F487574
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 988 | 409 | 971 | 211 |
Family's Representative Sequence
| Representative Sequence | 3300048909|Ga0496106_0426757|Ga0496106_0426757_219_974 |
| Length | 251 |
| Sequence | VSGGGDWDAAYGKLVLDKTSRSAVELFPLTAYHLRLTVLGMSYAVKEIFYTLQGEGANTGRPAVFCRFAGCNLWTGREEDRLQATCQFCDTDFVGIDGVGGGRFGSAAQLANAIAAAWPIDAETPRFVVCTGGEPLLQLDSALIGALHDEGFEVAVETNGTLEPPPDIDWLCVSPKAGAGLVVRQGDELKLVFPQAGAEPAEFEQLRFSHYFLQPMDGPEREVHTAAALQYCLRHPRWRLSLQTHKLLGIP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 2 | 2515154123 | Trinickia symbiotica JPY347 | Isolate | Nodule |
| 3 | 2718217927 | Rhizobium sp. N324 | Isolate | Nodule |
| 4 | 2721755763 | Pandoraea thiooxydans ATSB16 | Isolate | Rhizosphere |
| 5 | 2842462802 | Rhizobium phaseoli SEMIA 4057 | Isolate | Nodule |
| 6 | 2884693830 | Nonomuraea phyllanthi WYY166 | Isolate | Unclassified |
| 7 | 2891326441 | Actinokineospora pegani TRM65233 | Isolate | Unclassified |
| 8 | 2895442618 | Nonomuraea phyllanthi PA1-10 | Isolate | Unclassified |
| 9 | 2904434214 | Robbsia andropogonis 1567 | Isolate | Rhizosphere |
| 10 | 3006425503 | Streptomyces zingiberis PLAI1-29 | Isolate | Unclassified |
| 11 | 3006486233 | Streptomyces sp. BR123 | Isolate | Rhizosphere |
| 12 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 13 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 14 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 15 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 22 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 24 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 50 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 51 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 57 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 58 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 59 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 60 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 62 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 67 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 68 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 70 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 71 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 72 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 74 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 75 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 76 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 77 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 78 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 79 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 80 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 81 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 82 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 83 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 84 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 85 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 86 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 87 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 88 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 89 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 90 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 92 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 93 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 94 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 95 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 96 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 97 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 98 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 99 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 100 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 102 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 103 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 104 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300012495 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 | Metagenome | Rhizosphere |
| 118 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 129 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300015688 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 | Metagenome | Rhizosphere |
| 133 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 135 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 136 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 137 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 138 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 139 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 140 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300028017 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 | Metagenome | Rhizosphere |
| 200 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 204 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 205 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 206 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 207 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 208 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 209 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 210 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 211 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 212 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 213 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 214 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 215 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 216 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 217 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 218 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 219 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 220 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 221 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 222 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 223 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 224 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 225 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 226 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 227 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 228 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 229 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 230 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 231 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 232 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 233 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 234 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 235 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 236 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 237 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 238 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 239 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 240 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 241 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 242 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 243 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 244 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 245 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 246 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 247 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 248 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 249 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 250 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 251 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 252 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 253 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 254 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 255 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 256 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 257 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 258 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 259 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 260 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 261 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 262 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 263 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 264 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 265 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 266 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 267 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 268 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 269 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 270 | 3300044659 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E | Metagenome | Unclassified |
| 271 | 3300044666 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1E | Metagenome | Unclassified |
| 272 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 273 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 274 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 275 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 276 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 277 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 278 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 279 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 280 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 281 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 282 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 283 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 284 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 285 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 286 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 326 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 327 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 328 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 329 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 330 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 331 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 332 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 333 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 334 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 335 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 336 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 337 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 338 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 339 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 340 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 341 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 342 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 343 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 344 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 345 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 346 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 347 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 348 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 349 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 350 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 351 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 352 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 353 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 354 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 355 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 356 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 357 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 358 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 359 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 360 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 361 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 362 | 3300049689 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought | Metagenome | Rhizosphere |
| 363 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 364 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 365 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 366 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 367 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 368 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 369 | 3300049757 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control | Metagenome | Rhizosphere |
| 370 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 371 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 372 | 3300049767 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought | Metagenome | Rhizosphere |
| 373 | 3300049769 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought | Metagenome | Rhizosphere |
| 374 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 375 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 376 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 377 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 378 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 379 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 380 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 381 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 382 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 383 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 384 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 385 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 386 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 387 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 388 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 391 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 392 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 393 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 394 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 395 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 396 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 397 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 398 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 399 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 400 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 401 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 402 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 403 | 8005275841 | Rhizobium sp. N4311 | Isolate | Nodule |
| 404 | 8008485437 | Streptomyces mimosae 3MP-10 | Isolate | Unclassified |
| 405 | 8025478263 | Streptomyces telluris AA8 | Isolate | Rhizosphere |
| 406 | 8025524527 | Streptomyces sp. 3MP-14 | Isolate | Unclassified |
| 407 | 8033684223 | Streptomyces phytophilus PIP175 | Isolate | Unclassified |
| 408 | 8047893842 | Streptomyces cangkringensis DSM 41769 | Isolate | Rhizosphere |
| 409 | 8056829672 | Streptomyces barringtoniae JA03 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.87 |
| Metatranscriptomes | 0.4 |
| Isolates | 1.72 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.72 |
| Nodule | 0.4 |
| Rhizoplane | 2.02 |
| Rhizosphere | 93.93 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.92 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MBSR1b_contig_11739019 | 2162886012 | Bacteria | 1386 |
| 2 | rootH2_10144468 | 3300003320 | Bacteria | 1065 |
| 3 | Ga0065715_10167639 | 3300005293 | Bacteria | 1558 |
| 4 | Ga0065715_10177927 | 3300005293 | Bacteria | 1497 |
| 5 | Ga0065715_10196336 | 3300005293 | Bacteria | 1385 |
| 6 | Ga0065707_10290892 | 3300005295 | Bacteria | 1025 |
| 7 | Ga0065707_10319758 | 3300005295 | Bacteria | 969 |
| 8 | Ga0070658_10045668 | 3300005327 | Bacteria | 3542 |
| 9 | Ga0070658_10046895 | 3300005327 | Bacteria | 3496 |
| 10 | Ga0070658_10069590 | 3300005327 | Bacteria | 2879 |
| 11 | Ga0070658_10190980 | 3300005327 | Bacteria | 1726 |
| 12 | Ga0070658_11061796 | 3300005327 | Bacteria | 704 |
| 13 | Ga0070676_10036268 | 3300005328 | Bacteria | 2840 |
| 14 | Ga0070676_10206723 | 3300005328 | Bacteria | 1290 |
| 15 | Ga0070676_10237696 | 3300005328 | Bacteria | 1210 |
| 16 | Ga0070683_100000655 | 3300005329 | Bacteria | 25019 |
| 17 | Ga0070683_100006909 | 3300005329 | Bacteria | 9538 |
| 18 | Ga0070683_100079053 | 3300005329 | Bacteria | 3078 |
| 19 | Ga0070683_100369058 | 3300005329 | Bacteria | 1367 |
| 20 | Ga0070683_100413459 | 3300005329 | Bacteria | 1286 |
| 21 | Ga0070683_100604067 | 3300005329 | Bacteria | 1050 |
| 22 | Ga0070690_100337578 | 3300005330 | Bacteria | 1090 |
| 23 | Ga0070670_100002779 | 3300005331 | Bacteria | 14467 |
| 24 | Ga0070670_100216564 | 3300005331 | Bacteria | 1666 |
| 25 | Ga0070670_100339023 | 3300005331 | Bacteria | 1319 |
| 26 | Ga0070666_10498290 | 3300005335 | Bacteria | 883 |
| 27 | Ga0070680_100006802 | 3300005336 | Bacteria | 8711 |
| 28 | Ga0070680_100024698 | 3300005336 | Bacteria | 4804 |
| 29 | Ga0070680_100031242 | 3300005336 | Bacteria | 4281 |
| 30 | Ga0070682_100071427 | 3300005337 | Bacteria | 2222 |
| 31 | Ga0070682_100320308 | 3300005337 | Bacteria | 1145 |
| 32 | Ga0068868_100089736 | 3300005338 | Bacteria | 2474 |
| 33 | Ga0068868_100103379 | 3300005338 | Bacteria | 2308 |
| 34 | Ga0070660_100065655 | 3300005339 | Bacteria | 2824 |
| 35 | Ga0070660_100075721 | 3300005339 | Bacteria | 2635 |
| 36 | Ga0070660_100117534 | 3300005339 | Bacteria | 2121 |
| 37 | Ga0070660_100385862 | 3300005339 | Bacteria | 1157 |
| 38 | Ga0070687_100049785 | 3300005343 | Bacteria | 2161 |
| 39 | Ga0070661_100073631 | 3300005344 | Bacteria | 2515 |
| 40 | Ga0070661_100121211 | 3300005344 | Bacteria | 1959 |
| 41 | Ga0070692_10054394 | 3300005345 | Bacteria | 2090 |
| 42 | Ga0070692_10282046 | 3300005345 | Bacteria | 1007 |
| 43 | Ga0070668_100292271 | 3300005347 | Bacteria | 1364 |
| 44 | Ga0070668_100663585 | 3300005347 | Bacteria | 917 |
| 45 | Ga0070669_100000566 | 3300005353 | Bacteria | 27503 |
| 46 | Ga0070675_100224962 | 3300005354 | Bacteria | 1635 |
| 47 | Ga0070675_100267169 | 3300005354 | Bacteria | 1500 |
| 48 | Ga0070675_100605232 | 3300005354 | Bacteria | 994 |
| 49 | Ga0070675_101225365 | 3300005354 | Bacteria | 691 |
| 50 | Ga0070671_100009865 | 3300005355 | Bacteria | 7665 |
| 51 | Ga0070671_100010716 | 3300005355 | Bacteria | 7360 |
| 52 | Ga0070671_100395295 | 3300005355 | Bacteria | 1182 |
| 53 | Ga0070671_100451730 | 3300005355 | Unclassified | 1103 |
| 54 | Ga0070674_100299205 | 3300005356 | Bacteria | 1282 |
| 55 | Ga0070673_100064069 | 3300005364 | Bacteria | 2927 |
| 56 | Ga0070673_100881302 | 3300005364 | Bacteria | 829 |
| 57 | Ga0070659_100029486 | 3300005366 | Bacteria | 4241 |
| 58 | Ga0070659_100038787 | 3300005366 | Bacteria | 3717 |
| 59 | Ga0070659_100163612 | 3300005366 | Bacteria | 1820 |
| 60 | Ga0070659_100205948 | 3300005366 | Bacteria | 1620 |
| 61 | Ga0070659_100445278 | 3300005366 | Bacteria | 1098 |
| 62 | Ga0070667_100147454 | 3300005367 | Bacteria | 2064 |
| 63 | Ga0070709_10016652 | 3300005434 | Bacteria | 4201 |
| 64 | Ga0070709_10463011 | 3300005434 | Bacteria | 957 |
| 65 | Ga0070714_100006448 | 3300005435 | Bacteria | 9063 |
| 66 | Ga0070714_100032491 | 3300005435 | Bacteria | 4356 |
| 67 | Ga0070714_100095720 | 3300005435 | Bacteria | 2608 |
| 68 | Ga0070714_100188936 | 3300005435 | Bacteria | 1878 |
| 69 | Ga0070714_100242505 | 3300005435 | Bacteria | 1664 |
| 70 | Ga0070713_100013756 | 3300005436 | Bacteria | 5985 |
| 71 | Ga0070713_100017633 | 3300005436 | Bacteria | 5405 |
| 72 | Ga0070713_100565883 | 3300005436 | Bacteria | 1077 |
| 73 | Ga0070713_100687631 | 3300005436 | Bacteria | 976 |
| 74 | Ga0070710_10003320 | 3300005437 | Bacteria | 7633 |
| 75 | Ga0070710_10003572 | 3300005437 | Bacteria | 7374 |
| 76 | Ga0070701_10003257 | 3300005438 | Bacteria | 6392 |
| 77 | Ga0070701_10056268 | 3300005438 | Bacteria | 2057 |
| 78 | Ga0070711_100023585 | 3300005439 | Bacteria | 4004 |
| 79 | Ga0070705_100002041 | 3300005440 | Bacteria | 10319 |
| 80 | Ga0070700_100131955 | 3300005441 | Bacteria | 1687 |
| 81 | Ga0070700_100253087 | 3300005441 | Bacteria | 1264 |
| 82 | Ga0070694_100007030 | 3300005444 | Bacteria | 6847 |
| 83 | Ga0070694_100043995 | 3300005444 | Bacteria | 2987 |
| 84 | Ga0070694_100061005 | 3300005444 | Bacteria | 2573 |
| 85 | Ga0070694_100243159 | 3300005444 | Bacteria | 1358 |
| 86 | Ga0070694_100547592 | 3300005444 | Bacteria | 926 |
| 87 | Ga0070694_100577194 | 3300005444 | Bacteria | 903 |
| 88 | Ga0070708_100000138 | 3300005445 | Bacteria | 49981 |
| 89 | Ga0070708_100000381 | 3300005445 | Bacteria | 33426 |
| 90 | Ga0070708_100012335 | 3300005445 | Bacteria | 6970 |
| 91 | Ga0070708_100080082 | 3300005445 | Bacteria | 2955 |
| 92 | Ga0070663_100006516 | 3300005455 | Bacteria | 7030 |
| 93 | Ga0070678_100070099 | 3300005456 | Bacteria | 2619 |
| 94 | Ga0070678_100533244 | 3300005456 | Bacteria | 1040 |
| 95 | Ga0070662_100057016 | 3300005457 | Bacteria | 2837 |
| 96 | Ga0070662_100089880 | 3300005457 | Bacteria | 2304 |
| 97 | Ga0070681_10003042 | 3300005458 | Bacteria | 15549 |
| 98 | Ga0070681_10008604 | 3300005458 | Bacteria | 10005 |
| 99 | Ga0070681_10125458 | 3300005458 | Bacteria | 2500 |
| 100 | Ga0070681_10169599 | 3300005458 | Bacteria | 2104 |
| 101 | Ga0070681_10419523 | 3300005458 | Bacteria | 1250 |
| 102 | Ga0068867_100032665 | 3300005459 | Bacteria | 3765 |
| 103 | Ga0068867_100100291 | 3300005459 | Bacteria | 2211 |
| 104 | Ga0068867_100230504 | 3300005459 | Bacteria | 1497 |
| 105 | Ga0070685_10002911 | 3300005466 | Bacteria | 8749 |
| 106 | Ga0070706_100008495 | 3300005467 | Bacteria | 9570 |
| 107 | Ga0070706_100036866 | 3300005467 | Bacteria | 4517 |
| 108 | Ga0070706_100074652 | 3300005467 | Bacteria | 3138 |
| 109 | Ga0070706_100127696 | 3300005467 | Bacteria | 2372 |
| 110 | Ga0070706_100191135 | 3300005467 | Bacteria | 1913 |
| 111 | Ga0070706_100758452 | 3300005467 | Bacteria | 899 |
| 112 | Ga0070707_100002489 | 3300005468 | Bacteria | 17550 |
| 113 | Ga0070707_100032687 | 3300005468 | Bacteria | 4957 |
| 114 | Ga0070707_100038820 | 3300005468 | Bacteria | 4549 |
| 115 | Ga0070707_100044161 | 3300005468 | Bacteria | 4266 |
| 116 | Ga0070707_100134698 | 3300005468 | Bacteria | 2403 |
| 117 | Ga0070707_100233126 | 3300005468 | Bacteria | 1792 |
| 118 | Ga0070707_101086147 | 3300005468 | Bacteria | 766 |
| 119 | Ga0070698_100000122 | 3300005471 | Bacteria | 67115 |
| 120 | Ga0070698_100002933 | 3300005471 | Bacteria | 18759 |
| 121 | Ga0070698_100147322 | 3300005471 | Bacteria | 2303 |
| 122 | Ga0070698_100165574 | 3300005471 | Bacteria | 2154 |
| 123 | Ga0070698_100300389 | 3300005471 | Bacteria | 1536 |
| 124 | Ga0070698_100351545 | 3300005471 | Bacteria | 1405 |
| 125 | Ga0070698_100380437 | 3300005471 | Bacteria | 1344 |
| 126 | Ga0070698_100504197 | 3300005471 | Bacteria | 1148 |
| 127 | Ga0070699_100000779 | 3300005518 | Bacteria | 29462 |
| 128 | Ga0070699_100001147 | 3300005518 | Bacteria | 24612 |
| 129 | Ga0070699_100002138 | 3300005518 | Bacteria | 17923 |
| 130 | Ga0070699_100010635 | 3300005518 | Bacteria | 7965 |
| 131 | Ga0070699_100064235 | 3300005518 | Bacteria | 3184 |
| 132 | Ga0070699_100074979 | 3300005518 | Bacteria | 2944 |
| 133 | Ga0070699_100125188 | 3300005518 | Bacteria | 2262 |
| 134 | Ga0070699_100740251 | 3300005518 | Bacteria | 899 |
| 135 | Ga0070679_100013231 | 3300005530 | Bacteria | 7897 |
| 136 | Ga0070679_100026551 | 3300005530 | Bacteria | 5691 |
| 137 | Ga0070679_100060525 | 3300005530 | Bacteria | 3774 |
| 138 | Ga0070679_100069429 | 3300005530 | Bacteria | 3514 |
| 139 | Ga0070679_100127633 | 3300005530 | Bacteria | 2525 |
| 140 | Ga0070679_100259329 | 3300005530 | Bacteria | 1694 |
| 141 | Ga0070679_100605950 | 3300005530 | Bacteria | 1038 |
| 142 | Ga0070679_101220636 | 3300005530 | Bacteria | 697 |
| 143 | Ga0070684_100016107 | 3300005535 | Bacteria | 6107 |
| 144 | Ga0070684_100031010 | 3300005535 | Bacteria | 4548 |
| 145 | Ga0070684_100034276 | 3300005535 | Bacteria | 4340 |
| 146 | Ga0070684_100055337 | 3300005535 | Bacteria | 3458 |
| 147 | Ga0070684_100224294 | 3300005535 | Bacteria | 1715 |
| 148 | Ga0070684_100349077 | 3300005535 | Bacteria | 1361 |
| 149 | Ga0070684_100450704 | 3300005535 | Bacteria | 1189 |
| 150 | Ga0070697_100000272 | 3300005536 | Bacteria | 42107 |
| 151 | Ga0070697_100002379 | 3300005536 | Bacteria | 14478 |
| 152 | Ga0070697_100008526 | 3300005536 | Bacteria | 8002 |
| 153 | Ga0070697_100050347 | 3300005536 | Bacteria | 3380 |
| 154 | Ga0070697_100064880 | 3300005536 | Bacteria | 2983 |
| 155 | Ga0068853_100251114 | 3300005539 | Bacteria | 1623 |
| 156 | Ga0068853_100266207 | 3300005539 | Bacteria | 1577 |
| 157 | Ga0068853_100358428 | 3300005539 | Bacteria | 1358 |
| 158 | Ga0068853_100948110 | 3300005539 | Bacteria | 827 |
| 159 | Ga0070672_100164581 | 3300005543 | Bacteria | 1842 |
| 160 | Ga0070672_100222904 | 3300005543 | Bacteria | 1582 |
| 161 | Ga0070686_100110580 | 3300005544 | Bacteria | 1871 |
| 162 | Ga0070695_100002517 | 3300005545 | Bacteria | 10569 |
| 163 | Ga0070695_100021848 | 3300005545 | Bacteria | 3921 |
| 164 | Ga0070695_100046003 | 3300005545 | Bacteria | 2784 |
| 165 | Ga0070695_100130069 | 3300005545 | Bacteria | 1734 |
| 166 | Ga0070696_100000059 | 3300005546 | Bacteria | 52787 |
| 167 | Ga0070696_100003944 | 3300005546 | Bacteria | 9903 |
| 168 | Ga0070696_100017114 | 3300005546 | Bacteria | 4893 |
| 169 | Ga0070696_100018215 | 3300005546 | Bacteria | 4744 |
| 170 | Ga0070696_100346782 | 3300005546 | Bacteria | 1149 |
| 171 | Ga0070696_100409163 | 3300005546 | Bacteria | 1063 |
| 172 | Ga0070693_100018308 | 3300005547 | Bacteria | 3656 |
| 173 | Ga0070693_100270123 | 3300005547 | Bacteria | 1135 |
| 174 | Ga0070665_100082484 | 3300005548 | Bacteria | 3221 |
| 175 | Ga0070665_100120769 | 3300005548 | Bacteria | 2622 |
| 176 | Ga0070665_100498637 | 3300005548 | Bacteria | 1229 |
| 177 | Ga0070704_100471533 | 3300005549 | Bacteria | 1085 |
| 178 | Ga0068855_100002369 | 3300005563 | Bacteria | 23238 |
| 179 | Ga0068855_100030887 | 3300005563 | Bacteria | 6403 |
| 180 | Ga0068855_100047437 | 3300005563 | Bacteria | 5075 |
| 181 | Ga0068855_100373390 | 3300005563 | Bacteria | 1567 |
| 182 | Ga0068855_100604565 | 3300005563 | Bacteria | 1182 |
| 183 | Ga0070664_100013004 | 3300005564 | Bacteria | 6773 |
| 184 | Ga0070664_100289697 | 3300005564 | Bacteria | 1478 |
| 185 | Ga0070664_100300535 | 3300005564 | Bacteria | 1450 |
| 186 | Ga0070664_100587608 | 3300005564 | Bacteria | 1032 |
| 187 | Ga0068857_100009041 | 3300005577 | Bacteria | 8642 |
| 188 | Ga0068857_100010828 | 3300005577 | Bacteria | 7940 |
| 189 | Ga0068857_100014675 | 3300005577 | Bacteria | 6834 |
| 190 | Ga0068854_100049592 | 3300005578 | Bacteria | 2999 |
| 191 | Ga0068854_100224209 | 3300005578 | Bacteria | 1489 |
| 192 | Ga0068856_100007921 | 3300005614 | Bacteria | 10377 |
| 193 | Ga0068856_100111496 | 3300005614 | Bacteria | 2733 |
| 194 | Ga0068856_100192461 | 3300005614 | Bacteria | 2053 |
| 195 | Ga0068856_100195593 | 3300005614 | Bacteria | 2036 |
| 196 | Ga0068856_100243791 | 3300005614 | Bacteria | 1812 |
| 197 | Ga0068856_100364064 | 3300005614 | Bacteria | 1464 |
| 198 | Ga0068856_100579993 | 3300005614 | Bacteria | 1143 |
| 199 | Ga0070702_100151051 | 3300005615 | Bacteria | 1491 |
| 200 | Ga0068852_100020060 | 3300005616 | Bacteria | 5308 |
| 201 | Ga0068852_100128548 | 3300005616 | Bacteria | 2330 |
| 202 | Ga0068852_100161080 | 3300005616 | Bacteria | 2095 |
| 203 | Ga0068852_100189299 | 3300005616 | Bacteria | 1940 |
| 204 | Ga0068852_100335586 | 3300005616 | Bacteria | 1472 |
| 205 | Ga0068852_100464638 | 3300005616 | Bacteria | 1255 |
| 206 | Ga0068859_100123633 | 3300005617 | Bacteria | 2655 |
| 207 | Ga0068859_100182134 | 3300005617 | Bacteria | 2184 |
| 208 | Ga0068859_100186844 | 3300005617 | Unclassified | 2156 |
| 209 | Ga0068859_100228879 | 3300005617 | Bacteria | 1947 |
| 210 | Ga0068859_100511465 | 3300005617 | Bacteria | 1296 |
| 211 | Ga0068859_100620865 | 3300005617 | Bacteria | 1174 |
| 212 | Ga0068864_100032802 | 3300005618 | Bacteria | 4414 |
| 213 | Ga0068864_100216853 | 3300005618 | Bacteria | 1764 |
| 214 | Ga0068866_10090041 | 3300005718 | Bacteria | 1669 |
| 215 | Ga0068861_100231039 | 3300005719 | Bacteria | 1569 |
| 216 | Ga0068870_10018009 | 3300005840 | Bacteria | 3403 |
| 217 | Ga0068863_100099236 | 3300005841 | Bacteria | 2767 |
| 218 | Ga0068863_100138558 | 3300005841 | Bacteria | 2325 |
| 219 | Ga0068858_100020693 | 3300005842 | Bacteria | 6145 |
| 220 | Ga0068858_100227595 | 3300005842 | Bacteria | 1767 |
| 221 | Ga0068858_100318188 | 3300005842 | Bacteria | 1487 |
| 222 | Ga0068860_100011796 | 3300005843 | Bacteria | 8612 |
| 223 | Ga0068860_100481535 | 3300005843 | Bacteria | 1237 |
| 224 | Ga0068860_100814766 | 3300005843 | Bacteria | 947 |
| 225 | Ga0068860_100915722 | 3300005843 | Bacteria | 893 |
| 226 | Ga0068862_100007064 | 3300005844 | Bacteria | 9325 |
| 227 | Ga0068862_100640600 | 3300005844 | Bacteria | 1024 |
| 228 | Ga0068862_100856178 | 3300005844 | Bacteria | 891 |
| 229 | Ga0068862_100928672 | 3300005844 | Bacteria | 857 |
| 230 | Ga0068862_101013634 | 3300005844 | Bacteria | 822 |
| 231 | Ga0081455_10000733 | 3300005937 | Bacteria | 42613 |
| 232 | Ga0081455_10147178 | 3300005937 | Bacteria | 1820 |
| 233 | Ga0081538_10006932 | 3300005981 | Bacteria | 9857 |
| 234 | Ga0081538_10013401 | 3300005981 | Bacteria | 6494 |
| 235 | Ga0081538_10019713 | 3300005981 | Bacteria | 4995 |
| 236 | Ga0081539_10000087 | 3300005985 | Bacteria | 214031 |
| 237 | Ga0070716_100002710 | 3300006173 | Bacteria | 8207 |
| 238 | Ga0070712_100058906 | 3300006175 | Bacteria | 2703 |
| 239 | Ga0070712_100273466 | 3300006175 | Bacteria | 1358 |
| 240 | Ga0075367_10086696 | 3300006178 | Bacteria | 1901 |
| 241 | Ga0075366_10051119 | 3300006195 | Bacteria | 2455 |
| 242 | Ga0075366_10168125 | 3300006195 | Bacteria | 1330 |
| 243 | Ga0097621_100004481 | 3300006237 | Bacteria | 9736 |
| 244 | Ga0097621_100077827 | 3300006237 | Bacteria | 2754 |
| 245 | Ga0097621_100095490 | 3300006237 | Bacteria | 2494 |
| 246 | Ga0097621_100369902 | 3300006237 | Bacteria | 1278 |
| 247 | Ga0075370_10015474 | 3300006353 | Bacteria | 4085 |
| 248 | Ga0068871_100004639 | 3300006358 | Bacteria | 9600 |
| 249 | Ga0068871_100032288 | 3300006358 | Bacteria | 4135 |
| 250 | Ga0068871_100049384 | 3300006358 | Bacteria | 3400 |
| 251 | Ga0068871_100063462 | 3300006358 | Bacteria | 3021 |
| 252 | Ga0075430_100042803 | 3300006846 | Bacteria | 3829 |
| 253 | Ga0075430_100060159 | 3300006846 | Bacteria | 3193 |
| 254 | Ga0075430_100283840 | 3300006846 | Bacteria | 1370 |
| 255 | Ga0075431_100047077 | 3300006847 | Bacteria | 4446 |
| 256 | Ga0075431_100067520 | 3300006847 | Bacteria | 3691 |
| 257 | Ga0075431_100106084 | 3300006847 | Bacteria | 2899 |
| 258 | Ga0075431_100189656 | 3300006847 | Bacteria | 2107 |
| 259 | Ga0075431_100197940 | 3300006847 | Bacteria | 2057 |
| 260 | Ga0075431_101006526 | 3300006847 | Bacteria | 800 |
| 261 | Ga0075433_10438048 | 3300006852 | Bacteria | 1152 |
| 262 | Ga0075434_100004223 | 3300006871 | Bacteria | 12876 |
| 263 | Ga0075434_100038828 | 3300006871 | Bacteria | 4718 |
| 264 | Ga0075434_100054837 | 3300006871 | Bacteria | 3960 |
| 265 | Ga0075434_100383321 | 3300006871 | Bacteria | 1427 |
| 266 | Ga0075434_100427666 | 3300006871 | Bacteria | 1345 |
| 267 | Ga0075434_100770395 | 3300006871 | Bacteria | 979 |
| 268 | Ga0075429_100719775 | 3300006880 | Bacteria | 874 |
| 269 | Ga0068865_100001396 | 3300006881 | Bacteria | 14036 |
| 270 | Ga0068865_100071903 | 3300006881 | Bacteria | 2455 |
| 271 | Ga0068865_100194759 | 3300006881 | Bacteria | 1570 |
| 272 | Ga0075436_100008037 | 3300006914 | Bacteria | 7222 |
| 273 | Ga0075436_100016660 | 3300006914 | Bacteria | 5031 |
| 274 | Ga0075436_100030317 | 3300006914 | Bacteria | 3723 |
| 275 | Ga0075436_100048619 | 3300006914 | Bacteria | 2927 |
| 276 | Ga0075436_100185848 | 3300006914 | Bacteria | 1470 |
| 277 | Ga0075436_100341323 | 3300006914 | Bacteria | 1078 |
| 278 | Ga0097620_100123624 | 3300006931 | Bacteria | 2655 |
| 279 | Ga0097620_100182145 | 3300006931 | Bacteria | 2184 |
| 280 | Ga0097620_100186859 | 3300006931 | Unclassified | 2156 |
| 281 | Ga0097620_100228882 | 3300006931 | Bacteria | 1947 |
| 282 | Ga0097620_100511434 | 3300006931 | Bacteria | 1296 |
| 283 | Ga0097620_100620873 | 3300006931 | Bacteria | 1174 |
| 284 | Ga0075435_100051075 | 3300007076 | Bacteria | 3329 |
| 285 | Ga0075435_100089319 | 3300007076 | Bacteria | 2541 |
| 286 | Ga0099794_10119513 | 3300007265 | Bacteria | 1325 |
| 287 | Ga0099795_10018957 | 3300007788 | Bacteria | 2220 |
| 288 | Ga0105240_10002142 | 3300009093 | Bacteria | 32242 |
| 289 | Ga0105240_10003537 | 3300009093 | Bacteria | 24233 |
| 290 | Ga0105240_10004066 | 3300009093 | Bacteria | 22506 |
| 291 | Ga0105240_10016265 | 3300009093 | Bacteria | 10078 |
| 292 | Ga0105240_10091573 | 3300009093 | Bacteria | 3714 |
| 293 | Ga0105240_10179009 | 3300009093 | Bacteria | 2504 |
| 294 | Ga0105240_11096136 | 3300009093 | Bacteria | 847 |
| 295 | Ga0105240_11129592 | 3300009093 | Bacteria | 833 |
| 296 | Ga0105240_11310902 | 3300009093 | Bacteria | 763 |
| 297 | Ga0111539_10117554 | 3300009094 | Bacteria | 3116 |
| 298 | Ga0105245_10075361 | 3300009098 | Bacteria | 3072 |
| 299 | Ga0105245_10128517 | 3300009098 | Bacteria | 2374 |
| 300 | Ga0105245_10230510 | 3300009098 | Bacteria | 1791 |
| 301 | Ga0105245_10724424 | 3300009098 | Bacteria | 1029 |
| 302 | Ga0114129_10000260 | 3300009147 | Bacteria | 59525 |
| 303 | Ga0114129_10156707 | 3300009147 | Bacteria | 3113 |
| 304 | Ga0105243_10791779 | 3300009148 | Bacteria | 933 |
| 305 | Ga0105241_10019962 | 3300009174 | Bacteria | 4947 |
| 306 | Ga0105241_10221046 | 3300009174 | Bacteria | 1592 |
| 307 | Ga0105241_10431043 | 3300009174 | Bacteria | 1162 |
| 308 | Ga0105241_10495752 | 3300009174 | Bacteria | 1088 |
| 309 | Ga0105241_11155599 | 3300009174 | Bacteria | 731 |
| 310 | Ga0105242_10000494 | 3300009176 | Bacteria | 31086 |
| 311 | Ga0105242_10002807 | 3300009176 | Bacteria | 13645 |
| 312 | Ga0105242_10116716 | 3300009176 | Unclassified | 2284 |
| 313 | Ga0105242_10326789 | 3300009176 | Bacteria | 1409 |
| 314 | Ga0105242_10560451 | 3300009176 | Bacteria | 1097 |
| 315 | Ga0105248_10000006 | 3300009177 | Bacteria | 595060 |
| 316 | Ga0105248_10045933 | 3300009177 | Bacteria | 4897 |
| 317 | Ga0105248_10050185 | 3300009177 | Bacteria | 4679 |
| 318 | Ga0105248_10110766 | 3300009177 | Bacteria | 3096 |
| 319 | Ga0105248_10151528 | 3300009177 | Bacteria | 2616 |
| 320 | Ga0105248_10157021 | 3300009177 | Bacteria | 2567 |
| 321 | Ga0105248_10265137 | 3300009177 | Bacteria | 1934 |
| 322 | Ga0105248_10360453 | 3300009177 | Bacteria | 1637 |
| 323 | Ga0105248_10405388 | 3300009177 | Bacteria | 1535 |
| 324 | Ga0105248_10500149 | 3300009177 | Bacteria | 1370 |
| 325 | Ga0105248_10884624 | 3300009177 | Bacteria | 1008 |
| 326 | Ga0105237_10314435 | 3300009545 | Bacteria | 1569 |
| 327 | Ga0105238_10023340 | 3300009551 | Bacteria | 6306 |
| 328 | Ga0105238_10040071 | 3300009551 | Bacteria | 4748 |
| 329 | Ga0105238_10110244 | 3300009551 | Bacteria | 2733 |
| 330 | Ga0105238_10136838 | 3300009551 | Bacteria | 2427 |
| 331 | Ga0105238_10408914 | 3300009551 | Bacteria | 1351 |
| 332 | Ga0105249_10000582 | 3300009553 | Bacteria | 33411 |
| 333 | Ga0105249_10110848 | 3300009553 | Bacteria | 2594 |
| 334 | Ga0105249_10320446 | 3300009553 | Bacteria | 1561 |
| 335 | Ga0105249_10688532 | 3300009553 | Bacteria | 1082 |
| 336 | Ga0105249_10707473 | 3300009553 | Bacteria | 1068 |
| 337 | Ga0105239_10029595 | 3300010375 | Bacteria | 6022 |
| 338 | Ga0105239_10065246 | 3300010375 | Bacteria | 3998 |
| 339 | Ga0105239_10247823 | 3300010375 | Bacteria | 2000 |
| 340 | Ga0105246_10239800 | 3300011119 | Unclassified | 1433 |
| 341 | Ga0105246_10276024 | 3300011119 | Bacteria | 1346 |
| 342 | Ga0105246_10517081 | 3300011119 | Bacteria | 1017 |
| 343 | Ga0157323_1003327 | 3300012495 | Bacteria | 962 |
| 344 | Ga0157371_10042745 | 3300013102 | Bacteria | 3230 |
| 345 | Ga0157370_10089962 | 3300013104 | Bacteria | 2883 |
| 346 | Ga0157370_10230707 | 3300013104 | Bacteria | 1713 |
| 347 | Ga0157370_10708518 | 3300013104 | Bacteria | 919 |
| 348 | Ga0157369_10001363 | 3300013105 | Bacteria | 30141 |
| 349 | Ga0157369_10003286 | 3300013105 | Bacteria | 19260 |
| 350 | Ga0157369_10058133 | 3300013105 | Bacteria | 4172 |
| 351 | Ga0157369_10122350 | 3300013105 | Bacteria | 2760 |
| 352 | Ga0157369_10147357 | 3300013105 | Bacteria | 2488 |
| 353 | Ga0157369_10198817 | 3300013105 | Bacteria | 2104 |
| 354 | Ga0157369_10228799 | 3300013105 | Bacteria | 1944 |
| 355 | Ga0157369_10250883 | 3300013105 | Bacteria | 1847 |
| 356 | Ga0157369_10381642 | 3300013105 | Bacteria | 1463 |
| 357 | Ga0157369_10424739 | 3300013105 | Bacteria | 1378 |
| 358 | Ga0157374_10000158 | 3300013296 | Bacteria | 62352 |
| 359 | Ga0157374_10013300 | 3300013296 | Bacteria | 7181 |
| 360 | Ga0157374_10133732 | 3300013296 | Bacteria | 2402 |
| 361 | Ga0157374_10243823 | 3300013296 | Bacteria | 1767 |
| 362 | Ga0157374_10280137 | 3300013296 | Bacteria | 1646 |
| 363 | Ga0157374_10460804 | 3300013296 | Bacteria | 1273 |
| 364 | Ga0157378_10025984 | 3300013297 | Bacteria | 5160 |
| 365 | Ga0163162_10036600 | 3300013306 | Bacteria | 4893 |
| 366 | Ga0163162_10087536 | 3300013306 | Bacteria | 3193 |
| 367 | Ga0163162_10285468 | 3300013306 | Bacteria | 1782 |
| 368 | Ga0163162_10374191 | 3300013306 | Bacteria | 1558 |
| 369 | Ga0157372_10000968 | 3300013307 | Bacteria | 31318 |
| 370 | Ga0157372_10012193 | 3300013307 | Bacteria | 9155 |
| 371 | Ga0157372_10024833 | 3300013307 | Bacteria | 6513 |
| 372 | Ga0157372_10024910 | 3300013307 | Bacteria | 6503 |
| 373 | Ga0157372_10034058 | 3300013307 | Bacteria | 5597 |
| 374 | Ga0157372_10056941 | 3300013307 | Bacteria | 4369 |
| 375 | Ga0157372_10188970 | 3300013307 | Bacteria | 2385 |
| 376 | Ga0157372_10457521 | 3300013307 | Bacteria | 1487 |
| 377 | Ga0157372_10552813 | 3300013307 | Bacteria | 1342 |
| 378 | Ga0157372_10565726 | 3300013307 | Bacteria | 1325 |
| 379 | Ga0157372_10685876 | 3300013307 | Bacteria | 1192 |
| 380 | Ga0157372_10752511 | 3300013307 | Bacteria | 1133 |
| 381 | Ga0157372_10835362 | 3300013307 | Bacteria | 1070 |
| 382 | Ga0157375_10014989 | 3300013308 | Bacteria | 6932 |
| 383 | Ga0157375_10017676 | 3300013308 | Bacteria | 6443 |
| 384 | Ga0157375_10161016 | 3300013308 | Bacteria | 2386 |
| 385 | Ga0157375_10416950 | 3300013308 | Bacteria | 1509 |
| 386 | Ga0163163_10913605 | 3300014325 | Bacteria | 941 |
| 387 | Ga0157380_10005964 | 3300014326 | Bacteria | 8524 |
| 388 | Ga0157380_10169393 | 3300014326 | Bacteria | 1906 |
| 389 | Ga0182008_10021026 | 3300014497 | Bacteria | 3355 |
| 390 | Ga0157377_10134404 | 3300014745 | Bacteria | 1514 |
| 391 | Ga0157379_10051452 | 3300014968 | Bacteria | 3679 |
| 392 | Ga0157379_10618953 | 3300014968 | Bacteria | 1012 |
| 393 | Ga0157376_10000504 | 3300014969 | Bacteria | 25284 |
| 394 | Ga0157376_10168130 | 3300014969 | Unclassified | 1994 |
| 395 | Ga0157376_10192030 | 3300014969 | Bacteria | 1873 |
| 396 | Ga0157376_10244356 | 3300014969 | Bacteria | 1673 |
| 397 | Ga0157376_11439227 | 3300014969 | Bacteria | 721 |
| 398 | Ga0183367_1001 | 3300015688 | Bacteria | 1225545 |
| 399 | Ga0163161_10245198 | 3300017792 | Bacteria | 1395 |
| 400 | Ga0197907_11166738 | 3300020069 | Bacteria | 1195 |
| 401 | Ga0206356_10711775 | 3300020070 | Bacteria | 2030 |
| 402 | Ga0206354_10069137 | 3300020081 | Bacteria | 1010 |
| 403 | Ga0213876_10184708 | 3300021384 | Bacteria | 1109 |
| 404 | Ga0213871_10023561 | 3300021441 | Bacteria | 1551 |
| 405 | Ga0224712_10001684 | 3300022467 | Bacteria | 5229 |
| 406 | Ga0207697_10071700 | 3300025315 | Bacteria | 1452 |
| 407 | Ga0207682_10004059 | 3300025893 | Bacteria | 6219 |
| 408 | Ga0207692_10016610 | 3300025898 | Bacteria | 3265 |
| 409 | Ga0207642_10063368 | 3300025899 | Bacteria | 1729 |
| 410 | Ga0207680_10239419 | 3300025903 | Bacteria | 1250 |
| 411 | Ga0207699_10020457 | 3300025906 | Bacteria | 3548 |
| 412 | Ga0207645_10016610 | 3300025907 | Bacteria | 4870 |
| 413 | Ga0207645_10037069 | 3300025907 | Bacteria | 3130 |
| 414 | Ga0207645_10260144 | 3300025907 | Bacteria | 1149 |
| 415 | Ga0207643_10005910 | 3300025908 | Bacteria | 6536 |
| 416 | Ga0207705_10017431 | 3300025909 | Bacteria | 5142 |
| 417 | Ga0207705_10153349 | 3300025909 | Bacteria | 1727 |
| 418 | Ga0207705_10337048 | 3300025909 | Bacteria | 1160 |
| 419 | Ga0207705_10693964 | 3300025909 | Bacteria | 791 |
| 420 | Ga0207684_10021616 | 3300025910 | Bacteria | 5493 |
| 421 | Ga0207684_10055225 | 3300025910 | Bacteria | 3369 |
| 422 | Ga0207684_10219347 | 3300025910 | Bacteria | 1641 |
| 423 | Ga0207684_10257645 | 3300025910 | Bacteria | 1505 |
| 424 | Ga0207654_10237808 | 3300025911 | Bacteria | 1216 |
| 425 | Ga0207707_10001557 | 3300025912 | Bacteria | 21117 |
| 426 | Ga0207707_10002130 | 3300025912 | Bacteria | 17924 |
| 427 | Ga0207707_10010399 | 3300025912 | Bacteria | 8074 |
| 428 | Ga0207707_10067287 | 3300025912 | Bacteria | 3120 |
| 429 | Ga0207707_10834887 | 3300025912 | Bacteria | 765 |
| 430 | Ga0207695_10001162 | 3300025913 | Bacteria | 45655 |
| 431 | Ga0207695_10003501 | 3300025913 | Bacteria | 22022 |
| 432 | Ga0207695_10061983 | 3300025913 | Bacteria | 3863 |
| 433 | Ga0207695_10227897 | 3300025913 | Bacteria | 1769 |
| 434 | Ga0207695_10249293 | 3300025913 | Bacteria | 1675 |
| 435 | Ga0207693_10261133 | 3300025915 | Bacteria | 1358 |
| 436 | Ga0207663_10026240 | 3300025916 | Bacteria | 3379 |
| 437 | Ga0207660_10011149 | 3300025917 | Bacteria | 5844 |
| 438 | Ga0207660_10030762 | 3300025917 | Bacteria | 3691 |
| 439 | Ga0207660_10179379 | 3300025917 | Bacteria | 1644 |
| 440 | Ga0207660_10188301 | 3300025917 | Bacteria | 1606 |
| 441 | Ga0207660_10522818 | 3300025917 | Bacteria | 964 |
| 442 | Ga0207660_10615744 | 3300025917 | Bacteria | 885 |
| 443 | Ga0207657_10028851 | 3300025919 | Bacteria | 5056 |
| 444 | Ga0207657_10060219 | 3300025919 | Bacteria | 3259 |
| 445 | Ga0207657_10126537 | 3300025919 | Bacteria | 2098 |
| 446 | Ga0207657_10496794 | 3300025919 | Bacteria | 956 |
| 447 | Ga0207649_10092720 | 3300025920 | Bacteria | 1981 |
| 448 | Ga0207652_10104650 | 3300025921 | Bacteria | 2504 |
| 449 | Ga0207652_10183376 | 3300025921 | Bacteria | 1882 |
| 450 | Ga0207652_10197228 | 3300025921 | Bacteria | 1811 |
| 451 | Ga0207652_10218224 | 3300025921 | Bacteria | 1718 |
| 452 | Ga0207652_10364194 | 3300025921 | Bacteria | 1305 |
| 453 | Ga0207652_10953022 | 3300025921 | Bacteria | 756 |
| 454 | Ga0207646_10012507 | 3300025922 | Bacteria | 8151 |
| 455 | Ga0207646_10032401 | 3300025922 | Bacteria | 4730 |
| 456 | Ga0207646_10097667 | 3300025922 | Bacteria | 2631 |
| 457 | Ga0207646_10107926 | 3300025922 | Bacteria | 2497 |
| 458 | Ga0207646_10285631 | 3300025922 | Bacteria | 1491 |
| 459 | Ga0207646_10311500 | 3300025922 | Bacteria | 1422 |
| 460 | Ga0207646_10630679 | 3300025922 | Unclassified | 961 |
| 461 | Ga0207681_10001953 | 3300025923 | Bacteria | 13235 |
| 462 | Ga0207681_10408253 | 3300025923 | Bacteria | 1098 |
| 463 | Ga0207694_10035082 | 3300025924 | Bacteria | 3847 |
| 464 | Ga0207694_10223768 | 3300025924 | Bacteria | 1535 |
| 465 | Ga0207694_10238891 | 3300025924 | Bacteria | 1484 |
| 466 | Ga0207694_10577942 | 3300025924 | Bacteria | 944 |
| 467 | Ga0207650_10238267 | 3300025925 | Bacteria | 1470 |
| 468 | Ga0207650_10557007 | 3300025925 | Bacteria | 961 |
| 469 | Ga0207687_10269446 | 3300025927 | Bacteria | 1361 |
| 470 | Ga0207687_10286280 | 3300025927 | Bacteria | 1323 |
| 471 | Ga0207687_10399166 | 3300025927 | Bacteria | 1130 |
| 472 | Ga0207700_10012282 | 3300025928 | Bacteria | 5514 |
| 473 | Ga0207700_10024905 | 3300025928 | Bacteria | 4148 |
| 474 | Ga0207664_10052569 | 3300025929 | Bacteria | 3222 |
| 475 | Ga0207664_10074592 | 3300025929 | Bacteria | 2741 |
| 476 | Ga0207664_10082927 | 3300025929 | Bacteria | 2612 |
| 477 | Ga0207664_10225412 | 3300025929 | Bacteria | 1627 |
| 478 | Ga0207664_10246337 | 3300025929 | Bacteria | 1558 |
| 479 | Ga0207644_10024876 | 3300025931 | Bacteria | 4113 |
| 480 | Ga0207644_10130483 | 3300025931 | Bacteria | 1923 |
| 481 | Ga0207644_10916206 | 3300025931 | Bacteria | 735 |
| 482 | Ga0207690_10170308 | 3300025932 | Bacteria | 1631 |
| 483 | Ga0207690_10360263 | 3300025932 | Bacteria | 1152 |
| 484 | Ga0207706_10001355 | 3300025933 | Bacteria | 24461 |
| 485 | Ga0207706_10305637 | 3300025933 | Bacteria | 1385 |
| 486 | Ga0207686_10003613 | 3300025934 | Bacteria | 8284 |
| 487 | Ga0207686_10059287 | 3300025934 | Bacteria | 2417 |
| 488 | Ga0207686_10108662 | 3300025934 | Bacteria | 1866 |
| 489 | Ga0207686_10321583 | 3300025934 | Bacteria | 1156 |
| 490 | Ga0207704_10009704 | 3300025938 | Bacteria | 4658 |
| 491 | Ga0207704_10109335 | 3300025938 | Bacteria | 1864 |
| 492 | Ga0207665_10000447 | 3300025939 | Bacteria | 28305 |
| 493 | Ga0207691_10104455 | 3300025940 | Bacteria | 2525 |
| 494 | Ga0207691_10235973 | 3300025940 | Bacteria | 1582 |
| 495 | Ga0207711_10000064 | 3300025941 | Bacteria | 120779 |
| 496 | Ga0207711_10028170 | 3300025941 | Bacteria | 4725 |
| 497 | Ga0207711_10106774 | 3300025941 | Bacteria | 2485 |
| 498 | Ga0207711_10198429 | 3300025941 | Bacteria | 1830 |
| 499 | Ga0207711_10243019 | 3300025941 | Bacteria | 1651 |
| 500 | Ga0207711_10463549 | 3300025941 | Bacteria | 1180 |
| 501 | Ga0207711_10576668 | 3300025941 | Bacteria | 1049 |
| 502 | Ga0207711_10633277 | 3300025941 | Bacteria | 998 |
| 503 | Ga0207689_10429709 | 3300025942 | Bacteria | 1103 |
| 504 | Ga0207661_10004560 | 3300025944 | Bacteria | 9716 |
| 505 | Ga0207661_10035472 | 3300025944 | Bacteria | 3887 |
| 506 | Ga0207661_10043953 | 3300025944 | Bacteria | 3527 |
| 507 | Ga0207661_10054675 | 3300025944 | Bacteria | 3199 |
| 508 | Ga0207661_10264876 | 3300025944 | Bacteria | 1532 |
| 509 | Ga0207661_10423769 | 3300025944 | Bacteria | 1209 |
| 510 | Ga0207679_10040294 | 3300025945 | Bacteria | 3342 |
| 511 | Ga0207679_10211073 | 3300025945 | Bacteria | 1628 |
| 512 | Ga0207667_10002772 | 3300025949 | Bacteria | 21680 |
| 513 | Ga0207667_10011432 | 3300025949 | Bacteria | 10318 |
| 514 | Ga0207667_10237727 | 3300025949 | Bacteria | 1865 |
| 515 | Ga0207667_10267382 | 3300025949 | Bacteria | 1748 |
| 516 | Ga0207667_10299157 | 3300025949 | Bacteria | 1644 |
| 517 | Ga0207667_10602328 | 3300025949 | Bacteria | 1108 |
| 518 | Ga0207667_10661481 | 3300025949 | Bacteria | 1049 |
| 519 | Ga0207651_10314553 | 3300025960 | Bacteria | 1307 |
| 520 | Ga0207651_10710825 | 3300025960 | Bacteria | 886 |
| 521 | Ga0207712_10033535 | 3300025961 | Bacteria | 3472 |
| 522 | Ga0207712_10090893 | 3300025961 | Bacteria | 2247 |
| 523 | Ga0207712_10677967 | 3300025961 | Bacteria | 898 |
| 524 | Ga0207668_10021239 | 3300025972 | Bacteria | 4138 |
| 525 | Ga0207668_10135080 | 3300025972 | Bacteria | 1889 |
| 526 | Ga0207668_10290103 | 3300025972 | Bacteria | 1346 |
| 527 | Ga0207658_10119678 | 3300025986 | Bacteria | 2097 |
| 528 | Ga0207677_10207681 | 3300026023 | Bacteria | 1561 |
| 529 | Ga0207703_10016259 | 3300026035 | Bacteria | 5799 |
| 530 | Ga0207639_10020607 | 3300026041 | Bacteria | 4722 |
| 531 | Ga0207639_10097046 | 3300026041 | Bacteria | 2372 |
| 532 | Ga0207639_10313713 | 3300026041 | Bacteria | 1390 |
| 533 | Ga0207678_10004751 | 3300026067 | Bacteria | 12204 |
| 534 | Ga0207678_10260919 | 3300026067 | Bacteria | 1485 |
| 535 | Ga0207708_10027253 | 3300026075 | Bacteria | 4326 |
| 536 | Ga0207708_10081783 | 3300026075 | Bacteria | 2483 |
| 537 | Ga0207702_10002702 | 3300026078 | Bacteria | 16652 |
| 538 | Ga0207702_10163517 | 3300026078 | Bacteria | 2034 |
| 539 | Ga0207702_10215461 | 3300026078 | Bacteria | 1787 |
| 540 | Ga0207702_10216516 | 3300026078 | Bacteria | 1783 |
| 541 | Ga0207702_10419076 | 3300026078 | Bacteria | 1294 |
| 542 | Ga0207702_10667301 | 3300026078 | Bacteria | 1023 |
| 543 | Ga0207641_10084028 | 3300026088 | Bacteria | 2770 |
| 544 | Ga0207641_10157741 | 3300026088 | Bacteria | 2060 |
| 545 | Ga0207641_10579111 | 3300026088 | Bacteria | 1097 |
| 546 | Ga0207648_10091323 | 3300026089 | Bacteria | 2662 |
| 547 | Ga0207648_10109890 | 3300026089 | Bacteria | 2420 |
| 548 | Ga0207648_10154034 | 3300026089 | Bacteria | 2028 |
| 549 | Ga0207648_10271522 | 3300026089 | Bacteria | 1515 |
| 550 | Ga0207648_10294290 | 3300026089 | Bacteria | 1454 |
| 551 | Ga0207676_10351848 | 3300026095 | Bacteria | 1362 |
| 552 | Ga0207676_10671134 | 3300026095 | Bacteria | 1002 |
| 553 | Ga0207674_10001358 | 3300026116 | Bacteria | 31659 |
| 554 | Ga0207674_10020080 | 3300026116 | Bacteria | 7227 |
| 555 | Ga0207674_10229698 | 3300026116 | Bacteria | 1803 |
| 556 | Ga0207675_100186703 | 3300026118 | Bacteria | 1987 |
| 557 | Ga0207675_100376531 | 3300026118 | Bacteria | 1395 |
| 558 | Ga0207683_10016698 | 3300026121 | Bacteria | 6246 |
| 559 | Ga0207683_10170602 | 3300026121 | Bacteria | 1970 |
| 560 | Ga0207683_10674667 | 3300026121 | Bacteria | 958 |
| 561 | Ga0207698_10034196 | 3300026142 | Bacteria | 3703 |
| 562 | Ga0207698_10366481 | 3300026142 | Bacteria | 1366 |
| 563 | Ga0207698_10646115 | 3300026142 | Bacteria | 1047 |
| 564 | Ga0207698_10845076 | 3300026142 | Bacteria | 920 |
| 565 | Ga0209588_1040615 | 3300027671 | Bacteria | 1501 |
| 566 | Ga0209966_1008583 | 3300027695 | Bacteria | 1816 |
| 567 | Ga0209998_10002474 | 3300027717 | Bacteria | 4225 |
| 568 | Ga0209974_10029724 | 3300027876 | Bacteria | 1811 |
| 569 | Ga0265356_1009420 | 3300028017 | Bacteria | 1101 |
| 570 | Ga0268266_10113298 | 3300028379 | Bacteria | 2405 |
| 571 | Ga0268266_10294592 | 3300028379 | Bacteria | 1512 |
| 572 | Ga0268266_11028465 | 3300028379 | Bacteria | 797 |
| 573 | Ga0268265_10001794 | 3300028380 | Bacteria | 17212 |
| 574 | Ga0268265_10140629 | 3300028380 | Bacteria | 2020 |
| 575 | Ga0268265_10144093 | 3300028380 | Bacteria | 1999 |
| 576 | Ga0268265_10257721 | 3300028380 | Bacteria | 1549 |
| 577 | Ga0268264_10115371 | 3300028381 | Bacteria | 2359 |
| 578 | Ga0268264_10408325 | 3300028381 | Bacteria | 1307 |
| 579 | Ga0268264_10428336 | 3300028381 | Bacteria | 1277 |
| 580 | Ga0268264_10953771 | 3300028381 | Bacteria | 863 |
| 581 | Ga0268264_11138541 | 3300028381 | Bacteria | 789 |
| 582 | Ga0265337_1005073 | 3300028556 | Bacteria | 5313 |
| 583 | Ga0265334_10005808 | 3300028573 | Bacteria | 5372 |
| 584 | Ga0265336_10097129 | 3300028666 | Bacteria | 878 |
| 585 | Ga0265338_10009207 | 3300028800 | Bacteria | 11824 |
| 586 | Ga0265338_10049107 | 3300028800 | Bacteria | 3829 |
| 587 | Ga0265338_10094073 | 3300028800 | Bacteria | 2467 |
| 588 | Ga0265324_10006770 | 3300029957 | Bacteria | 4730 |
| 589 | Ga0307511_10214577 | 3300030521 | Bacteria | 976 |
| 590 | Ga0265330_10014736 | 3300031235 | Bacteria | 3626 |
| 591 | Ga0265330_10134665 | 3300031235 | Bacteria | 1051 |
| 592 | Ga0265328_10049034 | 3300031239 | Bacteria | 1551 |
| 593 | Ga0265325_10072037 | 3300031241 | Bacteria | 1733 |
| 594 | Ga0265325_10079165 | 3300031241 | Bacteria | 1636 |
| 595 | Ga0265339_10000209 | 3300031249 | Bacteria | 48039 |
| 596 | Ga0265339_10078648 | 3300031249 | Bacteria | 1746 |
| 597 | Ga0265339_10102181 | 3300031249 | Bacteria | 1490 |
| 598 | Ga0265339_10105466 | 3300031249 | Bacteria | 1463 |
| 599 | Ga0265331_10002092 | 3300031250 | Bacteria | 13775 |
| 600 | Ga0265331_10003605 | 3300031250 | Bacteria | 9913 |
| 601 | Ga0265327_10000176 | 3300031251 | Bacteria | 137002 |
| 602 | Ga0265316_10004054 | 3300031344 | Bacteria | 14658 |
| 603 | Ga0265316_10004227 | 3300031344 | Bacteria | 14342 |
| 604 | Ga0265316_10198831 | 3300031344 | Bacteria | 1487 |
| 605 | Ga0307408_100061935 | 3300031548 | Bacteria | 2732 |
| 606 | Ga0307408_100185011 | 3300031548 | Bacteria | 1674 |
| 607 | Ga0265313_10000004 | 3300031595 | Bacteria | 188027 |
| 608 | Ga0265313_10062762 | 3300031595 | Bacteria | 1735 |
| 609 | Ga0265314_10002032 | 3300031711 | Bacteria | 21431 |
| 610 | Ga0265314_10031258 | 3300031711 | Bacteria | 3934 |
| 611 | Ga0265314_10058659 | 3300031711 | Bacteria | 2637 |
| 612 | Ga0265342_10006946 | 3300031712 | Bacteria | 8366 |
| 613 | Ga0265342_10177902 | 3300031712 | Bacteria | 1166 |
| 614 | Ga0316576_10012341 | 3300031727 | Bacteria | 5640 |
| 615 | Ga0316576_10096914 | 3300031727 | Bacteria | 2202 |
| 616 | Ga0316578_10133806 | 3300031728 | Bacteria | 1492 |
| 617 | Ga0316578_10317503 | 3300031728 | Bacteria | 930 |
| 618 | Ga0307405_10019903 | 3300031731 | Bacteria | 3740 |
| 619 | Ga0307405_10037115 | 3300031731 | Bacteria | 2926 |
| 620 | Ga0307405_10164712 | 3300031731 | Bacteria | 1575 |
| 621 | Ga0307405_10999306 | 3300031731 | Bacteria | 714 |
| 622 | Ga0307413_10082285 | 3300031824 | Bacteria | 2067 |
| 623 | Ga0307518_10152317 | 3300031838 | Bacteria | 1598 |
| 624 | Ga0307410_10007540 | 3300031852 | Bacteria | 5964 |
| 625 | Ga0307410_10081588 | 3300031852 | Bacteria | 2272 |
| 626 | Ga0307410_10141492 | 3300031852 | Bacteria | 1780 |
| 627 | Ga0307410_10204546 | 3300031852 | Bacteria | 1509 |
| 628 | Ga0307410_10316451 | 3300031852 | Bacteria | 1237 |
| 629 | Ga0307406_10026687 | 3300031901 | Bacteria | 3471 |
| 630 | Ga0307406_10083486 | 3300031901 | Bacteria | 2130 |
| 631 | Ga0307407_10006582 | 3300031903 | Bacteria | 5184 |
| 632 | Ga0307407_10092424 | 3300031903 | Bacteria | 1858 |
| 633 | Ga0307407_10123813 | 3300031903 | Bacteria | 1643 |
| 634 | Ga0307409_100100105 | 3300031995 | Bacteria | 2402 |
| 635 | Ga0307409_100203471 | 3300031995 | Bacteria | 1773 |
| 636 | Ga0307409_100211985 | 3300031995 | Bacteria | 1741 |
| 637 | Ga0307409_100386489 | 3300031995 | Bacteria | 1332 |
| 638 | Ga0307409_100576246 | 3300031995 | Bacteria | 1109 |
| 639 | Ga0307409_100962409 | 3300031995 | Bacteria | 870 |
| 640 | Ga0307416_100017432 | 3300032002 | Bacteria | 5026 |
| 641 | Ga0307416_100176034 | 3300032002 | Bacteria | 1998 |
| 642 | Ga0307416_100518137 | 3300032002 | Bacteria | 1260 |
| 643 | Ga0307414_10053577 | 3300032004 | Bacteria | 2814 |
| 644 | Ga0307414_10140692 | 3300032004 | Bacteria | 1889 |
| 645 | Ga0307414_10282147 | 3300032004 | Bacteria | 1396 |
| 646 | Ga0307414_10906373 | 3300032004 | Bacteria | 808 |
| 647 | Ga0307411_10038737 | 3300032005 | Bacteria | 3010 |
| 648 | Ga0307411_10073014 | 3300032005 | Bacteria | 2332 |
| 649 | Ga0307411_10095944 | 3300032005 | Bacteria | 2083 |
| 650 | Ga0307411_10147723 | 3300032005 | Bacteria | 1742 |
| 651 | Ga0307411_10150085 | 3300032005 | Unclassified | 1731 |
| 652 | Ga0307411_10155673 | 3300032005 | Bacteria | 1704 |
| 653 | Ga0307415_100006168 | 3300032126 | Bacteria | 6436 |
| 654 | Ga0307415_100049196 | 3300032126 | Bacteria | 2849 |
| 655 | Ga0307415_100228616 | 3300032126 | Bacteria | 1496 |
| 656 | Ga0307507_10082573 | 3300033179 | Bacteria | 2816 |
| 657 | Ga0373926_0001823 | 3300035083 | Bacteria | 6623 |
| 658 | Ga0373929_0030848 | 3300035085 | Bacteria | 1145 |
| 659 | Ga0373952_0066259 | 3300035092 | Bacteria | 894 |
| 660 | Ga0373939_0130243 | 3300035114 | Bacteria | 897 |
| 661 | Ga0373939_0149164 | 3300035114 | Bacteria | 850 |
| 662 | Ga0373954_0106603 | 3300035118 | Bacteria | 1354 |
| 663 | Ga0373956_0020139 | 3300035119 | Bacteria | 2836 |
| 664 | Ga0373956_0052367 | 3300035119 | Bacteria | 1836 |
| 665 | Ga0373943_0244677 | 3300035170 | Bacteria | 1006 |
| 666 | Ga0373946_0036679 | 3300035171 | Bacteria | 1989 |
| 667 | Ga0373946_0075875 | 3300035171 | Bacteria | 1462 |
| 668 | Ga0373946_0372657 | 3300035171 | Bacteria | 717 |
| 669 | Ga0373942_0008853 | 3300035207 | Bacteria | 2352 |
| 670 | Ga0373931_0044305 | 3300035691 | Bacteria | 2346 |
| 671 | Ga0373931_0052452 | 3300035691 | Bacteria | 2174 |
| 672 | Ga0373931_0141454 | 3300035691 | Bacteria | 1394 |
| 673 | Ga0373935_0197784 | 3300035692 | Bacteria | 1388 |
| 674 | Ga0373935_0325804 | 3300035692 | Bacteria | 1091 |
| 675 | Ga0373933_0013413 | 3300035724 | Bacteria | 4541 |
| 676 | Ga0373947_0000031 | 3300035725 | Bacteria | 73833 |
| 677 | Ga0373947_0158352 | 3300035725 | Bacteria | 1463 |
| 678 | Ga0373937_0022396 | 3300036401 | Bacteria | 5681 |
| 679 | Ga0373937_0126984 | 3300036401 | Bacteria | 2380 |
| 680 | Ga0373937_0286638 | 3300036401 | Bacteria | 1556 |
| 681 | Ga0373937_0715890 | 3300036401 | Bacteria | 948 |
| 682 | Ga0316584_0024092 | 3300036712 | Bacteria | 4452 |
| 683 | Ga0316584_0172788 | 3300036712 | Bacteria | 1602 |
| 684 | Ga0373925_0271028 | 3300037068 | Bacteria | 1365 |
| 685 | Ga0373925_0301996 | 3300037068 | Bacteria | 1293 |
| 686 | Ga0395899_0000421 | 3300037312 | Bacteria | 49097 |
| 687 | Ga0395899_0003093 | 3300037312 | Bacteria | 13244 |
| 688 | Ga0395900_0000159 | 3300037418 | Bacteria | 111486 |
| 689 | Ga0395900_0000445 | 3300037418 | Bacteria | 59139 |
| 690 | Ga0395900_0055109 | 3300037418 | Bacteria | 4093 |
| 691 | Ga0395900_0136280 | 3300037418 | Bacteria | 2515 |
| 692 | Ga0395900_0138891 | 3300037418 | Bacteria | 2489 |
| 693 | Ga0395898_0000425 | 3300037466 | Bacteria | 89768 |
| 694 | Ga0395898_0002174 | 3300037466 | Bacteria | 24017 |
| 695 | Ga0395898_0005757 | 3300037466 | Bacteria | 13337 |
| 696 | Ga0395898_0217076 | 3300037466 | Bacteria | 1824 |
| 697 | Ga0395905_0531470 | 3300037471 | Bacteria | 1077 |
| 698 | Ga0395901_0000017 | 3300038443 | Bacteria | 345003 |
| 699 | Ga0395901_0000109 | 3300038443 | Bacteria | 112882 |
| 700 | Ga0395901_0009637 | 3300038443 | Bacteria | 9798 |
| 701 | Ga0395901_0043931 | 3300038443 | Bacteria | 4635 |
| 702 | Ga0436365_1876799 | 3300039437 | Bacteria | 3966 |
| 703 | Ga0436360_0035010 | 3300039438 | Bacteria | 1878 |
| 704 | Ga0436361_0807603 | 3300039447 | Bacteria | 982 |
| 705 | Ga0436361_1124937 | 3300039447 | Bacteria | 3569 |
| 706 | Ga0436363_0588233 | 3300039450 | Bacteria | 1294 |
| 707 | Ga0451837_1244620 | 3300041494 | Bacteria | 1099 |
| 708 | Ga0451849_0243995 | 3300041505 | Bacteria | 720 |
| 709 | Ga0451853_2650962 | 3300041512 | Bacteria | 616 |
| 710 | Ga0439445_0005495 | 3300042004 | Bacteria | 2889 |
| 711 | Ga0439448_0012918 | 3300042005 | Bacteria | 2505 |
| 712 | Ga0450898_003049 | 3300042134 | Bacteria | 2376 |
| 713 | Ga0450910_023046 | 3300042147 | Bacteria | 950 |
| 714 | Ga0439444_0025165 | 3300042437 | Bacteria | 1081 |
| 715 | Ga0451577_0008981 | 3300042876 | Bacteria | 9662 |
| 716 | Ga0451577_0065552 | 3300042876 | Bacteria | 3239 |
| 717 | Ga0451577_0125156 | 3300042876 | Bacteria | 2303 |
| 718 | Ga0451577_0703078 | 3300042876 | Bacteria | 915 |
| 719 | Ga0466969_0000008 | 3300044656 | Bacteria | 139607 |
| 720 | Ga0466969_0028334 | 3300044656 | Bacteria | 2863 |
| 721 | Ga0466969_0029616 | 3300044656 | Bacteria | 2794 |
| 722 | Ga0466969_0037730 | 3300044656 | Bacteria | 2435 |
| 723 | Ga0466972_0032516 | 3300044658 | Bacteria | 2561 |
| 724 | Ga0466973_0022991 | 3300044659 | Bacteria | 5971 |
| 725 | Ga0466977_0000673 | 3300044666 | Bacteria | 12021 |
| 726 | Ga0453683_0143288 | 3300044673 | Bacteria | 1509 |
| 727 | Ga0466965_0000743 | 3300044683 | Bacteria | 12188 |
| 728 | Ga0466966_0000082 | 3300044684 | Bacteria | 59091 |
| 729 | Ga0466966_0009579 | 3300044684 | Bacteria | 6411 |
| 730 | Ga0466966_0037145 | 3300044684 | Bacteria | 3142 |
| 731 | Ga0466966_0038085 | 3300044684 | Bacteria | 3099 |
| 732 | Ga0466966_0045063 | 3300044684 | Bacteria | 2821 |
| 733 | Ga0466961_0001496 | 3300044693 | Bacteria | 14495 |
| 734 | Ga0466961_0009743 | 3300044693 | Bacteria | 6113 |
| 735 | Ga0466963_0001180 | 3300044694 | Bacteria | 13723 |
| 736 | Ga0466963_0033456 | 3300044694 | Bacteria | 3338 |
| 737 | Ga0466963_0086023 | 3300044694 | Bacteria | 2135 |
| 738 | Ga0466963_0088979 | 3300044694 | Bacteria | 2100 |
| 739 | Ga0466963_0336435 | 3300044694 | Bacteria | 1063 |
| 740 | Ga0466964_0022176 | 3300044706 | Bacteria | 2461 |
| 741 | Ga0466964_0475049 | 3300044706 | Bacteria | 667 |
| 742 | Ga0453684_0001146 | 3300044712 | Bacteria | 82773 |
| 743 | Ga0453684_0736806 | 3300044712 | Bacteria | 1068 |
| 744 | Ga0466971_0007186 | 3300044719 | Bacteria | 4848 |
| 745 | Ga0466971_0039338 | 3300044719 | Bacteria | 2122 |
| 746 | Ga0466971_0204817 | 3300044719 | Bacteria | 932 |
| 747 | Ga0466971_0281552 | 3300044719 | Bacteria | 796 |
| 748 | Ga0466970_0025967 | 3300044765 | Bacteria | 3069 |
| 749 | Ga0466970_0110582 | 3300044765 | Bacteria | 1500 |
| 750 | Ga0466957_0181816 | 3300044842 | Bacteria | 1373 |
| 751 | Ga0466959_0029019 | 3300045049 | Bacteria | 4097 |
| 752 | Ga0466959_0117826 | 3300045049 | Bacteria | 1890 |
| 753 | Ga0451576_0291384 | 3300045051 | Bacteria | 1706 |
| 754 | Ga0451576_0468889 | 3300045051 | Bacteria | 1322 |
| 755 | Ga0466958_0001820 | 3300045836 | Bacteria | 10358 |
| 756 | Ga0466958_0002956 | 3300045836 | Bacteria | 8700 |
| 757 | Ga0466958_0380643 | 3300045836 | Bacteria | 910 |
| 758 | Ga0466967_0257460 | 3300045976 | Bacteria | 1669 |
| 759 | Ga0466967_0373277 | 3300045976 | Bacteria | 1384 |
| 760 | Ga0466967_0664439 | 3300045976 | Bacteria | 1031 |
| 761 | Ga0495592_0030243 | 3300046454 | Bacteria | 4097 |
| 762 | Ga0495629_0483559 | 3300046459 | Bacteria | 836 |
| 763 | Ga0495638_0135704 | 3300046460 | Bacteria | 1441 |
| 764 | Ga0495653_0139753 | 3300046463 | Bacteria | 1705 |
| 765 | Ga0495580_0283406 | 3300046472 | Bacteria | 1130 |
| 766 | Ga0495582_0148080 | 3300046473 | Bacteria | 1332 |
| 767 | Ga0495639_0210381 | 3300046475 | Bacteria | 954 |
| 768 | Ga0495662_0050118 | 3300046476 | Bacteria | 2015 |
| 769 | Ga0495594_0054450 | 3300046499 | Bacteria | 2205 |
| 770 | Ga0495594_0062189 | 3300046499 | Bacteria | 2067 |
| 771 | Ga0495618_0020940 | 3300046514 | Bacteria | 4027 |
| 772 | Ga0495618_0237874 | 3300046514 | Bacteria | 1145 |
| 773 | Ga0495618_0315385 | 3300046514 | Bacteria | 969 |
| 774 | Ga0495630_0098480 | 3300046517 | Bacteria | 2212 |
| 775 | Ga0495630_0300125 | 3300046517 | Bacteria | 1227 |
| 776 | Ga0495642_0039507 | 3300046528 | Bacteria | 1915 |
| 777 | Ga0495652_0041799 | 3300046529 | Bacteria | 3955 |
| 778 | Ga0495665_0008286 | 3300046531 | Bacteria | 5635 |
| 779 | Ga0495665_0161935 | 3300046531 | Bacteria | 1166 |
| 780 | Ga0495640_0083114 | 3300046533 | Bacteria | 2125 |
| 781 | Ga0495586_0052221 | 3300046535 | Bacteria | 2213 |
| 782 | Ga0495586_0175633 | 3300046535 | Bacteria | 1211 |
| 783 | Ga0495586_0248381 | 3300046535 | Bacteria | 1015 |
| 784 | Ga0495587_0063377 | 3300046536 | Bacteria | 2162 |
| 785 | Ga0495587_0104224 | 3300046536 | Bacteria | 1633 |
| 786 | Ga0495587_0189405 | 3300046536 | Bacteria | 1165 |
| 787 | Ga0495645_0006492 | 3300046543 | Bacteria | 8120 |
| 788 | Ga0495645_0031033 | 3300046543 | Bacteria | 3892 |
| 789 | Ga0495645_0063452 | 3300046543 | Bacteria | 2675 |
| 790 | Ga0495622_0061393 | 3300046557 | Bacteria | 1740 |
| 791 | Ga0495667_0039532 | 3300046559 | Bacteria | 3136 |
| 792 | Ga0495656_0222307 | 3300046615 | Bacteria | 944 |
| 793 | Ga0495634_0023766 | 3300046642 | Bacteria | 4306 |
| 794 | Ga0495634_0069434 | 3300046642 | Bacteria | 2325 |
| 795 | Ga0495634_0102008 | 3300046642 | Bacteria | 1853 |
| 796 | Ga0495625_0105085 | 3300046660 | Bacteria | 1935 |
| 797 | Ga0495635_0079368 | 3300046663 | Bacteria | 2246 |
| 798 | Ga0495635_0083784 | 3300046663 | Bacteria | 2182 |
| 799 | Ga0495635_0305641 | 3300046663 | Bacteria | 1066 |
| 800 | Ga0495659_0101908 | 3300046664 | Bacteria | 1113 |
| 801 | Ga0495588_0082529 | 3300046674 | Bacteria | 1679 |
| 802 | Ga0495657_0138140 | 3300046675 | Bacteria | 1521 |
| 803 | Ga0495599_0168889 | 3300046678 | Bacteria | 1350 |
| 804 | Ga0495599_0195806 | 3300046678 | Bacteria | 1242 |
| 805 | Ga0495647_0134608 | 3300046681 | Bacteria | 1050 |
| 806 | Ga0495669_0084137 | 3300046684 | Bacteria | 1463 |
| 807 | Ga0495600_0042250 | 3300046809 | Bacteria | 2972 |
| 808 | Ga0495600_0117065 | 3300046809 | Bacteria | 1734 |
| 809 | Ga0495581_0357677 | 3300047315 | Bacteria | 852 |
| 810 | Ga0495604_0071217 | 3300047317 | Bacteria | 2630 |
| 811 | Ga0495674_0073126 | 3300047319 | Bacteria | 2956 |
| 812 | Ga0495674_0120872 | 3300047319 | Bacteria | 2213 |
| 813 | Ga0495672_0088848 | 3300047320 | Bacteria | 1702 |
| 814 | Ga0495675_0115959 | 3300047444 | Bacteria | 1670 |
| 815 | Ga0495684_0008456 | 3300047471 | Bacteria | 7967 |
| 816 | Ga0495686_0000007 | 3300047472 | Bacteria | 732622 |
| 817 | Ga0495686_0016441 | 3300047472 | Bacteria | 5016 |
| 818 | Ga0495686_0116205 | 3300047472 | Bacteria | 1599 |
| 819 | Ga0495602_0035227 | 3300048088 | Bacteria | 4670 |
| 820 | Ga0496100_0334857 | 3300048903 | Bacteria | 1140 |
| 821 | Ga0496102_0000693 | 3300048905 | Bacteria | 33499 |
| 822 | Ga0496102_0076207 | 3300048905 | Bacteria | 3085 |
| 823 | Ga0496102_0129691 | 3300048905 | Bacteria | 2359 |
| 824 | Ga0496102_0237220 | 3300048905 | Bacteria | 1720 |
| 825 | Ga0496104_0000014 | 3300048907 | Bacteria | 377972 |
| 826 | Ga0496104_0000542 | 3300048907 | Bacteria | 32369 |
| 827 | Ga0496105_0089615 | 3300048908 | Bacteria | 2541 |
| 828 | Ga0496106_0426757 | 3300048909 | Bacteria | 1065 |
| 829 | Ga0496107_0009969 | 3300048910 | Bacteria | 6593 |
| 830 | Ga0496107_0330020 | 3300048910 | Bacteria | 1135 |
| 831 | Ga0496108_0000659 | 3300048911 | Bacteria | 26589 |
| 832 | Ga0496109_0001342 | 3300048912 | Bacteria | 20335 |
| 833 | Ga0496109_0165812 | 3300048912 | Bacteria | 2071 |
| 834 | Ga0496110_0010771 | 3300048913 | Bacteria | 7452 |
| 835 | Ga0496110_0014556 | 3300048913 | Bacteria | 6537 |
| 836 | Ga0496112_0036657 | 3300048915 | Bacteria | 4784 |
| 837 | Ga0496115_0000923 | 3300048918 | Bacteria | 21295 |
| 838 | Ga0496115_0001557 | 3300048918 | Bacteria | 16490 |
| 839 | Ga0496115_0445497 | 3300048918 | Bacteria | 1047 |
| 840 | Ga0501033_0134943 | 3300049570 | Bacteria | 1786 |
| 841 | Ga0501034_0008979 | 3300049571 | Bacteria | 10501 |
| 842 | Ga0501036_0238656 | 3300049572 | Bacteria | 1525 |
| 843 | Ga0501037_0099222 | 3300049573 | Bacteria | 2103 |
| 844 | Ga0501038_0008308 | 3300049574 | Bacteria | 9555 |
| 845 | Ga0501038_0297491 | 3300049574 | Bacteria | 1267 |
| 846 | Ga0501039_0075802 | 3300049575 | Bacteria | 2614 |
| 847 | Ga0501039_0122578 | 3300049575 | Bacteria | 2038 |
| 848 | Ga0501039_0676276 | 3300049575 | Bacteria | 808 |
| 849 | Ga0501040_0132370 | 3300049576 | Bacteria | 1754 |
| 850 | Ga0501040_0196896 | 3300049576 | Bacteria | 1430 |
| 851 | Ga0501041_0045415 | 3300049577 | Bacteria | 2671 |
| 852 | Ga0501042_0251306 | 3300049578 | Bacteria | 1276 |
| 853 | Ga0501043_0018518 | 3300049579 | Bacteria | 5463 |
| 854 | Ga0501043_0074691 | 3300049579 | Bacteria | 2663 |
| 855 | Ga0501043_0543496 | 3300049579 | Bacteria | 864 |
| 856 | Ga0501046_0048523 | 3300049580 | Bacteria | 3362 |
| 857 | Ga0501046_0108943 | 3300049580 | Bacteria | 2118 |
| 858 | Ga0501047_0124677 | 3300049581 | Bacteria | 2456 |
| 859 | Ga0501047_0179023 | 3300049581 | Bacteria | 1987 |
| 860 | Ga0501047_0358482 | 3300049581 | Bacteria | 1294 |
| 861 | Ga0501048_0001269 | 3300049582 | Bacteria | 19114 |
| 862 | Ga0501067_0021474 | 3300049583 | Bacteria | 3572 |
| 863 | Ga0501067_0030717 | 3300049583 | Bacteria | 2980 |
| 864 | Ga0501067_0084445 | 3300049583 | Bacteria | 1761 |
| 865 | Ga0501068_0003826 | 3300049584 | Bacteria | 8164 |
| 866 | Ga0501069_0004771 | 3300049585 | Bacteria | 7017 |
| 867 | Ga0501069_0009983 | 3300049585 | Bacteria | 5019 |
| 868 | Ga0501070_0018564 | 3300049586 | Bacteria | 5834 |
| 869 | Ga0501070_0024586 | 3300049586 | Bacteria | 5051 |
| 870 | Ga0501070_0066405 | 3300049586 | Bacteria | 2987 |
| 871 | Ga0501070_0172373 | 3300049586 | Bacteria | 1782 |
| 872 | Ga0501070_0432306 | 3300049586 | Bacteria | 1062 |
| 873 | Ga0501071_0003078 | 3300049587 | Bacteria | 10338 |
| 874 | Ga0501072_0002641 | 3300049588 | Bacteria | 13433 |
| 875 | Ga0501072_0141522 | 3300049588 | Bacteria | 1918 |
| 876 | Ga0501072_0367758 | 3300049588 | Bacteria | 1141 |
| 877 | Ga0501073_0088631 | 3300049589 | Bacteria | 2151 |
| 878 | Ga0501074_0001140 | 3300049590 | Bacteria | 17400 |
| 879 | Ga0501074_0145963 | 3300049590 | Bacteria | 1692 |
| 880 | Ga0501074_0767700 | 3300049590 | Bacteria | 680 |
| 881 | Ga0501075_0046762 | 3300049591 | Bacteria | 3251 |
| 882 | Ga0501076_0147375 | 3300049592 | Bacteria | 1914 |
| 883 | Ga0501076_0208768 | 3300049592 | Bacteria | 1595 |
| 884 | Ga0501076_0572006 | 3300049592 | Bacteria | 932 |
| 885 | Ga0501077_0001806 | 3300049593 | Bacteria | 12930 |
| 886 | Ga0501077_0155092 | 3300049593 | Bacteria | 1453 |
| 887 | Ga0501217_045400 | 3300049661 | Bacteria | 1132 |
| 888 | Ga0501233_037201 | 3300049668 | Bacteria | 1129 |
| 889 | Ga0501233_081863 | 3300049668 | Bacteria | 832 |
| 890 | Ga0501260_005022 | 3300049689 | Bacteria | 1235 |
| 891 | Ga0501234_005779 | 3300049707 | Bacteria | 1933 |
| 892 | Ga0501245_005183 | 3300049708 | Bacteria | 1803 |
| 893 | Ga0501079_0268600 | 3300049741 | Bacteria | 1333 |
| 894 | Ga0501080_0021326 | 3300049742 | Bacteria | 5996 |
| 895 | Ga0501080_0085723 | 3300049742 | Bacteria | 2927 |
| 896 | Ga0501081_0083532 | 3300049743 | Bacteria | 2239 |
| 897 | Ga0501081_0124233 | 3300049743 | Bacteria | 1840 |
| 898 | Ga0501083_0004908 | 3300049744 | Bacteria | 9462 |
| 899 | Ga0501232_029030 | 3300049757 | Bacteria | 758 |
| 900 | Ga0501262_030517 | 3300049759 | Bacteria | 775 |
| 901 | Ga0501268_002141 | 3300049765 | Bacteria | 2569 |
| 902 | Ga0501268_009827 | 3300049765 | Bacteria | 1477 |
| 903 | Ga0501270_014857 | 3300049767 | Bacteria | 1103 |
| 904 | Ga0501272_001712 | 3300049769 | Bacteria | 2111 |
| 905 | Ga0501035_0407055 | 3300049822 | Bacteria | 1131 |
| 906 | Ga0501044_0008204 | 3300049823 | Bacteria | 11460 |
| 907 | Ga0501045_0061254 | 3300049824 | Bacteria | 2761 |
| 908 | Ga0501045_0225827 | 3300049824 | Bacteria | 1394 |
| 909 | Ga0501045_0476465 | 3300049824 | Bacteria | 927 |
| 910 | nmdc:mga0k408_363755_c1 | 3300050493 | Bacteria | 862 |
| 911 | nmdc:mga0k408_49684_c1 | 3300050493 | Bacteria | 2428 |
| 912 | nmdc:mga06z11_432393_c1 | 3300050494 | Bacteria | 794 |
| 913 | nmdc:mga06z11_97626_c1 | 3300050494 | Bacteria | 1606 |
| 914 | nmdc:mga05p37_162125_c1 | 3300050507 | Bacteria | 2730 |
| 915 | nmdc:mga05p37_458105_c1 | 3300050507 | Bacteria | 1474 |
| 916 | nmdc:mga05p37_69749_c1 | 3300050507 | Bacteria | 4324 |
| 917 | nmdc:mga09592_4370_c1 | 3300050508 | Bacteria | 11429 |
| 918 | nmdc:mga09592_64643_c1 | 3300050508 | Bacteria | 3097 |
| 919 | nmdc:mga0qj67_145_c1 | 3300050509 | Bacteria | 41305 |
| 920 | nmdc:mga0qj67_24987_c1 | 3300050509 | Bacteria | 4610 |
| 921 | nmdc:mga0qj67_36230_c1 | 3300050509 | Bacteria | 3859 |
| 922 | nmdc:mga0qj67_41314_c1 | 3300050509 | Bacteria | 3626 |
| 923 | nmdc:mga06r32_113138_c1 | 3300050510 | Bacteria | 2671 |
| 924 | nmdc:mga06r32_244046_c1 | 3300050510 | Bacteria | 1783 |
| 925 | nmdc:mga06r32_244491_c1 | 3300050510 | Bacteria | 1782 |
| 926 | nmdc:mga06r32_30913_c1 | 3300050510 | Bacteria | 5025 |
| 927 | nmdc:mga06r32_6579_c1 | 3300050510 | Bacteria | 10441 |
| 928 | nmdc:mga08y16_50614_c1 | 3300050511 | Bacteria | 4347 |
| 929 | nmdc:mga08y16_762988_c1 | 3300050511 | Bacteria | 962 |
| 930 | nmdc:mga08y16_76635_c1 | 3300050511 | Bacteria | 3485 |
| 931 | nmdc:mga0n895_156754_c1 | 3300050512 | Bacteria | 2308 |
| 932 | nmdc:mga0n895_163392_c1 | 3300050512 | Bacteria | 2258 |
| 933 | nmdc:mga0n895_36095_c1 | 3300050512 | Bacteria | 4771 |
| 934 | nmdc:mga0n895_55943_c1 | 3300050512 | Bacteria | 3885 |
| 935 | nmdc:mga0n895_693533_c1 | 3300050512 | Bacteria | 1015 |
| 936 | nmdc:mga0rr50_224953_c1 | 3300050513 | Bacteria | 1551 |
| 937 | nmdc:mga0rr50_244214_c1 | 3300050513 | Bacteria | 1489 |
| 938 | nmdc:mga0rr50_45452_c1 | 3300050513 | Bacteria | 3227 |
| 939 | nmdc:mga0rr50_762536_c1 | 3300050513 | Bacteria | 826 |
| 940 | nmdc:mga0rr50_83232_c1 | 3300050513 | Bacteria | 2473 |
| 941 | nmdc:mga0rr50_852479_c1 | 3300050513 | Bacteria | 777 |
| 942 | nmdc:mga08x19_126962_c1 | 3300050514 | Bacteria | 1713 |
| 943 | nmdc:mga08x19_14339_c1 | 3300050514 | Bacteria | 4807 |
| 944 | nmdc:mga08x19_264729_c1 | 3300050514 | Bacteria | 1189 |
| 945 | nmdc:mga08x19_289370_c1 | 3300050514 | Bacteria | 1136 |
| 946 | nmdc:mga08x19_6037_c1 | 3300050514 | Bacteria | 7159 |
| 947 | nmdc:mga08x19_88799_c1 | 3300050514 | Bacteria | 2038 |
| 948 | nmdc:mga0a205_115483_c1 | 3300050515 | Bacteria | 2583 |
| 949 | nmdc:mga0a205_177653_c1 | 3300050515 | Bacteria | 2024 |
| 950 | nmdc:mga0a205_327552_c1 | 3300050515 | Bacteria | 1402 |
| 951 | nmdc:mga0a205_51645_c1 | 3300050515 | Bacteria | 3969 |
| 952 | nmdc:mga0a205_913489_c1 | 3300050515 | Bacteria | 725 |
| 953 | Ga0495601_0041642 | 3300053077 | Bacteria | 2880 |
| 954 | Ga0495601_0054612 | 3300053077 | Bacteria | 2527 |
| 955 | Ga0495595_0023819 | 3300053084 | Bacteria | 2699 |
| 956 | Ga0500583_0030584 | 3300053092 | Bacteria | 2360 |
| 957 | Ga0500566_0026880 | 3300053094 | Bacteria | 3368 |
| 958 | Ga0500595_006337 | 3300053119 | Bacteria | 5027 |
| 959 | Ga0500618_002101 | 3300053125 | Bacteria | 7898 |
| 960 | Ga0500618_002594 | 3300053125 | Bacteria | 6670 |
| 961 | Ga0500655_008591 | 3300053133 | Bacteria | 1839 |
| 962 | Ga0500559_0284678 | 3300053136 | Bacteria | 777 |
| 963 | Ga0500603_054851 | 3300053150 | Bacteria | 1100 |
| 964 | Ga0500601_000465 | 3300053737 | Bacteria | 6552 |
| 965 | Ga0501084_0005169 | 3300054114 | Bacteria | 10676 |
| 966 | Ga0501084_0005653 | 3300054114 | Bacteria | 10265 |
| 967 | Ga0501084_0481064 | 3300054114 | Bacteria | 1049 |
| 968 | Ga0590071_001022 | 3300059421 | Bacteria | 7605 |
| 969 | Ga0590077_005597 | 3300059426 | Bacteria | 2569 |
| 970 | Ga0501082_0007067 | 3300060353 | Bacteria | 9686 |
| 971 | Ga0466962_0046644 | 3300061719 | Bacteria | 2070 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049743 | Ga0501081_0083532 | Ga0501081_0083532_54_569 | 162 |
| 2 | 3300041512 | Ga0451853_2650962 | Ga0451853_2650962_38_565 | 165 |
| 3 | 3300044706 | Ga0466964_0475049 | Ga0466964_0475049_78_614 | 171 |
| 4 | 3300047315 | Ga0495581_0357677 | Ga0495581_0357677_306_842 | 171 |
| 5 | 3300045836 | Ga0466958_0380643 | Ga0466958_0380643_319_891 | 180 |
| 6 | 3300046514 | Ga0495618_0315385 | Ga0495618_0315385_29_604 | 180 |
| 7 | 3300005937 | Ga0081455_10147178 | Ga0081455_101471782 | 184 |
| 8 | 3300049578 | Ga0501042_0251306 | Ga0501042_0251306_483_1064 | 184 |
| 9 | 3300053092 | Ga0500583_0030584 | Ga0500583_0030584_1758_2345 | 186 |
| 10 | 3300005436 | Ga0070713_100017633 | Ga0070713_1000176334 | 189 |
| 11 | 3300005439 | Ga0070711_100023585 | Ga0070711_1000235855 | 189 |
| 12 | 3300005535 | Ga0070684_100031010 | Ga0070684_1000310104 | 189 |
| 13 | 3300005539 | Ga0068853_100266207 | Ga0068853_1002662072 | 189 |
| 14 | 3300005577 | Ga0068857_100014675 | Ga0068857_1000146754 | 189 |
| 15 | 3300005614 | Ga0068856_100007921 | Ga0068856_1000079217 | 189 |
| 16 | 3300005616 | Ga0068852_100128548 | Ga0068852_1001285482 | 189 |
| 17 | 3300009551 | Ga0105238_10136838 | Ga0105238_101368382 | 189 |
| 18 | 3300013307 | Ga0157372_10056941 | Ga0157372_100569412 | 189 |
| 19 | 3300025916 | Ga0207663_10026240 | Ga0207663_100262401 | 189 |
| 20 | 3300025928 | Ga0207700_10012282 | Ga0207700_100122825 | 189 |
| 21 | 3300025960 | Ga0207651_10710825 | Ga0207651_107108252 | 189 |
| 22 | 3300026041 | Ga0207639_10020607 | Ga0207639_100206076 | 189 |
| 23 | 3300026078 | Ga0207702_10002702 | Ga0207702_100027022 | 189 |
| 24 | 3300026116 | Ga0207674_10001358 | Ga0207674_100013588 | 189 |
| 25 | 3300026142 | Ga0207698_10845076 | Ga0207698_108450761 | 189 |
| 26 | 3300028800 | Ga0265338_10009207 | Ga0265338_100092073 | 189 |
| 27 | 3300029957 | Ga0265324_10006770 | Ga0265324_100067703 | 189 |
| 28 | 3300031239 | Ga0265328_10049034 | Ga0265328_100490342 | 189 |
| 29 | 3300031241 | Ga0265325_10072037 | Ga0265325_100720373 | 189 |
| 30 | 3300031249 | Ga0265339_10000209 | Ga0265339_1000020932 | 189 |
| 31 | 3300031344 | Ga0265316_10004227 | Ga0265316_100042277 | 189 |
| 32 | 3300031711 | Ga0265314_10002032 | Ga0265314_1000203210 | 189 |
| 33 | 3300044656 | Ga0466969_0000008 | Ga0466969_0000008_31019_31717 | 189 |
| 34 | 3300044684 | Ga0466966_0037145 | Ga0466966_0037145_1648_2346 | 189 |
| 35 | 3300044765 | Ga0466970_0110582 | Ga0466970_0110582_423_1118 | 189 |
| 36 | 3300046473 | Ga0495582_0148080 | Ga0495582_0148080_668_1291 | 190 |
| 37 | 3300046514 | Ga0495618_0020940 | Ga0495618_0020940_2656_3279 | 190 |
| 38 | 3300046642 | Ga0495634_0102008 | Ga0495634_0102008_1168_1791 | 190 |
| 39 | 3300013308 | Ga0157375_10161016 | Ga0157375_101610163 | 191 |
| 40 | 3300005530 | Ga0070679_100060525 | Ga0070679_1000605252 | 192 |
| 41 | 3300013307 | Ga0157372_10752511 | Ga0157372_107525112 | 192 |
| 42 | 3300025917 | Ga0207660_10522818 | Ga0207660_105228181 | 192 |
| 43 | 3300025921 | Ga0207652_10197228 | Ga0207652_101972282 | 192 |
| 44 | 3300046674 | Ga0495588_0082529 | Ga0495588_0082529_213_842 | 192 |
| 45 | 3300050494 | nmdc:mga06z11_432393_c1 | nmdc:mga06z11_432393_c1_13_657 | 193 |
| 46 | 3300005295 | Ga0065707_10290892 | Ga0065707_102908922 | 194 |
| 47 | 3300005329 | Ga0070683_100079053 | Ga0070683_1000790533 | 194 |
| 48 | 3300005614 | Ga0068856_100111496 | Ga0068856_1001114963 | 194 |
| 49 | 3300009093 | Ga0105240_10002142 | Ga0105240_100021423 | 194 |
| 50 | 3300013104 | Ga0157370_10089962 | Ga0157370_100899622 | 194 |
| 51 | 3300013105 | Ga0157369_10001363 | Ga0157369_1000136330 | 194 |
| 52 | 3300013105 | Ga0157369_10003286 | Ga0157369_1000328619 | 194 |
| 53 | 3300013307 | Ga0157372_10000968 | Ga0157372_1000096830 | 194 |
| 54 | 3300025913 | Ga0207695_10003501 | Ga0207695_1000350119 | 194 |
| 55 | 3300025917 | Ga0207660_10615744 | Ga0207660_106157441 | 194 |
| 56 | 3300025921 | Ga0207652_10104650 | Ga0207652_101046505 | 194 |
| 57 | 3300025924 | Ga0207694_10035082 | Ga0207694_100350822 | 194 |
| 58 | 3300025924 | Ga0207694_10238891 | Ga0207694_102388912 | 194 |
| 59 | 3300025944 | Ga0207661_10035472 | Ga0207661_100354724 | 194 |
| 60 | 3300025949 | Ga0207667_10002772 | Ga0207667_1000277215 | 194 |
| 61 | 3300026078 | Ga0207702_10216516 | Ga0207702_102165163 | 194 |
| 62 | 3300039447 | Ga0436361_0807603 | Ga0436361_0807603_154_843 | 194 |
| 63 | 3300049573 | Ga0501037_0099222 | Ga0501037_0099222_304_936 | 194 |
| 64 | 3300049574 | Ga0501038_0008308 | Ga0501038_0008308_8385_9017 | 194 |
| 65 | 3300049575 | Ga0501039_0075802 | Ga0501039_0075802_486_1118 | 194 |
| 66 | 3300049579 | Ga0501043_0018518 | Ga0501043_0018518_3276_3908 | 194 |
| 67 | 3300049580 | Ga0501046_0108943 | Ga0501046_0108943_454_1086 | 194 |
| 68 | 3300049581 | Ga0501047_0124677 | Ga0501047_0124677_1740_2372 | 194 |
| 69 | 3300049823 | Ga0501044_0008204 | Ga0501044_0008204_7743_8375 | 194 |
| 70 | 3300005458 | Ga0070681_10008604 | Ga0070681_100086046 | 195 |
| 71 | 3300005535 | Ga0070684_100450704 | Ga0070684_1004507042 | 195 |
| 72 | 3300005616 | Ga0068852_100464638 | Ga0068852_1004646382 | 195 |
| 73 | 3300013307 | Ga0157372_10685876 | Ga0157372_106858762 | 195 |
| 74 | 3300031235 | Ga0265330_10014736 | Ga0265330_100147364 | 195 |
| 75 | 3300031344 | Ga0265316_10004054 | Ga0265316_100040544 | 195 |
| 76 | 3300031712 | Ga0265342_10006946 | Ga0265342_100069465 | 195 |
| 77 | iso_pu_bacteria | 2884693830 | 2884700044 | 195 |
| 78 | iso_pu_bacteria | 2895442618 | 2895450016 | 195 |
| 79 | 3300005355 | Ga0070671_100010716 | Ga0070671_1000107165 | 196 |
| 80 | 3300005618 | Ga0068864_100032802 | Ga0068864_1000328024 | 196 |
| 81 | 3300005841 | Ga0068863_100099236 | Ga0068863_1000992364 | 196 |
| 82 | 3300006237 | Ga0097621_100004481 | Ga0097621_1000044815 | 196 |
| 83 | 3300006358 | Ga0068871_100004639 | Ga0068871_1000046392 | 196 |
| 84 | 3300009176 | Ga0105242_10116716 | Ga0105242_101167162 | 196 |
| 85 | 3300009177 | Ga0105248_10050185 | Ga0105248_100501855 | 196 |
| 86 | 3300013296 | Ga0157374_10000158 | Ga0157374_1000015870 | 196 |
| 87 | 3300014969 | Ga0157376_10000504 | Ga0157376_100005045 | 196 |
| 88 | 3300025931 | Ga0207644_10024876 | Ga0207644_100248765 | 196 |
| 89 | 3300025941 | Ga0207711_10028170 | Ga0207711_100281703 | 196 |
| 90 | 3300026088 | Ga0207641_10084028 | Ga0207641_100840282 | 196 |
| 91 | 3300026095 | Ga0207676_10351848 | Ga0207676_103518482 | 196 |
| 92 | 3300013306 | Ga0163162_10036600 | Ga0163162_100366007 | 197 |
| 93 | 3300035692 | Ga0373935_0197784 | Ga0373935_0197784_496_1110 | 198 |
| 94 | 3300028666 | Ga0265336_10097129 | Ga0265336_100971292 | 199 |
| 95 | 3300031595 | Ga0265313_10000004 | Ga0265313_10000004145 | 199 |
| 96 | iso_pu_bacteria | 2515154123 | 2515688237 | 199 |
| 97 | iso_pu_bacteria | 2718217927 | 2719384146 | 199 |
| 98 | iso_pu_bacteria | 2721755763 | 2723875837 | 199 |
| 99 | iso_pu_bacteria | 2842462802 | 2842462823 | 199 |
| 100 | iso_pu_bacteria | 2891326441 | 2891330014 | 199 |
| 101 | iso_pu_bacteria | 2904434214 | 2904436662 | 199 |
| 102 | iso_pu_bacteria | 3006425503 | 3006428595 | 199 |
| 103 | iso_pu_bacteria | 3006486233 | 3006488871 | 199 |
| 104 | iso_pu_bacteria | 8005275841 | 8005278856 | 199 |
| 105 | iso_pu_bacteria | 8008485437 | 8008487469 | 199 |
| 106 | iso_pu_bacteria | 8025478263 | 8025481731 | 199 |
| 107 | iso_pu_bacteria | 8025524527 | 8025527011 | 199 |
| 108 | iso_pu_bacteria | 8033684223 | 8033689934 | 199 |
| 109 | iso_pu_bacteria | 8047893842 | 8047896765 | 199 |
| 110 | iso_pu_bacteria | 8056829672 | 8056832119 | 199 |
| 111 | 3300005435 | Ga0070714_100095720 | Ga0070714_1000957204 | 200 |
| 112 | 3300005435 | Ga0070714_100242505 | Ga0070714_1002425052 | 200 |
| 113 | 3300006914 | Ga0075436_100030317 | Ga0075436_1000303174 | 200 |
| 114 | 3300025929 | Ga0207664_10082927 | Ga0207664_100829274 | 200 |
| 115 | 3300025929 | Ga0207664_10246337 | Ga0207664_102463372 | 200 |
| 116 | 3300050513 | nmdc:mga0rr50_244214_c1 | nmdc:mga0rr50_244214_c1_550_1170 | 200 |
| 117 | 3300050514 | nmdc:mga08x19_14339_c1 | nmdc:mga08x19_14339_c1_2492_3112 | 200 |
| 118 | 3300049586 | Ga0501070_0024586 | Ga0501070_0024586_814_1446 | 201 |
| 119 | 3300003320 | rootH2_10144468 | rootH2_101444682 | 202 |
| 120 | 3300005295 | Ga0065707_10319758 | Ga0065707_103197582 | 202 |
| 121 | 3300005327 | Ga0070658_10046895 | Ga0070658_100468952 | 202 |
| 122 | 3300005327 | Ga0070658_11061796 | Ga0070658_110617961 | 202 |
| 123 | 3300005328 | Ga0070676_10206723 | Ga0070676_102067232 | 202 |
| 124 | 3300005329 | Ga0070683_100000655 | Ga0070683_10000065516 | 202 |
| 125 | 3300005329 | Ga0070683_100006909 | Ga0070683_1000069095 | 202 |
| 126 | 3300005329 | Ga0070683_100369058 | Ga0070683_1003690582 | 202 |
| 127 | 3300005329 | Ga0070683_100604067 | Ga0070683_1006040671 | 202 |
| 128 | 3300005331 | Ga0070670_100002779 | Ga0070670_1000027792 | 202 |
| 129 | 3300005331 | Ga0070670_100216564 | Ga0070670_1002165642 | 202 |
| 130 | 3300005335 | Ga0070666_10498290 | Ga0070666_104982901 | 202 |
| 131 | 3300005337 | Ga0070682_100071427 | Ga0070682_1000714272 | 202 |
| 132 | 3300005337 | Ga0070682_100320308 | Ga0070682_1003203082 | 202 |
| 133 | 3300005338 | Ga0068868_100089736 | Ga0068868_1000897363 | 202 |
| 134 | 3300005338 | Ga0068868_100103379 | Ga0068868_1001033792 | 202 |
| 135 | 3300005339 | Ga0070660_100117534 | Ga0070660_1001175343 | 202 |
| 136 | 3300005347 | Ga0070668_100292271 | Ga0070668_1002922712 | 202 |
| 137 | 3300005347 | Ga0070668_100663585 | Ga0070668_1006635851 | 202 |
| 138 | 3300005353 | Ga0070669_100000566 | Ga0070669_10000056619 | 202 |
| 139 | 3300005354 | Ga0070675_100267169 | Ga0070675_1002671692 | 202 |
| 140 | 3300005356 | Ga0070674_100299205 | Ga0070674_1002992052 | 202 |
| 141 | 3300005366 | Ga0070659_100029486 | Ga0070659_1000294864 | 202 |
| 142 | 3300005366 | Ga0070659_100445278 | Ga0070659_1004452782 | 202 |
| 143 | 3300005367 | Ga0070667_100147454 | Ga0070667_1001474543 | 202 |
| 144 | 3300005435 | Ga0070714_100032491 | Ga0070714_1000324916 | 202 |
| 145 | 3300005436 | Ga0070713_100013756 | Ga0070713_1000137562 | 202 |
| 146 | 3300005438 | Ga0070701_10003257 | Ga0070701_100032576 | 202 |
| 147 | 3300005441 | Ga0070700_100131955 | Ga0070700_1001319552 | 202 |
| 148 | 3300005444 | Ga0070694_100577194 | Ga0070694_1005771942 | 202 |
| 149 | 3300005445 | Ga0070708_100080082 | Ga0070708_1000800823 | 202 |
| 150 | 3300005458 | Ga0070681_10003042 | Ga0070681_1000304211 | 202 |
| 151 | 3300005458 | Ga0070681_10419523 | Ga0070681_104195232 | 202 |
| 152 | 3300005459 | Ga0068867_100032665 | Ga0068867_1000326652 | 202 |
| 153 | 3300005459 | Ga0068867_100100291 | Ga0068867_1001002912 | 202 |
| 154 | 3300005467 | Ga0070706_100036866 | Ga0070706_1000368665 | 202 |
| 155 | 3300005467 | Ga0070706_100758452 | Ga0070706_1007584521 | 202 |
| 156 | 3300005468 | Ga0070707_100233126 | Ga0070707_1002331262 | 202 |
| 157 | 3300005468 | Ga0070707_101086147 | Ga0070707_1010861471 | 202 |
| 158 | 3300005471 | Ga0070698_100000122 | Ga0070698_10000012247 | 202 |
| 159 | 3300005471 | Ga0070698_100147322 | Ga0070698_1001473222 | 202 |
| 160 | 3300005471 | Ga0070698_100380437 | Ga0070698_1003804371 | 202 |
| 161 | 3300005518 | Ga0070699_100000779 | Ga0070699_10000077917 | 202 |
| 162 | 3300005518 | Ga0070699_100010635 | Ga0070699_1000106358 | 202 |
| 163 | 3300005518 | Ga0070699_100064235 | Ga0070699_1000642354 | 202 |
| 164 | 3300005530 | Ga0070679_100013231 | Ga0070679_1000132313 | 202 |
| 165 | 3300005535 | Ga0070684_100016107 | Ga0070684_1000161074 | 202 |
| 166 | 3300005535 | Ga0070684_100055337 | Ga0070684_1000553373 | 202 |
| 167 | 3300005535 | Ga0070684_100224294 | Ga0070684_1002242942 | 202 |
| 168 | 3300005535 | Ga0070684_100349077 | Ga0070684_1003490772 | 202 |
| 169 | 3300005536 | Ga0070697_100008526 | Ga0070697_1000085268 | 202 |
| 170 | 3300005539 | Ga0068853_100358428 | Ga0068853_1003584282 | 202 |
| 171 | 3300005543 | Ga0070672_100164581 | Ga0070672_1001645813 | 202 |
| 172 | 3300005545 | Ga0070695_100046003 | Ga0070695_1000460033 | 202 |
| 173 | 3300005546 | Ga0070696_100000059 | Ga0070696_10000005921 | 202 |
| 174 | 3300005546 | Ga0070696_100018215 | Ga0070696_1000182154 | 202 |
| 175 | 3300005547 | Ga0070693_100018308 | Ga0070693_1000183083 | 202 |
| 176 | 3300005547 | Ga0070693_100270123 | Ga0070693_1002701231 | 202 |
| 177 | 3300005548 | Ga0070665_100120769 | Ga0070665_1001207691 | 202 |
| 178 | 3300005563 | Ga0068855_100002369 | Ga0068855_1000023695 | 202 |
| 179 | 3300005563 | Ga0068855_100030887 | Ga0068855_1000308877 | 202 |
| 180 | 3300005563 | Ga0068855_100047437 | Ga0068855_1000474375 | 202 |
| 181 | 3300005564 | Ga0070664_100013004 | Ga0070664_1000130044 | 202 |
| 182 | 3300005564 | Ga0070664_100289697 | Ga0070664_1002896971 | 202 |
| 183 | 3300005564 | Ga0070664_100587608 | Ga0070664_1005876081 | 202 |
| 184 | 3300005577 | Ga0068857_100009041 | Ga0068857_1000090419 | 202 |
| 185 | 3300005577 | Ga0068857_100010828 | Ga0068857_1000108287 | 202 |
| 186 | 3300005578 | Ga0068854_100224209 | Ga0068854_1002242092 | 202 |
| 187 | 3300005614 | Ga0068856_100243791 | Ga0068856_1002437912 | 202 |
| 188 | 3300005614 | Ga0068856_100579993 | Ga0068856_1005799932 | 202 |
| 189 | 3300005616 | Ga0068852_100161080 | Ga0068852_1001610802 | 202 |
| 190 | 3300005616 | Ga0068852_100189299 | Ga0068852_1001892992 | 202 |
| 191 | 3300005616 | Ga0068852_100335586 | Ga0068852_1003355862 | 202 |
| 192 | 3300005617 | Ga0068859_100186844 | Ga0068859_1001868442 | 202 |
| 193 | 3300005617 | Ga0068859_100228879 | Ga0068859_1002288792 | 202 |
| 194 | 3300005617 | Ga0068859_100511465 | Ga0068859_1005114652 | 202 |
| 195 | 3300005718 | Ga0068866_10090041 | Ga0068866_100900412 | 202 |
| 196 | 3300005719 | Ga0068861_100231039 | Ga0068861_1002310392 | 202 |
| 197 | 3300005840 | Ga0068870_10018009 | Ga0068870_100180094 | 202 |
| 198 | 3300005841 | Ga0068863_100138558 | Ga0068863_1001385583 | 202 |
| 199 | 3300005842 | Ga0068858_100020693 | Ga0068858_1000206937 | 202 |
| 200 | 3300005843 | Ga0068860_100481535 | Ga0068860_1004815351 | 202 |
| 201 | 3300005843 | Ga0068860_100814766 | Ga0068860_1008147662 | 202 |
| 202 | 3300005843 | Ga0068860_100915722 | Ga0068860_1009157221 | 202 |
| 203 | 3300005844 | Ga0068862_100007064 | Ga0068862_1000070647 | 202 |
| 204 | 3300006195 | Ga0075366_10168125 | Ga0075366_101681251 | 202 |
| 205 | 3300006237 | Ga0097621_100095490 | Ga0097621_1000954903 | 202 |
| 206 | 3300006237 | Ga0097621_100369902 | Ga0097621_1003699021 | 202 |
| 207 | 3300006358 | Ga0068871_100049384 | Ga0068871_1000493842 | 202 |
| 208 | 3300006358 | Ga0068871_100063462 | Ga0068871_1000634623 | 202 |
| 209 | 3300006847 | Ga0075431_100197940 | Ga0075431_1001979402 | 202 |
| 210 | 3300006881 | Ga0068865_100071903 | Ga0068865_1000719032 | 202 |
| 211 | 3300006881 | Ga0068865_100194759 | Ga0068865_1001947592 | 202 |
| 212 | 3300006931 | Ga0097620_100186859 | Ga0097620_1001868593 | 202 |
| 213 | 3300006931 | Ga0097620_100228882 | Ga0097620_1002288822 | 202 |
| 214 | 3300006931 | Ga0097620_100511434 | Ga0097620_1005114342 | 202 |
| 215 | 3300007265 | Ga0099794_10119513 | Ga0099794_101195132 | 202 |
| 216 | 3300009093 | Ga0105240_10003537 | Ga0105240_1000353717 | 202 |
| 217 | 3300009093 | Ga0105240_10016265 | Ga0105240_1001626510 | 202 |
| 218 | 3300009093 | Ga0105240_11096136 | Ga0105240_110961361 | 202 |
| 219 | 3300009098 | Ga0105245_10075361 | Ga0105245_100753612 | 202 |
| 220 | 3300009098 | Ga0105245_10128517 | Ga0105245_101285172 | 202 |
| 221 | 3300009098 | Ga0105245_10724424 | Ga0105245_107244242 | 202 |
| 222 | 3300009174 | Ga0105241_10019962 | Ga0105241_100199626 | 202 |
| 223 | 3300009174 | Ga0105241_10495752 | Ga0105241_104957522 | 202 |
| 224 | 3300009174 | Ga0105241_11155599 | Ga0105241_111555991 | 202 |
| 225 | 3300009176 | Ga0105242_10000494 | Ga0105242_1000049416 | 202 |
| 226 | 3300009176 | Ga0105242_10002807 | Ga0105242_100028079 | 202 |
| 227 | 3300009176 | Ga0105242_10326789 | Ga0105242_103267891 | 202 |
| 228 | 3300009177 | Ga0105248_10110766 | Ga0105248_101107664 | 202 |
| 229 | 3300009177 | Ga0105248_10151528 | Ga0105248_101515283 | 202 |
| 230 | 3300009177 | Ga0105248_10157021 | Ga0105248_101570213 | 202 |
| 231 | 3300009177 | Ga0105248_10265137 | Ga0105248_102651373 | 202 |
| 232 | 3300009177 | Ga0105248_10884624 | Ga0105248_108846241 | 202 |
| 233 | 3300009545 | Ga0105237_10314435 | Ga0105237_103144351 | 202 |
| 234 | 3300009551 | Ga0105238_10023340 | Ga0105238_100233405 | 202 |
| 235 | 3300009551 | Ga0105238_10040071 | Ga0105238_100400714 | 202 |
| 236 | 3300009551 | Ga0105238_10110244 | Ga0105238_101102444 | 202 |
| 237 | 3300009551 | Ga0105238_10408914 | Ga0105238_104089142 | 202 |
| 238 | 3300009553 | Ga0105249_10000582 | Ga0105249_1000058219 | 202 |
| 239 | 3300009553 | Ga0105249_10110848 | Ga0105249_101108483 | 202 |
| 240 | 3300010375 | Ga0105239_10065246 | Ga0105239_100652464 | 202 |
| 241 | 3300011119 | Ga0105246_10239800 | Ga0105246_102398001 | 202 |
| 242 | 3300013104 | Ga0157370_10708518 | Ga0157370_107085182 | 202 |
| 243 | 3300013105 | Ga0157369_10122350 | Ga0157369_101223504 | 202 |
| 244 | 3300013105 | Ga0157369_10147357 | Ga0157369_101473573 | 202 |
| 245 | 3300013105 | Ga0157369_10198817 | Ga0157369_101988172 | 202 |
| 246 | 3300013105 | Ga0157369_10381642 | Ga0157369_103816422 | 202 |
| 247 | 3300013105 | Ga0157369_10424739 | Ga0157369_104247392 | 202 |
| 248 | 3300013296 | Ga0157374_10133732 | Ga0157374_101337322 | 202 |
| 249 | 3300013296 | Ga0157374_10243823 | Ga0157374_102438232 | 202 |
| 250 | 3300013306 | Ga0163162_10087536 | Ga0163162_100875364 | 202 |
| 251 | 3300013306 | Ga0163162_10285468 | Ga0163162_102854682 | 202 |
| 252 | 3300013306 | Ga0163162_10374191 | Ga0163162_103741913 | 202 |
| 253 | 3300013307 | Ga0157372_10034058 | Ga0157372_100340582 | 202 |
| 254 | 3300013307 | Ga0157372_10188970 | Ga0157372_101889702 | 202 |
| 255 | 3300013307 | Ga0157372_10552813 | Ga0157372_105528132 | 202 |
| 256 | 3300013307 | Ga0157372_10565726 | Ga0157372_105657262 | 202 |
| 257 | 3300013308 | Ga0157375_10014989 | Ga0157375_100149892 | 202 |
| 258 | 3300013308 | Ga0157375_10017676 | Ga0157375_100176762 | 202 |
| 259 | 3300013308 | Ga0157375_10416950 | Ga0157375_104169502 | 202 |
| 260 | 3300014326 | Ga0157380_10169393 | Ga0157380_101693932 | 202 |
| 261 | 3300014745 | Ga0157377_10134404 | Ga0157377_101344042 | 202 |
| 262 | 3300014968 | Ga0157379_10051452 | Ga0157379_100514522 | 202 |
| 263 | 3300014969 | Ga0157376_10168130 | Ga0157376_101681302 | 202 |
| 264 | 3300014969 | Ga0157376_10192030 | Ga0157376_101920302 | 202 |
| 265 | 3300014969 | Ga0157376_10244356 | Ga0157376_102443563 | 202 |
| 266 | 3300017792 | Ga0163161_10245198 | Ga0163161_102451982 | 202 |
| 267 | 3300025315 | Ga0207697_10071700 | Ga0207697_100717002 | 202 |
| 268 | 3300025899 | Ga0207642_10063368 | Ga0207642_100633682 | 202 |
| 269 | 3300025903 | Ga0207680_10239419 | Ga0207680_102394192 | 202 |
| 270 | 3300025907 | Ga0207645_10037069 | Ga0207645_100370693 | 202 |
| 271 | 3300025908 | Ga0207643_10005910 | Ga0207643_100059102 | 202 |
| 272 | 3300025909 | Ga0207705_10017431 | Ga0207705_100174315 | 202 |
| 273 | 3300025909 | Ga0207705_10693964 | Ga0207705_106939641 | 202 |
| 274 | 3300025910 | Ga0207684_10055225 | Ga0207684_100552254 | 202 |
| 275 | 3300025911 | Ga0207654_10237808 | Ga0207654_102378082 | 202 |
| 276 | 3300025912 | Ga0207707_10067287 | Ga0207707_100672873 | 202 |
| 277 | 3300025913 | Ga0207695_10001162 | Ga0207695_1000116239 | 202 |
| 278 | 3300025913 | Ga0207695_10061983 | Ga0207695_100619832 | 202 |
| 279 | 3300025919 | Ga0207657_10126537 | Ga0207657_101265372 | 202 |
| 280 | 3300025919 | Ga0207657_10496794 | Ga0207657_104967941 | 202 |
| 281 | 3300025922 | Ga0207646_10630679 | Ga0207646_106306792 | 202 |
| 282 | 3300025923 | Ga0207681_10001953 | Ga0207681_100019539 | 202 |
| 283 | 3300025923 | Ga0207681_10408253 | Ga0207681_104082531 | 202 |
| 284 | 3300025924 | Ga0207694_10223768 | Ga0207694_102237682 | 202 |
| 285 | 3300025924 | Ga0207694_10577942 | Ga0207694_105779421 | 202 |
| 286 | 3300025925 | Ga0207650_10557007 | Ga0207650_105570071 | 202 |
| 287 | 3300025927 | Ga0207687_10269446 | Ga0207687_102694461 | 202 |
| 288 | 3300025927 | Ga0207687_10286280 | Ga0207687_102862801 | 202 |
| 289 | 3300025928 | Ga0207700_10024905 | Ga0207700_100249054 | 202 |
| 290 | 3300025929 | Ga0207664_10074592 | Ga0207664_100745923 | 202 |
| 291 | 3300025929 | Ga0207664_10225412 | Ga0207664_102254122 | 202 |
| 292 | 3300025931 | Ga0207644_10916206 | Ga0207644_109162061 | 202 |
| 293 | 3300025934 | Ga0207686_10003613 | Ga0207686_100036135 | 202 |
| 294 | 3300025934 | Ga0207686_10059287 | Ga0207686_100592872 | 202 |
| 295 | 3300025934 | Ga0207686_10108662 | Ga0207686_101086622 | 202 |
| 296 | 3300025938 | Ga0207704_10109335 | Ga0207704_101093353 | 202 |
| 297 | 3300025940 | Ga0207691_10104455 | Ga0207691_101044554 | 202 |
| 298 | 3300025941 | Ga0207711_10198429 | Ga0207711_101984292 | 202 |
| 299 | 3300025941 | Ga0207711_10576668 | Ga0207711_105766682 | 202 |
| 300 | 3300025942 | Ga0207689_10429709 | Ga0207689_104297091 | 202 |
| 301 | 3300025944 | Ga0207661_10004560 | Ga0207661_100045609 | 202 |
| 302 | 3300025944 | Ga0207661_10043953 | Ga0207661_100439532 | 202 |
| 303 | 3300025944 | Ga0207661_10054675 | Ga0207661_100546752 | 202 |
| 304 | 3300025945 | Ga0207679_10040294 | Ga0207679_100402943 | 202 |
| 305 | 3300025945 | Ga0207679_10211073 | Ga0207679_102110733 | 202 |
| 306 | 3300025949 | Ga0207667_10011432 | Ga0207667_100114326 | 202 |
| 307 | 3300025949 | Ga0207667_10237727 | Ga0207667_102377271 | 202 |
| 308 | 3300025949 | Ga0207667_10661481 | Ga0207667_106614811 | 202 |
| 309 | 3300025961 | Ga0207712_10033535 | Ga0207712_100335353 | 202 |
| 310 | 3300025961 | Ga0207712_10090893 | Ga0207712_100908932 | 202 |
| 311 | 3300025972 | Ga0207668_10021239 | Ga0207668_100212392 | 202 |
| 312 | 3300025972 | Ga0207668_10135080 | Ga0207668_101350801 | 202 |
| 313 | 3300025972 | Ga0207668_10290103 | Ga0207668_102901031 | 202 |
| 314 | 3300025986 | Ga0207658_10119678 | Ga0207658_101196782 | 202 |
| 315 | 3300026023 | Ga0207677_10207681 | Ga0207677_102076812 | 202 |
| 316 | 3300026035 | Ga0207703_10016259 | Ga0207703_100162596 | 202 |
| 317 | 3300026075 | Ga0207708_10081783 | Ga0207708_100817833 | 202 |
| 318 | 3300026078 | Ga0207702_10163517 | Ga0207702_101635172 | 202 |
| 319 | 3300026078 | Ga0207702_10215461 | Ga0207702_102154611 | 202 |
| 320 | 3300026078 | Ga0207702_10667301 | Ga0207702_106673011 | 202 |
| 321 | 3300026088 | Ga0207641_10157741 | Ga0207641_101577412 | 202 |
| 322 | 3300026089 | Ga0207648_10091323 | Ga0207648_100913233 | 202 |
| 323 | 3300026089 | Ga0207648_10271522 | Ga0207648_102715223 | 202 |
| 324 | 3300026116 | Ga0207674_10020080 | Ga0207674_100200806 | 202 |
| 325 | 3300026116 | Ga0207674_10229698 | Ga0207674_102296981 | 202 |
| 326 | 3300026118 | Ga0207675_100186703 | Ga0207675_1001867032 | 202 |
| 327 | 3300026121 | Ga0207683_10674667 | Ga0207683_106746671 | 202 |
| 328 | 3300026142 | Ga0207698_10366481 | Ga0207698_103664812 | 202 |
| 329 | 3300028379 | Ga0268266_11028465 | Ga0268266_110284651 | 202 |
| 330 | 3300028380 | Ga0268265_10001794 | Ga0268265_100017946 | 202 |
| 331 | 3300028380 | Ga0268265_10140629 | Ga0268265_101406292 | 202 |
| 332 | 3300028381 | Ga0268264_10408325 | Ga0268264_104083252 | 202 |
| 333 | 3300028381 | Ga0268264_10428336 | Ga0268264_104283362 | 202 |
| 334 | 3300031731 | Ga0307405_10164712 | Ga0307405_101647122 | 202 |
| 335 | 3300031995 | Ga0307409_100962409 | Ga0307409_1009624092 | 202 |
| 336 | 3300032002 | Ga0307416_100518137 | Ga0307416_1005181372 | 202 |
| 337 | 3300032004 | Ga0307414_10140692 | Ga0307414_101406922 | 202 |
| 338 | 3300035085 | Ga0373929_0030848 | Ga0373929_0030848_421_1053 | 202 |
| 339 | 3300035114 | Ga0373939_0130243 | Ga0373939_0130243_138_770 | 202 |
| 340 | 3300035119 | Ga0373956_0020139 | Ga0373956_0020139_1742_2398 | 202 |
| 341 | 3300035171 | Ga0373946_0372657 | Ga0373946_0372657_56_685 | 202 |
| 342 | 3300035207 | Ga0373942_0008853 | Ga0373942_0008853_64_696 | 202 |
| 343 | 3300035691 | Ga0373931_0141454 | Ga0373931_0141454_225_857 | 202 |
| 344 | 3300035724 | Ga0373933_0013413 | Ga0373933_0013413_2163_2795 | 202 |
| 345 | 3300035725 | Ga0373947_0158352 | Ga0373947_0158352_36_665 | 202 |
| 346 | 3300036401 | Ga0373937_0126984 | Ga0373937_0126984_1117_1773 | 202 |
| 347 | 3300041494 | Ga0451837_1244620 | Ga0451837_1244620_319_951 | 202 |
| 348 | 3300042005 | Ga0439448_0012918 | Ga0439448_0012918_658_1290 | 202 |
| 349 | 3300042876 | Ga0451577_0703078 | Ga0451577_0703078_200_841 | 202 |
| 350 | 3300044684 | Ga0466966_0045063 | Ga0466966_0045063_1894_2526 | 202 |
| 351 | 3300044694 | Ga0466963_0033456 | Ga0466963_0033456_566_1195 | 202 |
| 352 | 3300044694 | Ga0466963_0088979 | Ga0466963_0088979_1449_2081 | 202 |
| 353 | 3300044694 | Ga0466963_0336435 | Ga0466963_0336435_156_788 | 202 |
| 354 | 3300044719 | Ga0466971_0281552 | Ga0466971_0281552_48_680 | 202 |
| 355 | 3300045049 | Ga0466959_0117826 | Ga0466959_0117826_1129_1761 | 202 |
| 356 | 3300045976 | Ga0466967_0664439 | Ga0466967_0664439_220_849 | 202 |
| 357 | 3300046459 | Ga0495629_0483559 | Ga0495629_0483559_136_765 | 202 |
| 358 | 3300046460 | Ga0495638_0135704 | Ga0495638_0135704_378_1016 | 202 |
| 359 | 3300046463 | Ga0495653_0139753 | Ga0495653_0139753_999_1631 | 202 |
| 360 | 3300046499 | Ga0495594_0054450 | Ga0495594_0054450_424_1053 | 202 |
| 361 | 3300046499 | Ga0495594_0062189 | Ga0495594_0062189_995_1624 | 202 |
| 362 | 3300046514 | Ga0495618_0237874 | Ga0495618_0237874_365_994 | 202 |
| 363 | 3300046517 | Ga0495630_0300125 | Ga0495630_0300125_560_1189 | 202 |
| 364 | 3300046529 | Ga0495652_0041799 | Ga0495652_0041799_3138_3770 | 202 |
| 365 | 3300046531 | Ga0495665_0008286 | Ga0495665_0008286_4205_4834 | 202 |
| 366 | 3300046535 | Ga0495586_0248381 | Ga0495586_0248381_355_984 | 202 |
| 367 | 3300046536 | Ga0495587_0063377 | Ga0495587_0063377_331_963 | 202 |
| 368 | 3300046543 | Ga0495645_0006492 | Ga0495645_0006492_1116_1748 | 202 |
| 369 | 3300046642 | Ga0495634_0069434 | Ga0495634_0069434_1392_2021 | 202 |
| 370 | 3300046663 | Ga0495635_0083784 | Ga0495635_0083784_710_1342 | 202 |
| 371 | 3300046681 | Ga0495647_0134608 | Ga0495647_0134608_15_644 | 202 |
| 372 | 3300047317 | Ga0495604_0071217 | Ga0495604_0071217_241_873 | 202 |
| 373 | 3300047319 | Ga0495674_0073126 | Ga0495674_0073126_412_1041 | 202 |
| 374 | 3300047471 | Ga0495684_0008456 | Ga0495684_0008456_3290_3919 | 202 |
| 375 | 3300047472 | Ga0495686_0016441 | Ga0495686_0016441_3014_3646 | 202 |
| 376 | 3300048088 | Ga0495602_0035227 | Ga0495602_0035227_3927_4559 | 202 |
| 377 | 3300048907 | Ga0496104_0000014 | Ga0496104_0000014_130154_130786 | 202 |
| 378 | 3300049576 | Ga0501040_0132370 | Ga0501040_0132370_1099_1728 | 202 |
| 379 | 3300049579 | Ga0501043_0543496 | Ga0501043_0543496_25_657 | 202 |
| 380 | 3300049582 | Ga0501048_0001269 | Ga0501048_0001269_2285_2917 | 202 |
| 381 | 3300049593 | Ga0501077_0155092 | Ga0501077_0155092_776_1396 | 202 |
| 382 | 3300049668 | Ga0501233_081863 | Ga0501233_081863_61_693 | 202 |
| 383 | 3300049822 | Ga0501035_0407055 | Ga0501035_0407055_156_788 | 202 |
| 384 | 3300050493 | nmdc:mga0k408_363755_c1 | nmdc:mga0k408_363755_c1_128_760 | 202 |
| 385 | 3300050508 | nmdc:mga09592_4370_c1 | nmdc:mga09592_4370_c1_8724_9362 | 202 |
| 386 | 3300050509 | nmdc:mga0qj67_145_c1 | nmdc:mga0qj67_145_c1_34690_35328 | 202 |
| 387 | 3300050510 | nmdc:mga06r32_244046_c1 | nmdc:mga06r32_244046_c1_1004_1639 | 202 |
| 388 | 3300050511 | nmdc:mga08y16_50614_c1 | nmdc:mga08y16_50614_c1_3397_4032 | 202 |
| 389 | 3300053133 | Ga0500655_008591 | Ga0500655_008591_190_825 | 202 |
| 390 | 3300053150 | Ga0500603_054851 | Ga0500603_054851_162_809 | 202 |
| 391 | 3300053737 | Ga0500601_000465 | Ga0500601_000465_4380_5009 | 202 |
| 392 | 3300005293 | Ga0065715_10167639 | Ga0065715_101676392 | 203 |
| 393 | 3300005327 | Ga0070658_10045668 | Ga0070658_100456682 | 203 |
| 394 | 3300005327 | Ga0070658_10190980 | Ga0070658_101909803 | 203 |
| 395 | 3300005330 | Ga0070690_100337578 | Ga0070690_1003375782 | 203 |
| 396 | 3300005331 | Ga0070670_100339023 | Ga0070670_1003390232 | 203 |
| 397 | 3300005336 | Ga0070680_100006802 | Ga0070680_1000068025 | 203 |
| 398 | 3300005336 | Ga0070680_100024698 | Ga0070680_1000246983 | 203 |
| 399 | 3300005336 | Ga0070680_100031242 | Ga0070680_1000312426 | 203 |
| 400 | 3300005339 | Ga0070660_100065655 | Ga0070660_1000656553 | 203 |
| 401 | 3300005339 | Ga0070660_100385862 | Ga0070660_1003858622 | 203 |
| 402 | 3300005344 | Ga0070661_100121211 | Ga0070661_1001212112 | 203 |
| 403 | 3300005345 | Ga0070692_10282046 | Ga0070692_102820461 | 203 |
| 404 | 3300005354 | Ga0070675_100605232 | Ga0070675_1006052322 | 203 |
| 405 | 3300005354 | Ga0070675_101225365 | Ga0070675_1012253651 | 203 |
| 406 | 3300005355 | Ga0070671_100009865 | Ga0070671_1000098653 | 203 |
| 407 | 3300005364 | Ga0070673_100064069 | Ga0070673_1000640692 | 203 |
| 408 | 3300005364 | Ga0070673_100881302 | Ga0070673_1008813021 | 203 |
| 409 | 3300005366 | Ga0070659_100038787 | Ga0070659_1000387873 | 203 |
| 410 | 3300005366 | Ga0070659_100205948 | Ga0070659_1002059482 | 203 |
| 411 | 3300005434 | Ga0070709_10463011 | Ga0070709_104630111 | 203 |
| 412 | 3300005435 | Ga0070714_100006448 | Ga0070714_1000064486 | 203 |
| 413 | 3300005435 | Ga0070714_100188936 | Ga0070714_1001889362 | 203 |
| 414 | 3300005436 | Ga0070713_100565883 | Ga0070713_1005658833 | 203 |
| 415 | 3300005437 | Ga0070710_10003320 | Ga0070710_100033205 | 203 |
| 416 | 3300005438 | Ga0070701_10056268 | Ga0070701_100562683 | 203 |
| 417 | 3300005440 | Ga0070705_100002041 | Ga0070705_1000020414 | 203 |
| 418 | 3300005444 | Ga0070694_100007030 | Ga0070694_1000070304 | 203 |
| 419 | 3300005444 | Ga0070694_100043995 | Ga0070694_1000439953 | 203 |
| 420 | 3300005444 | Ga0070694_100547592 | Ga0070694_1005475921 | 203 |
| 421 | 3300005445 | Ga0070708_100000381 | Ga0070708_1000003819 | 203 |
| 422 | 3300005445 | Ga0070708_100012335 | Ga0070708_1000123358 | 203 |
| 423 | 3300005456 | Ga0070678_100533244 | Ga0070678_1005332442 | 203 |
| 424 | 3300005458 | Ga0070681_10125458 | Ga0070681_101254583 | 203 |
| 425 | 3300005458 | Ga0070681_10169599 | Ga0070681_101695993 | 203 |
| 426 | 3300005466 | Ga0070685_10002911 | Ga0070685_100029112 | 203 |
| 427 | 3300005467 | Ga0070706_100008495 | Ga0070706_1000084953 | 203 |
| 428 | 3300005467 | Ga0070706_100074652 | Ga0070706_1000746523 | 203 |
| 429 | 3300005467 | Ga0070706_100127696 | Ga0070706_1001276963 | 203 |
| 430 | 3300005468 | Ga0070707_100002489 | Ga0070707_1000024899 | 203 |
| 431 | 3300005468 | Ga0070707_100032687 | Ga0070707_1000326873 | 203 |
| 432 | 3300005468 | Ga0070707_100044161 | Ga0070707_1000441614 | 203 |
| 433 | 3300005468 | Ga0070707_100134698 | Ga0070707_1001346983 | 203 |
| 434 | 3300005471 | Ga0070698_100002933 | Ga0070698_10000293313 | 203 |
| 435 | 3300005471 | Ga0070698_100165574 | Ga0070698_1001655743 | 203 |
| 436 | 3300005518 | Ga0070699_100001147 | Ga0070699_1000011477 | 203 |
| 437 | 3300005518 | Ga0070699_100002138 | Ga0070699_10000213811 | 203 |
| 438 | 3300005518 | Ga0070699_100740251 | Ga0070699_1007402511 | 203 |
| 439 | 3300005530 | Ga0070679_100026551 | Ga0070679_1000265515 | 203 |
| 440 | 3300005530 | Ga0070679_100069429 | Ga0070679_1000694291 | 203 |
| 441 | 3300005530 | Ga0070679_100127633 | Ga0070679_1001276333 | 203 |
| 442 | 3300005530 | Ga0070679_100605950 | Ga0070679_1006059502 | 203 |
| 443 | 3300005530 | Ga0070679_101220636 | Ga0070679_1012206361 | 203 |
| 444 | 3300005536 | Ga0070697_100000272 | Ga0070697_1000002727 | 203 |
| 445 | 3300005536 | Ga0070697_100002379 | Ga0070697_1000023794 | 203 |
| 446 | 3300005536 | Ga0070697_100050347 | Ga0070697_1000503471 | 203 |
| 447 | 3300005536 | Ga0070697_100064880 | Ga0070697_1000648803 | 203 |
| 448 | 3300005539 | Ga0068853_100251114 | Ga0068853_1002511142 | 203 |
| 449 | 3300005543 | Ga0070672_100222904 | Ga0070672_1002229042 | 203 |
| 450 | 3300005544 | Ga0070686_100110580 | Ga0070686_1001105803 | 203 |
| 451 | 3300005545 | Ga0070695_100002517 | Ga0070695_1000025178 | 203 |
| 452 | 3300005545 | Ga0070695_100021848 | Ga0070695_1000218484 | 203 |
| 453 | 3300005545 | Ga0070695_100130069 | Ga0070695_1001300692 | 203 |
| 454 | 3300005546 | Ga0070696_100003944 | Ga0070696_1000039447 | 203 |
| 455 | 3300005546 | Ga0070696_100017114 | Ga0070696_1000171145 | 203 |
| 456 | 3300005546 | Ga0070696_100346782 | Ga0070696_1003467822 | 203 |
| 457 | 3300005546 | Ga0070696_100409163 | Ga0070696_1004091632 | 203 |
| 458 | 3300005548 | Ga0070665_100082484 | Ga0070665_1000824842 | 203 |
| 459 | 3300005548 | Ga0070665_100498637 | Ga0070665_1004986372 | 203 |
| 460 | 3300005563 | Ga0068855_100604565 | Ga0068855_1006045652 | 203 |
| 461 | 3300005615 | Ga0070702_100151051 | Ga0070702_1001510511 | 203 |
| 462 | 3300005617 | Ga0068859_100123633 | Ga0068859_1001236333 | 203 |
| 463 | 3300005617 | Ga0068859_100182134 | Ga0068859_1001821342 | 203 |
| 464 | 3300005617 | Ga0068859_100620865 | Ga0068859_1006208652 | 203 |
| 465 | 3300005618 | Ga0068864_100216853 | Ga0068864_1002168531 | 203 |
| 466 | 3300005842 | Ga0068858_100318188 | Ga0068858_1003181882 | 203 |
| 467 | 3300005843 | Ga0068860_100011796 | Ga0068860_1000117963 | 203 |
| 468 | 3300005844 | Ga0068862_100640600 | Ga0068862_1006406002 | 203 |
| 469 | 3300005844 | Ga0068862_100856178 | Ga0068862_1008561781 | 203 |
| 470 | 3300005844 | Ga0068862_100928672 | Ga0068862_1009286722 | 203 |
| 471 | 3300005844 | Ga0068862_101013634 | Ga0068862_1010136341 | 203 |
| 472 | 3300005937 | Ga0081455_10000733 | Ga0081455_1000073325 | 203 |
| 473 | 3300005981 | Ga0081538_10006932 | Ga0081538_100069323 | 203 |
| 474 | 3300005981 | Ga0081538_10013401 | Ga0081538_100134016 | 203 |
| 475 | 3300005981 | Ga0081538_10019713 | Ga0081538_100197132 | 203 |
| 476 | 3300005985 | Ga0081539_10000087 | Ga0081539_1000008790 | 203 |
| 477 | 3300006175 | Ga0070712_100273466 | Ga0070712_1002734662 | 203 |
| 478 | 3300006178 | Ga0075367_10086696 | Ga0075367_100866962 | 203 |
| 479 | 3300006195 | Ga0075366_10051119 | Ga0075366_100511193 | 203 |
| 480 | 3300006237 | Ga0097621_100077827 | Ga0097621_1000778273 | 203 |
| 481 | 3300006353 | Ga0075370_10015474 | Ga0075370_100154742 | 203 |
| 482 | 3300006358 | Ga0068871_100032288 | Ga0068871_1000322883 | 203 |
| 483 | 3300006846 | Ga0075430_100042803 | Ga0075430_1000428034 | 203 |
| 484 | 3300006846 | Ga0075430_100060159 | Ga0075430_1000601593 | 203 |
| 485 | 3300006846 | Ga0075430_100283840 | Ga0075430_1002838401 | 203 |
| 486 | 3300006847 | Ga0075431_100047077 | Ga0075431_1000470772 | 203 |
| 487 | 3300006847 | Ga0075431_100067520 | Ga0075431_1000675203 | 203 |
| 488 | 3300006847 | Ga0075431_100106084 | Ga0075431_1001060842 | 203 |
| 489 | 3300006847 | Ga0075431_100189656 | Ga0075431_1001896563 | 203 |
| 490 | 3300006847 | Ga0075431_101006526 | Ga0075431_1010065262 | 203 |
| 491 | 3300006852 | Ga0075433_10438048 | Ga0075433_104380482 | 203 |
| 492 | 3300006871 | Ga0075434_100004223 | Ga0075434_10000422310 | 203 |
| 493 | 3300006871 | Ga0075434_100038828 | Ga0075434_1000388284 | 203 |
| 494 | 3300006871 | Ga0075434_100054837 | Ga0075434_1000548375 | 203 |
| 495 | 3300006871 | Ga0075434_100383321 | Ga0075434_1003833212 | 203 |
| 496 | 3300006871 | Ga0075434_100770395 | Ga0075434_1007703952 | 203 |
| 497 | 3300006880 | Ga0075429_100719775 | Ga0075429_1007197752 | 203 |
| 498 | 3300006914 | Ga0075436_100008037 | Ga0075436_1000080378 | 203 |
| 499 | 3300006914 | Ga0075436_100048619 | Ga0075436_1000486191 | 203 |
| 500 | 3300006914 | Ga0075436_100185848 | Ga0075436_1001858482 | 203 |
| 501 | 3300006914 | Ga0075436_100341323 | Ga0075436_1003413232 | 203 |
| 502 | 3300006931 | Ga0097620_100123624 | Ga0097620_1001236243 | 203 |
| 503 | 3300006931 | Ga0097620_100182145 | Ga0097620_1001821452 | 203 |
| 504 | 3300006931 | Ga0097620_100620873 | Ga0097620_1006208732 | 203 |
| 505 | 3300007076 | Ga0075435_100051075 | Ga0075435_1000510752 | 203 |
| 506 | 3300007076 | Ga0075435_100089319 | Ga0075435_1000893192 | 203 |
| 507 | 3300009093 | Ga0105240_10179009 | Ga0105240_101790093 | 203 |
| 508 | 3300009094 | Ga0111539_10117554 | Ga0111539_101175541 | 203 |
| 509 | 3300009098 | Ga0105245_10230510 | Ga0105245_102305102 | 203 |
| 510 | 3300009147 | Ga0114129_10000260 | Ga0114129_1000026035 | 203 |
| 511 | 3300009147 | Ga0114129_10156707 | Ga0114129_101567074 | 203 |
| 512 | 3300009174 | Ga0105241_10221046 | Ga0105241_102210462 | 203 |
| 513 | 3300009174 | Ga0105241_10431043 | Ga0105241_104310432 | 203 |
| 514 | 3300009177 | Ga0105248_10000006 | Ga0105248_100000066 | 203 |
| 515 | 3300009177 | Ga0105248_10360453 | Ga0105248_103604532 | 203 |
| 516 | 3300009177 | Ga0105248_10405388 | Ga0105248_104053882 | 203 |
| 517 | 3300009177 | Ga0105248_10500149 | Ga0105248_105001492 | 203 |
| 518 | 3300009553 | Ga0105249_10320446 | Ga0105249_103204461 | 203 |
| 519 | 3300009553 | Ga0105249_10688532 | Ga0105249_106885322 | 203 |
| 520 | 3300009553 | Ga0105249_10707473 | Ga0105249_107074732 | 203 |
| 521 | 3300010375 | Ga0105239_10029595 | Ga0105239_100295956 | 203 |
| 522 | 3300010375 | Ga0105239_10247823 | Ga0105239_102478232 | 203 |
| 523 | 3300011119 | Ga0105246_10276024 | Ga0105246_102760242 | 203 |
| 524 | 3300011119 | Ga0105246_10517081 | Ga0105246_105170812 | 203 |
| 525 | 3300012495 | Ga0157323_1003327 | Ga0157323_10033272 | 203 |
| 526 | 3300013105 | Ga0157369_10228799 | Ga0157369_102287992 | 203 |
| 527 | 3300013105 | Ga0157369_10250883 | Ga0157369_102508834 | 203 |
| 528 | 3300013296 | Ga0157374_10013300 | Ga0157374_100133004 | 203 |
| 529 | 3300013307 | Ga0157372_10012193 | Ga0157372_100121935 | 203 |
| 530 | 3300013307 | Ga0157372_10024833 | Ga0157372_100248333 | 203 |
| 531 | 3300013307 | Ga0157372_10457521 | Ga0157372_104575212 | 203 |
| 532 | 3300014325 | Ga0163163_10913605 | Ga0163163_109136052 | 203 |
| 533 | 3300014326 | Ga0157380_10005964 | Ga0157380_100059648 | 203 |
| 534 | 3300014968 | Ga0157379_10618953 | Ga0157379_106189532 | 203 |
| 535 | 3300014969 | Ga0157376_11439227 | Ga0157376_114392271 | 203 |
| 536 | 3300015688 | Ga0183367_1001 | Ga0183367_100120 | 203 |
| 537 | 3300020069 | Ga0197907_11166738 | Ga0197907_111667382 | 203 |
| 538 | 3300020070 | Ga0206356_10711775 | Ga0206356_107117753 | 203 |
| 539 | 3300020081 | Ga0206354_10069137 | Ga0206354_100691372 | 203 |
| 540 | 3300021384 | Ga0213876_10184708 | Ga0213876_101847082 | 203 |
| 541 | 3300021441 | Ga0213871_10023561 | Ga0213871_100235612 | 203 |
| 542 | 3300022467 | Ga0224712_10001684 | Ga0224712_100016845 | 203 |
| 543 | 3300025893 | Ga0207682_10004059 | Ga0207682_100040596 | 203 |
| 544 | 3300025898 | Ga0207692_10016610 | Ga0207692_100166103 | 203 |
| 545 | 3300025909 | Ga0207705_10337048 | Ga0207705_103370482 | 203 |
| 546 | 3300025910 | Ga0207684_10021616 | Ga0207684_100216163 | 203 |
| 547 | 3300025910 | Ga0207684_10219347 | Ga0207684_102193471 | 203 |
| 548 | 3300025910 | Ga0207684_10257645 | Ga0207684_102576452 | 203 |
| 549 | 3300025912 | Ga0207707_10001557 | Ga0207707_100015579 | 203 |
| 550 | 3300025912 | Ga0207707_10002130 | Ga0207707_100021304 | 203 |
| 551 | 3300025912 | Ga0207707_10010399 | Ga0207707_100103995 | 203 |
| 552 | 3300025912 | Ga0207707_10834887 | Ga0207707_108348871 | 203 |
| 553 | 3300025913 | Ga0207695_10227897 | Ga0207695_102278973 | 203 |
| 554 | 3300025915 | Ga0207693_10261133 | Ga0207693_102611332 | 203 |
| 555 | 3300025917 | Ga0207660_10011149 | Ga0207660_100111491 | 203 |
| 556 | 3300025917 | Ga0207660_10030762 | Ga0207660_100307623 | 203 |
| 557 | 3300025917 | Ga0207660_10179379 | Ga0207660_101793792 | 203 |
| 558 | 3300025919 | Ga0207657_10060219 | Ga0207657_100602193 | 203 |
| 559 | 3300025920 | Ga0207649_10092720 | Ga0207649_100927202 | 203 |
| 560 | 3300025921 | Ga0207652_10218224 | Ga0207652_102182243 | 203 |
| 561 | 3300025921 | Ga0207652_10364194 | Ga0207652_103641942 | 203 |
| 562 | 3300025921 | Ga0207652_10953022 | Ga0207652_109530221 | 203 |
| 563 | 3300025922 | Ga0207646_10012507 | Ga0207646_100125072 | 203 |
| 564 | 3300025922 | Ga0207646_10107926 | Ga0207646_101079263 | 203 |
| 565 | 3300025922 | Ga0207646_10285631 | Ga0207646_102856312 | 203 |
| 566 | 3300025922 | Ga0207646_10311500 | Ga0207646_103115002 | 203 |
| 567 | 3300025925 | Ga0207650_10238267 | Ga0207650_102382672 | 203 |
| 568 | 3300025927 | Ga0207687_10399166 | Ga0207687_103991661 | 203 |
| 569 | 3300025929 | Ga0207664_10052569 | Ga0207664_100525691 | 203 |
| 570 | 3300025931 | Ga0207644_10130483 | Ga0207644_101304832 | 203 |
| 571 | 3300025932 | Ga0207690_10170308 | Ga0207690_101703082 | 203 |
| 572 | 3300025932 | Ga0207690_10360263 | Ga0207690_103602632 | 203 |
| 573 | 3300025933 | Ga0207706_10305637 | Ga0207706_103056372 | 203 |
| 574 | 3300025940 | Ga0207691_10235973 | Ga0207691_102359732 | 203 |
| 575 | 3300025941 | Ga0207711_10000064 | Ga0207711_100000645 | 203 |
| 576 | 3300025941 | Ga0207711_10243019 | Ga0207711_102430192 | 203 |
| 577 | 3300025941 | Ga0207711_10463549 | Ga0207711_104635492 | 203 |
| 578 | 3300025941 | Ga0207711_10633277 | Ga0207711_106332771 | 203 |
| 579 | 3300025949 | Ga0207667_10602328 | Ga0207667_106023282 | 203 |
| 580 | 3300025960 | Ga0207651_10314553 | Ga0207651_103145532 | 203 |
| 581 | 3300025961 | Ga0207712_10677967 | Ga0207712_106779671 | 203 |
| 582 | 3300026041 | Ga0207639_10097046 | Ga0207639_100970463 | 203 |
| 583 | 3300026041 | Ga0207639_10313713 | Ga0207639_103137131 | 203 |
| 584 | 3300026067 | Ga0207678_10260919 | Ga0207678_102609192 | 203 |
| 585 | 3300026088 | Ga0207641_10579111 | Ga0207641_105791112 | 203 |
| 586 | 3300026089 | Ga0207648_10109890 | Ga0207648_101098903 | 203 |
| 587 | 3300026089 | Ga0207648_10294290 | Ga0207648_102942902 | 203 |
| 588 | 3300026095 | Ga0207676_10671134 | Ga0207676_106711342 | 203 |
| 589 | 3300026142 | Ga0207698_10646115 | Ga0207698_106461152 | 203 |
| 590 | 3300027671 | Ga0209588_1040615 | Ga0209588_10406152 | 203 |
| 591 | 3300027876 | Ga0209974_10029724 | Ga0209974_100297242 | 203 |
| 592 | 3300028017 | Ga0265356_1009420 | Ga0265356_10094202 | 203 |
| 593 | 3300028379 | Ga0268266_10113298 | Ga0268266_101132982 | 203 |
| 594 | 3300028379 | Ga0268266_10294592 | Ga0268266_102945922 | 203 |
| 595 | 3300028380 | Ga0268265_10144093 | Ga0268265_101440932 | 203 |
| 596 | 3300028380 | Ga0268265_10257721 | Ga0268265_102577211 | 203 |
| 597 | 3300028381 | Ga0268264_10115371 | Ga0268264_101153712 | 203 |
| 598 | 3300028381 | Ga0268264_10953771 | Ga0268264_109537711 | 203 |
| 599 | 3300028381 | Ga0268264_11138541 | Ga0268264_111385411 | 203 |
| 600 | 3300028556 | Ga0265337_1005073 | Ga0265337_10050733 | 203 |
| 601 | 3300028573 | Ga0265334_10005808 | Ga0265334_100058083 | 203 |
| 602 | 3300028800 | Ga0265338_10049107 | Ga0265338_100491074 | 203 |
| 603 | 3300030521 | Ga0307511_10214577 | Ga0307511_102145772 | 203 |
| 604 | 3300031235 | Ga0265330_10134665 | Ga0265330_101346652 | 203 |
| 605 | 3300031241 | Ga0265325_10079165 | Ga0265325_100791652 | 203 |
| 606 | 3300031249 | Ga0265339_10078648 | Ga0265339_100786483 | 203 |
| 607 | 3300031249 | Ga0265339_10102181 | Ga0265339_101021812 | 203 |
| 608 | 3300031249 | Ga0265339_10105466 | Ga0265339_101054662 | 203 |
| 609 | 3300031250 | Ga0265331_10002092 | Ga0265331_100020927 | 203 |
| 610 | 3300031250 | Ga0265331_10003605 | Ga0265331_100036058 | 203 |
| 611 | 3300031251 | Ga0265327_10000176 | Ga0265327_1000017653 | 203 |
| 612 | 3300031344 | Ga0265316_10198831 | Ga0265316_101988311 | 203 |
| 613 | 3300031548 | Ga0307408_100061935 | Ga0307408_1000619351 | 203 |
| 614 | 3300031548 | Ga0307408_100185011 | Ga0307408_1001850111 | 203 |
| 615 | 3300031595 | Ga0265313_10062762 | Ga0265313_100627622 | 203 |
| 616 | 3300031711 | Ga0265314_10031258 | Ga0265314_100312585 | 203 |
| 617 | 3300031711 | Ga0265314_10058659 | Ga0265314_100586593 | 203 |
| 618 | 3300031712 | Ga0265342_10177902 | Ga0265342_101779022 | 203 |
| 619 | 3300031728 | Ga0316578_10317503 | Ga0316578_103175032 | 203 |
| 620 | 3300031731 | Ga0307405_10019903 | Ga0307405_100199034 | 203 |
| 621 | 3300031731 | Ga0307405_10037115 | Ga0307405_100371152 | 203 |
| 622 | 3300031731 | Ga0307405_10999306 | Ga0307405_109993061 | 203 |
| 623 | 3300031824 | Ga0307413_10082285 | Ga0307413_100822852 | 203 |
| 624 | 3300031838 | Ga0307518_10152317 | Ga0307518_101523172 | 203 |
| 625 | 3300031852 | Ga0307410_10007540 | Ga0307410_100075405 | 203 |
| 626 | 3300031852 | Ga0307410_10081588 | Ga0307410_100815883 | 203 |
| 627 | 3300031852 | Ga0307410_10141492 | Ga0307410_101414922 | 203 |
| 628 | 3300031852 | Ga0307410_10204546 | Ga0307410_102045462 | 203 |
| 629 | 3300031852 | Ga0307410_10316451 | Ga0307410_103164513 | 203 |
| 630 | 3300031901 | Ga0307406_10026687 | Ga0307406_100266872 | 203 |
| 631 | 3300031901 | Ga0307406_10083486 | Ga0307406_100834862 | 203 |
| 632 | 3300031903 | Ga0307407_10006582 | Ga0307407_100065824 | 203 |
| 633 | 3300031903 | Ga0307407_10092424 | Ga0307407_100924242 | 203 |
| 634 | 3300031903 | Ga0307407_10123813 | Ga0307407_101238133 | 203 |
| 635 | 3300031995 | Ga0307409_100100105 | Ga0307409_1001001052 | 203 |
| 636 | 3300031995 | Ga0307409_100203471 | Ga0307409_1002034712 | 203 |
| 637 | 3300031995 | Ga0307409_100211985 | Ga0307409_1002119851 | 203 |
| 638 | 3300031995 | Ga0307409_100386489 | Ga0307409_1003864892 | 203 |
| 639 | 3300031995 | Ga0307409_100576246 | Ga0307409_1005762462 | 203 |
| 640 | 3300032002 | Ga0307416_100017432 | Ga0307416_1000174326 | 203 |
| 641 | 3300032002 | Ga0307416_100176034 | Ga0307416_1001760343 | 203 |
| 642 | 3300032004 | Ga0307414_10053577 | Ga0307414_100535773 | 203 |
| 643 | 3300032004 | Ga0307414_10282147 | Ga0307414_102821472 | 203 |
| 644 | 3300032004 | Ga0307414_10906373 | Ga0307414_109063731 | 203 |
| 645 | 3300032005 | Ga0307411_10038737 | Ga0307411_100387371 | 203 |
| 646 | 3300032005 | Ga0307411_10073014 | Ga0307411_100730141 | 203 |
| 647 | 3300032005 | Ga0307411_10095944 | Ga0307411_100959443 | 203 |
| 648 | 3300032005 | Ga0307411_10147723 | Ga0307411_101477233 | 203 |
| 649 | 3300032005 | Ga0307411_10155673 | Ga0307411_101556732 | 203 |
| 650 | 3300032126 | Ga0307415_100006168 | Ga0307415_1000061682 | 203 |
| 651 | 3300032126 | Ga0307415_100049196 | Ga0307415_1000491962 | 203 |
| 652 | 3300032126 | Ga0307415_100228616 | Ga0307415_1002286162 | 203 |
| 653 | 3300033179 | Ga0307507_10082573 | Ga0307507_100825734 | 203 |
| 654 | 3300035083 | Ga0373926_0001823 | Ga0373926_0001823_1902_2543 | 203 |
| 655 | 3300035092 | Ga0373952_0066259 | Ga0373952_0066259_127_762 | 203 |
| 656 | 3300035114 | Ga0373939_0149164 | Ga0373939_0149164_71_706 | 203 |
| 657 | 3300035118 | Ga0373954_0106603 | Ga0373954_0106603_512_1156 | 203 |
| 658 | 3300035119 | Ga0373956_0052367 | Ga0373956_0052367_451_1095 | 203 |
| 659 | 3300035171 | Ga0373946_0036679 | Ga0373946_0036679_261_896 | 203 |
| 660 | 3300035171 | Ga0373946_0075875 | Ga0373946_0075875_820_1449 | 203 |
| 661 | 3300035691 | Ga0373931_0044305 | Ga0373931_0044305_133_768 | 203 |
| 662 | 3300035691 | Ga0373931_0052452 | Ga0373931_0052452_739_1374 | 203 |
| 663 | 3300035725 | Ga0373947_0000031 | Ga0373947_0000031_35626_36267 | 203 |
| 664 | 3300036401 | Ga0373937_0022396 | Ga0373937_0022396_4464_5108 | 203 |
| 665 | 3300036401 | Ga0373937_0286638 | Ga0373937_0286638_135_770 | 203 |
| 666 | 3300036401 | Ga0373937_0715890 | Ga0373937_0715890_170_805 | 203 |
| 667 | 3300037068 | Ga0373925_0271028 | Ga0373925_0271028_726_1355 | 203 |
| 668 | 3300037068 | Ga0373925_0301996 | Ga0373925_0301996_350_1054 | 203 |
| 669 | 3300037312 | Ga0395899_0000421 | Ga0395899_0000421_22885_23517 | 203 |
| 670 | 3300037312 | Ga0395899_0003093 | Ga0395899_0003093_5823_6455 | 203 |
| 671 | 3300037418 | Ga0395900_0000159 | Ga0395900_0000159_87970_88602 | 203 |
| 672 | 3300037418 | Ga0395900_0000445 | Ga0395900_0000445_30288_30920 | 203 |
| 673 | 3300037418 | Ga0395900_0055109 | Ga0395900_0055109_691_1323 | 203 |
| 674 | 3300037418 | Ga0395900_0136280 | Ga0395900_0136280_808_1440 | 203 |
| 675 | 3300037418 | Ga0395900_0138891 | Ga0395900_0138891_1126_1758 | 203 |
| 676 | 3300037466 | Ga0395898_0000425 | Ga0395898_0000425_1167_1799 | 203 |
| 677 | 3300037466 | Ga0395898_0002174 | Ga0395898_0002174_1157_1789 | 203 |
| 678 | 3300037466 | Ga0395898_0005757 | Ga0395898_0005757_11554_12186 | 203 |
| 679 | 3300037466 | Ga0395898_0217076 | Ga0395898_0217076_1051_1683 | 203 |
| 680 | 3300037471 | Ga0395905_0531470 | Ga0395905_0531470_363_998 | 203 |
| 681 | 3300038443 | Ga0395901_0000017 | Ga0395901_0000017_189635_190267 | 203 |
| 682 | 3300038443 | Ga0395901_0000109 | Ga0395901_0000109_21349_21981 | 203 |
| 683 | 3300038443 | Ga0395901_0009637 | Ga0395901_0009637_1170_1802 | 203 |
| 684 | 3300038443 | Ga0395901_0043931 | Ga0395901_0043931_1378_2010 | 203 |
| 685 | 3300039437 | Ga0436365_1876799 | Ga0436365_1876799_1192_1839 | 203 |
| 686 | 3300039438 | Ga0436360_0035010 | Ga0436360_0035010_403_1032 | 203 |
| 687 | 3300039447 | Ga0436361_1124937 | Ga0436361_1124937_367_1002 | 203 |
| 688 | 3300039450 | Ga0436363_0588233 | Ga0436363_0588233_161_808 | 203 |
| 689 | 3300041505 | Ga0451849_0243995 | Ga0451849_0243995_40_675 | 203 |
| 690 | 3300042004 | Ga0439445_0005495 | Ga0439445_0005495_900_1550 | 203 |
| 691 | 3300042134 | Ga0450898_003049 | Ga0450898_003049_1090_1725 | 203 |
| 692 | 3300042147 | Ga0450910_023046 | Ga0450910_023046_13_648 | 203 |
| 693 | 3300042437 | Ga0439444_0025165 | Ga0439444_0025165_322_957 | 203 |
| 694 | 3300042876 | Ga0451577_0008981 | Ga0451577_0008981_2776_3417 | 203 |
| 695 | 3300042876 | Ga0451577_0065552 | Ga0451577_0065552_1180_1860 | 203 |
| 696 | 3300042876 | Ga0451577_0125156 | Ga0451577_0125156_1322_1960 | 203 |
| 697 | 3300044656 | Ga0466969_0028334 | Ga0466969_0028334_1073_1705 | 203 |
| 698 | 3300044656 | Ga0466969_0029616 | Ga0466969_0029616_1104_1736 | 203 |
| 699 | 3300044656 | Ga0466969_0037730 | Ga0466969_0037730_1332_1985 | 203 |
| 700 | 3300044658 | Ga0466972_0032516 | Ga0466972_0032516_1576_2208 | 203 |
| 701 | 3300044659 | Ga0466973_0022991 | Ga0466973_0022991_5247_5879 | 203 |
| 702 | 3300044666 | Ga0466977_0000673 | Ga0466977_0000673_10425_11060 | 203 |
| 703 | 3300044673 | Ga0453683_0143288 | Ga0453683_0143288_139_774 | 203 |
| 704 | 3300044683 | Ga0466965_0000743 | Ga0466965_0000743_11081_11713 | 203 |
| 705 | 3300044684 | Ga0466966_0000082 | Ga0466966_0000082_1605_2237 | 203 |
| 706 | 3300044684 | Ga0466966_0009579 | Ga0466966_0009579_2896_3528 | 203 |
| 707 | 3300044684 | Ga0466966_0038085 | Ga0466966_0038085_1467_2099 | 203 |
| 708 | 3300044693 | Ga0466961_0001496 | Ga0466961_0001496_5367_5999 | 203 |
| 709 | 3300044693 | Ga0466961_0009743 | Ga0466961_0009743_4550_5182 | 203 |
| 710 | 3300044694 | Ga0466963_0001180 | Ga0466963_0001180_7540_8172 | 203 |
| 711 | 3300044694 | Ga0466963_0086023 | Ga0466963_0086023_364_996 | 203 |
| 712 | 3300044706 | Ga0466964_0022176 | Ga0466964_0022176_1463_2095 | 203 |
| 713 | 3300044712 | Ga0453684_0001146 | Ga0453684_0001146_77800_78441 | 203 |
| 714 | 3300044712 | Ga0453684_0736806 | Ga0453684_0736806_46_726 | 203 |
| 715 | 3300044719 | Ga0466971_0007186 | Ga0466971_0007186_3199_3831 | 203 |
| 716 | 3300044719 | Ga0466971_0039338 | Ga0466971_0039338_931_1563 | 203 |
| 717 | 3300044719 | Ga0466971_0204817 | Ga0466971_0204817_272_907 | 203 |
| 718 | 3300044765 | Ga0466970_0025967 | Ga0466970_0025967_1354_1986 | 203 |
| 719 | 3300044842 | Ga0466957_0181816 | Ga0466957_0181816_204_836 | 203 |
| 720 | 3300045049 | Ga0466959_0029019 | Ga0466959_0029019_3347_3979 | 203 |
| 721 | 3300045051 | Ga0451576_0291384 | Ga0451576_0291384_698_1333 | 203 |
| 722 | 3300045051 | Ga0451576_0468889 | Ga0451576_0468889_373_1011 | 203 |
| 723 | 3300045836 | Ga0466958_0001820 | Ga0466958_0001820_885_1517 | 203 |
| 724 | 3300045836 | Ga0466958_0002956 | Ga0466958_0002956_7832_8464 | 203 |
| 725 | 3300045976 | Ga0466967_0257460 | Ga0466967_0257460_170_802 | 203 |
| 726 | 3300045976 | Ga0466967_0373277 | Ga0466967_0373277_477_1112 | 203 |
| 727 | 3300046454 | Ga0495592_0030243 | Ga0495592_0030243_811_1455 | 203 |
| 728 | 3300046472 | Ga0495580_0283406 | Ga0495580_0283406_349_984 | 203 |
| 729 | 3300046475 | Ga0495639_0210381 | Ga0495639_0210381_125_769 | 203 |
| 730 | 3300046517 | Ga0495630_0098480 | Ga0495630_0098480_1438_2067 | 203 |
| 731 | 3300046528 | Ga0495642_0039507 | Ga0495642_0039507_1009_1644 | 203 |
| 732 | 3300046533 | Ga0495640_0083114 | Ga0495640_0083114_1316_1960 | 203 |
| 733 | 3300046535 | Ga0495586_0052221 | Ga0495586_0052221_35_679 | 203 |
| 734 | 3300046535 | Ga0495586_0175633 | Ga0495586_0175633_492_1127 | 203 |
| 735 | 3300046536 | Ga0495587_0104224 | Ga0495587_0104224_366_1001 | 203 |
| 736 | 3300046536 | Ga0495587_0189405 | Ga0495587_0189405_403_1038 | 203 |
| 737 | 3300046543 | Ga0495645_0031033 | Ga0495645_0031033_95_730 | 203 |
| 738 | 3300046543 | Ga0495645_0063452 | Ga0495645_0063452_1487_2119 | 203 |
| 739 | 3300046557 | Ga0495622_0061393 | Ga0495622_0061393_1100_1729 | 203 |
| 740 | 3300046559 | Ga0495667_0039532 | Ga0495667_0039532_506_1150 | 203 |
| 741 | 3300046615 | Ga0495656_0222307 | Ga0495656_0222307_60_695 | 203 |
| 742 | 3300046642 | Ga0495634_0023766 | Ga0495634_0023766_609_1244 | 203 |
| 743 | 3300046660 | Ga0495625_0105085 | Ga0495625_0105085_367_1002 | 203 |
| 744 | 3300046663 | Ga0495635_0079368 | Ga0495635_0079368_1401_2045 | 203 |
| 745 | 3300046663 | Ga0495635_0305641 | Ga0495635_0305641_286_921 | 203 |
| 746 | 3300046664 | Ga0495659_0101908 | Ga0495659_0101908_385_1020 | 203 |
| 747 | 3300046675 | Ga0495657_0138140 | Ga0495657_0138140_863_1498 | 203 |
| 748 | 3300046678 | Ga0495599_0168889 | Ga0495599_0168889_213_857 | 203 |
| 749 | 3300046678 | Ga0495599_0195806 | Ga0495599_0195806_386_1021 | 203 |
| 750 | 3300046684 | Ga0495669_0084137 | Ga0495669_0084137_637_1272 | 203 |
| 751 | 3300046809 | Ga0495600_0042250 | Ga0495600_0042250_2250_2885 | 203 |
| 752 | 3300046809 | Ga0495600_0117065 | Ga0495600_0117065_396_1040 | 203 |
| 753 | 3300047319 | Ga0495674_0120872 | Ga0495674_0120872_1148_1777 | 203 |
| 754 | 3300047320 | Ga0495672_0088848 | Ga0495672_0088848_642_1286 | 203 |
| 755 | 3300047444 | Ga0495675_0115959 | Ga0495675_0115959_909_1544 | 203 |
| 756 | 3300047472 | Ga0495686_0000007 | Ga0495686_0000007_252415_253047 | 203 |
| 757 | 3300047472 | Ga0495686_0116205 | Ga0495686_0116205_695_1327 | 203 |
| 758 | 3300048903 | Ga0496100_0334857 | Ga0496100_0334857_379_1014 | 203 |
| 759 | 3300048905 | Ga0496102_0000693 | Ga0496102_0000693_32550_33185 | 203 |
| 760 | 3300048905 | Ga0496102_0076207 | Ga0496102_0076207_2161_2799 | 203 |
| 761 | 3300048905 | Ga0496102_0129691 | Ga0496102_0129691_27_662 | 203 |
| 762 | 3300048905 | Ga0496102_0237220 | Ga0496102_0237220_809_1501 | 203 |
| 763 | 3300048907 | Ga0496104_0000542 | Ga0496104_0000542_23024_23659 | 203 |
| 764 | 3300048908 | Ga0496105_0089615 | Ga0496105_0089615_1786_2421 | 203 |
| 765 | 3300048909 | Ga0496106_0426757 | Ga0496106_0426757_219_974 | 203 |
| 766 | 3300048910 | Ga0496107_0009969 | Ga0496107_0009969_116_751 | 203 |
| 767 | 3300048910 | Ga0496107_0330020 | Ga0496107_0330020_208_843 | 203 |
| 768 | 3300048911 | Ga0496108_0000659 | Ga0496108_0000659_8036_8671 | 203 |
| 769 | 3300048912 | Ga0496109_0001342 | Ga0496109_0001342_5833_6468 | 203 |
| 770 | 3300048912 | Ga0496109_0165812 | Ga0496109_0165812_1106_1741 | 203 |
| 771 | 3300048913 | Ga0496110_0010771 | Ga0496110_0010771_3437_4072 | 203 |
| 772 | 3300048913 | Ga0496110_0014556 | Ga0496110_0014556_1969_2604 | 203 |
| 773 | 3300048918 | Ga0496115_0000923 | Ga0496115_0000923_6323_6964 | 203 |
| 774 | 3300048918 | Ga0496115_0001557 | Ga0496115_0001557_3707_4399 | 203 |
| 775 | 3300048918 | Ga0496115_0445497 | Ga0496115_0445497_327_962 | 203 |
| 776 | 3300049570 | Ga0501033_0134943 | Ga0501033_0134943_760_1398 | 203 |
| 777 | 3300049571 | Ga0501034_0008979 | Ga0501034_0008979_7173_7808 | 203 |
| 778 | 3300049572 | Ga0501036_0238656 | Ga0501036_0238656_41_679 | 203 |
| 779 | 3300049574 | Ga0501038_0297491 | Ga0501038_0297491_311_949 | 203 |
| 780 | 3300049575 | Ga0501039_0122578 | Ga0501039_0122578_676_1314 | 203 |
| 781 | 3300049575 | Ga0501039_0676276 | Ga0501039_0676276_136_774 | 203 |
| 782 | 3300049576 | Ga0501040_0196896 | Ga0501040_0196896_731_1369 | 203 |
| 783 | 3300049577 | Ga0501041_0045415 | Ga0501041_0045415_101_739 | 203 |
| 784 | 3300049579 | Ga0501043_0074691 | Ga0501043_0074691_1716_2354 | 203 |
| 785 | 3300049580 | Ga0501046_0048523 | Ga0501046_0048523_2017_2652 | 203 |
| 786 | 3300049581 | Ga0501047_0179023 | Ga0501047_0179023_1310_1945 | 203 |
| 787 | 3300049581 | Ga0501047_0358482 | Ga0501047_0358482_385_1020 | 203 |
| 788 | 3300049583 | Ga0501067_0021474 | Ga0501067_0021474_2730_3365 | 203 |
| 789 | 3300049583 | Ga0501067_0030717 | Ga0501067_0030717_1306_1941 | 203 |
| 790 | 3300049584 | Ga0501068_0003826 | Ga0501068_0003826_1286_1921 | 203 |
| 791 | 3300049585 | Ga0501069_0004771 | Ga0501069_0004771_4557_5192 | 203 |
| 792 | 3300049585 | Ga0501069_0009983 | Ga0501069_0009983_1721_2356 | 203 |
| 793 | 3300049586 | Ga0501070_0018564 | Ga0501070_0018564_3648_4283 | 203 |
| 794 | 3300049586 | Ga0501070_0066405 | Ga0501070_0066405_517_1152 | 203 |
| 795 | 3300049586 | Ga0501070_0172373 | Ga0501070_0172373_677_1312 | 203 |
| 796 | 3300049586 | Ga0501070_0432306 | Ga0501070_0432306_306_941 | 203 |
| 797 | 3300049587 | Ga0501071_0003078 | Ga0501071_0003078_7941_8576 | 203 |
| 798 | 3300049588 | Ga0501072_0002641 | Ga0501072_0002641_10969_11604 | 203 |
| 799 | 3300049588 | Ga0501072_0141522 | Ga0501072_0141522_54_692 | 203 |
| 800 | 3300049588 | Ga0501072_0367758 | Ga0501072_0367758_46_684 | 203 |
| 801 | 3300049589 | Ga0501073_0088631 | Ga0501073_0088631_1087_1722 | 203 |
| 802 | 3300049590 | Ga0501074_0001140 | Ga0501074_0001140_10508_11143 | 203 |
| 803 | 3300049590 | Ga0501074_0145963 | Ga0501074_0145963_1043_1681 | 203 |
| 804 | 3300049590 | Ga0501074_0767700 | Ga0501074_0767700_27_665 | 203 |
| 805 | 3300049591 | Ga0501075_0046762 | Ga0501075_0046762_1971_2609 | 203 |
| 806 | 3300049592 | Ga0501076_0147375 | Ga0501076_0147375_961_1599 | 203 |
| 807 | 3300049592 | Ga0501076_0208768 | Ga0501076_0208768_807_1445 | 203 |
| 808 | 3300049592 | Ga0501076_0572006 | Ga0501076_0572006_274_909 | 203 |
| 809 | 3300049593 | Ga0501077_0001806 | Ga0501077_0001806_65_703 | 203 |
| 810 | 3300049661 | Ga0501217_045400 | Ga0501217_045400_421_1056 | 203 |
| 811 | 3300049708 | Ga0501245_005183 | Ga0501245_005183_661_1296 | 203 |
| 812 | 3300049741 | Ga0501079_0268600 | Ga0501079_0268600_36_674 | 203 |
| 813 | 3300049742 | Ga0501080_0021326 | Ga0501080_0021326_3999_4634 | 203 |
| 814 | 3300049742 | Ga0501080_0085723 | Ga0501080_0085723_801_1436 | 203 |
| 815 | 3300049743 | Ga0501081_0124233 | Ga0501081_0124233_43_681 | 203 |
| 816 | 3300049744 | Ga0501083_0004908 | Ga0501083_0004908_2084_2719 | 203 |
| 817 | 3300049765 | Ga0501268_009827 | Ga0501268_009827_82_717 | 203 |
| 818 | 3300049767 | Ga0501270_014857 | Ga0501270_014857_340_975 | 203 |
| 819 | 3300049769 | Ga0501272_001712 | Ga0501272_001712_598_1233 | 203 |
| 820 | 3300049824 | Ga0501045_0061254 | Ga0501045_0061254_515_1153 | 203 |
| 821 | 3300049824 | Ga0501045_0225827 | Ga0501045_0225827_537_1172 | 203 |
| 822 | 3300049824 | Ga0501045_0476465 | Ga0501045_0476465_42_698 | 203 |
| 823 | 3300050493 | nmdc:mga0k408_49684_c1 | nmdc:mga0k408_49684_c1_1276_1911 | 203 |
| 824 | 3300050494 | nmdc:mga06z11_97626_c1 | nmdc:mga06z11_97626_c1_587_1222 | 203 |
| 825 | 3300050507 | nmdc:mga05p37_162125_c1 | nmdc:mga05p37_162125_c1_1556_2197 | 203 |
| 826 | 3300050507 | nmdc:mga05p37_458105_c1 | nmdc:mga05p37_458105_c1_573_1208 | 203 |
| 827 | 3300050507 | nmdc:mga05p37_69749_c1 | nmdc:mga05p37_69749_c1_200_835 | 203 |
| 828 | 3300050508 | nmdc:mga09592_64643_c1 | nmdc:mga09592_64643_c1_2104_2739 | 203 |
| 829 | 3300050509 | nmdc:mga0qj67_24987_c1 | nmdc:mga0qj67_24987_c1_2611_3249 | 203 |
| 830 | 3300050509 | nmdc:mga0qj67_36230_c1 | nmdc:mga0qj67_36230_c1_1043_1681 | 203 |
| 831 | 3300050509 | nmdc:mga0qj67_41314_c1 | nmdc:mga0qj67_41314_c1_1377_2012 | 203 |
| 832 | 3300050510 | nmdc:mga06r32_113138_c1 | nmdc:mga06r32_113138_c1_1456_2094 | 203 |
| 833 | 3300050510 | nmdc:mga06r32_244491_c1 | nmdc:mga06r32_244491_c1_719_1354 | 203 |
| 834 | 3300050510 | nmdc:mga06r32_30913_c1 | nmdc:mga06r32_30913_c1_2747_3388 | 203 |
| 835 | 3300050510 | nmdc:mga06r32_6579_c1 | nmdc:mga06r32_6579_c1_6282_6920 | 203 |
| 836 | 3300050511 | nmdc:mga08y16_762988_c1 | nmdc:mga08y16_762988_c1_185_820 | 203 |
| 837 | 3300050511 | nmdc:mga08y16_76635_c1 | nmdc:mga08y16_76635_c1_2381_3016 | 203 |
| 838 | 3300050512 | nmdc:mga0n895_156754_c1 | nmdc:mga0n895_156754_c1_685_1320 | 203 |
| 839 | 3300050512 | nmdc:mga0n895_163392_c1 | nmdc:mga0n895_163392_c1_609_1247 | 203 |
| 840 | 3300050512 | nmdc:mga0n895_36095_c1 | nmdc:mga0n895_36095_c1_2220_2855 | 203 |
| 841 | 3300050512 | nmdc:mga0n895_55943_c1 | nmdc:mga0n895_55943_c1_377_1012 | 203 |
| 842 | 3300050512 | nmdc:mga0n895_693533_c1 | nmdc:mga0n895_693533_c1_278_913 | 203 |
| 843 | 3300050513 | nmdc:mga0rr50_224953_c1 | nmdc:mga0rr50_224953_c1_880_1515 | 203 |
| 844 | 3300050513 | nmdc:mga0rr50_45452_c1 | nmdc:mga0rr50_45452_c1_2079_2714 | 203 |
| 845 | 3300050513 | nmdc:mga0rr50_762536_c1 | nmdc:mga0rr50_762536_c1_55_690 | 203 |
| 846 | 3300050513 | nmdc:mga0rr50_83232_c1 | nmdc:mga0rr50_83232_c1_883_1518 | 203 |
| 847 | 3300050513 | nmdc:mga0rr50_852479_c1 | nmdc:mga0rr50_852479_c1_33_671 | 203 |
| 848 | 3300050514 | nmdc:mga08x19_126962_c1 | nmdc:mga08x19_126962_c1_444_1079 | 203 |
| 849 | 3300050514 | nmdc:mga08x19_264729_c1 | nmdc:mga08x19_264729_c1_79_732 | 203 |
| 850 | 3300050514 | nmdc:mga08x19_289370_c1 | nmdc:mga08x19_289370_c1_196_831 | 203 |
| 851 | 3300050514 | nmdc:mga08x19_6037_c1 | nmdc:mga08x19_6037_c1_2026_2661 | 203 |
| 852 | 3300050515 | nmdc:mga0a205_115483_c1 | nmdc:mga0a205_115483_c1_516_1151 | 203 |
| 853 | 3300050515 | nmdc:mga0a205_177653_c1 | nmdc:mga0a205_177653_c1_821_1459 | 203 |
| 854 | 3300050515 | nmdc:mga0a205_327552_c1 | nmdc:mga0a205_327552_c1_642_1283 | 203 |
| 855 | 3300050515 | nmdc:mga0a205_51645_c1 | nmdc:mga0a205_51645_c1_2650_3285 | 203 |
| 856 | 3300050515 | nmdc:mga0a205_913489_c1 | nmdc:mga0a205_913489_c1_79_714 | 203 |
| 857 | 3300053077 | Ga0495601_0041642 | Ga0495601_0041642_1963_2625 | 203 |
| 858 | 3300053077 | Ga0495601_0054612 | Ga0495601_0054612_1775_2419 | 203 |
| 859 | 3300053084 | Ga0495595_0023819 | Ga0495595_0023819_172_816 | 203 |
| 860 | 3300053094 | Ga0500566_0026880 | Ga0500566_0026880_2218_2847 | 203 |
| 861 | 3300053119 | Ga0500595_006337 | Ga0500595_006337_1963_2622 | 203 |
| 862 | 3300053125 | Ga0500618_002101 | Ga0500618_002101_4628_5260 | 203 |
| 863 | 3300053125 | Ga0500618_002594 | Ga0500618_002594_3400_4035 | 203 |
| 864 | 3300053136 | Ga0500559_0284678 | Ga0500559_0284678_96_731 | 203 |
| 865 | 3300054114 | Ga0501084_0005169 | Ga0501084_0005169_3807_4442 | 203 |
| 866 | 3300054114 | Ga0501084_0005653 | Ga0501084_0005653_2578_3216 | 203 |
| 867 | 3300054114 | Ga0501084_0481064 | Ga0501084_0481064_31_669 | 203 |
| 868 | 3300059421 | Ga0590071_001022 | Ga0590071_001022_6285_6965 | 203 |
| 869 | 3300059426 | Ga0590077_005597 | Ga0590077_005597_1841_2521 | 203 |
| 870 | 3300060353 | Ga0501082_0007067 | Ga0501082_0007067_6238_6873 | 203 |
| 871 | 3300061719 | Ga0466962_0046644 | Ga0466962_0046644_653_1285 | 203 |
| 872 | 3300005327 | Ga0070658_10069590 | Ga0070658_100695905 | 204 |
| 873 | 3300005329 | Ga0070683_100413459 | Ga0070683_1004134592 | 204 |
| 874 | 3300005339 | Ga0070660_100075721 | Ga0070660_1000757213 | 204 |
| 875 | 3300005344 | Ga0070661_100073631 | Ga0070661_1000736312 | 204 |
| 876 | 3300005354 | Ga0070675_100224962 | Ga0070675_1002249622 | 204 |
| 877 | 3300005455 | Ga0070663_100006516 | Ga0070663_1000065164 | 204 |
| 878 | 3300005530 | Ga0070679_100259329 | Ga0070679_1002593292 | 204 |
| 879 | 3300005535 | Ga0070684_100034276 | Ga0070684_1000342765 | 204 |
| 880 | 3300005563 | Ga0068855_100373390 | Ga0068855_1003733902 | 204 |
| 881 | 3300005564 | Ga0070664_100300535 | Ga0070664_1003005352 | 204 |
| 882 | 3300005578 | Ga0068854_100049592 | Ga0068854_1000495922 | 204 |
| 883 | 3300005614 | Ga0068856_100192461 | Ga0068856_1001924612 | 204 |
| 884 | 3300005614 | Ga0068856_100364064 | Ga0068856_1003640642 | 204 |
| 885 | 3300005616 | Ga0068852_100020060 | Ga0068852_1000200602 | 204 |
| 886 | 3300009093 | Ga0105240_10091573 | Ga0105240_100915735 | 204 |
| 887 | 3300009093 | Ga0105240_11129592 | Ga0105240_111295921 | 204 |
| 888 | 3300009093 | Ga0105240_11310902 | Ga0105240_113109021 | 204 |
| 889 | 3300013102 | Ga0157371_10042745 | Ga0157371_100427453 | 204 |
| 890 | 3300013104 | Ga0157370_10230707 | Ga0157370_102307072 | 204 |
| 891 | 3300013105 | Ga0157369_10058133 | Ga0157369_100581333 | 204 |
| 892 | 3300013307 | Ga0157372_10024910 | Ga0157372_100249103 | 204 |
| 893 | 3300025909 | Ga0207705_10153349 | Ga0207705_101533491 | 204 |
| 894 | 3300025913 | Ga0207695_10249293 | Ga0207695_102492933 | 204 |
| 895 | 3300025917 | Ga0207660_10188301 | Ga0207660_101883012 | 204 |
| 896 | 3300025919 | Ga0207657_10028851 | Ga0207657_100288512 | 204 |
| 897 | 3300025921 | Ga0207652_10183376 | Ga0207652_101833762 | 204 |
| 898 | 3300025944 | Ga0207661_10264876 | Ga0207661_102648762 | 204 |
| 899 | 3300025944 | Ga0207661_10423769 | Ga0207661_104237692 | 204 |
| 900 | 3300025949 | Ga0207667_10267382 | Ga0207667_102673823 | 204 |
| 901 | 3300025949 | Ga0207667_10299157 | Ga0207667_102991572 | 204 |
| 902 | 3300026067 | Ga0207678_10004751 | Ga0207678_100047519 | 204 |
| 903 | 3300026078 | Ga0207702_10419076 | Ga0207702_104190762 | 204 |
| 904 | 3300026142 | Ga0207698_10034196 | Ga0207698_100341963 | 204 |
| 905 | 3300031727 | Ga0316576_10012341 | Ga0316576_100123414 | 204 |
| 906 | 3300031727 | Ga0316576_10096914 | Ga0316576_100969142 | 204 |
| 907 | 3300031728 | Ga0316578_10133806 | Ga0316578_101338061 | 204 |
| 908 | 3300036712 | Ga0316584_0024092 | Ga0316584_0024092_1206_1853 | 204 |
| 909 | 3300036712 | Ga0316584_0172788 | Ga0316584_0172788_824_1471 | 204 |
| 910 | 3300046476 | Ga0495662_0050118 | Ga0495662_0050118_1351_1989 | 204 |
| 911 | 3300009177 | Ga0105248_10045933 | Ga0105248_100459334 | 205 |
| 912 | 3300025941 | Ga0207711_10106774 | Ga0207711_101067743 | 205 |
| 913 | 3300005328 | Ga0070676_10237696 | Ga0070676_102376961 | 206 |
| 914 | 3300013296 | Ga0157374_10460804 | Ga0157374_104608042 | 206 |
| 915 | 3300025907 | Ga0207645_10260144 | Ga0207645_102601442 | 206 |
| 916 | 3300028800 | Ga0265338_10094073 | Ga0265338_100940732 | 206 |
| 917 | 3300005328 | Ga0070676_10036268 | Ga0070676_100362682 | 208 |
| 918 | 3300005355 | Ga0070671_100395295 | Ga0070671_1003952951 | 208 |
| 919 | 3300005456 | Ga0070678_100070099 | Ga0070678_1000700992 | 208 |
| 920 | 3300005457 | Ga0070662_100057016 | Ga0070662_1000570162 | 208 |
| 921 | 3300005459 | Ga0068867_100230504 | Ga0068867_1002305041 | 208 |
| 922 | 3300006881 | Ga0068865_100001396 | Ga0068865_1000013969 | 208 |
| 923 | 3300009148 | Ga0105243_10791779 | Ga0105243_107917792 | 208 |
| 924 | 3300009176 | Ga0105242_10560451 | Ga0105242_105604512 | 208 |
| 925 | 3300013297 | Ga0157378_10025984 | Ga0157378_100259843 | 208 |
| 926 | 3300025907 | Ga0207645_10016610 | Ga0207645_100166102 | 208 |
| 927 | 3300025933 | Ga0207706_10001355 | Ga0207706_1000135510 | 208 |
| 928 | 3300025934 | Ga0207686_10321583 | Ga0207686_103215831 | 208 |
| 929 | 3300025938 | Ga0207704_10009704 | Ga0207704_100097042 | 208 |
| 930 | 3300026075 | Ga0207708_10027253 | Ga0207708_100272535 | 208 |
| 931 | 3300026089 | Ga0207648_10154034 | Ga0207648_101540342 | 208 |
| 932 | 3300026118 | Ga0207675_100376531 | Ga0207675_1003765312 | 208 |
| 933 | 3300026121 | Ga0207683_10016698 | Ga0207683_100166985 | 208 |
| 934 | 3300005343 | Ga0070687_100049785 | Ga0070687_1000497853 | 209 |
| 935 | 3300005518 | Ga0070699_100125188 | Ga0070699_1001251883 | 209 |
| 936 | 3300005539 | Ga0068853_100948110 | Ga0068853_1009481101 | 209 |
| 937 | 3300005842 | Ga0068858_100227595 | Ga0068858_1002275952 | 209 |
| 938 | 3300009093 | Ga0105240_10004066 | Ga0105240_100040665 | 209 |
| 939 | 3300013296 | Ga0157374_10280137 | Ga0157374_102801372 | 209 |
| 940 | 3300014497 | Ga0182008_10021026 | Ga0182008_100210263 | 209 |
| 941 | 3300005293 | Ga0065715_10196336 | Ga0065715_101963362 | 210 |
| 942 | 3300005345 | Ga0070692_10054394 | Ga0070692_100543942 | 210 |
| 943 | 3300005355 | Ga0070671_100451730 | Ga0070671_1004517302 | 210 |
| 944 | 3300005444 | Ga0070694_100061005 | Ga0070694_1000610052 | 210 |
| 945 | 3300005471 | Ga0070698_100504197 | Ga0070698_1005041972 | 210 |
| 946 | 3300005549 | Ga0070704_100471533 | Ga0070704_1004715332 | 210 |
| 947 | 3300005614 | Ga0068856_100195593 | Ga0068856_1001955932 | 210 |
| 948 | 3300006871 | Ga0075434_100427666 | Ga0075434_1004276661 | 210 |
| 949 | 3300013307 | Ga0157372_10835362 | Ga0157372_108353622 | 210 |
| 950 | 3300026121 | Ga0207683_10170602 | Ga0207683_101706022 | 210 |
| 951 | 3300027695 | Ga0209966_1008583 | Ga0209966_10085833 | 210 |
| 952 | 3300027717 | Ga0209998_10002474 | Ga0209998_100024743 | 210 |
| 953 | 3300032005 | Ga0307411_10150085 | Ga0307411_101500852 | 210 |
| 954 | 3300049668 | Ga0501233_037201 | Ga0501233_037201_388_1020 | 210 |
| 955 | 3300049689 | Ga0501260_005022 | Ga0501260_005022_578_1210 | 210 |
| 956 | 3300049707 | Ga0501234_005779 | Ga0501234_005779_703_1335 | 210 |
| 957 | 3300049757 | Ga0501232_029030 | Ga0501232_029030_109_741 | 210 |
| 958 | 3300049759 | Ga0501262_030517 | Ga0501262_030517_13_645 | 210 |
| 959 | 3300049765 | Ga0501268_002141 | Ga0501268_002141_1001_1633 | 210 |
| 960 | 2162886012 | MBSR1b_contig_11739019 | MBSR1b_0927.00001830 | 211 |
| 961 | 3300005293 | Ga0065715_10177927 | Ga0065715_101779272 | 211 |
| 962 | 3300005366 | Ga0070659_100163612 | Ga0070659_1001636122 | 211 |
| 963 | 3300005434 | Ga0070709_10016652 | Ga0070709_100166523 | 211 |
| 964 | 3300005436 | Ga0070713_100687631 | Ga0070713_1006876311 | 211 |
| 965 | 3300005437 | Ga0070710_10003572 | Ga0070710_100035723 | 211 |
| 966 | 3300005441 | Ga0070700_100253087 | Ga0070700_1002530872 | 211 |
| 967 | 3300005444 | Ga0070694_100243159 | Ga0070694_1002431592 | 211 |
| 968 | 3300005445 | Ga0070708_100000138 | Ga0070708_10000013825 | 211 |
| 969 | 3300005457 | Ga0070662_100089880 | Ga0070662_1000898801 | 211 |
| 970 | 3300005467 | Ga0070706_100191135 | Ga0070706_1001911352 | 211 |
| 971 | 3300005468 | Ga0070707_100038820 | Ga0070707_1000388202 | 211 |
| 972 | 3300005471 | Ga0070698_100300389 | Ga0070698_1003003892 | 211 |
| 973 | 3300005471 | Ga0070698_100351545 | Ga0070698_1003515451 | 211 |
| 974 | 3300005518 | Ga0070699_100074979 | Ga0070699_1000749792 | 211 |
| 975 | 3300006173 | Ga0070716_100002710 | Ga0070716_1000027107 | 211 |
| 976 | 3300006175 | Ga0070712_100058906 | Ga0070712_1000589062 | 211 |
| 977 | 3300006914 | Ga0075436_100016660 | Ga0075436_1000166602 | 211 |
| 978 | 3300007788 | Ga0099795_10018957 | Ga0099795_100189574 | 211 |
| 979 | 3300025906 | Ga0207699_10020457 | Ga0207699_100204573 | 211 |
| 980 | 3300025922 | Ga0207646_10032401 | Ga0207646_100324013 | 211 |
| 981 | 3300025922 | Ga0207646_10097667 | Ga0207646_100976672 | 211 |
| 982 | 3300025939 | Ga0207665_10000447 | Ga0207665_1000044721 | 211 |
| 983 | 3300035170 | Ga0373943_0244677 | Ga0373943_0244677_22_714 | 211 |
| 984 | 3300035692 | Ga0373935_0325804 | Ga0373935_0325804_172_864 | 211 |
| 985 | 3300046531 | Ga0495665_0161935 | Ga0495665_0161935_252_944 | 211 |
| 986 | 3300048915 | Ga0496112_0036657 | Ga0496112_0036657_45_731 | 211 |
| 987 | 3300049583 | Ga0501067_0084445 | Ga0501067_0084445_471_1106 | 211 |
| 988 | 3300050514 | nmdc:mga08x19_88799_c1 | nmdc:mga08x19_88799_c1_1363_2010 | 211 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4njh-assembly1.cif.gz_B | crystal structure of quee from burkholderia multivorans in complex with adomet and 6-carboxy-5,6,7,8-tetrahydropterin | 0.9727 | 3 | 211 |
| 4njh-assembly1.cif.gz_B | crystal structure of quee from burkholderia multivorans in complex with adomet and 6-carboxy-5,6,7,8-tetrahydropterin | 0.9635 | 3 | 211 |
| 6phu-assembly1.cif.gz_A | spaga wild type apo structure | 0.7661 | 87 | 118 |
| 6nhl-assembly1.cif.gz_A | crystal structure of quee from escherichia coli | 0.7381 | 1 | 205 |
| 5tgs-assembly1.cif.gz_A | crystal structure of quee from bacillus subtilis with methionine bound | 0.7178 | 3 | 208 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4njjA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9757 | 3 | 211 | 3.20.20.70 |
| 4njjA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9665 | 3 | 211 | 3.20.20.70 |
| af_P64554_2_223_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.7519 | 3 | 211 | 3.20.20.70 |
| af_P64554_2_223_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.742 | 3 | 211 | 3.20.20.70 |
| af_Q2G1X7_4_231_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.7218 | 4 | 208 | 3.20.20.70 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7S1HJL5-F1-model_v4 | Radical SAM core domain-containing protein | 0.9927 | 84 | 192 |
GO:0051539
|
| AF-A0A519Y4H4-F1-model_v4 | deleted | 0.9897 | 128 | 211 |
|
| AF-A0A357V077-F1-model_v4 | 7-carboxy-7-deazaguanine synthase (CDG synthase) (EC 4.3.99.3) (Queuosine biosynthesis protein QueE) | 0.9868 | 1 | 211 |
GO:0000287
GO:0008616 GO:0016840 GO:0051539 GO:1904047 |
| AF-A0A1B3LL78-F1-model_v4 | 7-carboxy-7-deazaguanine synthase (CDG synthase) (EC 4.3.99.3) (Queuosine biosynthesis protein QueE) | 0.985 | 2 | 211 |
GO:0000287
GO:0008616 GO:0016840 GO:0051539 GO:1904047 |
| AF-A0A383C4D5-F1-model_v4 | Radical SAM core domain-containing protein | 0.985 | 87 | 211 |
GO:0051539
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar