F487574

General Info

Members Datasets Scaffolds Average Seq Length
988 409 971 211

Family's Representative Sequence

Representative Sequence 3300048909|Ga0496106_0426757|Ga0496106_0426757_219_974
Length 251
Sequence VSGGGDWDAAYGKLVLDKTSRSAVELFPLTAYHLRLTVLGMSYAVKEIFYTLQGEGANTGRPAVFCRFAGCNLWTGREEDRLQATCQFCDTDFVGIDGVGGGRFGSAAQLANAIAAAWPIDAETPRFVVCTGGEPLLQLDSALIGALHDEGFEVAVETNGTLEPPPDIDWLCVSPKAGAGLVVRQGDELKLVFPQAGAEPAEFEQLRFSHYFLQPMDGPEREVHTAAALQYCLRHPRWRLSLQTHKLLGIP

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 2515154123 Trinickia symbiotica JPY347 Isolate Nodule
3 2718217927 Rhizobium sp. N324 Isolate Nodule
4 2721755763 Pandoraea thiooxydans ATSB16 Isolate Rhizosphere
5 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
6 2884693830 Nonomuraea phyllanthi WYY166 Isolate Unclassified
7 2891326441 Actinokineospora pegani TRM65233 Isolate Unclassified
8 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified
9 2904434214 Robbsia andropogonis 1567 Isolate Rhizosphere
10 3006425503 Streptomyces zingiberis PLAI1-29 Isolate Unclassified
11 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
12 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
13 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
14 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
15 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
16 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
17 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
18 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
19 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
20 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
21 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
22 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
23 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
24 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
25 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
26 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
27 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
28 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
29 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
30 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
31 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
32 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
33 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
34 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
35 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
36 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
37 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
38 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
39 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
40 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
41 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
42 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
43 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
44 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
45 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
46 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
47 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
48 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
49 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
50 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
51 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
52 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
53 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
54 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
55 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
56 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
57 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
58 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
59 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
60 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
61 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
62 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
63 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
64 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
65 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
66 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
67 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
68 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
69 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
70 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
71 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
72 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
73 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
74 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
75 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
76 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
77 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
78 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
79 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
80 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
81 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
82 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
83 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
84 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
85 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
86 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
87 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
88 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
89 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
90 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
91 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
92 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
93 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
94 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
95 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
96 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
97 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
98 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
99 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
100 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
101 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
102 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
103 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
104 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
105 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
106 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
107 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
108 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
109 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
110 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
111 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
112 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
113 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
114 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
115 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
116 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
117 3300012495 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 Metagenome Rhizosphere
118 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
119 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
120 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
121 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
122 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
123 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
124 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
125 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
126 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
127 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
128 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
129 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
130 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
131 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
132 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
133 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
134 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
135 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
136 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
137 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
138 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
139 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
140 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
197 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
198 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
199 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
200 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
204 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
205 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
206 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
207 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
208 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
209 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
210 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
211 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
212 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
213 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
214 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
215 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
216 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
217 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
218 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
219 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
220 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
221 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
222 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
223 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
224 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
225 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
226 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
227 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
228 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
229 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
230 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
231 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
232 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
233 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
234 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
235 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
236 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
237 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
238 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
239 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
240 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
241 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
242 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
243 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
244 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
245 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
246 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
247 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
248 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
249 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
250 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
251 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
252 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
253 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
254 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
255 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
256 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
257 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
258 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
259 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
260 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
261 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
262 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
263 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
264 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
265 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
266 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
267 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
268 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
269 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
270 3300044659 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E Metagenome Unclassified
271 3300044666 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1E Metagenome Unclassified
272 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
273 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
274 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
275 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
276 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
277 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
278 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
279 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
280 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
281 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
282 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
283 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
284 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
285 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
286 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
287 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
288 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
289 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
290 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
291 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
292 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
293 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
294 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
295 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
296 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
297 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
298 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
299 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
300 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
301 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
302 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
303 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
304 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
305 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
306 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
307 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
308 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
309 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
310 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
311 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
312 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
313 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
314 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
315 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
316 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
317 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
318 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
319 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
320 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
321 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
322 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
323 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
324 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
325 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
326 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
327 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
328 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
329 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
330 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
331 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
332 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
333 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
334 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
335 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
336 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
337 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
338 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
339 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
340 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
341 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
342 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
343 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
344 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
345 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
346 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
347 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
348 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
349 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
350 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
351 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
352 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
353 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
354 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
355 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
356 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
357 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
358 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
359 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
360 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
361 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
362 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
363 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
364 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
365 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
366 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
367 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
368 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
369 3300049757 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control Metagenome Rhizosphere
370 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
371 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
372 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
373 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
374 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
375 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
376 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
377 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
378 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
379 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
380 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
381 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
382 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
383 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
384 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
385 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
386 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
387 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
388 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
389 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
390 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
391 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
392 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
393 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
394 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
395 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
396 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
397 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
398 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
399 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
400 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
401 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
402 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
403 8005275841 Rhizobium sp. N4311 Isolate Nodule
404 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
405 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
406 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
407 8033684223 Streptomyces phytophilus PIP175 Isolate Unclassified
408 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
409 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.87
Metatranscriptomes 0.4
Isolates 1.72

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.72
Nodule 0.4
Rhizoplane 2.02
Rhizosphere 93.93
Stem 0
Stem Tuber 0
Unclassified 1.92

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_11739019 2162886012 Bacteria 1386
2 rootH2_10144468 3300003320 Bacteria 1065
3 Ga0065715_10167639 3300005293 Bacteria 1558
4 Ga0065715_10177927 3300005293 Bacteria 1497
5 Ga0065715_10196336 3300005293 Bacteria 1385
6 Ga0065707_10290892 3300005295 Bacteria 1025
7 Ga0065707_10319758 3300005295 Bacteria 969
8 Ga0070658_10045668 3300005327 Bacteria 3542
9 Ga0070658_10046895 3300005327 Bacteria 3496
10 Ga0070658_10069590 3300005327 Bacteria 2879
11 Ga0070658_10190980 3300005327 Bacteria 1726
12 Ga0070658_11061796 3300005327 Bacteria 704
13 Ga0070676_10036268 3300005328 Bacteria 2840
14 Ga0070676_10206723 3300005328 Bacteria 1290
15 Ga0070676_10237696 3300005328 Bacteria 1210
16 Ga0070683_100000655 3300005329 Bacteria 25019
17 Ga0070683_100006909 3300005329 Bacteria 9538
18 Ga0070683_100079053 3300005329 Bacteria 3078
19 Ga0070683_100369058 3300005329 Bacteria 1367
20 Ga0070683_100413459 3300005329 Bacteria 1286
21 Ga0070683_100604067 3300005329 Bacteria 1050
22 Ga0070690_100337578 3300005330 Bacteria 1090
23 Ga0070670_100002779 3300005331 Bacteria 14467
24 Ga0070670_100216564 3300005331 Bacteria 1666
25 Ga0070670_100339023 3300005331 Bacteria 1319
26 Ga0070666_10498290 3300005335 Bacteria 883
27 Ga0070680_100006802 3300005336 Bacteria 8711
28 Ga0070680_100024698 3300005336 Bacteria 4804
29 Ga0070680_100031242 3300005336 Bacteria 4281
30 Ga0070682_100071427 3300005337 Bacteria 2222
31 Ga0070682_100320308 3300005337 Bacteria 1145
32 Ga0068868_100089736 3300005338 Bacteria 2474
33 Ga0068868_100103379 3300005338 Bacteria 2308
34 Ga0070660_100065655 3300005339 Bacteria 2824
35 Ga0070660_100075721 3300005339 Bacteria 2635
36 Ga0070660_100117534 3300005339 Bacteria 2121
37 Ga0070660_100385862 3300005339 Bacteria 1157
38 Ga0070687_100049785 3300005343 Bacteria 2161
39 Ga0070661_100073631 3300005344 Bacteria 2515
40 Ga0070661_100121211 3300005344 Bacteria 1959
41 Ga0070692_10054394 3300005345 Bacteria 2090
42 Ga0070692_10282046 3300005345 Bacteria 1007
43 Ga0070668_100292271 3300005347 Bacteria 1364
44 Ga0070668_100663585 3300005347 Bacteria 917
45 Ga0070669_100000566 3300005353 Bacteria 27503
46 Ga0070675_100224962 3300005354 Bacteria 1635
47 Ga0070675_100267169 3300005354 Bacteria 1500
48 Ga0070675_100605232 3300005354 Bacteria 994
49 Ga0070675_101225365 3300005354 Bacteria 691
50 Ga0070671_100009865 3300005355 Bacteria 7665
51 Ga0070671_100010716 3300005355 Bacteria 7360
52 Ga0070671_100395295 3300005355 Bacteria 1182
53 Ga0070671_100451730 3300005355 Unclassified 1103
54 Ga0070674_100299205 3300005356 Bacteria 1282
55 Ga0070673_100064069 3300005364 Bacteria 2927
56 Ga0070673_100881302 3300005364 Bacteria 829
57 Ga0070659_100029486 3300005366 Bacteria 4241
58 Ga0070659_100038787 3300005366 Bacteria 3717
59 Ga0070659_100163612 3300005366 Bacteria 1820
60 Ga0070659_100205948 3300005366 Bacteria 1620
61 Ga0070659_100445278 3300005366 Bacteria 1098
62 Ga0070667_100147454 3300005367 Bacteria 2064
63 Ga0070709_10016652 3300005434 Bacteria 4201
64 Ga0070709_10463011 3300005434 Bacteria 957
65 Ga0070714_100006448 3300005435 Bacteria 9063
66 Ga0070714_100032491 3300005435 Bacteria 4356
67 Ga0070714_100095720 3300005435 Bacteria 2608
68 Ga0070714_100188936 3300005435 Bacteria 1878
69 Ga0070714_100242505 3300005435 Bacteria 1664
70 Ga0070713_100013756 3300005436 Bacteria 5985
71 Ga0070713_100017633 3300005436 Bacteria 5405
72 Ga0070713_100565883 3300005436 Bacteria 1077
73 Ga0070713_100687631 3300005436 Bacteria 976
74 Ga0070710_10003320 3300005437 Bacteria 7633
75 Ga0070710_10003572 3300005437 Bacteria 7374
76 Ga0070701_10003257 3300005438 Bacteria 6392
77 Ga0070701_10056268 3300005438 Bacteria 2057
78 Ga0070711_100023585 3300005439 Bacteria 4004
79 Ga0070705_100002041 3300005440 Bacteria 10319
80 Ga0070700_100131955 3300005441 Bacteria 1687
81 Ga0070700_100253087 3300005441 Bacteria 1264
82 Ga0070694_100007030 3300005444 Bacteria 6847
83 Ga0070694_100043995 3300005444 Bacteria 2987
84 Ga0070694_100061005 3300005444 Bacteria 2573
85 Ga0070694_100243159 3300005444 Bacteria 1358
86 Ga0070694_100547592 3300005444 Bacteria 926
87 Ga0070694_100577194 3300005444 Bacteria 903
88 Ga0070708_100000138 3300005445 Bacteria 49981
89 Ga0070708_100000381 3300005445 Bacteria 33426
90 Ga0070708_100012335 3300005445 Bacteria 6970
91 Ga0070708_100080082 3300005445 Bacteria 2955
92 Ga0070663_100006516 3300005455 Bacteria 7030
93 Ga0070678_100070099 3300005456 Bacteria 2619
94 Ga0070678_100533244 3300005456 Bacteria 1040
95 Ga0070662_100057016 3300005457 Bacteria 2837
96 Ga0070662_100089880 3300005457 Bacteria 2304
97 Ga0070681_10003042 3300005458 Bacteria 15549
98 Ga0070681_10008604 3300005458 Bacteria 10005
99 Ga0070681_10125458 3300005458 Bacteria 2500
100 Ga0070681_10169599 3300005458 Bacteria 2104
101 Ga0070681_10419523 3300005458 Bacteria 1250
102 Ga0068867_100032665 3300005459 Bacteria 3765
103 Ga0068867_100100291 3300005459 Bacteria 2211
104 Ga0068867_100230504 3300005459 Bacteria 1497
105 Ga0070685_10002911 3300005466 Bacteria 8749
106 Ga0070706_100008495 3300005467 Bacteria 9570
107 Ga0070706_100036866 3300005467 Bacteria 4517
108 Ga0070706_100074652 3300005467 Bacteria 3138
109 Ga0070706_100127696 3300005467 Bacteria 2372
110 Ga0070706_100191135 3300005467 Bacteria 1913
111 Ga0070706_100758452 3300005467 Bacteria 899
112 Ga0070707_100002489 3300005468 Bacteria 17550
113 Ga0070707_100032687 3300005468 Bacteria 4957
114 Ga0070707_100038820 3300005468 Bacteria 4549
115 Ga0070707_100044161 3300005468 Bacteria 4266
116 Ga0070707_100134698 3300005468 Bacteria 2403
117 Ga0070707_100233126 3300005468 Bacteria 1792
118 Ga0070707_101086147 3300005468 Bacteria 766
119 Ga0070698_100000122 3300005471 Bacteria 67115
120 Ga0070698_100002933 3300005471 Bacteria 18759
121 Ga0070698_100147322 3300005471 Bacteria 2303
122 Ga0070698_100165574 3300005471 Bacteria 2154
123 Ga0070698_100300389 3300005471 Bacteria 1536
124 Ga0070698_100351545 3300005471 Bacteria 1405
125 Ga0070698_100380437 3300005471 Bacteria 1344
126 Ga0070698_100504197 3300005471 Bacteria 1148
127 Ga0070699_100000779 3300005518 Bacteria 29462
128 Ga0070699_100001147 3300005518 Bacteria 24612
129 Ga0070699_100002138 3300005518 Bacteria 17923
130 Ga0070699_100010635 3300005518 Bacteria 7965
131 Ga0070699_100064235 3300005518 Bacteria 3184
132 Ga0070699_100074979 3300005518 Bacteria 2944
133 Ga0070699_100125188 3300005518 Bacteria 2262
134 Ga0070699_100740251 3300005518 Bacteria 899
135 Ga0070679_100013231 3300005530 Bacteria 7897
136 Ga0070679_100026551 3300005530 Bacteria 5691
137 Ga0070679_100060525 3300005530 Bacteria 3774
138 Ga0070679_100069429 3300005530 Bacteria 3514
139 Ga0070679_100127633 3300005530 Bacteria 2525
140 Ga0070679_100259329 3300005530 Bacteria 1694
141 Ga0070679_100605950 3300005530 Bacteria 1038
142 Ga0070679_101220636 3300005530 Bacteria 697
143 Ga0070684_100016107 3300005535 Bacteria 6107
144 Ga0070684_100031010 3300005535 Bacteria 4548
145 Ga0070684_100034276 3300005535 Bacteria 4340
146 Ga0070684_100055337 3300005535 Bacteria 3458
147 Ga0070684_100224294 3300005535 Bacteria 1715
148 Ga0070684_100349077 3300005535 Bacteria 1361
149 Ga0070684_100450704 3300005535 Bacteria 1189
150 Ga0070697_100000272 3300005536 Bacteria 42107
151 Ga0070697_100002379 3300005536 Bacteria 14478
152 Ga0070697_100008526 3300005536 Bacteria 8002
153 Ga0070697_100050347 3300005536 Bacteria 3380
154 Ga0070697_100064880 3300005536 Bacteria 2983
155 Ga0068853_100251114 3300005539 Bacteria 1623
156 Ga0068853_100266207 3300005539 Bacteria 1577
157 Ga0068853_100358428 3300005539 Bacteria 1358
158 Ga0068853_100948110 3300005539 Bacteria 827
159 Ga0070672_100164581 3300005543 Bacteria 1842
160 Ga0070672_100222904 3300005543 Bacteria 1582
161 Ga0070686_100110580 3300005544 Bacteria 1871
162 Ga0070695_100002517 3300005545 Bacteria 10569
163 Ga0070695_100021848 3300005545 Bacteria 3921
164 Ga0070695_100046003 3300005545 Bacteria 2784
165 Ga0070695_100130069 3300005545 Bacteria 1734
166 Ga0070696_100000059 3300005546 Bacteria 52787
167 Ga0070696_100003944 3300005546 Bacteria 9903
168 Ga0070696_100017114 3300005546 Bacteria 4893
169 Ga0070696_100018215 3300005546 Bacteria 4744
170 Ga0070696_100346782 3300005546 Bacteria 1149
171 Ga0070696_100409163 3300005546 Bacteria 1063
172 Ga0070693_100018308 3300005547 Bacteria 3656
173 Ga0070693_100270123 3300005547 Bacteria 1135
174 Ga0070665_100082484 3300005548 Bacteria 3221
175 Ga0070665_100120769 3300005548 Bacteria 2622
176 Ga0070665_100498637 3300005548 Bacteria 1229
177 Ga0070704_100471533 3300005549 Bacteria 1085
178 Ga0068855_100002369 3300005563 Bacteria 23238
179 Ga0068855_100030887 3300005563 Bacteria 6403
180 Ga0068855_100047437 3300005563 Bacteria 5075
181 Ga0068855_100373390 3300005563 Bacteria 1567
182 Ga0068855_100604565 3300005563 Bacteria 1182
183 Ga0070664_100013004 3300005564 Bacteria 6773
184 Ga0070664_100289697 3300005564 Bacteria 1478
185 Ga0070664_100300535 3300005564 Bacteria 1450
186 Ga0070664_100587608 3300005564 Bacteria 1032
187 Ga0068857_100009041 3300005577 Bacteria 8642
188 Ga0068857_100010828 3300005577 Bacteria 7940
189 Ga0068857_100014675 3300005577 Bacteria 6834
190 Ga0068854_100049592 3300005578 Bacteria 2999
191 Ga0068854_100224209 3300005578 Bacteria 1489
192 Ga0068856_100007921 3300005614 Bacteria 10377
193 Ga0068856_100111496 3300005614 Bacteria 2733
194 Ga0068856_100192461 3300005614 Bacteria 2053
195 Ga0068856_100195593 3300005614 Bacteria 2036
196 Ga0068856_100243791 3300005614 Bacteria 1812
197 Ga0068856_100364064 3300005614 Bacteria 1464
198 Ga0068856_100579993 3300005614 Bacteria 1143
199 Ga0070702_100151051 3300005615 Bacteria 1491
200 Ga0068852_100020060 3300005616 Bacteria 5308
201 Ga0068852_100128548 3300005616 Bacteria 2330
202 Ga0068852_100161080 3300005616 Bacteria 2095
203 Ga0068852_100189299 3300005616 Bacteria 1940
204 Ga0068852_100335586 3300005616 Bacteria 1472
205 Ga0068852_100464638 3300005616 Bacteria 1255
206 Ga0068859_100123633 3300005617 Bacteria 2655
207 Ga0068859_100182134 3300005617 Bacteria 2184
208 Ga0068859_100186844 3300005617 Unclassified 2156
209 Ga0068859_100228879 3300005617 Bacteria 1947
210 Ga0068859_100511465 3300005617 Bacteria 1296
211 Ga0068859_100620865 3300005617 Bacteria 1174
212 Ga0068864_100032802 3300005618 Bacteria 4414
213 Ga0068864_100216853 3300005618 Bacteria 1764
214 Ga0068866_10090041 3300005718 Bacteria 1669
215 Ga0068861_100231039 3300005719 Bacteria 1569
216 Ga0068870_10018009 3300005840 Bacteria 3403
217 Ga0068863_100099236 3300005841 Bacteria 2767
218 Ga0068863_100138558 3300005841 Bacteria 2325
219 Ga0068858_100020693 3300005842 Bacteria 6145
220 Ga0068858_100227595 3300005842 Bacteria 1767
221 Ga0068858_100318188 3300005842 Bacteria 1487
222 Ga0068860_100011796 3300005843 Bacteria 8612
223 Ga0068860_100481535 3300005843 Bacteria 1237
224 Ga0068860_100814766 3300005843 Bacteria 947
225 Ga0068860_100915722 3300005843 Bacteria 893
226 Ga0068862_100007064 3300005844 Bacteria 9325
227 Ga0068862_100640600 3300005844 Bacteria 1024
228 Ga0068862_100856178 3300005844 Bacteria 891
229 Ga0068862_100928672 3300005844 Bacteria 857
230 Ga0068862_101013634 3300005844 Bacteria 822
231 Ga0081455_10000733 3300005937 Bacteria 42613
232 Ga0081455_10147178 3300005937 Bacteria 1820
233 Ga0081538_10006932 3300005981 Bacteria 9857
234 Ga0081538_10013401 3300005981 Bacteria 6494
235 Ga0081538_10019713 3300005981 Bacteria 4995
236 Ga0081539_10000087 3300005985 Bacteria 214031
237 Ga0070716_100002710 3300006173 Bacteria 8207
238 Ga0070712_100058906 3300006175 Bacteria 2703
239 Ga0070712_100273466 3300006175 Bacteria 1358
240 Ga0075367_10086696 3300006178 Bacteria 1901
241 Ga0075366_10051119 3300006195 Bacteria 2455
242 Ga0075366_10168125 3300006195 Bacteria 1330
243 Ga0097621_100004481 3300006237 Bacteria 9736
244 Ga0097621_100077827 3300006237 Bacteria 2754
245 Ga0097621_100095490 3300006237 Bacteria 2494
246 Ga0097621_100369902 3300006237 Bacteria 1278
247 Ga0075370_10015474 3300006353 Bacteria 4085
248 Ga0068871_100004639 3300006358 Bacteria 9600
249 Ga0068871_100032288 3300006358 Bacteria 4135
250 Ga0068871_100049384 3300006358 Bacteria 3400
251 Ga0068871_100063462 3300006358 Bacteria 3021
252 Ga0075430_100042803 3300006846 Bacteria 3829
253 Ga0075430_100060159 3300006846 Bacteria 3193
254 Ga0075430_100283840 3300006846 Bacteria 1370
255 Ga0075431_100047077 3300006847 Bacteria 4446
256 Ga0075431_100067520 3300006847 Bacteria 3691
257 Ga0075431_100106084 3300006847 Bacteria 2899
258 Ga0075431_100189656 3300006847 Bacteria 2107
259 Ga0075431_100197940 3300006847 Bacteria 2057
260 Ga0075431_101006526 3300006847 Bacteria 800
261 Ga0075433_10438048 3300006852 Bacteria 1152
262 Ga0075434_100004223 3300006871 Bacteria 12876
263 Ga0075434_100038828 3300006871 Bacteria 4718
264 Ga0075434_100054837 3300006871 Bacteria 3960
265 Ga0075434_100383321 3300006871 Bacteria 1427
266 Ga0075434_100427666 3300006871 Bacteria 1345
267 Ga0075434_100770395 3300006871 Bacteria 979
268 Ga0075429_100719775 3300006880 Bacteria 874
269 Ga0068865_100001396 3300006881 Bacteria 14036
270 Ga0068865_100071903 3300006881 Bacteria 2455
271 Ga0068865_100194759 3300006881 Bacteria 1570
272 Ga0075436_100008037 3300006914 Bacteria 7222
273 Ga0075436_100016660 3300006914 Bacteria 5031
274 Ga0075436_100030317 3300006914 Bacteria 3723
275 Ga0075436_100048619 3300006914 Bacteria 2927
276 Ga0075436_100185848 3300006914 Bacteria 1470
277 Ga0075436_100341323 3300006914 Bacteria 1078
278 Ga0097620_100123624 3300006931 Bacteria 2655
279 Ga0097620_100182145 3300006931 Bacteria 2184
280 Ga0097620_100186859 3300006931 Unclassified 2156
281 Ga0097620_100228882 3300006931 Bacteria 1947
282 Ga0097620_100511434 3300006931 Bacteria 1296
283 Ga0097620_100620873 3300006931 Bacteria 1174
284 Ga0075435_100051075 3300007076 Bacteria 3329
285 Ga0075435_100089319 3300007076 Bacteria 2541
286 Ga0099794_10119513 3300007265 Bacteria 1325
287 Ga0099795_10018957 3300007788 Bacteria 2220
288 Ga0105240_10002142 3300009093 Bacteria 32242
289 Ga0105240_10003537 3300009093 Bacteria 24233
290 Ga0105240_10004066 3300009093 Bacteria 22506
291 Ga0105240_10016265 3300009093 Bacteria 10078
292 Ga0105240_10091573 3300009093 Bacteria 3714
293 Ga0105240_10179009 3300009093 Bacteria 2504
294 Ga0105240_11096136 3300009093 Bacteria 847
295 Ga0105240_11129592 3300009093 Bacteria 833
296 Ga0105240_11310902 3300009093 Bacteria 763
297 Ga0111539_10117554 3300009094 Bacteria 3116
298 Ga0105245_10075361 3300009098 Bacteria 3072
299 Ga0105245_10128517 3300009098 Bacteria 2374
300 Ga0105245_10230510 3300009098 Bacteria 1791
301 Ga0105245_10724424 3300009098 Bacteria 1029
302 Ga0114129_10000260 3300009147 Bacteria 59525
303 Ga0114129_10156707 3300009147 Bacteria 3113
304 Ga0105243_10791779 3300009148 Bacteria 933
305 Ga0105241_10019962 3300009174 Bacteria 4947
306 Ga0105241_10221046 3300009174 Bacteria 1592
307 Ga0105241_10431043 3300009174 Bacteria 1162
308 Ga0105241_10495752 3300009174 Bacteria 1088
309 Ga0105241_11155599 3300009174 Bacteria 731
310 Ga0105242_10000494 3300009176 Bacteria 31086
311 Ga0105242_10002807 3300009176 Bacteria 13645
312 Ga0105242_10116716 3300009176 Unclassified 2284
313 Ga0105242_10326789 3300009176 Bacteria 1409
314 Ga0105242_10560451 3300009176 Bacteria 1097
315 Ga0105248_10000006 3300009177 Bacteria 595060
316 Ga0105248_10045933 3300009177 Bacteria 4897
317 Ga0105248_10050185 3300009177 Bacteria 4679
318 Ga0105248_10110766 3300009177 Bacteria 3096
319 Ga0105248_10151528 3300009177 Bacteria 2616
320 Ga0105248_10157021 3300009177 Bacteria 2567
321 Ga0105248_10265137 3300009177 Bacteria 1934
322 Ga0105248_10360453 3300009177 Bacteria 1637
323 Ga0105248_10405388 3300009177 Bacteria 1535
324 Ga0105248_10500149 3300009177 Bacteria 1370
325 Ga0105248_10884624 3300009177 Bacteria 1008
326 Ga0105237_10314435 3300009545 Bacteria 1569
327 Ga0105238_10023340 3300009551 Bacteria 6306
328 Ga0105238_10040071 3300009551 Bacteria 4748
329 Ga0105238_10110244 3300009551 Bacteria 2733
330 Ga0105238_10136838 3300009551 Bacteria 2427
331 Ga0105238_10408914 3300009551 Bacteria 1351
332 Ga0105249_10000582 3300009553 Bacteria 33411
333 Ga0105249_10110848 3300009553 Bacteria 2594
334 Ga0105249_10320446 3300009553 Bacteria 1561
335 Ga0105249_10688532 3300009553 Bacteria 1082
336 Ga0105249_10707473 3300009553 Bacteria 1068
337 Ga0105239_10029595 3300010375 Bacteria 6022
338 Ga0105239_10065246 3300010375 Bacteria 3998
339 Ga0105239_10247823 3300010375 Bacteria 2000
340 Ga0105246_10239800 3300011119 Unclassified 1433
341 Ga0105246_10276024 3300011119 Bacteria 1346
342 Ga0105246_10517081 3300011119 Bacteria 1017
343 Ga0157323_1003327 3300012495 Bacteria 962
344 Ga0157371_10042745 3300013102 Bacteria 3230
345 Ga0157370_10089962 3300013104 Bacteria 2883
346 Ga0157370_10230707 3300013104 Bacteria 1713
347 Ga0157370_10708518 3300013104 Bacteria 919
348 Ga0157369_10001363 3300013105 Bacteria 30141
349 Ga0157369_10003286 3300013105 Bacteria 19260
350 Ga0157369_10058133 3300013105 Bacteria 4172
351 Ga0157369_10122350 3300013105 Bacteria 2760
352 Ga0157369_10147357 3300013105 Bacteria 2488
353 Ga0157369_10198817 3300013105 Bacteria 2104
354 Ga0157369_10228799 3300013105 Bacteria 1944
355 Ga0157369_10250883 3300013105 Bacteria 1847
356 Ga0157369_10381642 3300013105 Bacteria 1463
357 Ga0157369_10424739 3300013105 Bacteria 1378
358 Ga0157374_10000158 3300013296 Bacteria 62352
359 Ga0157374_10013300 3300013296 Bacteria 7181
360 Ga0157374_10133732 3300013296 Bacteria 2402
361 Ga0157374_10243823 3300013296 Bacteria 1767
362 Ga0157374_10280137 3300013296 Bacteria 1646
363 Ga0157374_10460804 3300013296 Bacteria 1273
364 Ga0157378_10025984 3300013297 Bacteria 5160
365 Ga0163162_10036600 3300013306 Bacteria 4893
366 Ga0163162_10087536 3300013306 Bacteria 3193
367 Ga0163162_10285468 3300013306 Bacteria 1782
368 Ga0163162_10374191 3300013306 Bacteria 1558
369 Ga0157372_10000968 3300013307 Bacteria 31318
370 Ga0157372_10012193 3300013307 Bacteria 9155
371 Ga0157372_10024833 3300013307 Bacteria 6513
372 Ga0157372_10024910 3300013307 Bacteria 6503
373 Ga0157372_10034058 3300013307 Bacteria 5597
374 Ga0157372_10056941 3300013307 Bacteria 4369
375 Ga0157372_10188970 3300013307 Bacteria 2385
376 Ga0157372_10457521 3300013307 Bacteria 1487
377 Ga0157372_10552813 3300013307 Bacteria 1342
378 Ga0157372_10565726 3300013307 Bacteria 1325
379 Ga0157372_10685876 3300013307 Bacteria 1192
380 Ga0157372_10752511 3300013307 Bacteria 1133
381 Ga0157372_10835362 3300013307 Bacteria 1070
382 Ga0157375_10014989 3300013308 Bacteria 6932
383 Ga0157375_10017676 3300013308 Bacteria 6443
384 Ga0157375_10161016 3300013308 Bacteria 2386
385 Ga0157375_10416950 3300013308 Bacteria 1509
386 Ga0163163_10913605 3300014325 Bacteria 941
387 Ga0157380_10005964 3300014326 Bacteria 8524
388 Ga0157380_10169393 3300014326 Bacteria 1906
389 Ga0182008_10021026 3300014497 Bacteria 3355
390 Ga0157377_10134404 3300014745 Bacteria 1514
391 Ga0157379_10051452 3300014968 Bacteria 3679
392 Ga0157379_10618953 3300014968 Bacteria 1012
393 Ga0157376_10000504 3300014969 Bacteria 25284
394 Ga0157376_10168130 3300014969 Unclassified 1994
395 Ga0157376_10192030 3300014969 Bacteria 1873
396 Ga0157376_10244356 3300014969 Bacteria 1673
397 Ga0157376_11439227 3300014969 Bacteria 721
398 Ga0183367_1001 3300015688 Bacteria 1225545
399 Ga0163161_10245198 3300017792 Bacteria 1395
400 Ga0197907_11166738 3300020069 Bacteria 1195
401 Ga0206356_10711775 3300020070 Bacteria 2030
402 Ga0206354_10069137 3300020081 Bacteria 1010
403 Ga0213876_10184708 3300021384 Bacteria 1109
404 Ga0213871_10023561 3300021441 Bacteria 1551
405 Ga0224712_10001684 3300022467 Bacteria 5229
406 Ga0207697_10071700 3300025315 Bacteria 1452
407 Ga0207682_10004059 3300025893 Bacteria 6219
408 Ga0207692_10016610 3300025898 Bacteria 3265
409 Ga0207642_10063368 3300025899 Bacteria 1729
410 Ga0207680_10239419 3300025903 Bacteria 1250
411 Ga0207699_10020457 3300025906 Bacteria 3548
412 Ga0207645_10016610 3300025907 Bacteria 4870
413 Ga0207645_10037069 3300025907 Bacteria 3130
414 Ga0207645_10260144 3300025907 Bacteria 1149
415 Ga0207643_10005910 3300025908 Bacteria 6536
416 Ga0207705_10017431 3300025909 Bacteria 5142
417 Ga0207705_10153349 3300025909 Bacteria 1727
418 Ga0207705_10337048 3300025909 Bacteria 1160
419 Ga0207705_10693964 3300025909 Bacteria 791
420 Ga0207684_10021616 3300025910 Bacteria 5493
421 Ga0207684_10055225 3300025910 Bacteria 3369
422 Ga0207684_10219347 3300025910 Bacteria 1641
423 Ga0207684_10257645 3300025910 Bacteria 1505
424 Ga0207654_10237808 3300025911 Bacteria 1216
425 Ga0207707_10001557 3300025912 Bacteria 21117
426 Ga0207707_10002130 3300025912 Bacteria 17924
427 Ga0207707_10010399 3300025912 Bacteria 8074
428 Ga0207707_10067287 3300025912 Bacteria 3120
429 Ga0207707_10834887 3300025912 Bacteria 765
430 Ga0207695_10001162 3300025913 Bacteria 45655
431 Ga0207695_10003501 3300025913 Bacteria 22022
432 Ga0207695_10061983 3300025913 Bacteria 3863
433 Ga0207695_10227897 3300025913 Bacteria 1769
434 Ga0207695_10249293 3300025913 Bacteria 1675
435 Ga0207693_10261133 3300025915 Bacteria 1358
436 Ga0207663_10026240 3300025916 Bacteria 3379
437 Ga0207660_10011149 3300025917 Bacteria 5844
438 Ga0207660_10030762 3300025917 Bacteria 3691
439 Ga0207660_10179379 3300025917 Bacteria 1644
440 Ga0207660_10188301 3300025917 Bacteria 1606
441 Ga0207660_10522818 3300025917 Bacteria 964
442 Ga0207660_10615744 3300025917 Bacteria 885
443 Ga0207657_10028851 3300025919 Bacteria 5056
444 Ga0207657_10060219 3300025919 Bacteria 3259
445 Ga0207657_10126537 3300025919 Bacteria 2098
446 Ga0207657_10496794 3300025919 Bacteria 956
447 Ga0207649_10092720 3300025920 Bacteria 1981
448 Ga0207652_10104650 3300025921 Bacteria 2504
449 Ga0207652_10183376 3300025921 Bacteria 1882
450 Ga0207652_10197228 3300025921 Bacteria 1811
451 Ga0207652_10218224 3300025921 Bacteria 1718
452 Ga0207652_10364194 3300025921 Bacteria 1305
453 Ga0207652_10953022 3300025921 Bacteria 756
454 Ga0207646_10012507 3300025922 Bacteria 8151
455 Ga0207646_10032401 3300025922 Bacteria 4730
456 Ga0207646_10097667 3300025922 Bacteria 2631
457 Ga0207646_10107926 3300025922 Bacteria 2497
458 Ga0207646_10285631 3300025922 Bacteria 1491
459 Ga0207646_10311500 3300025922 Bacteria 1422
460 Ga0207646_10630679 3300025922 Unclassified 961
461 Ga0207681_10001953 3300025923 Bacteria 13235
462 Ga0207681_10408253 3300025923 Bacteria 1098
463 Ga0207694_10035082 3300025924 Bacteria 3847
464 Ga0207694_10223768 3300025924 Bacteria 1535
465 Ga0207694_10238891 3300025924 Bacteria 1484
466 Ga0207694_10577942 3300025924 Bacteria 944
467 Ga0207650_10238267 3300025925 Bacteria 1470
468 Ga0207650_10557007 3300025925 Bacteria 961
469 Ga0207687_10269446 3300025927 Bacteria 1361
470 Ga0207687_10286280 3300025927 Bacteria 1323
471 Ga0207687_10399166 3300025927 Bacteria 1130
472 Ga0207700_10012282 3300025928 Bacteria 5514
473 Ga0207700_10024905 3300025928 Bacteria 4148
474 Ga0207664_10052569 3300025929 Bacteria 3222
475 Ga0207664_10074592 3300025929 Bacteria 2741
476 Ga0207664_10082927 3300025929 Bacteria 2612
477 Ga0207664_10225412 3300025929 Bacteria 1627
478 Ga0207664_10246337 3300025929 Bacteria 1558
479 Ga0207644_10024876 3300025931 Bacteria 4113
480 Ga0207644_10130483 3300025931 Bacteria 1923
481 Ga0207644_10916206 3300025931 Bacteria 735
482 Ga0207690_10170308 3300025932 Bacteria 1631
483 Ga0207690_10360263 3300025932 Bacteria 1152
484 Ga0207706_10001355 3300025933 Bacteria 24461
485 Ga0207706_10305637 3300025933 Bacteria 1385
486 Ga0207686_10003613 3300025934 Bacteria 8284
487 Ga0207686_10059287 3300025934 Bacteria 2417
488 Ga0207686_10108662 3300025934 Bacteria 1866
489 Ga0207686_10321583 3300025934 Bacteria 1156
490 Ga0207704_10009704 3300025938 Bacteria 4658
491 Ga0207704_10109335 3300025938 Bacteria 1864
492 Ga0207665_10000447 3300025939 Bacteria 28305
493 Ga0207691_10104455 3300025940 Bacteria 2525
494 Ga0207691_10235973 3300025940 Bacteria 1582
495 Ga0207711_10000064 3300025941 Bacteria 120779
496 Ga0207711_10028170 3300025941 Bacteria 4725
497 Ga0207711_10106774 3300025941 Bacteria 2485
498 Ga0207711_10198429 3300025941 Bacteria 1830
499 Ga0207711_10243019 3300025941 Bacteria 1651
500 Ga0207711_10463549 3300025941 Bacteria 1180
501 Ga0207711_10576668 3300025941 Bacteria 1049
502 Ga0207711_10633277 3300025941 Bacteria 998
503 Ga0207689_10429709 3300025942 Bacteria 1103
504 Ga0207661_10004560 3300025944 Bacteria 9716
505 Ga0207661_10035472 3300025944 Bacteria 3887
506 Ga0207661_10043953 3300025944 Bacteria 3527
507 Ga0207661_10054675 3300025944 Bacteria 3199
508 Ga0207661_10264876 3300025944 Bacteria 1532
509 Ga0207661_10423769 3300025944 Bacteria 1209
510 Ga0207679_10040294 3300025945 Bacteria 3342
511 Ga0207679_10211073 3300025945 Bacteria 1628
512 Ga0207667_10002772 3300025949 Bacteria 21680
513 Ga0207667_10011432 3300025949 Bacteria 10318
514 Ga0207667_10237727 3300025949 Bacteria 1865
515 Ga0207667_10267382 3300025949 Bacteria 1748
516 Ga0207667_10299157 3300025949 Bacteria 1644
517 Ga0207667_10602328 3300025949 Bacteria 1108
518 Ga0207667_10661481 3300025949 Bacteria 1049
519 Ga0207651_10314553 3300025960 Bacteria 1307
520 Ga0207651_10710825 3300025960 Bacteria 886
521 Ga0207712_10033535 3300025961 Bacteria 3472
522 Ga0207712_10090893 3300025961 Bacteria 2247
523 Ga0207712_10677967 3300025961 Bacteria 898
524 Ga0207668_10021239 3300025972 Bacteria 4138
525 Ga0207668_10135080 3300025972 Bacteria 1889
526 Ga0207668_10290103 3300025972 Bacteria 1346
527 Ga0207658_10119678 3300025986 Bacteria 2097
528 Ga0207677_10207681 3300026023 Bacteria 1561
529 Ga0207703_10016259 3300026035 Bacteria 5799
530 Ga0207639_10020607 3300026041 Bacteria 4722
531 Ga0207639_10097046 3300026041 Bacteria 2372
532 Ga0207639_10313713 3300026041 Bacteria 1390
533 Ga0207678_10004751 3300026067 Bacteria 12204
534 Ga0207678_10260919 3300026067 Bacteria 1485
535 Ga0207708_10027253 3300026075 Bacteria 4326
536 Ga0207708_10081783 3300026075 Bacteria 2483
537 Ga0207702_10002702 3300026078 Bacteria 16652
538 Ga0207702_10163517 3300026078 Bacteria 2034
539 Ga0207702_10215461 3300026078 Bacteria 1787
540 Ga0207702_10216516 3300026078 Bacteria 1783
541 Ga0207702_10419076 3300026078 Bacteria 1294
542 Ga0207702_10667301 3300026078 Bacteria 1023
543 Ga0207641_10084028 3300026088 Bacteria 2770
544 Ga0207641_10157741 3300026088 Bacteria 2060
545 Ga0207641_10579111 3300026088 Bacteria 1097
546 Ga0207648_10091323 3300026089 Bacteria 2662
547 Ga0207648_10109890 3300026089 Bacteria 2420
548 Ga0207648_10154034 3300026089 Bacteria 2028
549 Ga0207648_10271522 3300026089 Bacteria 1515
550 Ga0207648_10294290 3300026089 Bacteria 1454
551 Ga0207676_10351848 3300026095 Bacteria 1362
552 Ga0207676_10671134 3300026095 Bacteria 1002
553 Ga0207674_10001358 3300026116 Bacteria 31659
554 Ga0207674_10020080 3300026116 Bacteria 7227
555 Ga0207674_10229698 3300026116 Bacteria 1803
556 Ga0207675_100186703 3300026118 Bacteria 1987
557 Ga0207675_100376531 3300026118 Bacteria 1395
558 Ga0207683_10016698 3300026121 Bacteria 6246
559 Ga0207683_10170602 3300026121 Bacteria 1970
560 Ga0207683_10674667 3300026121 Bacteria 958
561 Ga0207698_10034196 3300026142 Bacteria 3703
562 Ga0207698_10366481 3300026142 Bacteria 1366
563 Ga0207698_10646115 3300026142 Bacteria 1047
564 Ga0207698_10845076 3300026142 Bacteria 920
565 Ga0209588_1040615 3300027671 Bacteria 1501
566 Ga0209966_1008583 3300027695 Bacteria 1816
567 Ga0209998_10002474 3300027717 Bacteria 4225
568 Ga0209974_10029724 3300027876 Bacteria 1811
569 Ga0265356_1009420 3300028017 Bacteria 1101
570 Ga0268266_10113298 3300028379 Bacteria 2405
571 Ga0268266_10294592 3300028379 Bacteria 1512
572 Ga0268266_11028465 3300028379 Bacteria 797
573 Ga0268265_10001794 3300028380 Bacteria 17212
574 Ga0268265_10140629 3300028380 Bacteria 2020
575 Ga0268265_10144093 3300028380 Bacteria 1999
576 Ga0268265_10257721 3300028380 Bacteria 1549
577 Ga0268264_10115371 3300028381 Bacteria 2359
578 Ga0268264_10408325 3300028381 Bacteria 1307
579 Ga0268264_10428336 3300028381 Bacteria 1277
580 Ga0268264_10953771 3300028381 Bacteria 863
581 Ga0268264_11138541 3300028381 Bacteria 789
582 Ga0265337_1005073 3300028556 Bacteria 5313
583 Ga0265334_10005808 3300028573 Bacteria 5372
584 Ga0265336_10097129 3300028666 Bacteria 878
585 Ga0265338_10009207 3300028800 Bacteria 11824
586 Ga0265338_10049107 3300028800 Bacteria 3829
587 Ga0265338_10094073 3300028800 Bacteria 2467
588 Ga0265324_10006770 3300029957 Bacteria 4730
589 Ga0307511_10214577 3300030521 Bacteria 976
590 Ga0265330_10014736 3300031235 Bacteria 3626
591 Ga0265330_10134665 3300031235 Bacteria 1051
592 Ga0265328_10049034 3300031239 Bacteria 1551
593 Ga0265325_10072037 3300031241 Bacteria 1733
594 Ga0265325_10079165 3300031241 Bacteria 1636
595 Ga0265339_10000209 3300031249 Bacteria 48039
596 Ga0265339_10078648 3300031249 Bacteria 1746
597 Ga0265339_10102181 3300031249 Bacteria 1490
598 Ga0265339_10105466 3300031249 Bacteria 1463
599 Ga0265331_10002092 3300031250 Bacteria 13775
600 Ga0265331_10003605 3300031250 Bacteria 9913
601 Ga0265327_10000176 3300031251 Bacteria 137002
602 Ga0265316_10004054 3300031344 Bacteria 14658
603 Ga0265316_10004227 3300031344 Bacteria 14342
604 Ga0265316_10198831 3300031344 Bacteria 1487
605 Ga0307408_100061935 3300031548 Bacteria 2732
606 Ga0307408_100185011 3300031548 Bacteria 1674
607 Ga0265313_10000004 3300031595 Bacteria 188027
608 Ga0265313_10062762 3300031595 Bacteria 1735
609 Ga0265314_10002032 3300031711 Bacteria 21431
610 Ga0265314_10031258 3300031711 Bacteria 3934
611 Ga0265314_10058659 3300031711 Bacteria 2637
612 Ga0265342_10006946 3300031712 Bacteria 8366
613 Ga0265342_10177902 3300031712 Bacteria 1166
614 Ga0316576_10012341 3300031727 Bacteria 5640
615 Ga0316576_10096914 3300031727 Bacteria 2202
616 Ga0316578_10133806 3300031728 Bacteria 1492
617 Ga0316578_10317503 3300031728 Bacteria 930
618 Ga0307405_10019903 3300031731 Bacteria 3740
619 Ga0307405_10037115 3300031731 Bacteria 2926
620 Ga0307405_10164712 3300031731 Bacteria 1575
621 Ga0307405_10999306 3300031731 Bacteria 714
622 Ga0307413_10082285 3300031824 Bacteria 2067
623 Ga0307518_10152317 3300031838 Bacteria 1598
624 Ga0307410_10007540 3300031852 Bacteria 5964
625 Ga0307410_10081588 3300031852 Bacteria 2272
626 Ga0307410_10141492 3300031852 Bacteria 1780
627 Ga0307410_10204546 3300031852 Bacteria 1509
628 Ga0307410_10316451 3300031852 Bacteria 1237
629 Ga0307406_10026687 3300031901 Bacteria 3471
630 Ga0307406_10083486 3300031901 Bacteria 2130
631 Ga0307407_10006582 3300031903 Bacteria 5184
632 Ga0307407_10092424 3300031903 Bacteria 1858
633 Ga0307407_10123813 3300031903 Bacteria 1643
634 Ga0307409_100100105 3300031995 Bacteria 2402
635 Ga0307409_100203471 3300031995 Bacteria 1773
636 Ga0307409_100211985 3300031995 Bacteria 1741
637 Ga0307409_100386489 3300031995 Bacteria 1332
638 Ga0307409_100576246 3300031995 Bacteria 1109
639 Ga0307409_100962409 3300031995 Bacteria 870
640 Ga0307416_100017432 3300032002 Bacteria 5026
641 Ga0307416_100176034 3300032002 Bacteria 1998
642 Ga0307416_100518137 3300032002 Bacteria 1260
643 Ga0307414_10053577 3300032004 Bacteria 2814
644 Ga0307414_10140692 3300032004 Bacteria 1889
645 Ga0307414_10282147 3300032004 Bacteria 1396
646 Ga0307414_10906373 3300032004 Bacteria 808
647 Ga0307411_10038737 3300032005 Bacteria 3010
648 Ga0307411_10073014 3300032005 Bacteria 2332
649 Ga0307411_10095944 3300032005 Bacteria 2083
650 Ga0307411_10147723 3300032005 Bacteria 1742
651 Ga0307411_10150085 3300032005 Unclassified 1731
652 Ga0307411_10155673 3300032005 Bacteria 1704
653 Ga0307415_100006168 3300032126 Bacteria 6436
654 Ga0307415_100049196 3300032126 Bacteria 2849
655 Ga0307415_100228616 3300032126 Bacteria 1496
656 Ga0307507_10082573 3300033179 Bacteria 2816
657 Ga0373926_0001823 3300035083 Bacteria 6623
658 Ga0373929_0030848 3300035085 Bacteria 1145
659 Ga0373952_0066259 3300035092 Bacteria 894
660 Ga0373939_0130243 3300035114 Bacteria 897
661 Ga0373939_0149164 3300035114 Bacteria 850
662 Ga0373954_0106603 3300035118 Bacteria 1354
663 Ga0373956_0020139 3300035119 Bacteria 2836
664 Ga0373956_0052367 3300035119 Bacteria 1836
665 Ga0373943_0244677 3300035170 Bacteria 1006
666 Ga0373946_0036679 3300035171 Bacteria 1989
667 Ga0373946_0075875 3300035171 Bacteria 1462
668 Ga0373946_0372657 3300035171 Bacteria 717
669 Ga0373942_0008853 3300035207 Bacteria 2352
670 Ga0373931_0044305 3300035691 Bacteria 2346
671 Ga0373931_0052452 3300035691 Bacteria 2174
672 Ga0373931_0141454 3300035691 Bacteria 1394
673 Ga0373935_0197784 3300035692 Bacteria 1388
674 Ga0373935_0325804 3300035692 Bacteria 1091
675 Ga0373933_0013413 3300035724 Bacteria 4541
676 Ga0373947_0000031 3300035725 Bacteria 73833
677 Ga0373947_0158352 3300035725 Bacteria 1463
678 Ga0373937_0022396 3300036401 Bacteria 5681
679 Ga0373937_0126984 3300036401 Bacteria 2380
680 Ga0373937_0286638 3300036401 Bacteria 1556
681 Ga0373937_0715890 3300036401 Bacteria 948
682 Ga0316584_0024092 3300036712 Bacteria 4452
683 Ga0316584_0172788 3300036712 Bacteria 1602
684 Ga0373925_0271028 3300037068 Bacteria 1365
685 Ga0373925_0301996 3300037068 Bacteria 1293
686 Ga0395899_0000421 3300037312 Bacteria 49097
687 Ga0395899_0003093 3300037312 Bacteria 13244
688 Ga0395900_0000159 3300037418 Bacteria 111486
689 Ga0395900_0000445 3300037418 Bacteria 59139
690 Ga0395900_0055109 3300037418 Bacteria 4093
691 Ga0395900_0136280 3300037418 Bacteria 2515
692 Ga0395900_0138891 3300037418 Bacteria 2489
693 Ga0395898_0000425 3300037466 Bacteria 89768
694 Ga0395898_0002174 3300037466 Bacteria 24017
695 Ga0395898_0005757 3300037466 Bacteria 13337
696 Ga0395898_0217076 3300037466 Bacteria 1824
697 Ga0395905_0531470 3300037471 Bacteria 1077
698 Ga0395901_0000017 3300038443 Bacteria 345003
699 Ga0395901_0000109 3300038443 Bacteria 112882
700 Ga0395901_0009637 3300038443 Bacteria 9798
701 Ga0395901_0043931 3300038443 Bacteria 4635
702 Ga0436365_1876799 3300039437 Bacteria 3966
703 Ga0436360_0035010 3300039438 Bacteria 1878
704 Ga0436361_0807603 3300039447 Bacteria 982
705 Ga0436361_1124937 3300039447 Bacteria 3569
706 Ga0436363_0588233 3300039450 Bacteria 1294
707 Ga0451837_1244620 3300041494 Bacteria 1099
708 Ga0451849_0243995 3300041505 Bacteria 720
709 Ga0451853_2650962 3300041512 Bacteria 616
710 Ga0439445_0005495 3300042004 Bacteria 2889
711 Ga0439448_0012918 3300042005 Bacteria 2505
712 Ga0450898_003049 3300042134 Bacteria 2376
713 Ga0450910_023046 3300042147 Bacteria 950
714 Ga0439444_0025165 3300042437 Bacteria 1081
715 Ga0451577_0008981 3300042876 Bacteria 9662
716 Ga0451577_0065552 3300042876 Bacteria 3239
717 Ga0451577_0125156 3300042876 Bacteria 2303
718 Ga0451577_0703078 3300042876 Bacteria 915
719 Ga0466969_0000008 3300044656 Bacteria 139607
720 Ga0466969_0028334 3300044656 Bacteria 2863
721 Ga0466969_0029616 3300044656 Bacteria 2794
722 Ga0466969_0037730 3300044656 Bacteria 2435
723 Ga0466972_0032516 3300044658 Bacteria 2561
724 Ga0466973_0022991 3300044659 Bacteria 5971
725 Ga0466977_0000673 3300044666 Bacteria 12021
726 Ga0453683_0143288 3300044673 Bacteria 1509
727 Ga0466965_0000743 3300044683 Bacteria 12188
728 Ga0466966_0000082 3300044684 Bacteria 59091
729 Ga0466966_0009579 3300044684 Bacteria 6411
730 Ga0466966_0037145 3300044684 Bacteria 3142
731 Ga0466966_0038085 3300044684 Bacteria 3099
732 Ga0466966_0045063 3300044684 Bacteria 2821
733 Ga0466961_0001496 3300044693 Bacteria 14495
734 Ga0466961_0009743 3300044693 Bacteria 6113
735 Ga0466963_0001180 3300044694 Bacteria 13723
736 Ga0466963_0033456 3300044694 Bacteria 3338
737 Ga0466963_0086023 3300044694 Bacteria 2135
738 Ga0466963_0088979 3300044694 Bacteria 2100
739 Ga0466963_0336435 3300044694 Bacteria 1063
740 Ga0466964_0022176 3300044706 Bacteria 2461
741 Ga0466964_0475049 3300044706 Bacteria 667
742 Ga0453684_0001146 3300044712 Bacteria 82773
743 Ga0453684_0736806 3300044712 Bacteria 1068
744 Ga0466971_0007186 3300044719 Bacteria 4848
745 Ga0466971_0039338 3300044719 Bacteria 2122
746 Ga0466971_0204817 3300044719 Bacteria 932
747 Ga0466971_0281552 3300044719 Bacteria 796
748 Ga0466970_0025967 3300044765 Bacteria 3069
749 Ga0466970_0110582 3300044765 Bacteria 1500
750 Ga0466957_0181816 3300044842 Bacteria 1373
751 Ga0466959_0029019 3300045049 Bacteria 4097
752 Ga0466959_0117826 3300045049 Bacteria 1890
753 Ga0451576_0291384 3300045051 Bacteria 1706
754 Ga0451576_0468889 3300045051 Bacteria 1322
755 Ga0466958_0001820 3300045836 Bacteria 10358
756 Ga0466958_0002956 3300045836 Bacteria 8700
757 Ga0466958_0380643 3300045836 Bacteria 910
758 Ga0466967_0257460 3300045976 Bacteria 1669
759 Ga0466967_0373277 3300045976 Bacteria 1384
760 Ga0466967_0664439 3300045976 Bacteria 1031
761 Ga0495592_0030243 3300046454 Bacteria 4097
762 Ga0495629_0483559 3300046459 Bacteria 836
763 Ga0495638_0135704 3300046460 Bacteria 1441
764 Ga0495653_0139753 3300046463 Bacteria 1705
765 Ga0495580_0283406 3300046472 Bacteria 1130
766 Ga0495582_0148080 3300046473 Bacteria 1332
767 Ga0495639_0210381 3300046475 Bacteria 954
768 Ga0495662_0050118 3300046476 Bacteria 2015
769 Ga0495594_0054450 3300046499 Bacteria 2205
770 Ga0495594_0062189 3300046499 Bacteria 2067
771 Ga0495618_0020940 3300046514 Bacteria 4027
772 Ga0495618_0237874 3300046514 Bacteria 1145
773 Ga0495618_0315385 3300046514 Bacteria 969
774 Ga0495630_0098480 3300046517 Bacteria 2212
775 Ga0495630_0300125 3300046517 Bacteria 1227
776 Ga0495642_0039507 3300046528 Bacteria 1915
777 Ga0495652_0041799 3300046529 Bacteria 3955
778 Ga0495665_0008286 3300046531 Bacteria 5635
779 Ga0495665_0161935 3300046531 Bacteria 1166
780 Ga0495640_0083114 3300046533 Bacteria 2125
781 Ga0495586_0052221 3300046535 Bacteria 2213
782 Ga0495586_0175633 3300046535 Bacteria 1211
783 Ga0495586_0248381 3300046535 Bacteria 1015
784 Ga0495587_0063377 3300046536 Bacteria 2162
785 Ga0495587_0104224 3300046536 Bacteria 1633
786 Ga0495587_0189405 3300046536 Bacteria 1165
787 Ga0495645_0006492 3300046543 Bacteria 8120
788 Ga0495645_0031033 3300046543 Bacteria 3892
789 Ga0495645_0063452 3300046543 Bacteria 2675
790 Ga0495622_0061393 3300046557 Bacteria 1740
791 Ga0495667_0039532 3300046559 Bacteria 3136
792 Ga0495656_0222307 3300046615 Bacteria 944
793 Ga0495634_0023766 3300046642 Bacteria 4306
794 Ga0495634_0069434 3300046642 Bacteria 2325
795 Ga0495634_0102008 3300046642 Bacteria 1853
796 Ga0495625_0105085 3300046660 Bacteria 1935
797 Ga0495635_0079368 3300046663 Bacteria 2246
798 Ga0495635_0083784 3300046663 Bacteria 2182
799 Ga0495635_0305641 3300046663 Bacteria 1066
800 Ga0495659_0101908 3300046664 Bacteria 1113
801 Ga0495588_0082529 3300046674 Bacteria 1679
802 Ga0495657_0138140 3300046675 Bacteria 1521
803 Ga0495599_0168889 3300046678 Bacteria 1350
804 Ga0495599_0195806 3300046678 Bacteria 1242
805 Ga0495647_0134608 3300046681 Bacteria 1050
806 Ga0495669_0084137 3300046684 Bacteria 1463
807 Ga0495600_0042250 3300046809 Bacteria 2972
808 Ga0495600_0117065 3300046809 Bacteria 1734
809 Ga0495581_0357677 3300047315 Bacteria 852
810 Ga0495604_0071217 3300047317 Bacteria 2630
811 Ga0495674_0073126 3300047319 Bacteria 2956
812 Ga0495674_0120872 3300047319 Bacteria 2213
813 Ga0495672_0088848 3300047320 Bacteria 1702
814 Ga0495675_0115959 3300047444 Bacteria 1670
815 Ga0495684_0008456 3300047471 Bacteria 7967
816 Ga0495686_0000007 3300047472 Bacteria 732622
817 Ga0495686_0016441 3300047472 Bacteria 5016
818 Ga0495686_0116205 3300047472 Bacteria 1599
819 Ga0495602_0035227 3300048088 Bacteria 4670
820 Ga0496100_0334857 3300048903 Bacteria 1140
821 Ga0496102_0000693 3300048905 Bacteria 33499
822 Ga0496102_0076207 3300048905 Bacteria 3085
823 Ga0496102_0129691 3300048905 Bacteria 2359
824 Ga0496102_0237220 3300048905 Bacteria 1720
825 Ga0496104_0000014 3300048907 Bacteria 377972
826 Ga0496104_0000542 3300048907 Bacteria 32369
827 Ga0496105_0089615 3300048908 Bacteria 2541
828 Ga0496106_0426757 3300048909 Bacteria 1065
829 Ga0496107_0009969 3300048910 Bacteria 6593
830 Ga0496107_0330020 3300048910 Bacteria 1135
831 Ga0496108_0000659 3300048911 Bacteria 26589
832 Ga0496109_0001342 3300048912 Bacteria 20335
833 Ga0496109_0165812 3300048912 Bacteria 2071
834 Ga0496110_0010771 3300048913 Bacteria 7452
835 Ga0496110_0014556 3300048913 Bacteria 6537
836 Ga0496112_0036657 3300048915 Bacteria 4784
837 Ga0496115_0000923 3300048918 Bacteria 21295
838 Ga0496115_0001557 3300048918 Bacteria 16490
839 Ga0496115_0445497 3300048918 Bacteria 1047
840 Ga0501033_0134943 3300049570 Bacteria 1786
841 Ga0501034_0008979 3300049571 Bacteria 10501
842 Ga0501036_0238656 3300049572 Bacteria 1525
843 Ga0501037_0099222 3300049573 Bacteria 2103
844 Ga0501038_0008308 3300049574 Bacteria 9555
845 Ga0501038_0297491 3300049574 Bacteria 1267
846 Ga0501039_0075802 3300049575 Bacteria 2614
847 Ga0501039_0122578 3300049575 Bacteria 2038
848 Ga0501039_0676276 3300049575 Bacteria 808
849 Ga0501040_0132370 3300049576 Bacteria 1754
850 Ga0501040_0196896 3300049576 Bacteria 1430
851 Ga0501041_0045415 3300049577 Bacteria 2671
852 Ga0501042_0251306 3300049578 Bacteria 1276
853 Ga0501043_0018518 3300049579 Bacteria 5463
854 Ga0501043_0074691 3300049579 Bacteria 2663
855 Ga0501043_0543496 3300049579 Bacteria 864
856 Ga0501046_0048523 3300049580 Bacteria 3362
857 Ga0501046_0108943 3300049580 Bacteria 2118
858 Ga0501047_0124677 3300049581 Bacteria 2456
859 Ga0501047_0179023 3300049581 Bacteria 1987
860 Ga0501047_0358482 3300049581 Bacteria 1294
861 Ga0501048_0001269 3300049582 Bacteria 19114
862 Ga0501067_0021474 3300049583 Bacteria 3572
863 Ga0501067_0030717 3300049583 Bacteria 2980
864 Ga0501067_0084445 3300049583 Bacteria 1761
865 Ga0501068_0003826 3300049584 Bacteria 8164
866 Ga0501069_0004771 3300049585 Bacteria 7017
867 Ga0501069_0009983 3300049585 Bacteria 5019
868 Ga0501070_0018564 3300049586 Bacteria 5834
869 Ga0501070_0024586 3300049586 Bacteria 5051
870 Ga0501070_0066405 3300049586 Bacteria 2987
871 Ga0501070_0172373 3300049586 Bacteria 1782
872 Ga0501070_0432306 3300049586 Bacteria 1062
873 Ga0501071_0003078 3300049587 Bacteria 10338
874 Ga0501072_0002641 3300049588 Bacteria 13433
875 Ga0501072_0141522 3300049588 Bacteria 1918
876 Ga0501072_0367758 3300049588 Bacteria 1141
877 Ga0501073_0088631 3300049589 Bacteria 2151
878 Ga0501074_0001140 3300049590 Bacteria 17400
879 Ga0501074_0145963 3300049590 Bacteria 1692
880 Ga0501074_0767700 3300049590 Bacteria 680
881 Ga0501075_0046762 3300049591 Bacteria 3251
882 Ga0501076_0147375 3300049592 Bacteria 1914
883 Ga0501076_0208768 3300049592 Bacteria 1595
884 Ga0501076_0572006 3300049592 Bacteria 932
885 Ga0501077_0001806 3300049593 Bacteria 12930
886 Ga0501077_0155092 3300049593 Bacteria 1453
887 Ga0501217_045400 3300049661 Bacteria 1132
888 Ga0501233_037201 3300049668 Bacteria 1129
889 Ga0501233_081863 3300049668 Bacteria 832
890 Ga0501260_005022 3300049689 Bacteria 1235
891 Ga0501234_005779 3300049707 Bacteria 1933
892 Ga0501245_005183 3300049708 Bacteria 1803
893 Ga0501079_0268600 3300049741 Bacteria 1333
894 Ga0501080_0021326 3300049742 Bacteria 5996
895 Ga0501080_0085723 3300049742 Bacteria 2927
896 Ga0501081_0083532 3300049743 Bacteria 2239
897 Ga0501081_0124233 3300049743 Bacteria 1840
898 Ga0501083_0004908 3300049744 Bacteria 9462
899 Ga0501232_029030 3300049757 Bacteria 758
900 Ga0501262_030517 3300049759 Bacteria 775
901 Ga0501268_002141 3300049765 Bacteria 2569
902 Ga0501268_009827 3300049765 Bacteria 1477
903 Ga0501270_014857 3300049767 Bacteria 1103
904 Ga0501272_001712 3300049769 Bacteria 2111
905 Ga0501035_0407055 3300049822 Bacteria 1131
906 Ga0501044_0008204 3300049823 Bacteria 11460
907 Ga0501045_0061254 3300049824 Bacteria 2761
908 Ga0501045_0225827 3300049824 Bacteria 1394
909 Ga0501045_0476465 3300049824 Bacteria 927
910 nmdc:mga0k408_363755_c1 3300050493 Bacteria 862
911 nmdc:mga0k408_49684_c1 3300050493 Bacteria 2428
912 nmdc:mga06z11_432393_c1 3300050494 Bacteria 794
913 nmdc:mga06z11_97626_c1 3300050494 Bacteria 1606
914 nmdc:mga05p37_162125_c1 3300050507 Bacteria 2730
915 nmdc:mga05p37_458105_c1 3300050507 Bacteria 1474
916 nmdc:mga05p37_69749_c1 3300050507 Bacteria 4324
917 nmdc:mga09592_4370_c1 3300050508 Bacteria 11429
918 nmdc:mga09592_64643_c1 3300050508 Bacteria 3097
919 nmdc:mga0qj67_145_c1 3300050509 Bacteria 41305
920 nmdc:mga0qj67_24987_c1 3300050509 Bacteria 4610
921 nmdc:mga0qj67_36230_c1 3300050509 Bacteria 3859
922 nmdc:mga0qj67_41314_c1 3300050509 Bacteria 3626
923 nmdc:mga06r32_113138_c1 3300050510 Bacteria 2671
924 nmdc:mga06r32_244046_c1 3300050510 Bacteria 1783
925 nmdc:mga06r32_244491_c1 3300050510 Bacteria 1782
926 nmdc:mga06r32_30913_c1 3300050510 Bacteria 5025
927 nmdc:mga06r32_6579_c1 3300050510 Bacteria 10441
928 nmdc:mga08y16_50614_c1 3300050511 Bacteria 4347
929 nmdc:mga08y16_762988_c1 3300050511 Bacteria 962
930 nmdc:mga08y16_76635_c1 3300050511 Bacteria 3485
931 nmdc:mga0n895_156754_c1 3300050512 Bacteria 2308
932 nmdc:mga0n895_163392_c1 3300050512 Bacteria 2258
933 nmdc:mga0n895_36095_c1 3300050512 Bacteria 4771
934 nmdc:mga0n895_55943_c1 3300050512 Bacteria 3885
935 nmdc:mga0n895_693533_c1 3300050512 Bacteria 1015
936 nmdc:mga0rr50_224953_c1 3300050513 Bacteria 1551
937 nmdc:mga0rr50_244214_c1 3300050513 Bacteria 1489
938 nmdc:mga0rr50_45452_c1 3300050513 Bacteria 3227
939 nmdc:mga0rr50_762536_c1 3300050513 Bacteria 826
940 nmdc:mga0rr50_83232_c1 3300050513 Bacteria 2473
941 nmdc:mga0rr50_852479_c1 3300050513 Bacteria 777
942 nmdc:mga08x19_126962_c1 3300050514 Bacteria 1713
943 nmdc:mga08x19_14339_c1 3300050514 Bacteria 4807
944 nmdc:mga08x19_264729_c1 3300050514 Bacteria 1189
945 nmdc:mga08x19_289370_c1 3300050514 Bacteria 1136
946 nmdc:mga08x19_6037_c1 3300050514 Bacteria 7159
947 nmdc:mga08x19_88799_c1 3300050514 Bacteria 2038
948 nmdc:mga0a205_115483_c1 3300050515 Bacteria 2583
949 nmdc:mga0a205_177653_c1 3300050515 Bacteria 2024
950 nmdc:mga0a205_327552_c1 3300050515 Bacteria 1402
951 nmdc:mga0a205_51645_c1 3300050515 Bacteria 3969
952 nmdc:mga0a205_913489_c1 3300050515 Bacteria 725
953 Ga0495601_0041642 3300053077 Bacteria 2880
954 Ga0495601_0054612 3300053077 Bacteria 2527
955 Ga0495595_0023819 3300053084 Bacteria 2699
956 Ga0500583_0030584 3300053092 Bacteria 2360
957 Ga0500566_0026880 3300053094 Bacteria 3368
958 Ga0500595_006337 3300053119 Bacteria 5027
959 Ga0500618_002101 3300053125 Bacteria 7898
960 Ga0500618_002594 3300053125 Bacteria 6670
961 Ga0500655_008591 3300053133 Bacteria 1839
962 Ga0500559_0284678 3300053136 Bacteria 777
963 Ga0500603_054851 3300053150 Bacteria 1100
964 Ga0500601_000465 3300053737 Bacteria 6552
965 Ga0501084_0005169 3300054114 Bacteria 10676
966 Ga0501084_0005653 3300054114 Bacteria 10265
967 Ga0501084_0481064 3300054114 Bacteria 1049
968 Ga0590071_001022 3300059421 Bacteria 7605
969 Ga0590077_005597 3300059426 Bacteria 2569
970 Ga0501082_0007067 3300060353 Bacteria 9686
971 Ga0466962_0046644 3300061719 Bacteria 2070

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049743 Ga0501081_0083532 Ga0501081_0083532_54_569 162
2 3300041512 Ga0451853_2650962 Ga0451853_2650962_38_565 165
3 3300044706 Ga0466964_0475049 Ga0466964_0475049_78_614 171
4 3300047315 Ga0495581_0357677 Ga0495581_0357677_306_842 171
5 3300045836 Ga0466958_0380643 Ga0466958_0380643_319_891 180
6 3300046514 Ga0495618_0315385 Ga0495618_0315385_29_604 180
7 3300005937 Ga0081455_10147178 Ga0081455_101471782 184
8 3300049578 Ga0501042_0251306 Ga0501042_0251306_483_1064 184
9 3300053092 Ga0500583_0030584 Ga0500583_0030584_1758_2345 186
10 3300005436 Ga0070713_100017633 Ga0070713_1000176334 189
11 3300005439 Ga0070711_100023585 Ga0070711_1000235855 189
12 3300005535 Ga0070684_100031010 Ga0070684_1000310104 189
13 3300005539 Ga0068853_100266207 Ga0068853_1002662072 189
14 3300005577 Ga0068857_100014675 Ga0068857_1000146754 189
15 3300005614 Ga0068856_100007921 Ga0068856_1000079217 189
16 3300005616 Ga0068852_100128548 Ga0068852_1001285482 189
17 3300009551 Ga0105238_10136838 Ga0105238_101368382 189
18 3300013307 Ga0157372_10056941 Ga0157372_100569412 189
19 3300025916 Ga0207663_10026240 Ga0207663_100262401 189
20 3300025928 Ga0207700_10012282 Ga0207700_100122825 189
21 3300025960 Ga0207651_10710825 Ga0207651_107108252 189
22 3300026041 Ga0207639_10020607 Ga0207639_100206076 189
23 3300026078 Ga0207702_10002702 Ga0207702_100027022 189
24 3300026116 Ga0207674_10001358 Ga0207674_100013588 189
25 3300026142 Ga0207698_10845076 Ga0207698_108450761 189
26 3300028800 Ga0265338_10009207 Ga0265338_100092073 189
27 3300029957 Ga0265324_10006770 Ga0265324_100067703 189
28 3300031239 Ga0265328_10049034 Ga0265328_100490342 189
29 3300031241 Ga0265325_10072037 Ga0265325_100720373 189
30 3300031249 Ga0265339_10000209 Ga0265339_1000020932 189
31 3300031344 Ga0265316_10004227 Ga0265316_100042277 189
32 3300031711 Ga0265314_10002032 Ga0265314_1000203210 189
33 3300044656 Ga0466969_0000008 Ga0466969_0000008_31019_31717 189
34 3300044684 Ga0466966_0037145 Ga0466966_0037145_1648_2346 189
35 3300044765 Ga0466970_0110582 Ga0466970_0110582_423_1118 189
36 3300046473 Ga0495582_0148080 Ga0495582_0148080_668_1291 190
37 3300046514 Ga0495618_0020940 Ga0495618_0020940_2656_3279 190
38 3300046642 Ga0495634_0102008 Ga0495634_0102008_1168_1791 190
39 3300013308 Ga0157375_10161016 Ga0157375_101610163 191
40 3300005530 Ga0070679_100060525 Ga0070679_1000605252 192
41 3300013307 Ga0157372_10752511 Ga0157372_107525112 192
42 3300025917 Ga0207660_10522818 Ga0207660_105228181 192
43 3300025921 Ga0207652_10197228 Ga0207652_101972282 192
44 3300046674 Ga0495588_0082529 Ga0495588_0082529_213_842 192
45 3300050494 nmdc:mga06z11_432393_c1 nmdc:mga06z11_432393_c1_13_657 193
46 3300005295 Ga0065707_10290892 Ga0065707_102908922 194
47 3300005329 Ga0070683_100079053 Ga0070683_1000790533 194
48 3300005614 Ga0068856_100111496 Ga0068856_1001114963 194
49 3300009093 Ga0105240_10002142 Ga0105240_100021423 194
50 3300013104 Ga0157370_10089962 Ga0157370_100899622 194
51 3300013105 Ga0157369_10001363 Ga0157369_1000136330 194
52 3300013105 Ga0157369_10003286 Ga0157369_1000328619 194
53 3300013307 Ga0157372_10000968 Ga0157372_1000096830 194
54 3300025913 Ga0207695_10003501 Ga0207695_1000350119 194
55 3300025917 Ga0207660_10615744 Ga0207660_106157441 194
56 3300025921 Ga0207652_10104650 Ga0207652_101046505 194
57 3300025924 Ga0207694_10035082 Ga0207694_100350822 194
58 3300025924 Ga0207694_10238891 Ga0207694_102388912 194
59 3300025944 Ga0207661_10035472 Ga0207661_100354724 194
60 3300025949 Ga0207667_10002772 Ga0207667_1000277215 194
61 3300026078 Ga0207702_10216516 Ga0207702_102165163 194
62 3300039447 Ga0436361_0807603 Ga0436361_0807603_154_843 194
63 3300049573 Ga0501037_0099222 Ga0501037_0099222_304_936 194
64 3300049574 Ga0501038_0008308 Ga0501038_0008308_8385_9017 194
65 3300049575 Ga0501039_0075802 Ga0501039_0075802_486_1118 194
66 3300049579 Ga0501043_0018518 Ga0501043_0018518_3276_3908 194
67 3300049580 Ga0501046_0108943 Ga0501046_0108943_454_1086 194
68 3300049581 Ga0501047_0124677 Ga0501047_0124677_1740_2372 194
69 3300049823 Ga0501044_0008204 Ga0501044_0008204_7743_8375 194
70 3300005458 Ga0070681_10008604 Ga0070681_100086046 195
71 3300005535 Ga0070684_100450704 Ga0070684_1004507042 195
72 3300005616 Ga0068852_100464638 Ga0068852_1004646382 195
73 3300013307 Ga0157372_10685876 Ga0157372_106858762 195
74 3300031235 Ga0265330_10014736 Ga0265330_100147364 195
75 3300031344 Ga0265316_10004054 Ga0265316_100040544 195
76 3300031712 Ga0265342_10006946 Ga0265342_100069465 195
77 iso_pu_bacteria 2884693830 2884700044 195
78 iso_pu_bacteria 2895442618 2895450016 195
79 3300005355 Ga0070671_100010716 Ga0070671_1000107165 196
80 3300005618 Ga0068864_100032802 Ga0068864_1000328024 196
81 3300005841 Ga0068863_100099236 Ga0068863_1000992364 196
82 3300006237 Ga0097621_100004481 Ga0097621_1000044815 196
83 3300006358 Ga0068871_100004639 Ga0068871_1000046392 196
84 3300009176 Ga0105242_10116716 Ga0105242_101167162 196
85 3300009177 Ga0105248_10050185 Ga0105248_100501855 196
86 3300013296 Ga0157374_10000158 Ga0157374_1000015870 196
87 3300014969 Ga0157376_10000504 Ga0157376_100005045 196
88 3300025931 Ga0207644_10024876 Ga0207644_100248765 196
89 3300025941 Ga0207711_10028170 Ga0207711_100281703 196
90 3300026088 Ga0207641_10084028 Ga0207641_100840282 196
91 3300026095 Ga0207676_10351848 Ga0207676_103518482 196
92 3300013306 Ga0163162_10036600 Ga0163162_100366007 197
93 3300035692 Ga0373935_0197784 Ga0373935_0197784_496_1110 198
94 3300028666 Ga0265336_10097129 Ga0265336_100971292 199
95 3300031595 Ga0265313_10000004 Ga0265313_10000004145 199
96 iso_pu_bacteria 2515154123 2515688237 199
97 iso_pu_bacteria 2718217927 2719384146 199
98 iso_pu_bacteria 2721755763 2723875837 199
99 iso_pu_bacteria 2842462802 2842462823 199
100 iso_pu_bacteria 2891326441 2891330014 199
101 iso_pu_bacteria 2904434214 2904436662 199
102 iso_pu_bacteria 3006425503 3006428595 199
103 iso_pu_bacteria 3006486233 3006488871 199
104 iso_pu_bacteria 8005275841 8005278856 199
105 iso_pu_bacteria 8008485437 8008487469 199
106 iso_pu_bacteria 8025478263 8025481731 199
107 iso_pu_bacteria 8025524527 8025527011 199
108 iso_pu_bacteria 8033684223 8033689934 199
109 iso_pu_bacteria 8047893842 8047896765 199
110 iso_pu_bacteria 8056829672 8056832119 199
111 3300005435 Ga0070714_100095720 Ga0070714_1000957204 200
112 3300005435 Ga0070714_100242505 Ga0070714_1002425052 200
113 3300006914 Ga0075436_100030317 Ga0075436_1000303174 200
114 3300025929 Ga0207664_10082927 Ga0207664_100829274 200
115 3300025929 Ga0207664_10246337 Ga0207664_102463372 200
116 3300050513 nmdc:mga0rr50_244214_c1 nmdc:mga0rr50_244214_c1_550_1170 200
117 3300050514 nmdc:mga08x19_14339_c1 nmdc:mga08x19_14339_c1_2492_3112 200
118 3300049586 Ga0501070_0024586 Ga0501070_0024586_814_1446 201
119 3300003320 rootH2_10144468 rootH2_101444682 202
120 3300005295 Ga0065707_10319758 Ga0065707_103197582 202
121 3300005327 Ga0070658_10046895 Ga0070658_100468952 202
122 3300005327 Ga0070658_11061796 Ga0070658_110617961 202
123 3300005328 Ga0070676_10206723 Ga0070676_102067232 202
124 3300005329 Ga0070683_100000655 Ga0070683_10000065516 202
125 3300005329 Ga0070683_100006909 Ga0070683_1000069095 202
126 3300005329 Ga0070683_100369058 Ga0070683_1003690582 202
127 3300005329 Ga0070683_100604067 Ga0070683_1006040671 202
128 3300005331 Ga0070670_100002779 Ga0070670_1000027792 202
129 3300005331 Ga0070670_100216564 Ga0070670_1002165642 202
130 3300005335 Ga0070666_10498290 Ga0070666_104982901 202
131 3300005337 Ga0070682_100071427 Ga0070682_1000714272 202
132 3300005337 Ga0070682_100320308 Ga0070682_1003203082 202
133 3300005338 Ga0068868_100089736 Ga0068868_1000897363 202
134 3300005338 Ga0068868_100103379 Ga0068868_1001033792 202
135 3300005339 Ga0070660_100117534 Ga0070660_1001175343 202
136 3300005347 Ga0070668_100292271 Ga0070668_1002922712 202
137 3300005347 Ga0070668_100663585 Ga0070668_1006635851 202
138 3300005353 Ga0070669_100000566 Ga0070669_10000056619 202
139 3300005354 Ga0070675_100267169 Ga0070675_1002671692 202
140 3300005356 Ga0070674_100299205 Ga0070674_1002992052 202
141 3300005366 Ga0070659_100029486 Ga0070659_1000294864 202
142 3300005366 Ga0070659_100445278 Ga0070659_1004452782 202
143 3300005367 Ga0070667_100147454 Ga0070667_1001474543 202
144 3300005435 Ga0070714_100032491 Ga0070714_1000324916 202
145 3300005436 Ga0070713_100013756 Ga0070713_1000137562 202
146 3300005438 Ga0070701_10003257 Ga0070701_100032576 202
147 3300005441 Ga0070700_100131955 Ga0070700_1001319552 202
148 3300005444 Ga0070694_100577194 Ga0070694_1005771942 202
149 3300005445 Ga0070708_100080082 Ga0070708_1000800823 202
150 3300005458 Ga0070681_10003042 Ga0070681_1000304211 202
151 3300005458 Ga0070681_10419523 Ga0070681_104195232 202
152 3300005459 Ga0068867_100032665 Ga0068867_1000326652 202
153 3300005459 Ga0068867_100100291 Ga0068867_1001002912 202
154 3300005467 Ga0070706_100036866 Ga0070706_1000368665 202
155 3300005467 Ga0070706_100758452 Ga0070706_1007584521 202
156 3300005468 Ga0070707_100233126 Ga0070707_1002331262 202
157 3300005468 Ga0070707_101086147 Ga0070707_1010861471 202
158 3300005471 Ga0070698_100000122 Ga0070698_10000012247 202
159 3300005471 Ga0070698_100147322 Ga0070698_1001473222 202
160 3300005471 Ga0070698_100380437 Ga0070698_1003804371 202
161 3300005518 Ga0070699_100000779 Ga0070699_10000077917 202
162 3300005518 Ga0070699_100010635 Ga0070699_1000106358 202
163 3300005518 Ga0070699_100064235 Ga0070699_1000642354 202
164 3300005530 Ga0070679_100013231 Ga0070679_1000132313 202
165 3300005535 Ga0070684_100016107 Ga0070684_1000161074 202
166 3300005535 Ga0070684_100055337 Ga0070684_1000553373 202
167 3300005535 Ga0070684_100224294 Ga0070684_1002242942 202
168 3300005535 Ga0070684_100349077 Ga0070684_1003490772 202
169 3300005536 Ga0070697_100008526 Ga0070697_1000085268 202
170 3300005539 Ga0068853_100358428 Ga0068853_1003584282 202
171 3300005543 Ga0070672_100164581 Ga0070672_1001645813 202
172 3300005545 Ga0070695_100046003 Ga0070695_1000460033 202
173 3300005546 Ga0070696_100000059 Ga0070696_10000005921 202
174 3300005546 Ga0070696_100018215 Ga0070696_1000182154 202
175 3300005547 Ga0070693_100018308 Ga0070693_1000183083 202
176 3300005547 Ga0070693_100270123 Ga0070693_1002701231 202
177 3300005548 Ga0070665_100120769 Ga0070665_1001207691 202
178 3300005563 Ga0068855_100002369 Ga0068855_1000023695 202
179 3300005563 Ga0068855_100030887 Ga0068855_1000308877 202
180 3300005563 Ga0068855_100047437 Ga0068855_1000474375 202
181 3300005564 Ga0070664_100013004 Ga0070664_1000130044 202
182 3300005564 Ga0070664_100289697 Ga0070664_1002896971 202
183 3300005564 Ga0070664_100587608 Ga0070664_1005876081 202
184 3300005577 Ga0068857_100009041 Ga0068857_1000090419 202
185 3300005577 Ga0068857_100010828 Ga0068857_1000108287 202
186 3300005578 Ga0068854_100224209 Ga0068854_1002242092 202
187 3300005614 Ga0068856_100243791 Ga0068856_1002437912 202
188 3300005614 Ga0068856_100579993 Ga0068856_1005799932 202
189 3300005616 Ga0068852_100161080 Ga0068852_1001610802 202
190 3300005616 Ga0068852_100189299 Ga0068852_1001892992 202
191 3300005616 Ga0068852_100335586 Ga0068852_1003355862 202
192 3300005617 Ga0068859_100186844 Ga0068859_1001868442 202
193 3300005617 Ga0068859_100228879 Ga0068859_1002288792 202
194 3300005617 Ga0068859_100511465 Ga0068859_1005114652 202
195 3300005718 Ga0068866_10090041 Ga0068866_100900412 202
196 3300005719 Ga0068861_100231039 Ga0068861_1002310392 202
197 3300005840 Ga0068870_10018009 Ga0068870_100180094 202
198 3300005841 Ga0068863_100138558 Ga0068863_1001385583 202
199 3300005842 Ga0068858_100020693 Ga0068858_1000206937 202
200 3300005843 Ga0068860_100481535 Ga0068860_1004815351 202
201 3300005843 Ga0068860_100814766 Ga0068860_1008147662 202
202 3300005843 Ga0068860_100915722 Ga0068860_1009157221 202
203 3300005844 Ga0068862_100007064 Ga0068862_1000070647 202
204 3300006195 Ga0075366_10168125 Ga0075366_101681251 202
205 3300006237 Ga0097621_100095490 Ga0097621_1000954903 202
206 3300006237 Ga0097621_100369902 Ga0097621_1003699021 202
207 3300006358 Ga0068871_100049384 Ga0068871_1000493842 202
208 3300006358 Ga0068871_100063462 Ga0068871_1000634623 202
209 3300006847 Ga0075431_100197940 Ga0075431_1001979402 202
210 3300006881 Ga0068865_100071903 Ga0068865_1000719032 202
211 3300006881 Ga0068865_100194759 Ga0068865_1001947592 202
212 3300006931 Ga0097620_100186859 Ga0097620_1001868593 202
213 3300006931 Ga0097620_100228882 Ga0097620_1002288822 202
214 3300006931 Ga0097620_100511434 Ga0097620_1005114342 202
215 3300007265 Ga0099794_10119513 Ga0099794_101195132 202
216 3300009093 Ga0105240_10003537 Ga0105240_1000353717 202
217 3300009093 Ga0105240_10016265 Ga0105240_1001626510 202
218 3300009093 Ga0105240_11096136 Ga0105240_110961361 202
219 3300009098 Ga0105245_10075361 Ga0105245_100753612 202
220 3300009098 Ga0105245_10128517 Ga0105245_101285172 202
221 3300009098 Ga0105245_10724424 Ga0105245_107244242 202
222 3300009174 Ga0105241_10019962 Ga0105241_100199626 202
223 3300009174 Ga0105241_10495752 Ga0105241_104957522 202
224 3300009174 Ga0105241_11155599 Ga0105241_111555991 202
225 3300009176 Ga0105242_10000494 Ga0105242_1000049416 202
226 3300009176 Ga0105242_10002807 Ga0105242_100028079 202
227 3300009176 Ga0105242_10326789 Ga0105242_103267891 202
228 3300009177 Ga0105248_10110766 Ga0105248_101107664 202
229 3300009177 Ga0105248_10151528 Ga0105248_101515283 202
230 3300009177 Ga0105248_10157021 Ga0105248_101570213 202
231 3300009177 Ga0105248_10265137 Ga0105248_102651373 202
232 3300009177 Ga0105248_10884624 Ga0105248_108846241 202
233 3300009545 Ga0105237_10314435 Ga0105237_103144351 202
234 3300009551 Ga0105238_10023340 Ga0105238_100233405 202
235 3300009551 Ga0105238_10040071 Ga0105238_100400714 202
236 3300009551 Ga0105238_10110244 Ga0105238_101102444 202
237 3300009551 Ga0105238_10408914 Ga0105238_104089142 202
238 3300009553 Ga0105249_10000582 Ga0105249_1000058219 202
239 3300009553 Ga0105249_10110848 Ga0105249_101108483 202
240 3300010375 Ga0105239_10065246 Ga0105239_100652464 202
241 3300011119 Ga0105246_10239800 Ga0105246_102398001 202
242 3300013104 Ga0157370_10708518 Ga0157370_107085182 202
243 3300013105 Ga0157369_10122350 Ga0157369_101223504 202
244 3300013105 Ga0157369_10147357 Ga0157369_101473573 202
245 3300013105 Ga0157369_10198817 Ga0157369_101988172 202
246 3300013105 Ga0157369_10381642 Ga0157369_103816422 202
247 3300013105 Ga0157369_10424739 Ga0157369_104247392 202
248 3300013296 Ga0157374_10133732 Ga0157374_101337322 202
249 3300013296 Ga0157374_10243823 Ga0157374_102438232 202
250 3300013306 Ga0163162_10087536 Ga0163162_100875364 202
251 3300013306 Ga0163162_10285468 Ga0163162_102854682 202
252 3300013306 Ga0163162_10374191 Ga0163162_103741913 202
253 3300013307 Ga0157372_10034058 Ga0157372_100340582 202
254 3300013307 Ga0157372_10188970 Ga0157372_101889702 202
255 3300013307 Ga0157372_10552813 Ga0157372_105528132 202
256 3300013307 Ga0157372_10565726 Ga0157372_105657262 202
257 3300013308 Ga0157375_10014989 Ga0157375_100149892 202
258 3300013308 Ga0157375_10017676 Ga0157375_100176762 202
259 3300013308 Ga0157375_10416950 Ga0157375_104169502 202
260 3300014326 Ga0157380_10169393 Ga0157380_101693932 202
261 3300014745 Ga0157377_10134404 Ga0157377_101344042 202
262 3300014968 Ga0157379_10051452 Ga0157379_100514522 202
263 3300014969 Ga0157376_10168130 Ga0157376_101681302 202
264 3300014969 Ga0157376_10192030 Ga0157376_101920302 202
265 3300014969 Ga0157376_10244356 Ga0157376_102443563 202
266 3300017792 Ga0163161_10245198 Ga0163161_102451982 202
267 3300025315 Ga0207697_10071700 Ga0207697_100717002 202
268 3300025899 Ga0207642_10063368 Ga0207642_100633682 202
269 3300025903 Ga0207680_10239419 Ga0207680_102394192 202
270 3300025907 Ga0207645_10037069 Ga0207645_100370693 202
271 3300025908 Ga0207643_10005910 Ga0207643_100059102 202
272 3300025909 Ga0207705_10017431 Ga0207705_100174315 202
273 3300025909 Ga0207705_10693964 Ga0207705_106939641 202
274 3300025910 Ga0207684_10055225 Ga0207684_100552254 202
275 3300025911 Ga0207654_10237808 Ga0207654_102378082 202
276 3300025912 Ga0207707_10067287 Ga0207707_100672873 202
277 3300025913 Ga0207695_10001162 Ga0207695_1000116239 202
278 3300025913 Ga0207695_10061983 Ga0207695_100619832 202
279 3300025919 Ga0207657_10126537 Ga0207657_101265372 202
280 3300025919 Ga0207657_10496794 Ga0207657_104967941 202
281 3300025922 Ga0207646_10630679 Ga0207646_106306792 202
282 3300025923 Ga0207681_10001953 Ga0207681_100019539 202
283 3300025923 Ga0207681_10408253 Ga0207681_104082531 202
284 3300025924 Ga0207694_10223768 Ga0207694_102237682 202
285 3300025924 Ga0207694_10577942 Ga0207694_105779421 202
286 3300025925 Ga0207650_10557007 Ga0207650_105570071 202
287 3300025927 Ga0207687_10269446 Ga0207687_102694461 202
288 3300025927 Ga0207687_10286280 Ga0207687_102862801 202
289 3300025928 Ga0207700_10024905 Ga0207700_100249054 202
290 3300025929 Ga0207664_10074592 Ga0207664_100745923 202
291 3300025929 Ga0207664_10225412 Ga0207664_102254122 202
292 3300025931 Ga0207644_10916206 Ga0207644_109162061 202
293 3300025934 Ga0207686_10003613 Ga0207686_100036135 202
294 3300025934 Ga0207686_10059287 Ga0207686_100592872 202
295 3300025934 Ga0207686_10108662 Ga0207686_101086622 202
296 3300025938 Ga0207704_10109335 Ga0207704_101093353 202
297 3300025940 Ga0207691_10104455 Ga0207691_101044554 202
298 3300025941 Ga0207711_10198429 Ga0207711_101984292 202
299 3300025941 Ga0207711_10576668 Ga0207711_105766682 202
300 3300025942 Ga0207689_10429709 Ga0207689_104297091 202
301 3300025944 Ga0207661_10004560 Ga0207661_100045609 202
302 3300025944 Ga0207661_10043953 Ga0207661_100439532 202
303 3300025944 Ga0207661_10054675 Ga0207661_100546752 202
304 3300025945 Ga0207679_10040294 Ga0207679_100402943 202
305 3300025945 Ga0207679_10211073 Ga0207679_102110733 202
306 3300025949 Ga0207667_10011432 Ga0207667_100114326 202
307 3300025949 Ga0207667_10237727 Ga0207667_102377271 202
308 3300025949 Ga0207667_10661481 Ga0207667_106614811 202
309 3300025961 Ga0207712_10033535 Ga0207712_100335353 202
310 3300025961 Ga0207712_10090893 Ga0207712_100908932 202
311 3300025972 Ga0207668_10021239 Ga0207668_100212392 202
312 3300025972 Ga0207668_10135080 Ga0207668_101350801 202
313 3300025972 Ga0207668_10290103 Ga0207668_102901031 202
314 3300025986 Ga0207658_10119678 Ga0207658_101196782 202
315 3300026023 Ga0207677_10207681 Ga0207677_102076812 202
316 3300026035 Ga0207703_10016259 Ga0207703_100162596 202
317 3300026075 Ga0207708_10081783 Ga0207708_100817833 202
318 3300026078 Ga0207702_10163517 Ga0207702_101635172 202
319 3300026078 Ga0207702_10215461 Ga0207702_102154611 202
320 3300026078 Ga0207702_10667301 Ga0207702_106673011 202
321 3300026088 Ga0207641_10157741 Ga0207641_101577412 202
322 3300026089 Ga0207648_10091323 Ga0207648_100913233 202
323 3300026089 Ga0207648_10271522 Ga0207648_102715223 202
324 3300026116 Ga0207674_10020080 Ga0207674_100200806 202
325 3300026116 Ga0207674_10229698 Ga0207674_102296981 202
326 3300026118 Ga0207675_100186703 Ga0207675_1001867032 202
327 3300026121 Ga0207683_10674667 Ga0207683_106746671 202
328 3300026142 Ga0207698_10366481 Ga0207698_103664812 202
329 3300028379 Ga0268266_11028465 Ga0268266_110284651 202
330 3300028380 Ga0268265_10001794 Ga0268265_100017946 202
331 3300028380 Ga0268265_10140629 Ga0268265_101406292 202
332 3300028381 Ga0268264_10408325 Ga0268264_104083252 202
333 3300028381 Ga0268264_10428336 Ga0268264_104283362 202
334 3300031731 Ga0307405_10164712 Ga0307405_101647122 202
335 3300031995 Ga0307409_100962409 Ga0307409_1009624092 202
336 3300032002 Ga0307416_100518137 Ga0307416_1005181372 202
337 3300032004 Ga0307414_10140692 Ga0307414_101406922 202
338 3300035085 Ga0373929_0030848 Ga0373929_0030848_421_1053 202
339 3300035114 Ga0373939_0130243 Ga0373939_0130243_138_770 202
340 3300035119 Ga0373956_0020139 Ga0373956_0020139_1742_2398 202
341 3300035171 Ga0373946_0372657 Ga0373946_0372657_56_685 202
342 3300035207 Ga0373942_0008853 Ga0373942_0008853_64_696 202
343 3300035691 Ga0373931_0141454 Ga0373931_0141454_225_857 202
344 3300035724 Ga0373933_0013413 Ga0373933_0013413_2163_2795 202
345 3300035725 Ga0373947_0158352 Ga0373947_0158352_36_665 202
346 3300036401 Ga0373937_0126984 Ga0373937_0126984_1117_1773 202
347 3300041494 Ga0451837_1244620 Ga0451837_1244620_319_951 202
348 3300042005 Ga0439448_0012918 Ga0439448_0012918_658_1290 202
349 3300042876 Ga0451577_0703078 Ga0451577_0703078_200_841 202
350 3300044684 Ga0466966_0045063 Ga0466966_0045063_1894_2526 202
351 3300044694 Ga0466963_0033456 Ga0466963_0033456_566_1195 202
352 3300044694 Ga0466963_0088979 Ga0466963_0088979_1449_2081 202
353 3300044694 Ga0466963_0336435 Ga0466963_0336435_156_788 202
354 3300044719 Ga0466971_0281552 Ga0466971_0281552_48_680 202
355 3300045049 Ga0466959_0117826 Ga0466959_0117826_1129_1761 202
356 3300045976 Ga0466967_0664439 Ga0466967_0664439_220_849 202
357 3300046459 Ga0495629_0483559 Ga0495629_0483559_136_765 202
358 3300046460 Ga0495638_0135704 Ga0495638_0135704_378_1016 202
359 3300046463 Ga0495653_0139753 Ga0495653_0139753_999_1631 202
360 3300046499 Ga0495594_0054450 Ga0495594_0054450_424_1053 202
361 3300046499 Ga0495594_0062189 Ga0495594_0062189_995_1624 202
362 3300046514 Ga0495618_0237874 Ga0495618_0237874_365_994 202
363 3300046517 Ga0495630_0300125 Ga0495630_0300125_560_1189 202
364 3300046529 Ga0495652_0041799 Ga0495652_0041799_3138_3770 202
365 3300046531 Ga0495665_0008286 Ga0495665_0008286_4205_4834 202
366 3300046535 Ga0495586_0248381 Ga0495586_0248381_355_984 202
367 3300046536 Ga0495587_0063377 Ga0495587_0063377_331_963 202
368 3300046543 Ga0495645_0006492 Ga0495645_0006492_1116_1748 202
369 3300046642 Ga0495634_0069434 Ga0495634_0069434_1392_2021 202
370 3300046663 Ga0495635_0083784 Ga0495635_0083784_710_1342 202
371 3300046681 Ga0495647_0134608 Ga0495647_0134608_15_644 202
372 3300047317 Ga0495604_0071217 Ga0495604_0071217_241_873 202
373 3300047319 Ga0495674_0073126 Ga0495674_0073126_412_1041 202
374 3300047471 Ga0495684_0008456 Ga0495684_0008456_3290_3919 202
375 3300047472 Ga0495686_0016441 Ga0495686_0016441_3014_3646 202
376 3300048088 Ga0495602_0035227 Ga0495602_0035227_3927_4559 202
377 3300048907 Ga0496104_0000014 Ga0496104_0000014_130154_130786 202
378 3300049576 Ga0501040_0132370 Ga0501040_0132370_1099_1728 202
379 3300049579 Ga0501043_0543496 Ga0501043_0543496_25_657 202
380 3300049582 Ga0501048_0001269 Ga0501048_0001269_2285_2917 202
381 3300049593 Ga0501077_0155092 Ga0501077_0155092_776_1396 202
382 3300049668 Ga0501233_081863 Ga0501233_081863_61_693 202
383 3300049822 Ga0501035_0407055 Ga0501035_0407055_156_788 202
384 3300050493 nmdc:mga0k408_363755_c1 nmdc:mga0k408_363755_c1_128_760 202
385 3300050508 nmdc:mga09592_4370_c1 nmdc:mga09592_4370_c1_8724_9362 202
386 3300050509 nmdc:mga0qj67_145_c1 nmdc:mga0qj67_145_c1_34690_35328 202
387 3300050510 nmdc:mga06r32_244046_c1 nmdc:mga06r32_244046_c1_1004_1639 202
388 3300050511 nmdc:mga08y16_50614_c1 nmdc:mga08y16_50614_c1_3397_4032 202
389 3300053133 Ga0500655_008591 Ga0500655_008591_190_825 202
390 3300053150 Ga0500603_054851 Ga0500603_054851_162_809 202
391 3300053737 Ga0500601_000465 Ga0500601_000465_4380_5009 202
392 3300005293 Ga0065715_10167639 Ga0065715_101676392 203
393 3300005327 Ga0070658_10045668 Ga0070658_100456682 203
394 3300005327 Ga0070658_10190980 Ga0070658_101909803 203
395 3300005330 Ga0070690_100337578 Ga0070690_1003375782 203
396 3300005331 Ga0070670_100339023 Ga0070670_1003390232 203
397 3300005336 Ga0070680_100006802 Ga0070680_1000068025 203
398 3300005336 Ga0070680_100024698 Ga0070680_1000246983 203
399 3300005336 Ga0070680_100031242 Ga0070680_1000312426 203
400 3300005339 Ga0070660_100065655 Ga0070660_1000656553 203
401 3300005339 Ga0070660_100385862 Ga0070660_1003858622 203
402 3300005344 Ga0070661_100121211 Ga0070661_1001212112 203
403 3300005345 Ga0070692_10282046 Ga0070692_102820461 203
404 3300005354 Ga0070675_100605232 Ga0070675_1006052322 203
405 3300005354 Ga0070675_101225365 Ga0070675_1012253651 203
406 3300005355 Ga0070671_100009865 Ga0070671_1000098653 203
407 3300005364 Ga0070673_100064069 Ga0070673_1000640692 203
408 3300005364 Ga0070673_100881302 Ga0070673_1008813021 203
409 3300005366 Ga0070659_100038787 Ga0070659_1000387873 203
410 3300005366 Ga0070659_100205948 Ga0070659_1002059482 203
411 3300005434 Ga0070709_10463011 Ga0070709_104630111 203
412 3300005435 Ga0070714_100006448 Ga0070714_1000064486 203
413 3300005435 Ga0070714_100188936 Ga0070714_1001889362 203
414 3300005436 Ga0070713_100565883 Ga0070713_1005658833 203
415 3300005437 Ga0070710_10003320 Ga0070710_100033205 203
416 3300005438 Ga0070701_10056268 Ga0070701_100562683 203
417 3300005440 Ga0070705_100002041 Ga0070705_1000020414 203
418 3300005444 Ga0070694_100007030 Ga0070694_1000070304 203
419 3300005444 Ga0070694_100043995 Ga0070694_1000439953 203
420 3300005444 Ga0070694_100547592 Ga0070694_1005475921 203
421 3300005445 Ga0070708_100000381 Ga0070708_1000003819 203
422 3300005445 Ga0070708_100012335 Ga0070708_1000123358 203
423 3300005456 Ga0070678_100533244 Ga0070678_1005332442 203
424 3300005458 Ga0070681_10125458 Ga0070681_101254583 203
425 3300005458 Ga0070681_10169599 Ga0070681_101695993 203
426 3300005466 Ga0070685_10002911 Ga0070685_100029112 203
427 3300005467 Ga0070706_100008495 Ga0070706_1000084953 203
428 3300005467 Ga0070706_100074652 Ga0070706_1000746523 203
429 3300005467 Ga0070706_100127696 Ga0070706_1001276963 203
430 3300005468 Ga0070707_100002489 Ga0070707_1000024899 203
431 3300005468 Ga0070707_100032687 Ga0070707_1000326873 203
432 3300005468 Ga0070707_100044161 Ga0070707_1000441614 203
433 3300005468 Ga0070707_100134698 Ga0070707_1001346983 203
434 3300005471 Ga0070698_100002933 Ga0070698_10000293313 203
435 3300005471 Ga0070698_100165574 Ga0070698_1001655743 203
436 3300005518 Ga0070699_100001147 Ga0070699_1000011477 203
437 3300005518 Ga0070699_100002138 Ga0070699_10000213811 203
438 3300005518 Ga0070699_100740251 Ga0070699_1007402511 203
439 3300005530 Ga0070679_100026551 Ga0070679_1000265515 203
440 3300005530 Ga0070679_100069429 Ga0070679_1000694291 203
441 3300005530 Ga0070679_100127633 Ga0070679_1001276333 203
442 3300005530 Ga0070679_100605950 Ga0070679_1006059502 203
443 3300005530 Ga0070679_101220636 Ga0070679_1012206361 203
444 3300005536 Ga0070697_100000272 Ga0070697_1000002727 203
445 3300005536 Ga0070697_100002379 Ga0070697_1000023794 203
446 3300005536 Ga0070697_100050347 Ga0070697_1000503471 203
447 3300005536 Ga0070697_100064880 Ga0070697_1000648803 203
448 3300005539 Ga0068853_100251114 Ga0068853_1002511142 203
449 3300005543 Ga0070672_100222904 Ga0070672_1002229042 203
450 3300005544 Ga0070686_100110580 Ga0070686_1001105803 203
451 3300005545 Ga0070695_100002517 Ga0070695_1000025178 203
452 3300005545 Ga0070695_100021848 Ga0070695_1000218484 203
453 3300005545 Ga0070695_100130069 Ga0070695_1001300692 203
454 3300005546 Ga0070696_100003944 Ga0070696_1000039447 203
455 3300005546 Ga0070696_100017114 Ga0070696_1000171145 203
456 3300005546 Ga0070696_100346782 Ga0070696_1003467822 203
457 3300005546 Ga0070696_100409163 Ga0070696_1004091632 203
458 3300005548 Ga0070665_100082484 Ga0070665_1000824842 203
459 3300005548 Ga0070665_100498637 Ga0070665_1004986372 203
460 3300005563 Ga0068855_100604565 Ga0068855_1006045652 203
461 3300005615 Ga0070702_100151051 Ga0070702_1001510511 203
462 3300005617 Ga0068859_100123633 Ga0068859_1001236333 203
463 3300005617 Ga0068859_100182134 Ga0068859_1001821342 203
464 3300005617 Ga0068859_100620865 Ga0068859_1006208652 203
465 3300005618 Ga0068864_100216853 Ga0068864_1002168531 203
466 3300005842 Ga0068858_100318188 Ga0068858_1003181882 203
467 3300005843 Ga0068860_100011796 Ga0068860_1000117963 203
468 3300005844 Ga0068862_100640600 Ga0068862_1006406002 203
469 3300005844 Ga0068862_100856178 Ga0068862_1008561781 203
470 3300005844 Ga0068862_100928672 Ga0068862_1009286722 203
471 3300005844 Ga0068862_101013634 Ga0068862_1010136341 203
472 3300005937 Ga0081455_10000733 Ga0081455_1000073325 203
473 3300005981 Ga0081538_10006932 Ga0081538_100069323 203
474 3300005981 Ga0081538_10013401 Ga0081538_100134016 203
475 3300005981 Ga0081538_10019713 Ga0081538_100197132 203
476 3300005985 Ga0081539_10000087 Ga0081539_1000008790 203
477 3300006175 Ga0070712_100273466 Ga0070712_1002734662 203
478 3300006178 Ga0075367_10086696 Ga0075367_100866962 203
479 3300006195 Ga0075366_10051119 Ga0075366_100511193 203
480 3300006237 Ga0097621_100077827 Ga0097621_1000778273 203
481 3300006353 Ga0075370_10015474 Ga0075370_100154742 203
482 3300006358 Ga0068871_100032288 Ga0068871_1000322883 203
483 3300006846 Ga0075430_100042803 Ga0075430_1000428034 203
484 3300006846 Ga0075430_100060159 Ga0075430_1000601593 203
485 3300006846 Ga0075430_100283840 Ga0075430_1002838401 203
486 3300006847 Ga0075431_100047077 Ga0075431_1000470772 203
487 3300006847 Ga0075431_100067520 Ga0075431_1000675203 203
488 3300006847 Ga0075431_100106084 Ga0075431_1001060842 203
489 3300006847 Ga0075431_100189656 Ga0075431_1001896563 203
490 3300006847 Ga0075431_101006526 Ga0075431_1010065262 203
491 3300006852 Ga0075433_10438048 Ga0075433_104380482 203
492 3300006871 Ga0075434_100004223 Ga0075434_10000422310 203
493 3300006871 Ga0075434_100038828 Ga0075434_1000388284 203
494 3300006871 Ga0075434_100054837 Ga0075434_1000548375 203
495 3300006871 Ga0075434_100383321 Ga0075434_1003833212 203
496 3300006871 Ga0075434_100770395 Ga0075434_1007703952 203
497 3300006880 Ga0075429_100719775 Ga0075429_1007197752 203
498 3300006914 Ga0075436_100008037 Ga0075436_1000080378 203
499 3300006914 Ga0075436_100048619 Ga0075436_1000486191 203
500 3300006914 Ga0075436_100185848 Ga0075436_1001858482 203
501 3300006914 Ga0075436_100341323 Ga0075436_1003413232 203
502 3300006931 Ga0097620_100123624 Ga0097620_1001236243 203
503 3300006931 Ga0097620_100182145 Ga0097620_1001821452 203
504 3300006931 Ga0097620_100620873 Ga0097620_1006208732 203
505 3300007076 Ga0075435_100051075 Ga0075435_1000510752 203
506 3300007076 Ga0075435_100089319 Ga0075435_1000893192 203
507 3300009093 Ga0105240_10179009 Ga0105240_101790093 203
508 3300009094 Ga0111539_10117554 Ga0111539_101175541 203
509 3300009098 Ga0105245_10230510 Ga0105245_102305102 203
510 3300009147 Ga0114129_10000260 Ga0114129_1000026035 203
511 3300009147 Ga0114129_10156707 Ga0114129_101567074 203
512 3300009174 Ga0105241_10221046 Ga0105241_102210462 203
513 3300009174 Ga0105241_10431043 Ga0105241_104310432 203
514 3300009177 Ga0105248_10000006 Ga0105248_100000066 203
515 3300009177 Ga0105248_10360453 Ga0105248_103604532 203
516 3300009177 Ga0105248_10405388 Ga0105248_104053882 203
517 3300009177 Ga0105248_10500149 Ga0105248_105001492 203
518 3300009553 Ga0105249_10320446 Ga0105249_103204461 203
519 3300009553 Ga0105249_10688532 Ga0105249_106885322 203
520 3300009553 Ga0105249_10707473 Ga0105249_107074732 203
521 3300010375 Ga0105239_10029595 Ga0105239_100295956 203
522 3300010375 Ga0105239_10247823 Ga0105239_102478232 203
523 3300011119 Ga0105246_10276024 Ga0105246_102760242 203
524 3300011119 Ga0105246_10517081 Ga0105246_105170812 203
525 3300012495 Ga0157323_1003327 Ga0157323_10033272 203
526 3300013105 Ga0157369_10228799 Ga0157369_102287992 203
527 3300013105 Ga0157369_10250883 Ga0157369_102508834 203
528 3300013296 Ga0157374_10013300 Ga0157374_100133004 203
529 3300013307 Ga0157372_10012193 Ga0157372_100121935 203
530 3300013307 Ga0157372_10024833 Ga0157372_100248333 203
531 3300013307 Ga0157372_10457521 Ga0157372_104575212 203
532 3300014325 Ga0163163_10913605 Ga0163163_109136052 203
533 3300014326 Ga0157380_10005964 Ga0157380_100059648 203
534 3300014968 Ga0157379_10618953 Ga0157379_106189532 203
535 3300014969 Ga0157376_11439227 Ga0157376_114392271 203
536 3300015688 Ga0183367_1001 Ga0183367_100120 203
537 3300020069 Ga0197907_11166738 Ga0197907_111667382 203
538 3300020070 Ga0206356_10711775 Ga0206356_107117753 203
539 3300020081 Ga0206354_10069137 Ga0206354_100691372 203
540 3300021384 Ga0213876_10184708 Ga0213876_101847082 203
541 3300021441 Ga0213871_10023561 Ga0213871_100235612 203
542 3300022467 Ga0224712_10001684 Ga0224712_100016845 203
543 3300025893 Ga0207682_10004059 Ga0207682_100040596 203
544 3300025898 Ga0207692_10016610 Ga0207692_100166103 203
545 3300025909 Ga0207705_10337048 Ga0207705_103370482 203
546 3300025910 Ga0207684_10021616 Ga0207684_100216163 203
547 3300025910 Ga0207684_10219347 Ga0207684_102193471 203
548 3300025910 Ga0207684_10257645 Ga0207684_102576452 203
549 3300025912 Ga0207707_10001557 Ga0207707_100015579 203
550 3300025912 Ga0207707_10002130 Ga0207707_100021304 203
551 3300025912 Ga0207707_10010399 Ga0207707_100103995 203
552 3300025912 Ga0207707_10834887 Ga0207707_108348871 203
553 3300025913 Ga0207695_10227897 Ga0207695_102278973 203
554 3300025915 Ga0207693_10261133 Ga0207693_102611332 203
555 3300025917 Ga0207660_10011149 Ga0207660_100111491 203
556 3300025917 Ga0207660_10030762 Ga0207660_100307623 203
557 3300025917 Ga0207660_10179379 Ga0207660_101793792 203
558 3300025919 Ga0207657_10060219 Ga0207657_100602193 203
559 3300025920 Ga0207649_10092720 Ga0207649_100927202 203
560 3300025921 Ga0207652_10218224 Ga0207652_102182243 203
561 3300025921 Ga0207652_10364194 Ga0207652_103641942 203
562 3300025921 Ga0207652_10953022 Ga0207652_109530221 203
563 3300025922 Ga0207646_10012507 Ga0207646_100125072 203
564 3300025922 Ga0207646_10107926 Ga0207646_101079263 203
565 3300025922 Ga0207646_10285631 Ga0207646_102856312 203
566 3300025922 Ga0207646_10311500 Ga0207646_103115002 203
567 3300025925 Ga0207650_10238267 Ga0207650_102382672 203
568 3300025927 Ga0207687_10399166 Ga0207687_103991661 203
569 3300025929 Ga0207664_10052569 Ga0207664_100525691 203
570 3300025931 Ga0207644_10130483 Ga0207644_101304832 203
571 3300025932 Ga0207690_10170308 Ga0207690_101703082 203
572 3300025932 Ga0207690_10360263 Ga0207690_103602632 203
573 3300025933 Ga0207706_10305637 Ga0207706_103056372 203
574 3300025940 Ga0207691_10235973 Ga0207691_102359732 203
575 3300025941 Ga0207711_10000064 Ga0207711_100000645 203
576 3300025941 Ga0207711_10243019 Ga0207711_102430192 203
577 3300025941 Ga0207711_10463549 Ga0207711_104635492 203
578 3300025941 Ga0207711_10633277 Ga0207711_106332771 203
579 3300025949 Ga0207667_10602328 Ga0207667_106023282 203
580 3300025960 Ga0207651_10314553 Ga0207651_103145532 203
581 3300025961 Ga0207712_10677967 Ga0207712_106779671 203
582 3300026041 Ga0207639_10097046 Ga0207639_100970463 203
583 3300026041 Ga0207639_10313713 Ga0207639_103137131 203
584 3300026067 Ga0207678_10260919 Ga0207678_102609192 203
585 3300026088 Ga0207641_10579111 Ga0207641_105791112 203
586 3300026089 Ga0207648_10109890 Ga0207648_101098903 203
587 3300026089 Ga0207648_10294290 Ga0207648_102942902 203
588 3300026095 Ga0207676_10671134 Ga0207676_106711342 203
589 3300026142 Ga0207698_10646115 Ga0207698_106461152 203
590 3300027671 Ga0209588_1040615 Ga0209588_10406152 203
591 3300027876 Ga0209974_10029724 Ga0209974_100297242 203
592 3300028017 Ga0265356_1009420 Ga0265356_10094202 203
593 3300028379 Ga0268266_10113298 Ga0268266_101132982 203
594 3300028379 Ga0268266_10294592 Ga0268266_102945922 203
595 3300028380 Ga0268265_10144093 Ga0268265_101440932 203
596 3300028380 Ga0268265_10257721 Ga0268265_102577211 203
597 3300028381 Ga0268264_10115371 Ga0268264_101153712 203
598 3300028381 Ga0268264_10953771 Ga0268264_109537711 203
599 3300028381 Ga0268264_11138541 Ga0268264_111385411 203
600 3300028556 Ga0265337_1005073 Ga0265337_10050733 203
601 3300028573 Ga0265334_10005808 Ga0265334_100058083 203
602 3300028800 Ga0265338_10049107 Ga0265338_100491074 203
603 3300030521 Ga0307511_10214577 Ga0307511_102145772 203
604 3300031235 Ga0265330_10134665 Ga0265330_101346652 203
605 3300031241 Ga0265325_10079165 Ga0265325_100791652 203
606 3300031249 Ga0265339_10078648 Ga0265339_100786483 203
607 3300031249 Ga0265339_10102181 Ga0265339_101021812 203
608 3300031249 Ga0265339_10105466 Ga0265339_101054662 203
609 3300031250 Ga0265331_10002092 Ga0265331_100020927 203
610 3300031250 Ga0265331_10003605 Ga0265331_100036058 203
611 3300031251 Ga0265327_10000176 Ga0265327_1000017653 203
612 3300031344 Ga0265316_10198831 Ga0265316_101988311 203
613 3300031548 Ga0307408_100061935 Ga0307408_1000619351 203
614 3300031548 Ga0307408_100185011 Ga0307408_1001850111 203
615 3300031595 Ga0265313_10062762 Ga0265313_100627622 203
616 3300031711 Ga0265314_10031258 Ga0265314_100312585 203
617 3300031711 Ga0265314_10058659 Ga0265314_100586593 203
618 3300031712 Ga0265342_10177902 Ga0265342_101779022 203
619 3300031728 Ga0316578_10317503 Ga0316578_103175032 203
620 3300031731 Ga0307405_10019903 Ga0307405_100199034 203
621 3300031731 Ga0307405_10037115 Ga0307405_100371152 203
622 3300031731 Ga0307405_10999306 Ga0307405_109993061 203
623 3300031824 Ga0307413_10082285 Ga0307413_100822852 203
624 3300031838 Ga0307518_10152317 Ga0307518_101523172 203
625 3300031852 Ga0307410_10007540 Ga0307410_100075405 203
626 3300031852 Ga0307410_10081588 Ga0307410_100815883 203
627 3300031852 Ga0307410_10141492 Ga0307410_101414922 203
628 3300031852 Ga0307410_10204546 Ga0307410_102045462 203
629 3300031852 Ga0307410_10316451 Ga0307410_103164513 203
630 3300031901 Ga0307406_10026687 Ga0307406_100266872 203
631 3300031901 Ga0307406_10083486 Ga0307406_100834862 203
632 3300031903 Ga0307407_10006582 Ga0307407_100065824 203
633 3300031903 Ga0307407_10092424 Ga0307407_100924242 203
634 3300031903 Ga0307407_10123813 Ga0307407_101238133 203
635 3300031995 Ga0307409_100100105 Ga0307409_1001001052 203
636 3300031995 Ga0307409_100203471 Ga0307409_1002034712 203
637 3300031995 Ga0307409_100211985 Ga0307409_1002119851 203
638 3300031995 Ga0307409_100386489 Ga0307409_1003864892 203
639 3300031995 Ga0307409_100576246 Ga0307409_1005762462 203
640 3300032002 Ga0307416_100017432 Ga0307416_1000174326 203
641 3300032002 Ga0307416_100176034 Ga0307416_1001760343 203
642 3300032004 Ga0307414_10053577 Ga0307414_100535773 203
643 3300032004 Ga0307414_10282147 Ga0307414_102821472 203
644 3300032004 Ga0307414_10906373 Ga0307414_109063731 203
645 3300032005 Ga0307411_10038737 Ga0307411_100387371 203
646 3300032005 Ga0307411_10073014 Ga0307411_100730141 203
647 3300032005 Ga0307411_10095944 Ga0307411_100959443 203
648 3300032005 Ga0307411_10147723 Ga0307411_101477233 203
649 3300032005 Ga0307411_10155673 Ga0307411_101556732 203
650 3300032126 Ga0307415_100006168 Ga0307415_1000061682 203
651 3300032126 Ga0307415_100049196 Ga0307415_1000491962 203
652 3300032126 Ga0307415_100228616 Ga0307415_1002286162 203
653 3300033179 Ga0307507_10082573 Ga0307507_100825734 203
654 3300035083 Ga0373926_0001823 Ga0373926_0001823_1902_2543 203
655 3300035092 Ga0373952_0066259 Ga0373952_0066259_127_762 203
656 3300035114 Ga0373939_0149164 Ga0373939_0149164_71_706 203
657 3300035118 Ga0373954_0106603 Ga0373954_0106603_512_1156 203
658 3300035119 Ga0373956_0052367 Ga0373956_0052367_451_1095 203
659 3300035171 Ga0373946_0036679 Ga0373946_0036679_261_896 203
660 3300035171 Ga0373946_0075875 Ga0373946_0075875_820_1449 203
661 3300035691 Ga0373931_0044305 Ga0373931_0044305_133_768 203
662 3300035691 Ga0373931_0052452 Ga0373931_0052452_739_1374 203
663 3300035725 Ga0373947_0000031 Ga0373947_0000031_35626_36267 203
664 3300036401 Ga0373937_0022396 Ga0373937_0022396_4464_5108 203
665 3300036401 Ga0373937_0286638 Ga0373937_0286638_135_770 203
666 3300036401 Ga0373937_0715890 Ga0373937_0715890_170_805 203
667 3300037068 Ga0373925_0271028 Ga0373925_0271028_726_1355 203
668 3300037068 Ga0373925_0301996 Ga0373925_0301996_350_1054 203
669 3300037312 Ga0395899_0000421 Ga0395899_0000421_22885_23517 203
670 3300037312 Ga0395899_0003093 Ga0395899_0003093_5823_6455 203
671 3300037418 Ga0395900_0000159 Ga0395900_0000159_87970_88602 203
672 3300037418 Ga0395900_0000445 Ga0395900_0000445_30288_30920 203
673 3300037418 Ga0395900_0055109 Ga0395900_0055109_691_1323 203
674 3300037418 Ga0395900_0136280 Ga0395900_0136280_808_1440 203
675 3300037418 Ga0395900_0138891 Ga0395900_0138891_1126_1758 203
676 3300037466 Ga0395898_0000425 Ga0395898_0000425_1167_1799 203
677 3300037466 Ga0395898_0002174 Ga0395898_0002174_1157_1789 203
678 3300037466 Ga0395898_0005757 Ga0395898_0005757_11554_12186 203
679 3300037466 Ga0395898_0217076 Ga0395898_0217076_1051_1683 203
680 3300037471 Ga0395905_0531470 Ga0395905_0531470_363_998 203
681 3300038443 Ga0395901_0000017 Ga0395901_0000017_189635_190267 203
682 3300038443 Ga0395901_0000109 Ga0395901_0000109_21349_21981 203
683 3300038443 Ga0395901_0009637 Ga0395901_0009637_1170_1802 203
684 3300038443 Ga0395901_0043931 Ga0395901_0043931_1378_2010 203
685 3300039437 Ga0436365_1876799 Ga0436365_1876799_1192_1839 203
686 3300039438 Ga0436360_0035010 Ga0436360_0035010_403_1032 203
687 3300039447 Ga0436361_1124937 Ga0436361_1124937_367_1002 203
688 3300039450 Ga0436363_0588233 Ga0436363_0588233_161_808 203
689 3300041505 Ga0451849_0243995 Ga0451849_0243995_40_675 203
690 3300042004 Ga0439445_0005495 Ga0439445_0005495_900_1550 203
691 3300042134 Ga0450898_003049 Ga0450898_003049_1090_1725 203
692 3300042147 Ga0450910_023046 Ga0450910_023046_13_648 203
693 3300042437 Ga0439444_0025165 Ga0439444_0025165_322_957 203
694 3300042876 Ga0451577_0008981 Ga0451577_0008981_2776_3417 203
695 3300042876 Ga0451577_0065552 Ga0451577_0065552_1180_1860 203
696 3300042876 Ga0451577_0125156 Ga0451577_0125156_1322_1960 203
697 3300044656 Ga0466969_0028334 Ga0466969_0028334_1073_1705 203
698 3300044656 Ga0466969_0029616 Ga0466969_0029616_1104_1736 203
699 3300044656 Ga0466969_0037730 Ga0466969_0037730_1332_1985 203
700 3300044658 Ga0466972_0032516 Ga0466972_0032516_1576_2208 203
701 3300044659 Ga0466973_0022991 Ga0466973_0022991_5247_5879 203
702 3300044666 Ga0466977_0000673 Ga0466977_0000673_10425_11060 203
703 3300044673 Ga0453683_0143288 Ga0453683_0143288_139_774 203
704 3300044683 Ga0466965_0000743 Ga0466965_0000743_11081_11713 203
705 3300044684 Ga0466966_0000082 Ga0466966_0000082_1605_2237 203
706 3300044684 Ga0466966_0009579 Ga0466966_0009579_2896_3528 203
707 3300044684 Ga0466966_0038085 Ga0466966_0038085_1467_2099 203
708 3300044693 Ga0466961_0001496 Ga0466961_0001496_5367_5999 203
709 3300044693 Ga0466961_0009743 Ga0466961_0009743_4550_5182 203
710 3300044694 Ga0466963_0001180 Ga0466963_0001180_7540_8172 203
711 3300044694 Ga0466963_0086023 Ga0466963_0086023_364_996 203
712 3300044706 Ga0466964_0022176 Ga0466964_0022176_1463_2095 203
713 3300044712 Ga0453684_0001146 Ga0453684_0001146_77800_78441 203
714 3300044712 Ga0453684_0736806 Ga0453684_0736806_46_726 203
715 3300044719 Ga0466971_0007186 Ga0466971_0007186_3199_3831 203
716 3300044719 Ga0466971_0039338 Ga0466971_0039338_931_1563 203
717 3300044719 Ga0466971_0204817 Ga0466971_0204817_272_907 203
718 3300044765 Ga0466970_0025967 Ga0466970_0025967_1354_1986 203
719 3300044842 Ga0466957_0181816 Ga0466957_0181816_204_836 203
720 3300045049 Ga0466959_0029019 Ga0466959_0029019_3347_3979 203
721 3300045051 Ga0451576_0291384 Ga0451576_0291384_698_1333 203
722 3300045051 Ga0451576_0468889 Ga0451576_0468889_373_1011 203
723 3300045836 Ga0466958_0001820 Ga0466958_0001820_885_1517 203
724 3300045836 Ga0466958_0002956 Ga0466958_0002956_7832_8464 203
725 3300045976 Ga0466967_0257460 Ga0466967_0257460_170_802 203
726 3300045976 Ga0466967_0373277 Ga0466967_0373277_477_1112 203
727 3300046454 Ga0495592_0030243 Ga0495592_0030243_811_1455 203
728 3300046472 Ga0495580_0283406 Ga0495580_0283406_349_984 203
729 3300046475 Ga0495639_0210381 Ga0495639_0210381_125_769 203
730 3300046517 Ga0495630_0098480 Ga0495630_0098480_1438_2067 203
731 3300046528 Ga0495642_0039507 Ga0495642_0039507_1009_1644 203
732 3300046533 Ga0495640_0083114 Ga0495640_0083114_1316_1960 203
733 3300046535 Ga0495586_0052221 Ga0495586_0052221_35_679 203
734 3300046535 Ga0495586_0175633 Ga0495586_0175633_492_1127 203
735 3300046536 Ga0495587_0104224 Ga0495587_0104224_366_1001 203
736 3300046536 Ga0495587_0189405 Ga0495587_0189405_403_1038 203
737 3300046543 Ga0495645_0031033 Ga0495645_0031033_95_730 203
738 3300046543 Ga0495645_0063452 Ga0495645_0063452_1487_2119 203
739 3300046557 Ga0495622_0061393 Ga0495622_0061393_1100_1729 203
740 3300046559 Ga0495667_0039532 Ga0495667_0039532_506_1150 203
741 3300046615 Ga0495656_0222307 Ga0495656_0222307_60_695 203
742 3300046642 Ga0495634_0023766 Ga0495634_0023766_609_1244 203
743 3300046660 Ga0495625_0105085 Ga0495625_0105085_367_1002 203
744 3300046663 Ga0495635_0079368 Ga0495635_0079368_1401_2045 203
745 3300046663 Ga0495635_0305641 Ga0495635_0305641_286_921 203
746 3300046664 Ga0495659_0101908 Ga0495659_0101908_385_1020 203
747 3300046675 Ga0495657_0138140 Ga0495657_0138140_863_1498 203
748 3300046678 Ga0495599_0168889 Ga0495599_0168889_213_857 203
749 3300046678 Ga0495599_0195806 Ga0495599_0195806_386_1021 203
750 3300046684 Ga0495669_0084137 Ga0495669_0084137_637_1272 203
751 3300046809 Ga0495600_0042250 Ga0495600_0042250_2250_2885 203
752 3300046809 Ga0495600_0117065 Ga0495600_0117065_396_1040 203
753 3300047319 Ga0495674_0120872 Ga0495674_0120872_1148_1777 203
754 3300047320 Ga0495672_0088848 Ga0495672_0088848_642_1286 203
755 3300047444 Ga0495675_0115959 Ga0495675_0115959_909_1544 203
756 3300047472 Ga0495686_0000007 Ga0495686_0000007_252415_253047 203
757 3300047472 Ga0495686_0116205 Ga0495686_0116205_695_1327 203
758 3300048903 Ga0496100_0334857 Ga0496100_0334857_379_1014 203
759 3300048905 Ga0496102_0000693 Ga0496102_0000693_32550_33185 203
760 3300048905 Ga0496102_0076207 Ga0496102_0076207_2161_2799 203
761 3300048905 Ga0496102_0129691 Ga0496102_0129691_27_662 203
762 3300048905 Ga0496102_0237220 Ga0496102_0237220_809_1501 203
763 3300048907 Ga0496104_0000542 Ga0496104_0000542_23024_23659 203
764 3300048908 Ga0496105_0089615 Ga0496105_0089615_1786_2421 203
765 3300048909 Ga0496106_0426757 Ga0496106_0426757_219_974 203
766 3300048910 Ga0496107_0009969 Ga0496107_0009969_116_751 203
767 3300048910 Ga0496107_0330020 Ga0496107_0330020_208_843 203
768 3300048911 Ga0496108_0000659 Ga0496108_0000659_8036_8671 203
769 3300048912 Ga0496109_0001342 Ga0496109_0001342_5833_6468 203
770 3300048912 Ga0496109_0165812 Ga0496109_0165812_1106_1741 203
771 3300048913 Ga0496110_0010771 Ga0496110_0010771_3437_4072 203
772 3300048913 Ga0496110_0014556 Ga0496110_0014556_1969_2604 203
773 3300048918 Ga0496115_0000923 Ga0496115_0000923_6323_6964 203
774 3300048918 Ga0496115_0001557 Ga0496115_0001557_3707_4399 203
775 3300048918 Ga0496115_0445497 Ga0496115_0445497_327_962 203
776 3300049570 Ga0501033_0134943 Ga0501033_0134943_760_1398 203
777 3300049571 Ga0501034_0008979 Ga0501034_0008979_7173_7808 203
778 3300049572 Ga0501036_0238656 Ga0501036_0238656_41_679 203
779 3300049574 Ga0501038_0297491 Ga0501038_0297491_311_949 203
780 3300049575 Ga0501039_0122578 Ga0501039_0122578_676_1314 203
781 3300049575 Ga0501039_0676276 Ga0501039_0676276_136_774 203
782 3300049576 Ga0501040_0196896 Ga0501040_0196896_731_1369 203
783 3300049577 Ga0501041_0045415 Ga0501041_0045415_101_739 203
784 3300049579 Ga0501043_0074691 Ga0501043_0074691_1716_2354 203
785 3300049580 Ga0501046_0048523 Ga0501046_0048523_2017_2652 203
786 3300049581 Ga0501047_0179023 Ga0501047_0179023_1310_1945 203
787 3300049581 Ga0501047_0358482 Ga0501047_0358482_385_1020 203
788 3300049583 Ga0501067_0021474 Ga0501067_0021474_2730_3365 203
789 3300049583 Ga0501067_0030717 Ga0501067_0030717_1306_1941 203
790 3300049584 Ga0501068_0003826 Ga0501068_0003826_1286_1921 203
791 3300049585 Ga0501069_0004771 Ga0501069_0004771_4557_5192 203
792 3300049585 Ga0501069_0009983 Ga0501069_0009983_1721_2356 203
793 3300049586 Ga0501070_0018564 Ga0501070_0018564_3648_4283 203
794 3300049586 Ga0501070_0066405 Ga0501070_0066405_517_1152 203
795 3300049586 Ga0501070_0172373 Ga0501070_0172373_677_1312 203
796 3300049586 Ga0501070_0432306 Ga0501070_0432306_306_941 203
797 3300049587 Ga0501071_0003078 Ga0501071_0003078_7941_8576 203
798 3300049588 Ga0501072_0002641 Ga0501072_0002641_10969_11604 203
799 3300049588 Ga0501072_0141522 Ga0501072_0141522_54_692 203
800 3300049588 Ga0501072_0367758 Ga0501072_0367758_46_684 203
801 3300049589 Ga0501073_0088631 Ga0501073_0088631_1087_1722 203
802 3300049590 Ga0501074_0001140 Ga0501074_0001140_10508_11143 203
803 3300049590 Ga0501074_0145963 Ga0501074_0145963_1043_1681 203
804 3300049590 Ga0501074_0767700 Ga0501074_0767700_27_665 203
805 3300049591 Ga0501075_0046762 Ga0501075_0046762_1971_2609 203
806 3300049592 Ga0501076_0147375 Ga0501076_0147375_961_1599 203
807 3300049592 Ga0501076_0208768 Ga0501076_0208768_807_1445 203
808 3300049592 Ga0501076_0572006 Ga0501076_0572006_274_909 203
809 3300049593 Ga0501077_0001806 Ga0501077_0001806_65_703 203
810 3300049661 Ga0501217_045400 Ga0501217_045400_421_1056 203
811 3300049708 Ga0501245_005183 Ga0501245_005183_661_1296 203
812 3300049741 Ga0501079_0268600 Ga0501079_0268600_36_674 203
813 3300049742 Ga0501080_0021326 Ga0501080_0021326_3999_4634 203
814 3300049742 Ga0501080_0085723 Ga0501080_0085723_801_1436 203
815 3300049743 Ga0501081_0124233 Ga0501081_0124233_43_681 203
816 3300049744 Ga0501083_0004908 Ga0501083_0004908_2084_2719 203
817 3300049765 Ga0501268_009827 Ga0501268_009827_82_717 203
818 3300049767 Ga0501270_014857 Ga0501270_014857_340_975 203
819 3300049769 Ga0501272_001712 Ga0501272_001712_598_1233 203
820 3300049824 Ga0501045_0061254 Ga0501045_0061254_515_1153 203
821 3300049824 Ga0501045_0225827 Ga0501045_0225827_537_1172 203
822 3300049824 Ga0501045_0476465 Ga0501045_0476465_42_698 203
823 3300050493 nmdc:mga0k408_49684_c1 nmdc:mga0k408_49684_c1_1276_1911 203
824 3300050494 nmdc:mga06z11_97626_c1 nmdc:mga06z11_97626_c1_587_1222 203
825 3300050507 nmdc:mga05p37_162125_c1 nmdc:mga05p37_162125_c1_1556_2197 203
826 3300050507 nmdc:mga05p37_458105_c1 nmdc:mga05p37_458105_c1_573_1208 203
827 3300050507 nmdc:mga05p37_69749_c1 nmdc:mga05p37_69749_c1_200_835 203
828 3300050508 nmdc:mga09592_64643_c1 nmdc:mga09592_64643_c1_2104_2739 203
829 3300050509 nmdc:mga0qj67_24987_c1 nmdc:mga0qj67_24987_c1_2611_3249 203
830 3300050509 nmdc:mga0qj67_36230_c1 nmdc:mga0qj67_36230_c1_1043_1681 203
831 3300050509 nmdc:mga0qj67_41314_c1 nmdc:mga0qj67_41314_c1_1377_2012 203
832 3300050510 nmdc:mga06r32_113138_c1 nmdc:mga06r32_113138_c1_1456_2094 203
833 3300050510 nmdc:mga06r32_244491_c1 nmdc:mga06r32_244491_c1_719_1354 203
834 3300050510 nmdc:mga06r32_30913_c1 nmdc:mga06r32_30913_c1_2747_3388 203
835 3300050510 nmdc:mga06r32_6579_c1 nmdc:mga06r32_6579_c1_6282_6920 203
836 3300050511 nmdc:mga08y16_762988_c1 nmdc:mga08y16_762988_c1_185_820 203
837 3300050511 nmdc:mga08y16_76635_c1 nmdc:mga08y16_76635_c1_2381_3016 203
838 3300050512 nmdc:mga0n895_156754_c1 nmdc:mga0n895_156754_c1_685_1320 203
839 3300050512 nmdc:mga0n895_163392_c1 nmdc:mga0n895_163392_c1_609_1247 203
840 3300050512 nmdc:mga0n895_36095_c1 nmdc:mga0n895_36095_c1_2220_2855 203
841 3300050512 nmdc:mga0n895_55943_c1 nmdc:mga0n895_55943_c1_377_1012 203
842 3300050512 nmdc:mga0n895_693533_c1 nmdc:mga0n895_693533_c1_278_913 203
843 3300050513 nmdc:mga0rr50_224953_c1 nmdc:mga0rr50_224953_c1_880_1515 203
844 3300050513 nmdc:mga0rr50_45452_c1 nmdc:mga0rr50_45452_c1_2079_2714 203
845 3300050513 nmdc:mga0rr50_762536_c1 nmdc:mga0rr50_762536_c1_55_690 203
846 3300050513 nmdc:mga0rr50_83232_c1 nmdc:mga0rr50_83232_c1_883_1518 203
847 3300050513 nmdc:mga0rr50_852479_c1 nmdc:mga0rr50_852479_c1_33_671 203
848 3300050514 nmdc:mga08x19_126962_c1 nmdc:mga08x19_126962_c1_444_1079 203
849 3300050514 nmdc:mga08x19_264729_c1 nmdc:mga08x19_264729_c1_79_732 203
850 3300050514 nmdc:mga08x19_289370_c1 nmdc:mga08x19_289370_c1_196_831 203
851 3300050514 nmdc:mga08x19_6037_c1 nmdc:mga08x19_6037_c1_2026_2661 203
852 3300050515 nmdc:mga0a205_115483_c1 nmdc:mga0a205_115483_c1_516_1151 203
853 3300050515 nmdc:mga0a205_177653_c1 nmdc:mga0a205_177653_c1_821_1459 203
854 3300050515 nmdc:mga0a205_327552_c1 nmdc:mga0a205_327552_c1_642_1283 203
855 3300050515 nmdc:mga0a205_51645_c1 nmdc:mga0a205_51645_c1_2650_3285 203
856 3300050515 nmdc:mga0a205_913489_c1 nmdc:mga0a205_913489_c1_79_714 203
857 3300053077 Ga0495601_0041642 Ga0495601_0041642_1963_2625 203
858 3300053077 Ga0495601_0054612 Ga0495601_0054612_1775_2419 203
859 3300053084 Ga0495595_0023819 Ga0495595_0023819_172_816 203
860 3300053094 Ga0500566_0026880 Ga0500566_0026880_2218_2847 203
861 3300053119 Ga0500595_006337 Ga0500595_006337_1963_2622 203
862 3300053125 Ga0500618_002101 Ga0500618_002101_4628_5260 203
863 3300053125 Ga0500618_002594 Ga0500618_002594_3400_4035 203
864 3300053136 Ga0500559_0284678 Ga0500559_0284678_96_731 203
865 3300054114 Ga0501084_0005169 Ga0501084_0005169_3807_4442 203
866 3300054114 Ga0501084_0005653 Ga0501084_0005653_2578_3216 203
867 3300054114 Ga0501084_0481064 Ga0501084_0481064_31_669 203
868 3300059421 Ga0590071_001022 Ga0590071_001022_6285_6965 203
869 3300059426 Ga0590077_005597 Ga0590077_005597_1841_2521 203
870 3300060353 Ga0501082_0007067 Ga0501082_0007067_6238_6873 203
871 3300061719 Ga0466962_0046644 Ga0466962_0046644_653_1285 203
872 3300005327 Ga0070658_10069590 Ga0070658_100695905 204
873 3300005329 Ga0070683_100413459 Ga0070683_1004134592 204
874 3300005339 Ga0070660_100075721 Ga0070660_1000757213 204
875 3300005344 Ga0070661_100073631 Ga0070661_1000736312 204
876 3300005354 Ga0070675_100224962 Ga0070675_1002249622 204
877 3300005455 Ga0070663_100006516 Ga0070663_1000065164 204
878 3300005530 Ga0070679_100259329 Ga0070679_1002593292 204
879 3300005535 Ga0070684_100034276 Ga0070684_1000342765 204
880 3300005563 Ga0068855_100373390 Ga0068855_1003733902 204
881 3300005564 Ga0070664_100300535 Ga0070664_1003005352 204
882 3300005578 Ga0068854_100049592 Ga0068854_1000495922 204
883 3300005614 Ga0068856_100192461 Ga0068856_1001924612 204
884 3300005614 Ga0068856_100364064 Ga0068856_1003640642 204
885 3300005616 Ga0068852_100020060 Ga0068852_1000200602 204
886 3300009093 Ga0105240_10091573 Ga0105240_100915735 204
887 3300009093 Ga0105240_11129592 Ga0105240_111295921 204
888 3300009093 Ga0105240_11310902 Ga0105240_113109021 204
889 3300013102 Ga0157371_10042745 Ga0157371_100427453 204
890 3300013104 Ga0157370_10230707 Ga0157370_102307072 204
891 3300013105 Ga0157369_10058133 Ga0157369_100581333 204
892 3300013307 Ga0157372_10024910 Ga0157372_100249103 204
893 3300025909 Ga0207705_10153349 Ga0207705_101533491 204
894 3300025913 Ga0207695_10249293 Ga0207695_102492933 204
895 3300025917 Ga0207660_10188301 Ga0207660_101883012 204
896 3300025919 Ga0207657_10028851 Ga0207657_100288512 204
897 3300025921 Ga0207652_10183376 Ga0207652_101833762 204
898 3300025944 Ga0207661_10264876 Ga0207661_102648762 204
899 3300025944 Ga0207661_10423769 Ga0207661_104237692 204
900 3300025949 Ga0207667_10267382 Ga0207667_102673823 204
901 3300025949 Ga0207667_10299157 Ga0207667_102991572 204
902 3300026067 Ga0207678_10004751 Ga0207678_100047519 204
903 3300026078 Ga0207702_10419076 Ga0207702_104190762 204
904 3300026142 Ga0207698_10034196 Ga0207698_100341963 204
905 3300031727 Ga0316576_10012341 Ga0316576_100123414 204
906 3300031727 Ga0316576_10096914 Ga0316576_100969142 204
907 3300031728 Ga0316578_10133806 Ga0316578_101338061 204
908 3300036712 Ga0316584_0024092 Ga0316584_0024092_1206_1853 204
909 3300036712 Ga0316584_0172788 Ga0316584_0172788_824_1471 204
910 3300046476 Ga0495662_0050118 Ga0495662_0050118_1351_1989 204
911 3300009177 Ga0105248_10045933 Ga0105248_100459334 205
912 3300025941 Ga0207711_10106774 Ga0207711_101067743 205
913 3300005328 Ga0070676_10237696 Ga0070676_102376961 206
914 3300013296 Ga0157374_10460804 Ga0157374_104608042 206
915 3300025907 Ga0207645_10260144 Ga0207645_102601442 206
916 3300028800 Ga0265338_10094073 Ga0265338_100940732 206
917 3300005328 Ga0070676_10036268 Ga0070676_100362682 208
918 3300005355 Ga0070671_100395295 Ga0070671_1003952951 208
919 3300005456 Ga0070678_100070099 Ga0070678_1000700992 208
920 3300005457 Ga0070662_100057016 Ga0070662_1000570162 208
921 3300005459 Ga0068867_100230504 Ga0068867_1002305041 208
922 3300006881 Ga0068865_100001396 Ga0068865_1000013969 208
923 3300009148 Ga0105243_10791779 Ga0105243_107917792 208
924 3300009176 Ga0105242_10560451 Ga0105242_105604512 208
925 3300013297 Ga0157378_10025984 Ga0157378_100259843 208
926 3300025907 Ga0207645_10016610 Ga0207645_100166102 208
927 3300025933 Ga0207706_10001355 Ga0207706_1000135510 208
928 3300025934 Ga0207686_10321583 Ga0207686_103215831 208
929 3300025938 Ga0207704_10009704 Ga0207704_100097042 208
930 3300026075 Ga0207708_10027253 Ga0207708_100272535 208
931 3300026089 Ga0207648_10154034 Ga0207648_101540342 208
932 3300026118 Ga0207675_100376531 Ga0207675_1003765312 208
933 3300026121 Ga0207683_10016698 Ga0207683_100166985 208
934 3300005343 Ga0070687_100049785 Ga0070687_1000497853 209
935 3300005518 Ga0070699_100125188 Ga0070699_1001251883 209
936 3300005539 Ga0068853_100948110 Ga0068853_1009481101 209
937 3300005842 Ga0068858_100227595 Ga0068858_1002275952 209
938 3300009093 Ga0105240_10004066 Ga0105240_100040665 209
939 3300013296 Ga0157374_10280137 Ga0157374_102801372 209
940 3300014497 Ga0182008_10021026 Ga0182008_100210263 209
941 3300005293 Ga0065715_10196336 Ga0065715_101963362 210
942 3300005345 Ga0070692_10054394 Ga0070692_100543942 210
943 3300005355 Ga0070671_100451730 Ga0070671_1004517302 210
944 3300005444 Ga0070694_100061005 Ga0070694_1000610052 210
945 3300005471 Ga0070698_100504197 Ga0070698_1005041972 210
946 3300005549 Ga0070704_100471533 Ga0070704_1004715332 210
947 3300005614 Ga0068856_100195593 Ga0068856_1001955932 210
948 3300006871 Ga0075434_100427666 Ga0075434_1004276661 210
949 3300013307 Ga0157372_10835362 Ga0157372_108353622 210
950 3300026121 Ga0207683_10170602 Ga0207683_101706022 210
951 3300027695 Ga0209966_1008583 Ga0209966_10085833 210
952 3300027717 Ga0209998_10002474 Ga0209998_100024743 210
953 3300032005 Ga0307411_10150085 Ga0307411_101500852 210
954 3300049668 Ga0501233_037201 Ga0501233_037201_388_1020 210
955 3300049689 Ga0501260_005022 Ga0501260_005022_578_1210 210
956 3300049707 Ga0501234_005779 Ga0501234_005779_703_1335 210
957 3300049757 Ga0501232_029030 Ga0501232_029030_109_741 210
958 3300049759 Ga0501262_030517 Ga0501262_030517_13_645 210
959 3300049765 Ga0501268_002141 Ga0501268_002141_1001_1633 210
960 2162886012 MBSR1b_contig_11739019 MBSR1b_0927.00001830 211
961 3300005293 Ga0065715_10177927 Ga0065715_101779272 211
962 3300005366 Ga0070659_100163612 Ga0070659_1001636122 211
963 3300005434 Ga0070709_10016652 Ga0070709_100166523 211
964 3300005436 Ga0070713_100687631 Ga0070713_1006876311 211
965 3300005437 Ga0070710_10003572 Ga0070710_100035723 211
966 3300005441 Ga0070700_100253087 Ga0070700_1002530872 211
967 3300005444 Ga0070694_100243159 Ga0070694_1002431592 211
968 3300005445 Ga0070708_100000138 Ga0070708_10000013825 211
969 3300005457 Ga0070662_100089880 Ga0070662_1000898801 211
970 3300005467 Ga0070706_100191135 Ga0070706_1001911352 211
971 3300005468 Ga0070707_100038820 Ga0070707_1000388202 211
972 3300005471 Ga0070698_100300389 Ga0070698_1003003892 211
973 3300005471 Ga0070698_100351545 Ga0070698_1003515451 211
974 3300005518 Ga0070699_100074979 Ga0070699_1000749792 211
975 3300006173 Ga0070716_100002710 Ga0070716_1000027107 211
976 3300006175 Ga0070712_100058906 Ga0070712_1000589062 211
977 3300006914 Ga0075436_100016660 Ga0075436_1000166602 211
978 3300007788 Ga0099795_10018957 Ga0099795_100189574 211
979 3300025906 Ga0207699_10020457 Ga0207699_100204573 211
980 3300025922 Ga0207646_10032401 Ga0207646_100324013 211
981 3300025922 Ga0207646_10097667 Ga0207646_100976672 211
982 3300025939 Ga0207665_10000447 Ga0207665_1000044721 211
983 3300035170 Ga0373943_0244677 Ga0373943_0244677_22_714 211
984 3300035692 Ga0373935_0325804 Ga0373935_0325804_172_864 211
985 3300046531 Ga0495665_0161935 Ga0495665_0161935_252_944 211
986 3300048915 Ga0496112_0036657 Ga0496112_0036657_45_731 211
987 3300049583 Ga0501067_0084445 Ga0501067_0084445_471_1106 211
988 3300050514 nmdc:mga08x19_88799_c1 nmdc:mga08x19_88799_c1_1363_2010 211

Structural Annotation

Top 5 Hits

ID Description Score Start End
4njh-assembly1.cif.gz_B crystal structure of quee from burkholderia multivorans in complex with adomet and 6-carboxy-5,6,7,8-tetrahydropterin 0.9727 3 211
4njh-assembly1.cif.gz_B crystal structure of quee from burkholderia multivorans in complex with adomet and 6-carboxy-5,6,7,8-tetrahydropterin 0.9635 3 211
6phu-assembly1.cif.gz_A spaga wild type apo structure 0.7661 87 118
6nhl-assembly1.cif.gz_A crystal structure of quee from escherichia coli 0.7381 1 205
5tgs-assembly1.cif.gz_A crystal structure of quee from bacillus subtilis with methionine bound 0.7178 3 208
ID Description Score Start End Superfamily
4njjA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9757 3 211 3.20.20.70
4njjA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9665 3 211 3.20.20.70
af_P64554_2_223_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.7519 3 211 3.20.20.70
af_P64554_2_223_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.742 3 211 3.20.20.70
af_Q2G1X7_4_231_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.7218 4 208 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A7S1HJL5-F1-model_v4 Radical SAM core domain-containing protein 0.9927 84 192 GO:0051539
AF-A0A519Y4H4-F1-model_v4 deleted 0.9897 128 211
AF-A0A357V077-F1-model_v4 7-carboxy-7-deazaguanine synthase (CDG synthase) (EC 4.3.99.3) (Queuosine biosynthesis protein QueE) 0.9868 1 211 GO:0000287
GO:0008616
GO:0016840
GO:0051539
GO:1904047
AF-A0A1B3LL78-F1-model_v4 7-carboxy-7-deazaguanine synthase (CDG synthase) (EC 4.3.99.3) (Queuosine biosynthesis protein QueE) 0.985 2 211 GO:0000287
GO:0008616
GO:0016840
GO:0051539
GO:1904047
AF-A0A383C4D5-F1-model_v4 Radical SAM core domain-containing protein 0.985 87 211 GO:0051539

Feature Viewer

pLDDT pTM Quality
95.57 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map