0003302 3300049823 Bacteria 18174
956 Ga0501044_0128358 3300049823 Bacteria 2531
957 Ga0501045_0176708 3300049824 Bacteria 1590
958 Ga0501045_0208588 3300049824 Bacteria 1455
959 Ga0501045_0260170 3300049824 Unclassified 1291
960 Ga0501045_0356977 3300049824 Bacteria 1088
961 nmdc:mga03683_7135_c1 3300050489 Bacteria 3865
962 nmdc:mga00v17_155480_c1 3300050491 Bacteria 1470
963 nmdc:mga00v17_57653_c1 3300050491 Bacteria 2377
964 nmdc:mga0k408_55221_c1 3300050493 Bacteria 2303
965 nmdc:mga06z11_112445_c1 3300050494 Bacteria 1510
966 nmdc:mga05p37_148380_c1 3300050507 Bacteria 2870
967 nmdc:mga05p37_214329_c1 3300050507 Bacteria 2326
968 nmdc:mga05p37_3228_c1 3300050507 Bacteria 18999
969 nmdc:mga05p37_562000_c1 3300050507 Bacteria 1296
970 nmdc:mga05p37_664104_c1 3300050507 Unclassified 1165
971 nmdc:mga05p37_696529_c1 3300050507 Unclassified 1129
972 nmdc:mga05p37_82436_c1 3300050507 Bacteria 3963
973 nmdc:mga05p37_91004_c1 3300050507 Bacteria 3760
974 nmdc:mga09592_11107_c1 3300050508 Bacteria 7325
975 nmdc:mga09592_13933_c1 3300050508 Bacteria 6566
976 nmdc:mga09592_161_c1 3300050508 Bacteria 46835
977 nmdc:mga09592_186268_c1 3300050508 Bacteria 1796
978 nmdc:mga09592_228446_c1 3300050508 Bacteria 1612
979 nmdc:mga09592_253805_c1 3300050508 Unclassified 1524
980 nmdc:mga09592_26507_c1 3300050508 Bacteria 4802
981 nmdc:mga09592_334283_c1 3300050508 Unclassified 1312
982 nmdc:mga09592_5841_c1 3300050508 Bacteria 10035
983 nmdc:mga09592_83899_c1 3300050508 Bacteria 2716
984 nmdc:mga09592_97535_c1 3300050508 Unclassified 1444
985 nmdc:mga0qj67_124819_c1 3300050509 Unclassified 2083
986 nmdc:mga0qj67_231484_c1 3300050509 Bacteria 1499
987 nmdc:mga0qj67_2542_c1 3300050509 Bacteria 13038
988 nmdc:mga0qj67_2968_c1 3300050509 Bacteria 12166
989 nmdc:mga0qj67_306236_c1 3300050509 Bacteria 1287
990 nmdc:mga0qj67_6076_c1 3300050509 Bacteria 6557
991 nmdc:mga0qj67_90573_c1 3300050509 Bacteria 2457
992 nmdc:mga06r32_19503_c1 3300050510 Bacteria 6226
993 nmdc:mga06r32_246957_c1 3300050510 Bacteria 1772
994 nmdc:mga06r32_318_c1 3300050510 Bacteria 40308
995 nmdc:mga06r32_4178_c1 3300050510 Bacteria 12934
996 nmdc:mga06r32_80244_c1 3300050510 Bacteria 3175
997 nmdc:mga08y16_11638_c1 3300050511 Bacteria 9244
998 nmdc:mga08y16_116871_c1 3300050511 Bacteria 2777
999 nmdc:mga08y16_205854_c1 3300050511 Bacteria 2039
1000 nmdc:mga08y16_332116_c1 3300050511 Bacteria 1564
1001 nmdc:mga08y16_38042_c1 3300050511 Bacteria 5052
1002 nmdc:mga08y16_39559_c1 3300050511 Bacteria 4948
1003 nmdc:mga08y16_399083_c1 3300050511 Bacteria 1408
1004 nmdc:mga08y16_46794_c1 3300050511 Bacteria 4529
1005 nmdc:mga08y16_496326_c1 3300050511 Bacteria 1241
1006 nmdc:mga08y16_9259_c1 3300050511 Bacteria 10334
1007 nmdc:mga0n895_110351_c1 3300050512 Bacteria 2767
1008 nmdc:mga0n895_47542_c1 3300050512 Unclassified 4195
1009 nmdc:mga0n895_504928_c1 3300050512 Bacteria 1218
1010 nmdc:mga0rr50_255643_c1 3300050513 Bacteria 1456
1011 nmdc:mga0rr50_9080_c1 3300050513 Bacteria 6224
1012 nmdc:mga0rr50_93451_c1 3300050513 Bacteria 2346
1013 nmdc:mga08x19_5547_c1 3300050514 Bacteria 7461
1014 nmdc:mga0a205_2632_c1 3300050515 Bacteria 15853
1015 nmdc:mga0a205_45613_c1 3300050515 Bacteria 4227
1016 Ga0495619_0002715 3300053085 Bacteria 11563
1017 Ga0495619_0141539 3300053085 Bacteria 1657
1018 Ga0495619_0265807 3300053085 Bacteria 1189
1019 Ga0500646_0009361 3300053090 Bacteria 2509
1020 Ga0500555_040638 3300053103 Bacteria 1296
1021 Ga0501084_0060429 3300054114 Bacteria 3173
1022 Ga0501084_0071013 3300054114 Bacteria 2915
1023 Ga0501084_0362110 3300054114 Bacteria 1225
1024 Ga0501084_0383544 3300054114 Unclassified 1187
1025 Ga0590071_006490 3300059421 Bacteria 2783
1026 Ga0590074_004080 3300059423 Bacteria 2414
1027 Ga0590075_000057 3300059424 Bacteria 28475
1028 Ga0590077_000869 3300059426 Bacteria 7748
1029 Ga0590077_042124 3300059426 Bacteria 1016
1030 Ga0501082_0000052 3300060353 Bacteria 83141
1031 Ga0501082_0042165 3300060353 Bacteria 3934
1032 Ga0501082_0128458 3300060353 Bacteria 2199
1033 Ga0501082_0300246 3300060353 Bacteria 1398
1034 Ga0207662_10046832
1035 MRS1b_contig_6353489
1036 rootH2_10026227
1037 rootL2_10164218
1038 rootL2_10363563
1039 rootH1_10235514
1040 rootH1_10285765
1041 Ga0065712_10082993
1042 Ga0065707_10105478
1043 Ga0065707_10129487
1044 Ga0065707_10186024
1045 Ga0070658_10014537
1046 Ga0070658_10274244
1047 Ga0070676_10041158
1048 Ga0070676_10060806
1049 Ga0070676_10077444
1050 Ga0070676_10235163
1051 Ga0070683_100002980
1052 Ga0070683_100051921
1053 Ga0070683_100130358
1054 Ga0070683_100168200
1055 Ga0070690_100008915
1056 Ga0070690_100051159
1057 Ga0070690_100107497
1058 Ga0070670_100000551
1059 Ga0070670_100024055
1060 Ga0070670_100054747
1061 Ga0070670_100061754
1062 Ga0070670_100076255
1063 Ga0070677_10001876
1064 Ga0070677_10023051
1065 Ga0070677_10059898
1066 Ga0068869_100001326
1067 Ga0068869_100004523
1068 Ga0068869_100012842
1069 Ga0068869_100050168
1070 Ga0070666_10018322
1071 Ga0070666_10112735
1072 Ga0070680_100019142
1073 Ga0070680_100027953
1074 Ga0070680_100079759
1075 Ga0070680_100080984
1076 Ga0070680_100082008
1077 Ga0070680_100205792
1078 Ga0070680_100252826
1079 Ga0070682_100079979
1080 Ga0070682_100258345
1081 Ga0068868_100016527
1082 Ga0068868_100020637
1083 Ga0068868_100072417
1084 Ga0068868_100120907
1085 Ga0068868_100389802
1086 Ga0070689_100000007
1087 Ga0070689_100005960
1088 Ga0070689_100007606
1089 Ga0070689_100014298
1090 Ga0070689_100022551
1091 Ga0070689_100076094
1092 Ga0070689_100113731
1093 Ga0070689_100171269
1094 Ga0070689_100199188
1095 Ga0070691_10013119
1096 Ga0070687_100007099
1097 Ga0070687_100213725
1098 Ga0070661_100038853
1099 Ga0070661_100087148
1100 Ga0070661_100196825
1101 Ga0070692_10012085
1102 Ga0070668_100018067
1103 Ga0070668_100040743
1104 Ga0070668_100162468
1105 Ga0070669_100001207
1106 Ga0070669_100001973
1107 Ga0070669_100002718
1108 Ga0070669_100006126
1109 Ga0070669_100012721
1110 Ga0070669_100095422
1111 Ga0070675_100000890
1112 Ga0070675_100003302
1113 Ga0070675_100003354
1114 Ga0070675_100006236
1115 Ga0070675_100025127
1116 Ga0070675_100057387
1117 Ga0070675_100073761
1118 Ga0070675_100218793
1119 Ga0070671_100019858
1120 Ga0070671_100024511
1121 Ga0070674_100002134
1122 Ga0070674_100002918
1123 Ga0070674_100151587
1124 Ga0070673_100000370
1125 Ga0070673_100003840
1126 Ga0070673_100006729
1127 Ga0070673_100011969
1128 Ga0070673_100027846
1129 Ga0070673_100061519
1130 Ga0070673_100115147
1131 Ga0070673_100154029
1132 Ga0070673_100174746
1133 Ga0070673_100294229
1134 Ga0070673_100298163
1135 Ga0070688_100012782
1136 Ga0070688_100052402
1137 Ga0070688_100184966
1138 Ga0070688_100218236
1139 Ga0070659_100176226
1140 Ga0070659_100266151
1141 Ga0070659_100326464
1142 Ga0070659_100380579
1143 Ga0070667_100017750
1144 Ga0070667_100060350
1145 Ga0070667_100368476
1146 Ga0070667_100468044
1147 Ga0070709_10050050
1148 Ga0070714_100181719
1149 Ga0070713_100026419
1150 Ga0070713_100115800
1151 Ga0070710_10188405
1152 Ga0070701_10009533
1153 Ga0070701_10055123
1154 Ga0070701_10109861
1155 Ga0070700_100000744
1156 Ga0070700_100005721
1157 Ga0070700_100005745
1158 Ga0070700_100009761
1159 Ga0070700_100009763
1160 Ga0070694_100015477
1161 Ga0070694_100113231
1162 Ga0070663_100016596
1163 Ga0070663_100053978
1164 Ga0070678_100000511
1165 Ga0070678_100032605
1166 Ga0070678_100037944
1167 Ga0070678_100134359
1168 Ga0070678_100155158
1169 Ga0070678_100242212
1170 Ga0070662_100072074
1171 Ga0070681_10000309
1172 Ga0070681_10003682
1173 Ga0070681_10010073
1174 Ga0070681_10066157
1175 Ga0070681_10073770
1176 Ga0070681_10115496
1177 Ga0070681_10194209
1178 Ga0070681_10312616
1179 Ga0068867_100005810
1180 Ga0068867_100005825
1181 Ga0068867_100012100
1182 Ga0068867_100018293
1183 Ga0068867_100148801
1184 Ga0068867_100213036
1185 Ga0070685_10019361
1186 Ga0070685_10065230
1187 Ga0070706_100062732
1188 Ga0070706_100074264
1189 Ga0070707_100064275
1190 Ga0070707_100224930
1191 Ga0070698_100020520
1192 Ga0070698_100064477
1193 Ga0070698_100142586
1194 Ga0070699_100099253
1195 Ga0070699_100106293
1196 Ga0070699_100406714
1197 Ga0070679_100001350
1198 Ga0070679_100002948
1199 Ga0070679_100005418
1200 Ga0070679_100010515
1201 Ga0070679_100016724
1202 Ga0070679_100073734
1203 Ga0070679_100135470
1204 Ga0070679_100197549
1205 Ga0070679_100252896
1206 Ga0070679_100338790
1207 Ga0070684_100002830
1208 Ga0070684_100003300
1209 Ga0070684_100052352
1210 Ga0070684_100232303
1211 Ga0070697_100065425
1212 Ga0070697_100331173
1213 Ga0068853_100000300
1214 Ga0068853_100073678
1215 Ga0068853_100160935
1216 Ga0070672_100015454
1217 Ga0070672_100023216
1218 Ga0070672_100043645
1219 Ga0070672_100065199
1220 Ga0070672_100069262
1221 Ga0070672_100111694
1222 Ga0070672_100154339
1223 Ga0070672_100198978
1224 Ga0070686_100000642
1225 Ga0070686_100005637
1226 Ga0070686_100011225
1227 Ga0070686_100019575
1228 Ga0070686_100043680
1229 Ga0070686_100162892
1230 Ga0070695_100079239
1231 Ga0070696_100398818
1232 Ga0070665_100080454
1233 Ga0070665_100380697
1234 Ga0070704_100017654
1235 Ga0070704_100124127
1236 Ga0070704_100208322
1237 Ga0070704_100281037
1238 Ga0068855_100000281
1239 Ga0068855_100002270
1240 Ga0068855_100003646
1241 Ga0068855_100033765
1242 Ga0068855_100041518
1243 Ga0068855_100053654
1244 Ga0068855_100055539
1245 Ga0068855_100151606
1246 Ga0068855_100312790
1247 Ga0070664_100000556
1248 Ga0070664_100005141
1249 Ga0070664_100008742
1250 Ga0070664_100018808
1251 Ga0068857_100003854
1252 Ga0068857_100114611
1253 Ga0068854_100013717
1254 Ga0068854_100084887
1255 Ga0068856_100000402
1256 Ga0068856_100001321
1257 Ga0068856_100036179
1258 Ga0068856_100126327
1259 Ga0068856_100215362
1260 Ga0068852_100035367
1261 Ga0068852_100171123
1262 Ga0068852_100471042
1263 Ga0068859_100000856
1264 Ga0068859_100012549
1265 Ga0068859_100018726
1266 Ga0068859_100019300
1267 Ga0068859_100132432
1268 Ga0068859_100235306
1269 Ga0068859_100619043
1270 Ga0068864_100001103
1271 Ga0068864_100134216
1272 Ga0068864_100240219
1273 Ga0068866_10005957
1274 Ga0068866_10016670
1275 Ga0068861_100023075
1276 Ga0068861_100044916
1277 Ga0068861_100117173
1278 Ga0068861_100175478
1279 Ga0068851_10069760
1280 Ga0068870_10053582
1281 Ga0068863_100012313
1282 Ga0068863_100083549
1283 Ga0068863_100164915
1284 Ga0068863_100395790
1285 Ga0068863_100516564
1286 Ga0068858_100003292
1287 Ga0068858_100019810
1288 Ga0068858_100044424
1289 Ga0068858_100105653
1290 Ga0068858_100204594
1291 Ga0068858_100418925
1292 Ga0068860_100010802
1293 Ga0068860_100058809
1294 Ga0068860_100121725
1295 Ga0068860_100297248
1296 Ga0068862_100002166
1297 Ga0068862_100016110
1298 Ga0068862_100063425
1299 Ga0068862_100121132
1300 Ga0068862_100130796
1301 Ga0081455_10011250
1302 Ga0081455_10123295
1303 Ga0081538_10103929
1304 Ga0081540_1022235
1305 Ga0075365_10048028
1306 Ga0075363_100093458
1307 Ga0075364_10068722
1308 Ga0075364_10153554
1309 Ga0075362_10002309
1310 Ga0075367_10003335
1311 Ga0075367_10033685
1312 Ga0075427_10019963
1313 Ga0075366_10004550
1314 Ga0075366_10041277
1315 Ga0075366_10081794
1316 Ga0097621_100000113
1317 Ga0097621_100123720
1318 Ga0097621_100294847
1319 Ga0068871_100000132
1320 Ga0068871_100090132
1321 Ga0075428_100000319
1322 Ga0075428_100000346
1323 Ga0075428_100028997
1324 Ga0075428_100029578
1325 Ga0075428_100032898
1326 Ga0075428_100124274
1327 Ga0075428_100151928
1328 Ga0075428_100218732
1329 Ga0075430_100001453
1330 Ga0075430_100003185
1331 Ga0075430_100107415
1332 Ga0075430_100123743
1333 Ga0075430_100133457
1334 Ga0075430_100184345
1335 Ga0075430_100205098
1336 Ga0075430_100296658
1337 Ga0075430_100312001
1338 Ga0075431_100000161
1339 Ga0075431_100001791
1340 Ga0075431_100008623
1341 Ga0075431_100065763
1342 Ga0075431_100091196
1343 Ga0075431_100319711
1344 Ga0075433_10001814
1345 Ga0075433_10036715
1346 Ga0075434_100008279
1347 Ga0075434_100090797
1348 Ga0075434_100134714
1349 Ga0075429_100001822
1350 Ga0075429_100002325
1351 Ga0075429_100016697
1352 Ga0075429_100029457
1353 Ga0075429_100059547
1354 Ga0075429_100215850
1355 Ga0068865_100000579
1356 Ga0068865_100005964
1357 Ga0068865_100017297
1358 Ga0068865_100022492
1359 Ga0075436_100015446
1360 Ga0097620_100000856
1361 Ga0097620_100012549
1362 Ga0097620_100018726
1363 Ga0097620_100019300
1364 Ga0097620_100132431
1365 Ga0097620_100235302
1366 Ga0097620_100619033
1367 Ga0099794_10014319
1368 Ga0105240_10000541
1369 Ga0105240_10001087
1370 Ga0105240_10004530
1371 Ga0105240_10012416
1372 Ga0105240_10038183
1373 Ga0105240_10053890
1374 Ga0105240_10297839
1375 Ga0111539_10000393
1376 Ga0111539_10001372
1377 Ga0111539_10010838
1378 Ga0111539_10019777
1379 Ga0111539_10026117
1380 Ga0111539_10097778
1381 Ga0111539_10112150
1382 Ga0111539_10443008
1383 Ga0111539_10927415
1384 Ga0105245_10400703
1385 Ga0105247_10080947
1386 Ga0114129_10004036
1387 Ga0114129_10010683
1388 Ga0114129_10033825
1389 Ga0114129_10174071
1390 Ga0114129_10219599
1391 Ga0114129_10241299
1392 Ga0114129_10253434
1393 Ga0114129_10449309
1394 Ga0114129_10508249
1395 Ga0114129_10791088
1396 Ga0114129_10966353
1397 Ga0105243_10023274
1398 Ga0105243_10339168
1399 Ga0105241_10009684
1400 Ga0105242_10048514
1401 Ga0105248_10014040
1402 Ga0105248_10019197
1403 Ga0105248_10127513
1404 Ga0105248_10144702
1405 Ga0105248_10572315
1406 Ga0105237_10000069
1407 Ga0105237_10029942
1408 Ga0105237_10049101
1409 Ga0105237_10088986
1410 Ga0105237_10204570
1411 Ga0105238_10000471
1412 Ga0105238_10002524
1413 Ga0105238_10021516
1414 Ga0105238_10048789
1415 Ga0105238_10075974
1416 Ga0105238_10417713
1417 Ga0105238_10727659
1418 Ga0105249_10000242
1419 Ga0105249_10000698
1420 Ga0099796_10104281
1421 Ga0105239_10026435
1422 Ga0105239_10040792
1423 Ga0105239_10043362
1424 Ga0105239_10057747
1425 Ga0105239_10103695
1426 Ga0105239_10104531
1427 Ga0105239_10571554
1428 Ga0105239_10694452
1429 Ga0105246_10050712
1430 Ga0157373_10035476
1431 Ga0157371_10034224
1432 Ga0157370_10305102
1433 Ga0157370_10306750
1434 Ga0157369_10032693
1435 Ga0157369_10056937
1436 Ga0157369_10350427
1437 Ga0157374_10000400
1438 Ga0157374_10003194
1439 Ga0157374_10007030
1440 Ga0157374_10030098
1441 Ga0157374_10040945
1442 Ga0157374_10131803
1443 Ga0157378_10000195
1444 Ga0157378_10002056
1445 Ga0157378_10228170
1446 Ga0163162_10127051
1447 Ga0163162_10131779
1448 Ga0157372_10010834
1449 Ga0157372_10012124
1450 Ga0157372_10225468
1451 Ga0157372_10330656
1452 Ga0157372_10407741
1453 Ga0157372_10642025
1454 Ga0157375_10008227
1455 Ga0157375_10092448
1456 Ga0157375_10145358
1457 Ga0163163_10006750
1458 Ga0163163_10016449
1459 Ga0163163_10077529
1460 Ga0163163_10085273
1461 Ga0163163_10110157
1462 Ga0163163_10112503
1463 Ga0163163_10410149
1464 Ga0163163_10469432
1465 Ga0157380_10006495
1466 Ga0157380_10006953
1467 Ga0157380_10009368
1468 Ga0157380_10013500
1469 Ga0157380_10089855
1470 Ga0157380_10136088
1471 Ga0157380_10189502
1472 Ga0157380_10204864
1473 Ga0157380_10596084
1474 Ga0157377_10003190
1475 Ga0157379_10004863
1476 Ga0157376_10040921
1477 Ga0157376_10044377
1478 Ga0157376_10099262
1479 Ga0157376_10469038
1480 Ga0157376_10601042
1481 Ga0163161_10099645
1482 Ga0163161_10470081
1483 Ga0213876_10027399
1484 Ga0207697_10000122
1485 Ga0207697_10015818
1486 Ga0207697_10130646
1487 Ga0207656_10008865
1488 Ga0207682_10004257
1489 Ga0207682_10026430
1490 Ga0207682_10038096
1491 Ga0207682_10044278
1492 Ga0207642_10003249
1493 Ga0207688_10009098
1494 Ga0207680_10250275
1495 Ga0207680_10270344
1496 Ga0207647_10027025
1497 Ga0207647_10091925
1498 Ga0207699_10112740
1499 Ga0207645_10000742
1500 Ga0207645_10019155
1501 Ga0207645_10020677
1502 Ga0207645_10059086
1503 Ga0207643_10000360
1504 Ga0207643_10026346
1505 Ga0207643_10054218
1506 Ga0207643_10304359
1507 Ga0207705_10015210
1508 Ga0207705_10242682
1509 Ga0207684_10032220
1510 Ga0207684_10200728
1511 Ga0207654_10010433
1512 Ga0207654_10034377
1513 Ga0207654_10075599
1514 Ga0207707_10001909
1515 Ga0207707_10060491
1516 Ga0207707_10125120
1517 Ga0207707_10163046
1518 Ga0207707_10217808
1519 Ga0207707_10227886
1520 Ga0207707_10255572
1521 Ga0207695_10002331
1522 Ga0207695_10015878
1523 Ga0207695_10016970
1524 Ga0207695_10047546
1525 Ga0207695_10316949
1526 Ga0207671_10000154
1527 Ga0207671_10049826
1528 Ga0207693_10187315
1529 Ga0207660_10009787
1530 Ga0207660_10052296
1531 Ga0207660_10124434
1532 Ga0207660_10176298
1533 Ga0207662_10000686
1534 Ga0207662_10005520
1535 Ga0207662_10052061
1536 Ga0207657_10256512
1537 Ga0207649_10120662
1538 Ga0207649_10215476
1539 Ga0207652_10001179
1540 Ga0207652_10001341
1541 Ga0207652_10003584
1542 Ga0207652_10008069
1543 Ga0207652_10044927
1544 Ga0207652_10060835
1545 Ga0207652_10086274
1546 Ga0207646_10479628
1547 Ga0207681_10000389
1548 Ga0207681_10001574
1549 Ga0207681_10015805
1550 Ga0207681_10052833
1551 Ga0207681_10270420
1552 Ga0207694_10000408
1553 Ga0207694_10011032
1554 Ga0207694_10029089
1555 Ga0207694_10038632
1556 Ga0207694_10170935
1557 Ga0207694_10430446
1558 Ga0207650_10001365
1559 Ga0207650_10082106
1560 Ga0207659_10003313
1561 Ga0207659_10006924
1562 Ga0207659_10008998
1563 Ga0207659_10010433
1564 Ga0207659_10017242
1565 Ga0207659_10167996
1566 Ga0207659_10257532
1567 Ga0207687_10346836
1568 Ga0207700_10050262
1569 Ga0207664_10183110
1570 Ga0207644_10180867
1571 Ga0207706_10003747
1572 Ga0207706_10013434
1573 Ga0207706_10094781
1574 Ga0207706_10261461
1575 Ga0207706_10343890
1576 Ga0207686_10186777
1577 Ga0207709_10004218
1578 Ga0207709_10048171
1579 Ga0207670_10000016
1580 Ga0207670_10004761
1581 Ga0207670_10005591
1582 Ga0207670_10015057
1583 Ga0207670_10022875
1584 Ga0207670_10110034
1585 Ga0207670_10112068
1586 Ga0207670_10138951
1587 Ga0207669_10001664
1588 Ga0207669_10003981
1589 Ga0207669_10039226
1590 Ga0207669_10067262
1591 Ga0207669_10225666
1592 Ga0207704_10003435
1593 Ga0207704_10018840
1594 Ga0207704_10018944
1595 Ga0207704_10175662
1596 Ga0207691_10002481
1597 Ga0207691_10007176
1598 Ga0207691_10018779
1599 Ga0207691_10035286
1600 Ga0207691_10040822
1601 Ga0207691_10049195
1602 Ga0207691_10071079
1603 Ga0207691_10072862
1604 Ga0207691_10082569
1605 Ga0207691_10093717
1606 Ga0207691_10110286
1607 Ga0207691_10178004
1608 Ga0207691_10322099
1609 Ga0207691_10471929
1610 Ga0207711_10034792
1611 Ga0207711_10056006
1612 Ga0207711_10093279
1613 Ga0207689_10010434
1614 Ga0207689_10010679
1615 Ga0207689_10116118
1616 Ga0207689_10283404
1617 Ga0207661_10000530
1618 Ga0207661_10003785
1619 Ga0207661_10053664
1620 Ga0207679_10000782
1621 Ga0207679_10008872
1622 Ga0207679_10097166
1623 Ga0207667_10000454
1624 Ga0207667_10000733
1625 Ga0207667_10012978
1626 Ga0207667_10097498
1627 Ga0207667_10269567
1628 Ga0207667_10412561
1629 Ga0207651_10006010
1630 Ga0207651_10007263
1631 Ga0207651_10007581
1632 Ga0207651_10007675
1633 Ga0207651_10019437
1634 Ga0207651_10061318
1635 Ga0207651_10179845
1636 Ga0207651_10216477
1637 Ga0207651_10217286
1638 Ga0207712_10019996
1639 Ga0207712_10179331
1640 Ga0207668_10004246
1641 Ga0207668_10028126
1642 Ga0207640_10007089
1643 Ga0207640_10030760
1644 Ga0207640_10055478
1645 Ga0207658_10137864
1646 Ga0207658_10142285
1647 Ga0207677_10010786
1648 Ga0207677_10119354
1649 Ga0207677_10520446
1650 Ga0207703_10022121
1651 Ga0207703_10087455
1652 Ga0207703_10219858
1653 Ga0207639_10000508
1654 Ga0207639_10009309
1655 Ga0207678_10028488
1656 Ga0207678_10307044
1657 Ga0207708_10009444
1658 Ga0207708_10010278
1659 Ga0207708_10016489
1660 Ga0207708_10087690
1661 Ga0207708_10107568
1662 Ga0207708_10130263
1663 Ga0207702_10000386
1664 Ga0207702_10040605
1665 Ga0207702_10054992
1666 Ga0207702_10255583
1667 Ga0207702_10449727
1668 Ga0207641_10077624
1669 Ga0207641_10151895
1670 Ga0207641_10267539
1671 Ga0207641_10377308
1672 Ga0207648_10004049
1673 Ga0207648_10006391
1674 Ga0207648_10010518
1675 Ga0207648_10019547
1676 Ga0207648_10055372
1677 Ga0207648_10056056
1678 Ga0207648_10136625
1679 Ga0207676_10012639
1680 Ga0207676_10522156
1681 Ga0207674_10000454
1682 Ga0207674_10007924
1683 Ga0207674_10142996
1684 Ga0207675_100032050
1685 Ga0207675_100075646
1686 Ga0207675_100101710
1687 Ga0207675_100154842
1688 Ga0207683_10002282
1689 Ga0207683_10006810
1690 Ga0207683_10009814
1691 Ga0207683_10029667
1692 Ga0207683_10056031
1693 Ga0207683_10059295
1694 Ga0207683_10154260
1695 Ga0207683_10423049
1696 Ga0207698_10065655
1697 Ga0207698_10203260
1698 Ga0207698_10449467
1699 Ga0209999_1009313
1700 Ga0209983_1021908
1701 Ga0209971_1001938
1702 Ga0209966_1005047
1703 Ga0209998_10005768
1704 Ga0209974_10002133
1705 Ga0209974_10003480
1706 Ga0209974_10020924
1707 Ga0207428_10001116
1708 Ga0207428_10004980
1709 Ga0207428_10039147
1710 Ga0207428_10052035
1711 Ga0207428_10067735
1712 Ga0207428_10328296
1713 Ga0268266_10024798
1714 Ga0268265_10485814
1715 Ga0268264_10008715
1716 Ga0268264_10158212
1717 Ga0268264_10555873
1718 Ga0265334_10023643
1719 Ga0265318_10000249
1720 Ga0265318_10026486
1721 Ga0265336_10002369
1722 Ga0307517_10126569
1723 Ga0265330_10001293
1724 Ga0265332_10012305
1725 Ga0265320_10008001
1726 Ga0265320_10016933
1727 Ga0265339_10007358
1728 Ga0265331_10002792
1729 Ga0265316_10002890
1730 Ga0307513_10131556
1731 Ga0307509_10073364
1732 Ga0265313_10007350
1733 Ga0265313_10010236
1734 Ga0265313_10016635
1735 Ga0265313_10068097
1736 Ga0307508_10006620
1737 Ga0265314_10011910
1738 Ga0265314_10152300
1739 Ga0265314_10190679
1740 Ga0265342_10000058
1741 Ga0265342_10000952
1742 Ga0265342_10034705
1743 Ga0265342_10113649
1744 Ga0316576_10197841
1745 Ga0316578_10231095
1746 Ga0307413_10006455
1747 Ga0307410_10012670
1748 Ga0307410_10057567
1749 Ga0307410_10135987
1750 Ga0307410_10322503
1751 Ga0307409_100161417
1752 Ga0307409_100189505
1753 Ga0307416_100180724
1754 Ga0307416_100310625
1755 Ga0307416_100410473
1756 Ga0307414_10058527
1757 Ga0307414_10215280
1758 Ga0307414_10255500
1759 Ga0307411_10001059
1760 Ga0307411_10007556
1761 Ga0307411_10321962
1762 Ga0307411_10356584
1763 Ga0307415_100277168
1764 Ga0373923_0080905
1765 Ga0373932_0039808
1766 Ga0373941_0012911
1767 Ga0373945_0068121
1768 Ga0373954_0035730
1769 Ga0373956_0165074
1770 Ga0373957_0034728
1771 Ga0373943_0004390
1772 Ga0373955_0192307
1773 Ga0373942_0060626
1774 Ga0316574_0109496
1775 Ga0373933_0000571
1776 Ga0373933_0075491
1777 Ga0373933_0150496
1778 Ga0373947_0071507
1779 Ga0373937_0015714
1780 Ga0373937_0059645
1781 Ga0373937_0150254
1782 Ga0316582_0234861
1783 Ga0316584_0367355
1784 Ga0373925_0211908
1785 Ga0395899_0003486
1786 Ga0395899_0131781
1787 Ga0395900_0039696
1788 Ga0395898_0119021
1789 Ga0395905_0008925
1790 Ga0395905_0126742
1791 Ga0436364_1364284
1792 Ga0395901_0100189
1793 Ga0395901_0125366
1794 Ga0436365_0315991
1795 Ga0436361_1194389
1796 Ga0436362_0113079
1797 Ga0451802_1119816
1798 Ga0451807_0323276
1799 Ga0451807_1842893
1800 Ga0451851_1349236
1801 Ga0439441_038890
1802 Ga0439462_0010088
1803 Ga0439434_0072154
1804 Ga0439435_0002028
1805 Ga0439435_0072291
1806 Ga0439460_0069379
1807 Ga0451577_0000014
1808 Ga0451577_0004796
1809 Ga0451577_0033189
1810 Ga0451577_0214941
1811 Ga0451577_0221732
1812 Ga0451577_0269203
1813 Ga0439440_0013426
1814 Ga0453683_0034950
1815 Ga0466966_0235692
1816 Ga0466963_0008133
1817 Ga0453684_0000571
1818 Ga0453684_0021379
1819 Ga0453684_0068727
1820 Ga0453684_0086022
1821 Ga0453684_0109542
1822 Ga0453684_0167107
1823 Ga0453684_0632872
1824 Ga0466968_0084984
1825 Ga0466959_0302063
1826 Ga0451576_0004634
1827 Ga0451576_0010676
1828 Ga0451576_0027607
1829 Ga0451576_0045309
1830 Ga0451576_0085432
1831 Ga0451576_0100679
1832 Ga0451576_0214068
1833 Ga0451576_0360891
1834 Ga0451576_0791200
1835 Ga0451576_0869759
1836 Ga0466967_0002498
1837 Ga0466967_0263358
1838 Ga0466967_0336842
1839 Ga0466967_0355419
1840 Ga0495629_0000013
1841 Ga0495638_0091498
1842 Ga0495641_0115740
1843 Ga0495651_0004108
1844 Ga0495580_0001294
1845 Ga0495580_0014860
1846 Ga0495580_0037990
1847 Ga0495580_0054275
1848 Ga0495582_0002525
1849 Ga0495639_0010666
1850 Ga0495662_0025870
1851 Ga0495664_0028187
1852 Ga0495594_0009877
1853 Ga0495640_0135137
1854 Ga0495586_0022185
1855 Ga0495587_0071760
1856 Ga0495667_0116708
1857 Ga0495656_0122938
1858 Ga0495634_0002195
1859 Ga0495635_0001297
1860 Ga0495635_0051124
1861 Ga0495588_0026363
1862 Ga0495657_0008498
1863 Ga0495646_0139043
1864 Ga0495658_0000018
1865 Ga0495658_0148559
1866 Ga0495613_0006193
1867 Ga0495613_0177286
1868 Ga0495581_0000031
1869 Ga0495581_0132604
1870 Ga0495674_0005609
1871 Ga0495676_0045929
1872 Ga0495680_0000427
1873 Ga0495680_0191373
1874 Ga0495675_0014622
1875 Ga0495675_0183902
1876 Ga0495684_0000439
1877 Ga0495593_0165024
1878 Ga0495602_0008476
1879 Ga0495614_0000561
1880 Ga0496100_0064629
1881 Ga0496101_0039221
1882 Ga0496101_0195110
1883 Ga0496102_0140971
1884 Ga0496104_0003039
1885 Ga0496104_0009068
1886 Ga0496104_0018588
1887 Ga0496104_0200747
1888 Ga0496105_0023290
1889 Ga0496105_0024825
1890 Ga0496105_0060082
1891 Ga0496106_0050352
1892 Ga0496107_0066938
1893 Ga0496108_0002286
1894 Ga0496108_0017200
1895 Ga0496108_0019818
1896 Ga0496108_0032535
1897 Ga0496109_0000608
1898 Ga0496109_0027391
1899 Ga0496109_0040390
1900 Ga0496109_0280053
1901 Ga0496109_0663527
1902 Ga0496110_0000743
1903 Ga0496110_0399992
1904 Ga0496111_0021689
1905 Ga0496112_0020015
1906 Ga0496112_0040937
1907 Ga0496112_0049896
1908 Ga0496112_0109031
1909 Ga0496112_0135132
1910 Ga0496112_0320448
1911 Ga0496113_0015973
1912 Ga0496114_0000068
1913 Ga0496114_0000737
1914 Ga0496115_0040214
1915 Ga0496115_0060311
1916 Ga0496115_0124154
1917 Ga0496115_0239247
1918 Ga0496126_0000209
1919 Ga0501031_0010228
1920 Ga0501031_0523855
1921 Ga0501033_0078628
1922 Ga0501034_0198011
1923 Ga0501036_0091226
1924 Ga0501036_0097038
1925 Ga0501036_0159125
1926 Ga0501037_0062907
1927 Ga0501038_0157840
1928 Ga0501038_0235675
1929 Ga0501040_0144301
1930 Ga0501040_0164808
1931 Ga0501040_0392366
1932 Ga0501041_0125941
1933 Ga0501041_0162914
1934 Ga0501042_0023266
1935 Ga0501043_0004220
1936 Ga0501046_0004262
1937 Ga0501047_0001022
1938 Ga0501047_0005274
1939 Ga0501047_0099511
1940 Ga0501048_0281941
1941 Ga0501048_0305644
1942 Ga0501068_0001246
1943 Ga0501069_0061544
1944 Ga0501069_0169256
1945 Ga0501069_0243472
1946 Ga0501070_0000007
1947 Ga0501070_0022228
1948 Ga0501071_0006704
1949 Ga0501071_0047897
1950 Ga0501071_0147008
1951 Ga0501071_0324291
1952 Ga0501072_0005036
1953 Ga0501072_0148186
1954 Ga0501072_0263642
1955 Ga0501072_0304919
1956 Ga0501072_0400897
1957 Ga0501073_0002900
1958 Ga0501073_0027220
1959 Ga0501073_0167474
1960 Ga0501073_0334631
1961 Ga0501074_0201097
1962 Ga0501075_0016996
1963 Ga0501075_0050546
1964 Ga0501075_0128424
1965 Ga0501076_0007740
1966 Ga0501076_0065438
1967 Ga0501076_0068626
1968 Ga0501076_0188302
1969 Ga0501076_0199409
1970 Ga0501077_0171382
1971 Ga0501077_0301461
1972 Ga0501216_010906
1973 Ga0501217_003126
1974 Ga0501227_000547
1975 Ga0501233_004758
1976 Ga0501079_0026481
1977 Ga0501080_0006815
1978 Ga0501080_0076387
1979 Ga0501080_0130574
1980 Ga0501080_0149800
1981 Ga0501080_0310777
1982 Ga0501083_0002370
1983 Ga0501283_010840
1984 Ga0501035_0131011
1985 Ga0501035_0266233
1986 Ga0501035_0326077
1987 Ga0501035_0515237
1988 Ga0501044_0003302
1989 Ga0501044_0128358
1990 Ga0501045_0176708
1991 Ga0501045_0208588
1992 Ga0501045_0260170
1993 Ga0501045_0356977
1994 nmdc:mga03683_7135_c1
1995 nmdc:mga00v17_155480_c1
1996 nmdc:mga00v17_57653_c1
1997 nmdc:mga0k408_55221_c1
1998 nmdc:mga06z11_112445_c1
1999 nmdc:mga05p37_148380_c1
2000 nmdc:mga05p37_214329_c1
2001 nmdc:mga05p37_3228_c1
2002 nmdc:mga05p37_562000_c1
2003 nmdc:mga05p37_664104_c1
2004 nmdc:mga05p37_696529_c1
2005 nmdc:mga05p37_82436_c1
2006 nmdc:mga05p37_91004_c1
2007 nmdc:mga09592_11107_c1
2008 nmdc:mga09592_13933_c1
2009 nmdc:mga09592_161_c1
2010 nmdc:mga09592_186268_c1
2011 nmdc:mga09592_228446_c1
2012 nmdc:mga09592_253805_c1
2013 nmdc:mga09592_26507_c1
2014 nmdc:mga09592_334283_c1
2015 nmdc:mga09592_5841_c1
2016 nmdc:mga09592_83899_c1
2017 nmdc:mga09592_97535_c1
2018 nmdc:mga0qj67_124819_c1
2019 nmdc:mga0qj67_231484_c1
2020 nmdc:mga0qj67_2542_c1
2021 nmdc:mga0qj67_2968_c1
2022 nmdc:mga0qj67_306236_c1
2023 nmdc:mga0qj67_6076_c1
2024 nmdc:mga0qj67_90573_c1
2025 nmdc:mga06r32_19503_c1
2026 nmdc:mga06r32_246957_c1
2027 nmdc:mga06r32_318_c1
2028 nmdc:mga06r32_4178_c1
2029 nmdc:mga06r32_80244_c1
2030 nmdc:mga08y16_11638_c1
2031 nmdc:mga08y16_116871_c1
2032 nmdc:mga08y16_205854_c1
2033 nmdc:mga08y16_332116_c1
2034 nmdc:mga08y16_38042_c1
2035 nmdc:mga08y16_39559_c1
2036 nmdc:mga08y16_399083_c1
2037 nmdc:mga08y16_46794_c1
2038 nmdc:mga08y16_496326_c1
2039 nmdc:mga08y16_9259_c1
2040 nmdc:mga0n895_110351_c1
2041 nmdc:mga0n895_47542_c1
2042 nmdc:mga0n895_504928_c1
2043 nmdc:mga0rr50_255643_c1
2044 nmdc:mga0rr50_9080_c1
2045 nmdc:mga0rr50_93451_c1
2046 nmdc:mga08x19_5547_c1
2047 nmdc:mga0a205_2632_c1
2048 nmdc:mga0a205_45613_c1
2049 Ga0495619_0002715
2050 Ga0495619_0141539
2051 Ga0495619_0265807
2052 Ga0500646_0009361
2053 Ga0500555_040638
2054 Ga0501084_0060429
2055 Ga0501084_0071013
2056 Ga0501084_0362110
2057 Ga0501084_0383544
2058 Ga0590071_006490
2059 Ga0590074_004080
2060 Ga0590075_000057
2061 Ga0590077_000869
2062 Ga0590077_042124
2063 Ga0501082_0000052
2064 Ga0501082_0042165
2065 Ga0501082_0128458
2066 Ga0501082_0300246

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00126

HTH_1

Bacterial regulatory helix-turn-helix protein, lysR family

59

118

0.97

PF03466

LysR_substrate

LysR substrate binding domain

142

351

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
7trv-assembly1.cif.gz_B crystal structure of the dna-binding domain of the lysr family transcriptional regulator yfba from yersinia pestis 0.9434 3 86
4ihs-assembly1.cif.gz_A crystal structure of benm_dbd/catb site 1 dna complex 0.9417 4 87
4ihs-assembly3.cif.gz_C crystal structure of benm_dbd/catb site 1 dna complex 0.9414 4 87
7trv-assembly1.cif.gz_A crystal structure of the dna-binding domain of the lysr family transcriptional regulator yfba from yersinia pestis 0.9329 5 86
4iht-assembly1.cif.gz_A crystal structure of benm_dbd/bena site 1 dna complex 0.9306 4 87
ID Description Score Start End Superfamily
af_P0A9G2_1_86_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9857 1 83 1.10.10.10
af_P0A9F6_3_89_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9784 3 86 1.10.10.10
af_P67662_3_85_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9708 5 86 1.10.10.10
af_Q57083_1_88_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9654 7 84 1.10.10.10
af_P30864_1_87_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.958 1 87 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A7C5R9H1-F1-model_v4 LysR family transcriptional regulator 0.9496 174 298 GO:0003677
GO:0003700
GO:2000142
AF-A0A258CPL3-F1-model_v4 LysR family transcriptional regulator 0.9427 4 85 GO:0003700
GO:0006351
GO:0043565
AF-A0A7C5R9H1-F1-model_v4 LysR family transcriptional regulator 0.9281 174 298 GO:0003677
GO:0003700
GO:2000142
AF-A0A7W8W6C4-F1-model_v4 DNA-binding transcriptional LysR family regulator 0.9256 3 91 GO:0003677
GO:0003700
GO:2000142
AF-A0A2M8V8B9-F1-model_v4 deleted 0.9166 3 87

Map