F487066
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 969 | 502 | 940 | 100 |
Family's Representative Sequence
| Representative Sequence | 3300014969|Ga0157376_11997844|Ga0157376_119978442 |
| Length | 109 |
| Sequence | MNLAIIAAAPKPTTTWYLILSAVLFGVGTLGVMVRRNPLVLFMCVELMLNAVNLSFVAFAQAYGVGGQVFVFFVMTVAAAEAAVGLAIIIALFRHKQTVDLQNINLLKG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2511231026 | Herbaspirillum sp. YR522 | Isolate | Rhizosphere |
| 2 | 2521172590 | Herbaspirillum sp. GW103 | Isolate | Rhizosphere |
| 3 | 2551306416 | Herbaspirillum seropedicae Os34 | Isolate | Unclassified |
| 4 | 2593339238 | Luteibacter sp. UNCMF366Tsu5.1 | Isolate | Unclassified |
| 5 | 2593339239 | Luteibacter sp. UNCMF331Sha3.1 | Isolate | Unclassified |
| 6 | 2643221585 | Pelomonas sp. Root662 | Isolate | Unclassified |
| 7 | 2643221639 | Pelomonas sp. Root1217 | Isolate | Unclassified |
| 8 | 2643221646 | Pelomonas sp. Root1237 | Isolate | Unclassified |
| 9 | 2643221656 | Pelomonas sp. Root405 | Isolate | Unclassified |
| 10 | 2718218334 | Luteibacter rhizovicinus LJ96 | Isolate | Rhizosphere |
| 11 | 2734482264 | Dyella sp. AD052 | Isolate | Unclassified |
| 12 | 2738543009 | Luteibacter sp. OK325 | Isolate | Unclassified |
| 13 | 2765235838 | Herbaspirillum robiniae AA6 | Isolate | Unclassified |
| 14 | 2818991449 | Herbaspirillum huttiense 1147 | Isolate | Unclassified |
| 15 | 2839094727 | Herbaspirillum robiniae HZ10 | Isolate | Nodule |
| 16 | 2842914999 | Luteibacter sp. R-72151 | Isolate | Unclassified |
| 17 | 2842918807 | Luteibacter sp. R-73110 | Isolate | Unclassified |
| 18 | 2904439833 | Herbaspirillum sp. 1589 | Isolate | Rhizosphere |
| 19 | 2904530477 | Herbaspirillum huttiense 611 | Isolate | Unclassified |
| 20 | 2904584206 | Herbaspirillum sp. 1050 | Isolate | Unclassified |
| 21 | 2904589729 | Herbaspirillum sp. 1130 | Isolate | Unclassified |
| 22 | 2904601388 | Herbaspirillum sp. 1273 | Isolate | Rhizosphere |
| 23 | 2919046199 | Herbaspirillum frisingense 596 | Isolate | Unclassified |
| 24 | 2919079590 | Herbaspirillum sp. 1173 | Isolate | Unclassified |
| 25 | 2919085039 | Luteibacter sp. 1214 | Isolate | Unclassified |
| 26 | 2919404418 | Luteibacter sp. 3190 | Isolate | Unclassified |
| 27 | 2923510766 | Herbaspirillum rubrisubalbicans SLBN-127 | Isolate | Rhizosphere |
| 28 | 2928130867 | Herbaspirillum seropedicae 1977 | Isolate | Unclassified |
| 29 | 2953994433 | Luteibacter sp. W1I16 | Isolate | Rhizosphere |
| 30 | 3300000549 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled | Metagenome | Rhizosphere |
| 31 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 32 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 33 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 34 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 35 | 3300003567 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_04_fullP_mix3_d1 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 36 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 37 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 38 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 39 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 40 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 41 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 42 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 43 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 44 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 45 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 46 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 47 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 51 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 53 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 55 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 56 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 58 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 67 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 70 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 72 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 73 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 75 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 76 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 80 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 81 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 82 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 83 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 85 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 86 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 87 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 89 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 90 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 91 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 92 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 93 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 94 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 95 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 96 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 97 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 98 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 99 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 100 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 101 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 102 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 103 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 104 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 105 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 106 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 107 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 108 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 109 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 110 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 111 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 112 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 113 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 114 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 115 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 116 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 117 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 118 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 119 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 120 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 121 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 122 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 123 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 125 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 126 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 127 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 128 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 137 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 138 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 139 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 140 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 141 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 142 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 143 | 3300012502 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 | Metagenome | Rhizosphere |
| 144 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 153 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 155 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 156 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 157 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 158 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 159 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 160 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 161 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 162 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 163 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 164 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 165 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 166 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 167 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 168 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 169 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 232 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 241 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300028036 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 | Metagenome | Rhizosphere |
| 245 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 248 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 249 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 250 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 251 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 252 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 253 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 254 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 255 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 256 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 257 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 258 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 259 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 260 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 261 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 262 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 263 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 264 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 265 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 266 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 267 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 268 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 269 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 270 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 271 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 272 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 273 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 274 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 275 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 276 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 277 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 278 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 279 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 280 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 281 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 282 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 283 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 284 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 285 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 286 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 287 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 288 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 289 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 290 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 291 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 292 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 293 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 294 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 295 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 296 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 297 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 298 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 299 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 300 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 301 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 302 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 303 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 304 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 305 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 306 | 3300042116 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 | Metagenome | Rhizosphere |
| 307 | 3300042120 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 | Metagenome | Rhizosphere |
| 308 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 309 | 3300042126 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 | Metagenome | Rhizosphere |
| 310 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 311 | 3300042129 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 | Metagenome | Rhizosphere |
| 312 | 3300042130 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 | Metagenome | Rhizosphere |
| 313 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 314 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 315 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 316 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 317 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 318 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 319 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 320 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 321 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 322 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 323 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 324 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 383 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 384 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 385 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 386 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 387 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 388 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 389 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 390 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 391 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 392 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 393 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 394 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 395 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 396 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 397 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 398 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 399 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 400 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 401 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 402 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 403 | 3300049160 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 404 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 405 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 406 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 407 | 3300049517 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control | Metagenome | Rhizosphere |
| 408 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 409 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 410 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 411 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 412 | 3300049529 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 413 | 3300049530 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 414 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 415 | 3300049532 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 416 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 417 | 3300049534 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 418 | 3300049537 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 419 | 3300049541 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 420 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 421 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 422 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 423 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 424 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 425 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 426 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 427 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 428 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 429 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 430 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 431 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 432 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 433 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 434 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 435 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 436 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 437 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 438 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 439 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 440 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 441 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 442 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 443 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 444 | 3300049657 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought | Metagenome | Rhizosphere |
| 445 | 3300049658 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought | Metagenome | Rhizosphere |
| 446 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 447 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 448 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 449 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 450 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 451 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 452 | 3300049672 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought | Metagenome | Rhizosphere |
| 453 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 454 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 455 | 3300049683 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control | Metagenome | Rhizosphere |
| 456 | 3300049684 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control | Metagenome | Rhizosphere |
| 457 | 3300049687 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought | Metagenome | Rhizosphere |
| 458 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 459 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 460 | 3300049706 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control | Metagenome | Rhizosphere |
| 461 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 462 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 463 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 464 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 465 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 466 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 467 | 3300049764 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control | Metagenome | Rhizosphere |
| 468 | 3300049768 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought | Metagenome | Rhizosphere |
| 469 | 3300049769 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought | Metagenome | Rhizosphere |
| 470 | 3300049772 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control | Metagenome | Rhizosphere |
| 471 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 472 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 473 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 474 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 475 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 476 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 477 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 478 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 479 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 480 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 481 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 482 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 483 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 484 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 485 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 486 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 487 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 488 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 489 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 490 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 491 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 492 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 493 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 494 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 495 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 496 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 497 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 498 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 499 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 500 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 501 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 502 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.63 |
| Metatranscriptomes | 2.37 |
| Isolates | 2.99 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.82 |
| Nodule | 0.41 |
| Rhizoplane | 2.68 |
| Rhizosphere | 89.68 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.41 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | LJQas_1020049 | 3300000549 | Bacteria | 778 |
| 2 | JGI24738J21930_10006379 | 3300002075 | Bacteria | 2772 |
| 3 | JGI25152J39213_1025333 | 3300002773 | Bacteria | 983 |
| 4 | JGI25406J46586_10017790 | 3300003203 | Bacteria | 2932 |
| 5 | JGI25153J46596_10055107 | 3300003215 | Bacteria | 1114 |
| 6 | Ga0006554J51385_1033774 | 3300003567 | Bacteria | 2186 |
| 7 | Ga0006562J51391_1061648 | 3300003578 | Bacteria | 4010 |
| 8 | Ga0055538_1000155 | 3300003751 | Bacteria | 46426 |
| 9 | Ga0055539_1000205 | 3300003752 | Bacteria | 46426 |
| 10 | Ga0055533_1000100 | 3300003756 | Bacteria | 111692 |
| 11 | Ga0055533_1000207 | 3300003756 | Bacteria | 46426 |
| 12 | Ga0055525_1000284 | 3300003759 | Bacteria | 46426 |
| 13 | Ga0055525_1000947 | 3300003759 | Bacteria | 8022 |
| 14 | Ga0055530_10014353 | 3300003791 | Bacteria | 2644 |
| 15 | Ga0055531_10000310 | 3300003794 | Bacteria | 47933 |
| 16 | Ga0055541_1000133 | 3300003841 | Bacteria | 46426 |
| 17 | Ga0055543_1030932 | 3300004625 | Bacteria | 935 |
| 18 | Ga0065165_1000028 | 3300005262 | Bacteria | 224430 |
| 19 | Ga0065712_10391693 | 3300005290 | Bacteria | 741 |
| 20 | Ga0070658_10003448 | 3300005327 | Bacteria | 12998 |
| 21 | Ga0070658_10011571 | 3300005327 | Bacteria | 7077 |
| 22 | Ga0070658_10238554 | 3300005327 | Bacteria | 1541 |
| 23 | Ga0070658_10339180 | 3300005327 | Bacteria | 1285 |
| 24 | Ga0070658_10368122 | 3300005327 | Bacteria | 1232 |
| 25 | Ga0070658_10564196 | 3300005327 | Bacteria | 985 |
| 26 | Ga0070658_10691620 | 3300005327 | Bacteria | 885 |
| 27 | Ga0070658_11388562 | 3300005327 | Bacteria | 609 |
| 28 | Ga0070676_10045115 | 3300005328 | Bacteria | 2567 |
| 29 | Ga0070676_10126377 | 3300005328 | Bacteria | 1612 |
| 30 | Ga0070676_10327830 | 3300005328 | Bacteria | 1046 |
| 31 | Ga0070683_100026589 | 3300005329 | Bacteria | 5213 |
| 32 | Ga0070683_100042213 | 3300005329 | Bacteria | 4199 |
| 33 | Ga0070683_100053034 | 3300005329 | Bacteria | 3758 |
| 34 | Ga0070683_100244034 | 3300005329 | Bacteria | 1708 |
| 35 | Ga0070683_100361467 | 3300005329 | Bacteria | 1382 |
| 36 | Ga0070683_100583988 | 3300005329 | Bacteria | 1069 |
| 37 | Ga0070683_101823334 | 3300005329 | Bacteria | 585 |
| 38 | Ga0070683_102390580 | 3300005329 | Bacteria | 506 |
| 39 | Ga0070690_100117944 | 3300005330 | Bacteria | 1778 |
| 40 | Ga0070690_100254849 | 3300005330 | Bacteria | 1242 |
| 41 | Ga0070670_100194310 | 3300005331 | Bacteria | 1763 |
| 42 | Ga0070670_100559842 | 3300005331 | Bacteria | 1020 |
| 43 | Ga0070670_100814984 | 3300005331 | Bacteria | 843 |
| 44 | Ga0070670_101004883 | 3300005331 | Bacteria | 759 |
| 45 | Ga0070670_101581087 | 3300005331 | Bacteria | 603 |
| 46 | Ga0068869_100052726 | 3300005334 | Bacteria | 2954 |
| 47 | Ga0070666_10669473 | 3300005335 | Bacteria | 760 |
| 48 | Ga0070680_100001111 | 3300005336 | Bacteria | 19323 |
| 49 | Ga0070680_100048545 | 3300005336 | Bacteria | 3460 |
| 50 | Ga0070680_101719489 | 3300005336 | Bacteria | 544 |
| 51 | Ga0070680_101944804 | 3300005336 | Bacteria | 510 |
| 52 | Ga0068868_101508223 | 3300005338 | Bacteria | 629 |
| 53 | Ga0068868_101613833 | 3300005338 | Bacteria | 610 |
| 54 | Ga0070660_100541286 | 3300005339 | Bacteria | 971 |
| 55 | Ga0070660_101180715 | 3300005339 | Bacteria | 649 |
| 56 | Ga0070689_100040508 | 3300005340 | Bacteria | 3572 |
| 57 | Ga0070689_101276798 | 3300005340 | Bacteria | 661 |
| 58 | Ga0070689_101992526 | 3300005340 | Bacteria | 531 |
| 59 | Ga0070661_100164706 | 3300005344 | Bacteria | 1681 |
| 60 | Ga0070661_100167277 | 3300005344 | Bacteria | 1668 |
| 61 | Ga0070661_100275338 | 3300005344 | Bacteria | 1304 |
| 62 | Ga0070661_100303941 | 3300005344 | Bacteria | 1242 |
| 63 | Ga0070661_101198879 | 3300005344 | Bacteria | 635 |
| 64 | Ga0070661_101247530 | 3300005344 | Bacteria | 623 |
| 65 | Ga0070661_101903415 | 3300005344 | Bacteria | 506 |
| 66 | Ga0070692_10054841 | 3300005345 | Bacteria | 2082 |
| 67 | Ga0070668_100116431 | 3300005347 | Bacteria | 2131 |
| 68 | Ga0070668_100813502 | 3300005347 | Bacteria | 831 |
| 69 | Ga0070668_100946918 | 3300005347 | Bacteria | 772 |
| 70 | Ga0070669_100095390 | 3300005353 | Bacteria | 2237 |
| 71 | Ga0070675_100004759 | 3300005354 | Bacteria | 10361 |
| 72 | Ga0070675_100230725 | 3300005354 | Bacteria | 1615 |
| 73 | Ga0070675_100245717 | 3300005354 | Bacteria | 1565 |
| 74 | Ga0070675_100309384 | 3300005354 | Bacteria | 1394 |
| 75 | Ga0070675_101587900 | 3300005354 | Bacteria | 603 |
| 76 | Ga0070675_101730905 | 3300005354 | Bacteria | 577 |
| 77 | Ga0070671_100175628 | 3300005355 | Bacteria | 1812 |
| 78 | Ga0070671_100407398 | 3300005355 | Bacteria | 1164 |
| 79 | Ga0070671_100516138 | 3300005355 | Bacteria | 1029 |
| 80 | Ga0070671_100525976 | 3300005355 | Bacteria | 1019 |
| 81 | Ga0070671_100945627 | 3300005355 | Bacteria | 754 |
| 82 | Ga0070674_100401045 | 3300005356 | Bacteria | 1121 |
| 83 | Ga0070673_100391182 | 3300005364 | Bacteria | 1241 |
| 84 | Ga0070673_100663455 | 3300005364 | Bacteria | 955 |
| 85 | Ga0070673_100770639 | 3300005364 | Bacteria | 887 |
| 86 | Ga0070673_102002971 | 3300005364 | Bacteria | 550 |
| 87 | Ga0070688_100018584 | 3300005365 | Bacteria | 4013 |
| 88 | Ga0070659_100048436 | 3300005366 | Bacteria | 3339 |
| 89 | Ga0070659_100184565 | 3300005366 | Bacteria | 1713 |
| 90 | Ga0070659_100297699 | 3300005366 | Bacteria | 1345 |
| 91 | Ga0070659_100308167 | 3300005366 | Bacteria | 1322 |
| 92 | Ga0070659_100920587 | 3300005366 | Bacteria | 765 |
| 93 | Ga0070667_100137301 | 3300005367 | Bacteria | 2138 |
| 94 | Ga0070667_100654787 | 3300005367 | Bacteria | 970 |
| 95 | Ga0070709_10009593 | 3300005434 | Bacteria | 5344 |
| 96 | Ga0070709_10036089 | 3300005434 | Bacteria | 3009 |
| 97 | Ga0070709_10056629 | 3300005434 | Bacteria | 2480 |
| 98 | Ga0070709_11591162 | 3300005434 | Bacteria | 532 |
| 99 | Ga0070714_100004697 | 3300005435 | Bacteria | 10327 |
| 100 | Ga0070714_100029810 | 3300005435 | Bacteria | 4538 |
| 101 | Ga0070714_100392216 | 3300005435 | Bacteria | 1311 |
| 102 | Ga0070714_101598920 | 3300005435 | Bacteria | 637 |
| 103 | Ga0070713_100000168 | 3300005436 | Bacteria | 43646 |
| 104 | Ga0070713_100051526 | 3300005436 | Bacteria | 3404 |
| 105 | Ga0070713_102055622 | 3300005436 | Bacteria | 554 |
| 106 | Ga0070710_10106524 | 3300005437 | Bacteria | 1678 |
| 107 | Ga0070710_10175492 | 3300005437 | Bacteria | 1338 |
| 108 | Ga0070711_100115217 | 3300005439 | Bacteria | 1979 |
| 109 | Ga0070711_100884414 | 3300005439 | Bacteria | 762 |
| 110 | Ga0070700_100719378 | 3300005441 | Bacteria | 796 |
| 111 | Ga0070694_100050054 | 3300005444 | Bacteria | 2815 |
| 112 | Ga0070694_100092890 | 3300005444 | Bacteria | 2120 |
| 113 | Ga0070663_100032502 | 3300005455 | Bacteria | 3597 |
| 114 | Ga0070663_100114062 | 3300005455 | Bacteria | 2034 |
| 115 | Ga0070678_100090584 | 3300005456 | Bacteria | 2345 |
| 116 | Ga0070678_101610695 | 3300005456 | Bacteria | 610 |
| 117 | Ga0070678_101705827 | 3300005456 | Bacteria | 593 |
| 118 | Ga0070662_100146176 | 3300005457 | Bacteria | 1836 |
| 119 | Ga0070662_100269442 | 3300005457 | Bacteria | 1374 |
| 120 | Ga0070662_100840166 | 3300005457 | Bacteria | 782 |
| 121 | Ga0070662_101342267 | 3300005457 | Bacteria | 616 |
| 122 | Ga0070681_10023492 | 3300005458 | Bacteria | 6201 |
| 123 | Ga0070681_10077854 | 3300005458 | Bacteria | 3273 |
| 124 | Ga0070681_10324270 | 3300005458 | Bacteria | 1450 |
| 125 | Ga0070681_10401530 | 3300005458 | Bacteria | 1282 |
| 126 | Ga0070681_10791978 | 3300005458 | Bacteria | 865 |
| 127 | Ga0068867_100010986 | 3300005459 | Bacteria | 6382 |
| 128 | Ga0070685_10087289 | 3300005466 | Bacteria | 1882 |
| 129 | Ga0070685_10093785 | 3300005466 | Bacteria | 1822 |
| 130 | Ga0070706_100454631 | 3300005467 | Bacteria | 1192 |
| 131 | Ga0070699_100230574 | 3300005518 | Bacteria | 1651 |
| 132 | Ga0070679_100032089 | 3300005530 | Bacteria | 5194 |
| 133 | Ga0070679_100888116 | 3300005530 | Bacteria | 835 |
| 134 | Ga0070679_101108943 | 3300005530 | Bacteria | 736 |
| 135 | Ga0070679_101290837 | 3300005530 | Bacteria | 676 |
| 136 | Ga0070684_100017327 | 3300005535 | Bacteria | 5909 |
| 137 | Ga0070684_100027011 | 3300005535 | Bacteria | 4840 |
| 138 | Ga0070684_100063417 | 3300005535 | Bacteria | 3239 |
| 139 | Ga0070684_100310942 | 3300005535 | Bacteria | 1447 |
| 140 | Ga0070684_100562247 | 3300005535 | Bacteria | 1059 |
| 141 | Ga0070684_100920190 | 3300005535 | Bacteria | 820 |
| 142 | Ga0068853_100576328 | 3300005539 | Bacteria | 1067 |
| 143 | Ga0068853_101749056 | 3300005539 | Bacteria | 603 |
| 144 | Ga0070672_100114001 | 3300005543 | Bacteria | 2206 |
| 145 | Ga0070672_100166475 | 3300005543 | Bacteria | 1831 |
| 146 | Ga0070672_100265732 | 3300005543 | Bacteria | 1448 |
| 147 | Ga0070672_100300661 | 3300005543 | Bacteria | 1360 |
| 148 | Ga0070672_100567463 | 3300005543 | Bacteria | 986 |
| 149 | Ga0070672_101092428 | 3300005543 | Bacteria | 709 |
| 150 | Ga0070672_101306804 | 3300005543 | Bacteria | 648 |
| 151 | Ga0070686_100639050 | 3300005544 | Bacteria | 842 |
| 152 | Ga0070686_100971405 | 3300005544 | Bacteria | 695 |
| 153 | Ga0070695_100318783 | 3300005545 | Bacteria | 1155 |
| 154 | Ga0070695_100327524 | 3300005545 | Bacteria | 1141 |
| 155 | Ga0070695_100520785 | 3300005545 | Bacteria | 923 |
| 156 | Ga0070695_101534646 | 3300005545 | Bacteria | 555 |
| 157 | Ga0070695_101637135 | 3300005545 | Bacteria | 538 |
| 158 | Ga0070696_100113732 | 3300005546 | Bacteria | 1951 |
| 159 | Ga0070696_100122741 | 3300005546 | Bacteria | 1882 |
| 160 | Ga0070693_100012610 | 3300005547 | Bacteria | 4280 |
| 161 | Ga0070693_100797629 | 3300005547 | Bacteria | 700 |
| 162 | Ga0070704_100003924 | 3300005549 | Bacteria | 8562 |
| 163 | Ga0070704_101408657 | 3300005549 | Bacteria | 640 |
| 164 | Ga0068855_100004465 | 3300005563 | Bacteria | 17102 |
| 165 | Ga0068855_100068633 | 3300005563 | Bacteria | 4127 |
| 166 | Ga0068855_100334991 | 3300005563 | Bacteria | 1670 |
| 167 | Ga0070664_100046540 | 3300005564 | Bacteria | 3663 |
| 168 | Ga0070664_100071150 | 3300005564 | Bacteria | 2980 |
| 169 | Ga0070664_100377929 | 3300005564 | Bacteria | 1293 |
| 170 | Ga0070664_100402657 | 3300005564 | Bacteria | 1251 |
| 171 | Ga0070664_100428124 | 3300005564 | Bacteria | 1213 |
| 172 | Ga0070664_100492270 | 3300005564 | Bacteria | 1129 |
| 173 | Ga0070664_101350123 | 3300005564 | Bacteria | 674 |
| 174 | Ga0070664_101799579 | 3300005564 | Bacteria | 581 |
| 175 | Ga0068857_100036956 | 3300005577 | Bacteria | 4325 |
| 176 | Ga0068857_100091619 | 3300005577 | Bacteria | 2721 |
| 177 | Ga0068857_100672225 | 3300005577 | Bacteria | 982 |
| 178 | Ga0068854_100029527 | 3300005578 | Bacteria | 3796 |
| 179 | Ga0068854_100395260 | 3300005578 | Bacteria | 1142 |
| 180 | Ga0068856_100348838 | 3300005614 | Bacteria | 1499 |
| 181 | Ga0068856_100358922 | 3300005614 | Bacteria | 1476 |
| 182 | Ga0068856_100398126 | 3300005614 | Bacteria | 1397 |
| 183 | Ga0070702_100973644 | 3300005615 | Bacteria | 670 |
| 184 | Ga0068852_100228011 | 3300005616 | Bacteria | 1775 |
| 185 | Ga0068852_100249695 | 3300005616 | Bacteria | 1699 |
| 186 | Ga0068852_100345930 | 3300005616 | Bacteria | 1450 |
| 187 | Ga0068852_100803720 | 3300005616 | Bacteria | 955 |
| 188 | Ga0068859_100020486 | 3300005617 | Bacteria | 6637 |
| 189 | Ga0068859_100531651 | 3300005617 | Bacteria | 1271 |
| 190 | Ga0068859_102185738 | 3300005617 | Bacteria | 611 |
| 191 | Ga0068864_100048790 | 3300005618 | Bacteria | 3641 |
| 192 | Ga0068866_11271712 | 3300005718 | Bacteria | 534 |
| 193 | Ga0068861_100248109 | 3300005719 | Bacteria | 1518 |
| 194 | Ga0068861_100265826 | 3300005719 | Bacteria | 1471 |
| 195 | Ga0068861_101091389 | 3300005719 | Bacteria | 767 |
| 196 | Ga0068851_10233002 | 3300005834 | Bacteria | 1039 |
| 197 | Ga0068851_10310274 | 3300005834 | Bacteria | 909 |
| 198 | Ga0068870_10001350 | 3300005840 | Bacteria | 9905 |
| 199 | Ga0068863_100345344 | 3300005841 | Bacteria | 1448 |
| 200 | Ga0068863_101500322 | 3300005841 | Bacteria | 683 |
| 201 | Ga0068858_100020744 | 3300005842 | Bacteria | 6139 |
| 202 | Ga0068858_100086515 | 3300005842 | Bacteria | 2916 |
| 203 | Ga0068858_102211906 | 3300005842 | Bacteria | 544 |
| 204 | Ga0068860_100038331 | 3300005843 | Bacteria | 4584 |
| 205 | Ga0068862_100088865 | 3300005844 | Bacteria | 2689 |
| 206 | Ga0068862_100607312 | 3300005844 | Bacteria | 1051 |
| 207 | Ga0081539_10000103 | 3300005985 | Bacteria | 197839 |
| 208 | Ga0070717_10058340 | 3300006028 | Bacteria | 3192 |
| 209 | Ga0070717_10471490 | 3300006028 | Bacteria | 1133 |
| 210 | Ga0070717_10724409 | 3300006028 | Bacteria | 904 |
| 211 | Ga0070712_100003656 | 3300006175 | Bacteria | 9482 |
| 212 | Ga0070712_100211655 | 3300006175 | Bacteria | 1529 |
| 213 | Ga0070712_100257583 | 3300006175 | Bacteria | 1397 |
| 214 | Ga0075369_10019451 | 3300006186 | Bacteria | 2772 |
| 215 | Ga0075366_10027909 | 3300006195 | Bacteria | 3312 |
| 216 | Ga0075370_10050067 | 3300006353 | Bacteria | 2369 |
| 217 | Ga0068871_100288671 | 3300006358 | Bacteria | 1437 |
| 218 | Ga0075430_100191765 | 3300006846 | Bacteria | 1698 |
| 219 | Ga0075430_100655505 | 3300006846 | Bacteria | 866 |
| 220 | Ga0075430_101006359 | 3300006846 | Bacteria | 687 |
| 221 | Ga0075431_100075350 | 3300006847 | Bacteria | 3482 |
| 222 | Ga0075431_100204773 | 3300006847 | Bacteria | 2017 |
| 223 | Ga0075431_101245805 | 3300006847 | Bacteria | 706 |
| 224 | Ga0075433_10339054 | 3300006852 | Bacteria | 1329 |
| 225 | Ga0075429_101055457 | 3300006880 | Bacteria | 710 |
| 226 | Ga0075429_101408755 | 3300006880 | Bacteria | 607 |
| 227 | Ga0068865_100236802 | 3300006881 | Bacteria | 1435 |
| 228 | Ga0075436_100100836 | 3300006914 | Bacteria | 2011 |
| 229 | Ga0075436_100560910 | 3300006914 | Bacteria | 839 |
| 230 | Ga0097620_100020486 | 3300006931 | Bacteria | 6637 |
| 231 | Ga0097620_100531639 | 3300006931 | Bacteria | 1271 |
| 232 | Ga0097620_102185929 | 3300006931 | Bacteria | 611 |
| 233 | Ga0079104_1016283 | 3300006946 | Bacteria | 2179 |
| 234 | Ga0075435_100004837 | 3300007076 | Bacteria | 9322 |
| 235 | Ga0075435_100483296 | 3300007076 | Bacteria | 1070 |
| 236 | Ga0099794_10023946 | 3300007265 | Bacteria | 2798 |
| 237 | Ga0099795_10003070 | 3300007788 | Bacteria | 4073 |
| 238 | Ga0099795_10280020 | 3300007788 | Bacteria | 728 |
| 239 | Ga0105251_10350811 | 3300009011 | Bacteria | 673 |
| 240 | Ga0105240_10013785 | 3300009093 | Bacteria | 11074 |
| 241 | Ga0105240_10302459 | 3300009093 | Bacteria | 1829 |
| 242 | Ga0105240_10880214 | 3300009093 | Bacteria | 965 |
| 243 | Ga0105240_12381192 | 3300009093 | Bacteria | 548 |
| 244 | Ga0111539_10196609 | 3300009094 | Bacteria | 2352 |
| 245 | Ga0111539_10458223 | 3300009094 | Bacteria | 1485 |
| 246 | Ga0105245_12011763 | 3300009098 | Bacteria | 631 |
| 247 | Ga0105247_11298443 | 3300009101 | Bacteria | 584 |
| 248 | Ga0114129_11524445 | 3300009147 | Bacteria | 821 |
| 249 | Ga0114129_12938087 | 3300009147 | Bacteria | 562 |
| 250 | Ga0105243_10046635 | 3300009148 | Bacteria | 3409 |
| 251 | Ga0105243_11778904 | 3300009148 | Bacteria | 647 |
| 252 | Ga0105242_12427266 | 3300009176 | Bacteria | 572 |
| 253 | Ga0105248_10187820 | 3300009177 | Bacteria | 2328 |
| 254 | Ga0105248_11247886 | 3300009177 | Bacteria | 840 |
| 255 | Ga0105237_10039956 | 3300009545 | Bacteria | 4733 |
| 256 | Ga0105237_12592574 | 3300009545 | Bacteria | 518 |
| 257 | Ga0105238_10061680 | 3300009551 | Bacteria | 3751 |
| 258 | Ga0105238_10434183 | 3300009551 | Bacteria | 1309 |
| 259 | Ga0105238_10657967 | 3300009551 | Bacteria | 1058 |
| 260 | Ga0105238_10797331 | 3300009551 | Bacteria | 960 |
| 261 | Ga0105238_11095629 | 3300009551 | Bacteria | 819 |
| 262 | Ga0105249_10948572 | 3300009553 | Bacteria | 928 |
| 263 | Ga0105249_11055526 | 3300009553 | Bacteria | 882 |
| 264 | Ga0105249_13487615 | 3300009553 | Bacteria | 506 |
| 265 | Ga0099796_10458075 | 3300010159 | Bacteria | 568 |
| 266 | Ga0105239_10025227 | 3300010375 | Bacteria | 6547 |
| 267 | Ga0105239_11405377 | 3300010375 | Bacteria | 806 |
| 268 | Ga0105239_12174877 | 3300010375 | Bacteria | 645 |
| 269 | Ga0105246_10411305 | 3300011119 | Bacteria | 1126 |
| 270 | Ga0105246_10852407 | 3300011119 | Bacteria | 813 |
| 271 | Ga0105246_11041459 | 3300011119 | Bacteria | 743 |
| 272 | Ga0157347_1020377 | 3300012502 | Bacteria | 772 |
| 273 | Ga0157373_10348239 | 3300013100 | Bacteria | 1056 |
| 274 | Ga0157373_10572287 | 3300013100 | Bacteria | 821 |
| 275 | Ga0157371_10111548 | 3300013102 | Bacteria | 1941 |
| 276 | Ga0157371_10385107 | 3300013102 | Bacteria | 1024 |
| 277 | Ga0157371_11164409 | 3300013102 | Bacteria | 593 |
| 278 | Ga0157370_10027470 | 3300013104 | Bacteria | 5611 |
| 279 | Ga0157370_10044296 | 3300013104 | Bacteria | 4278 |
| 280 | Ga0157370_10286338 | 3300013104 | Bacteria | 1522 |
| 281 | Ga0157370_10315306 | 3300013104 | Bacteria | 1443 |
| 282 | Ga0157370_11789799 | 3300013104 | Bacteria | 551 |
| 283 | Ga0157369_10155261 | 3300013105 | Bacteria | 2418 |
| 284 | Ga0157369_10646827 | 3300013105 | Bacteria | 1090 |
| 285 | Ga0157369_11329576 | 3300013105 | Bacteria | 732 |
| 286 | Ga0157369_12252195 | 3300013105 | Bacteria | 552 |
| 287 | Ga0157374_11279188 | 3300013296 | Bacteria | 755 |
| 288 | Ga0157374_12313574 | 3300013296 | Bacteria | 565 |
| 289 | Ga0157378_10506210 | 3300013297 | Bacteria | 1207 |
| 290 | Ga0157378_10920836 | 3300013297 | Bacteria | 906 |
| 291 | Ga0157378_11115765 | 3300013297 | Bacteria | 826 |
| 292 | Ga0157378_11387265 | 3300013297 | Bacteria | 745 |
| 293 | Ga0163162_10460780 | 3300013306 | Bacteria | 1403 |
| 294 | Ga0163162_10555845 | 3300013306 | Bacteria | 1276 |
| 295 | Ga0163162_10670238 | 3300013306 | Bacteria | 1160 |
| 296 | Ga0163162_11735111 | 3300013306 | Bacteria | 713 |
| 297 | Ga0163162_12903158 | 3300013306 | Bacteria | 551 |
| 298 | Ga0157372_10051984 | 3300013307 | Bacteria | 4561 |
| 299 | Ga0157372_10079293 | 3300013307 | Bacteria | 3713 |
| 300 | Ga0157372_10463378 | 3300013307 | Bacteria | 1477 |
| 301 | Ga0157375_10141341 | 3300013308 | Bacteria | 2534 |
| 302 | Ga0157375_10709640 | 3300013308 | Bacteria | 1159 |
| 303 | Ga0157375_11113680 | 3300013308 | Bacteria | 924 |
| 304 | Ga0163163_10352776 | 3300014325 | Bacteria | 1527 |
| 305 | Ga0163163_11550547 | 3300014325 | Bacteria | 724 |
| 306 | Ga0163163_12860585 | 3300014325 | Bacteria | 539 |
| 307 | Ga0157380_10396090 | 3300014326 | Bacteria | 1308 |
| 308 | Ga0157380_12000636 | 3300014326 | Bacteria | 641 |
| 309 | Ga0182008_10002555 | 3300014497 | Bacteria | 11332 |
| 310 | Ga0182008_10013374 | 3300014497 | Bacteria | 4316 |
| 311 | Ga0182008_10273328 | 3300014497 | Bacteria | 877 |
| 312 | Ga0157377_10364316 | 3300014745 | Bacteria | 974 |
| 313 | Ga0157377_10657886 | 3300014745 | Bacteria | 755 |
| 314 | Ga0157377_11365740 | 3300014745 | Bacteria | 557 |
| 315 | Ga0157379_10648618 | 3300014968 | Bacteria | 988 |
| 316 | Ga0157376_10605332 | 3300014969 | Bacteria | 1091 |
| 317 | Ga0157376_10894730 | 3300014969 | Bacteria | 905 |
| 318 | Ga0157376_11892112 | 3300014969 | Bacteria | 633 |
| 319 | Ga0157376_11997844 | 3300014969 | Bacteria | 617 |
| 320 | Ga0157376_13009303 | 3300014969 | Bacteria | 510 |
| 321 | Ga0182006_1000465 | 3300015261 | Bacteria | 31795 |
| 322 | Ga0182007_10007704 | 3300015262 | Bacteria | 4484 |
| 323 | Ga0182007_10282251 | 3300015262 | Bacteria | 605 |
| 324 | Ga0182005_1000078 | 3300015265 | Bacteria | 77287 |
| 325 | Ga0209784_100002 | 3300025224 | Bacteria | 1753105 |
| 326 | Ga0209566_100003 | 3300025225 | Bacteria | 1753105 |
| 327 | Ga0209674_100003 | 3300025226 | Bacteria | 2196646 |
| 328 | Ga0209674_100004 | 3300025226 | Bacteria | 1753105 |
| 329 | Ga0209563_100006 | 3300025230 | Bacteria | 1753105 |
| 330 | Ga0209563_100017 | 3300025230 | Bacteria | 796449 |
| 331 | Ga0209677_100003 | 3300025253 | Bacteria | 1753105 |
| 332 | Ga0209677_100467 | 3300025253 | Bacteria | 23243 |
| 333 | Ga0209051_1011278 | 3300025303 | Bacteria | 4427 |
| 334 | Ga0209257_1000032 | 3300025304 | Bacteria | 680354 |
| 335 | Ga0207697_10117564 | 3300025315 | Bacteria | 1142 |
| 336 | Ga0207656_10131262 | 3300025321 | Bacteria | 1174 |
| 337 | Ga0207656_10303200 | 3300025321 | Bacteria | 791 |
| 338 | Ga0207656_10485358 | 3300025321 | Bacteria | 626 |
| 339 | Ga0207656_10497700 | 3300025321 | Bacteria | 618 |
| 340 | Ga0207682_10301251 | 3300025893 | Bacteria | 751 |
| 341 | Ga0207682_10383952 | 3300025893 | Bacteria | 663 |
| 342 | Ga0207682_10495084 | 3300025893 | Bacteria | 579 |
| 343 | Ga0207692_10081066 | 3300025898 | Bacteria | 1736 |
| 344 | Ga0207692_10283405 | 3300025898 | Bacteria | 1003 |
| 345 | Ga0207642_10198671 | 3300025899 | Bacteria | 1106 |
| 346 | Ga0207647_10068185 | 3300025904 | Bacteria | 2154 |
| 347 | Ga0207685_10219732 | 3300025905 | Bacteria | 903 |
| 348 | Ga0207699_10010032 | 3300025906 | Bacteria | 4737 |
| 349 | Ga0207699_10019110 | 3300025906 | Bacteria | 3646 |
| 350 | Ga0207699_10074048 | 3300025906 | Bacteria | 2091 |
| 351 | Ga0207699_10391367 | 3300025906 | Bacteria | 988 |
| 352 | Ga0207645_10117231 | 3300025907 | Bacteria | 1727 |
| 353 | Ga0207645_10128707 | 3300025907 | Bacteria | 1647 |
| 354 | Ga0207645_10196254 | 3300025907 | Bacteria | 1327 |
| 355 | Ga0207643_10008540 | 3300025908 | Bacteria | 5493 |
| 356 | Ga0207705_10020296 | 3300025909 | Bacteria | 4751 |
| 357 | Ga0207705_10066042 | 3300025909 | Bacteria | 2616 |
| 358 | Ga0207705_10083344 | 3300025909 | Bacteria | 2332 |
| 359 | Ga0207705_10480128 | 3300025909 | Bacteria | 965 |
| 360 | Ga0207705_10480231 | 3300025909 | Bacteria | 965 |
| 361 | Ga0207705_10563023 | 3300025909 | Bacteria | 886 |
| 362 | Ga0207707_10008443 | 3300025912 | Bacteria | 8933 |
| 363 | Ga0207707_10188488 | 3300025912 | Bacteria | 1800 |
| 364 | Ga0207707_10681211 | 3300025912 | Bacteria | 865 |
| 365 | Ga0207707_11121705 | 3300025912 | Bacteria | 640 |
| 366 | Ga0207695_10001853 | 3300025913 | Bacteria | 33132 |
| 367 | Ga0207695_10003759 | 3300025913 | Bacteria | 21064 |
| 368 | Ga0207695_10037174 | 3300025913 | Bacteria | 5255 |
| 369 | Ga0207671_10013287 | 3300025914 | Bacteria | 6567 |
| 370 | Ga0207693_10003536 | 3300025915 | Bacteria | 13345 |
| 371 | Ga0207693_10113785 | 3300025915 | Bacteria | 2123 |
| 372 | Ga0207693_10122685 | 3300025915 | Bacteria | 2041 |
| 373 | Ga0207663_10004765 | 3300025916 | Bacteria | 6778 |
| 374 | Ga0207663_10088813 | 3300025916 | Bacteria | 2045 |
| 375 | Ga0207660_10000108 | 3300025917 | Bacteria | 46937 |
| 376 | Ga0207660_10184576 | 3300025917 | Bacteria | 1622 |
| 377 | Ga0207660_10187336 | 3300025917 | Bacteria | 1610 |
| 378 | Ga0207660_10473100 | 3300025917 | Bacteria | 1015 |
| 379 | Ga0207660_11189932 | 3300025917 | Bacteria | 620 |
| 380 | Ga0207660_11726346 | 3300025917 | Bacteria | 503 |
| 381 | Ga0207662_10040598 | 3300025918 | Bacteria | 2736 |
| 382 | Ga0207662_10823619 | 3300025918 | Bacteria | 655 |
| 383 | Ga0207657_10134465 | 3300025919 | Bacteria | 2024 |
| 384 | Ga0207657_10192341 | 3300025919 | Bacteria | 1645 |
| 385 | Ga0207657_10624397 | 3300025919 | Bacteria | 840 |
| 386 | Ga0207649_10059611 | 3300025920 | Bacteria | 2395 |
| 387 | Ga0207649_10284652 | 3300025920 | Bacteria | 1203 |
| 388 | Ga0207649_10448539 | 3300025920 | Bacteria | 973 |
| 389 | Ga0207652_10461974 | 3300025921 | Bacteria | 1144 |
| 390 | Ga0207652_11793562 | 3300025921 | Bacteria | 519 |
| 391 | Ga0207646_11875752 | 3300025922 | Bacteria | 511 |
| 392 | Ga0207681_10037004 | 3300025923 | Bacteria | 3223 |
| 393 | Ga0207694_10037025 | 3300025924 | Bacteria | 3745 |
| 394 | Ga0207650_10039405 | 3300025925 | Bacteria | 3453 |
| 395 | Ga0207650_10163241 | 3300025925 | Bacteria | 1766 |
| 396 | Ga0207650_10172409 | 3300025925 | Bacteria | 1720 |
| 397 | Ga0207650_11455561 | 3300025925 | Bacteria | 583 |
| 398 | Ga0207659_10037462 | 3300025926 | Bacteria | 3368 |
| 399 | Ga0207659_10216485 | 3300025926 | Bacteria | 1538 |
| 400 | Ga0207659_10574573 | 3300025926 | Bacteria | 959 |
| 401 | Ga0207659_11323980 | 3300025926 | Bacteria | 618 |
| 402 | Ga0207687_11615204 | 3300025927 | Bacteria | 556 |
| 403 | Ga0207687_11800710 | 3300025927 | Bacteria | 524 |
| 404 | Ga0207700_10026068 | 3300025928 | Bacteria | 4071 |
| 405 | Ga0207700_10143131 | 3300025928 | Bacteria | 1967 |
| 406 | Ga0207700_10153827 | 3300025928 | Bacteria | 1903 |
| 407 | Ga0207700_10694998 | 3300025928 | Bacteria | 908 |
| 408 | Ga0207664_10026276 | 3300025929 | Bacteria | 4399 |
| 409 | Ga0207664_10040338 | 3300025929 | Bacteria | 3630 |
| 410 | Ga0207644_10607647 | 3300025931 | Bacteria | 908 |
| 411 | Ga0207690_10181149 | 3300025932 | Bacteria | 1586 |
| 412 | Ga0207690_10213555 | 3300025932 | Bacteria | 1472 |
| 413 | Ga0207690_11402236 | 3300025932 | Bacteria | 584 |
| 414 | Ga0207706_10120698 | 3300025933 | Bacteria | 2305 |
| 415 | Ga0207706_10249799 | 3300025933 | Bacteria | 1550 |
| 416 | Ga0207706_10427236 | 3300025933 | Bacteria | 1147 |
| 417 | Ga0207706_10612496 | 3300025933 | Bacteria | 935 |
| 418 | Ga0207686_10211190 | 3300025934 | Bacteria | 1395 |
| 419 | Ga0207709_10834611 | 3300025935 | Bacteria | 746 |
| 420 | Ga0207709_11242391 | 3300025935 | Bacteria | 615 |
| 421 | Ga0207709_11347797 | 3300025935 | Bacteria | 590 |
| 422 | Ga0207670_10015446 | 3300025936 | Bacteria | 4563 |
| 423 | Ga0207670_11220513 | 3300025936 | Bacteria | 637 |
| 424 | Ga0207669_10330718 | 3300025937 | Bacteria | 1170 |
| 425 | Ga0207669_10509609 | 3300025937 | Bacteria | 964 |
| 426 | Ga0207704_10061975 | 3300025938 | Bacteria | 2323 |
| 427 | Ga0207704_10432381 | 3300025938 | Bacteria | 1046 |
| 428 | Ga0207665_10844310 | 3300025939 | Bacteria | 725 |
| 429 | Ga0207665_11212508 | 3300025939 | Bacteria | 602 |
| 430 | Ga0207691_10003241 | 3300025940 | Bacteria | 15858 |
| 431 | Ga0207691_10034050 | 3300025940 | Bacteria | 4741 |
| 432 | Ga0207691_10159600 | 3300025940 | Bacteria | 1979 |
| 433 | Ga0207691_10464926 | 3300025940 | Bacteria | 1076 |
| 434 | Ga0207691_10541450 | 3300025940 | Bacteria | 987 |
| 435 | Ga0207691_11410422 | 3300025940 | Bacteria | 572 |
| 436 | Ga0207711_10116293 | 3300025941 | Bacteria | 2384 |
| 437 | Ga0207711_10148571 | 3300025941 | Bacteria | 2113 |
| 438 | Ga0207711_10263813 | 3300025941 | Bacteria | 1584 |
| 439 | Ga0207689_10060980 | 3300025942 | Bacteria | 3102 |
| 440 | Ga0207661_10046637 | 3300025944 | Bacteria | 3436 |
| 441 | Ga0207661_10148680 | 3300025944 | Bacteria | 2023 |
| 442 | Ga0207661_10440636 | 3300025944 | Bacteria | 1185 |
| 443 | Ga0207661_10453473 | 3300025944 | Bacteria | 1168 |
| 444 | Ga0207661_10538442 | 3300025944 | Bacteria | 1069 |
| 445 | Ga0207679_10094142 | 3300025945 | Bacteria | 2325 |
| 446 | Ga0207679_10115434 | 3300025945 | Bacteria | 2127 |
| 447 | Ga0207679_10275936 | 3300025945 | Bacteria | 1440 |
| 448 | Ga0207679_10369007 | 3300025945 | Bacteria | 1256 |
| 449 | Ga0207679_10469775 | 3300025945 | Bacteria | 1118 |
| 450 | Ga0207679_11832344 | 3300025945 | Bacteria | 554 |
| 451 | Ga0207667_10000438 | 3300025949 | Bacteria | 55784 |
| 452 | Ga0207667_10054147 | 3300025949 | Bacteria | 4220 |
| 453 | Ga0207667_10080431 | 3300025949 | Bacteria | 3376 |
| 454 | Ga0207667_10120706 | 3300025949 | Bacteria | 2701 |
| 455 | Ga0207667_10532629 | 3300025949 | Bacteria | 1189 |
| 456 | Ga0207667_11078949 | 3300025949 | Bacteria | 787 |
| 457 | Ga0207667_11779875 | 3300025949 | Bacteria | 581 |
| 458 | Ga0207651_10044954 | 3300025960 | Bacteria | 2959 |
| 459 | Ga0207651_10049833 | 3300025960 | Bacteria | 2840 |
| 460 | Ga0207651_10592134 | 3300025960 | Bacteria | 968 |
| 461 | Ga0207651_11912507 | 3300025960 | Bacteria | 533 |
| 462 | Ga0207712_11111599 | 3300025961 | Bacteria | 704 |
| 463 | Ga0207712_11180360 | 3300025961 | Bacteria | 683 |
| 464 | Ga0207712_11858715 | 3300025961 | Bacteria | 539 |
| 465 | Ga0207668_10170685 | 3300025972 | Bacteria | 1705 |
| 466 | Ga0207668_10813330 | 3300025972 | Bacteria | 828 |
| 467 | Ga0207668_11650884 | 3300025972 | Bacteria | 579 |
| 468 | Ga0207640_10164010 | 3300025981 | Bacteria | 1648 |
| 469 | Ga0207658_10207146 | 3300025986 | Bacteria | 1641 |
| 470 | Ga0207658_10334431 | 3300025986 | Bacteria | 1315 |
| 471 | Ga0207658_10553881 | 3300025986 | Bacteria | 1029 |
| 472 | Ga0207677_10558543 | 3300026023 | Bacteria | 999 |
| 473 | Ga0207677_10874560 | 3300026023 | Bacteria | 809 |
| 474 | Ga0207677_11010063 | 3300026023 | Bacteria | 755 |
| 475 | Ga0207703_10320070 | 3300026035 | Bacteria | 1420 |
| 476 | Ga0207639_10335709 | 3300026041 | Bacteria | 1346 |
| 477 | Ga0207678_10228246 | 3300026067 | Bacteria | 1594 |
| 478 | Ga0207678_10286314 | 3300026067 | Bacteria | 1415 |
| 479 | Ga0207678_11119896 | 3300026067 | Bacteria | 697 |
| 480 | Ga0207678_11339925 | 3300026067 | Bacteria | 633 |
| 481 | Ga0207708_10567734 | 3300026075 | Bacteria | 958 |
| 482 | Ga0207708_11487935 | 3300026075 | Bacteria | 595 |
| 483 | Ga0207708_11562456 | 3300026075 | Bacteria | 580 |
| 484 | Ga0207702_10100428 | 3300026078 | Bacteria | 2553 |
| 485 | Ga0207702_10297815 | 3300026078 | Bacteria | 1530 |
| 486 | Ga0207702_10714697 | 3300026078 | Bacteria | 988 |
| 487 | Ga0207702_12128198 | 3300026078 | Bacteria | 550 |
| 488 | Ga0207641_10234602 | 3300026088 | Bacteria | 1707 |
| 489 | Ga0207641_10605511 | 3300026088 | Bacteria | 1073 |
| 490 | Ga0207648_10009384 | 3300026089 | Bacteria | 9367 |
| 491 | Ga0207648_11342871 | 3300026089 | Bacteria | 672 |
| 492 | Ga0207676_10528943 | 3300026095 | Bacteria | 1123 |
| 493 | Ga0207674_10019328 | 3300026116 | Bacteria | 7380 |
| 494 | Ga0207674_10030258 | 3300026116 | Bacteria | 5694 |
| 495 | Ga0207674_10471185 | 3300026116 | Bacteria | 1214 |
| 496 | Ga0207674_11842393 | 3300026116 | Bacteria | 572 |
| 497 | Ga0207675_100281049 | 3300026118 | Bacteria | 1617 |
| 498 | Ga0207675_100560854 | 3300026118 | Bacteria | 1142 |
| 499 | Ga0207675_100702801 | 3300026118 | Bacteria | 1020 |
| 500 | Ga0207675_100762188 | 3300026118 | Bacteria | 979 |
| 501 | Ga0207683_10188565 | 3300026121 | Bacteria | 1871 |
| 502 | Ga0207683_10227218 | 3300026121 | Bacteria | 1701 |
| 503 | Ga0207683_10406459 | 3300026121 | Bacteria | 1253 |
| 504 | Ga0207698_10203459 | 3300026142 | Bacteria | 1775 |
| 505 | Ga0207698_10212653 | 3300026142 | Bacteria | 1741 |
| 506 | Ga0207698_10577776 | 3300026142 | Bacteria | 1105 |
| 507 | Ga0207698_11302213 | 3300026142 | Bacteria | 741 |
| 508 | Ga0209281_1015504 | 3300027111 | Bacteria | 1587 |
| 509 | Ga0209969_1006876 | 3300027360 | Bacteria | 1603 |
| 510 | Ga0209969_1064622 | 3300027360 | Bacteria | 579 |
| 511 | Ga0209967_1002057 | 3300027364 | Bacteria | 2596 |
| 512 | Ga0209996_1012602 | 3300027395 | Bacteria | 1137 |
| 513 | Ga0210000_1000359 | 3300027462 | Bacteria | 6419 |
| 514 | Ga0210000_1021166 | 3300027462 | Bacteria | 994 |
| 515 | Ga0209179_1076816 | 3300027512 | Bacteria | 735 |
| 516 | Ga0209968_1057529 | 3300027526 | Bacteria | 682 |
| 517 | Ga0209968_1076531 | 3300027526 | Bacteria | 599 |
| 518 | Ga0209999_1000555 | 3300027543 | Bacteria | 5868 |
| 519 | Ga0209983_1046924 | 3300027665 | Bacteria | 941 |
| 520 | Ga0209282_1125663 | 3300027666 | Bacteria | 1276 |
| 521 | Ga0209588_1035122 | 3300027671 | Bacteria | 1611 |
| 522 | Ga0209971_1006039 | 3300027682 | Bacteria | 2871 |
| 523 | Ga0209974_10006308 | 3300027876 | Bacteria | 4145 |
| 524 | Ga0209974_10016099 | 3300027876 | Bacteria | 2482 |
| 525 | Ga0265355_1020574 | 3300028036 | Bacteria | 570 |
| 526 | Ga0268265_10974493 | 3300028380 | Bacteria | 836 |
| 527 | Ga0268265_11266507 | 3300028380 | Bacteria | 737 |
| 528 | Ga0268264_10359998 | 3300028381 | Bacteria | 1387 |
| 529 | Ga0265338_10460300 | 3300028800 | Bacteria | 900 |
| 530 | Ga0316182_1388674 | 3300030745 | Bacteria | 1705 |
| 531 | Ga0307408_100542836 | 3300031548 | Bacteria | 1025 |
| 532 | Ga0307408_101042820 | 3300031548 | Bacteria | 756 |
| 533 | Ga0307408_101318191 | 3300031548 | Bacteria | 677 |
| 534 | Ga0316575_10000032 | 3300031665 | Bacteria | 33845 |
| 535 | Ga0316575_10007166 | 3300031665 | Bacteria | 4035 |
| 536 | Ga0316575_10208096 | 3300031665 | Bacteria | 815 |
| 537 | Ga0316579_10000922 | 3300031691 | Bacteria | 10216 |
| 538 | Ga0316579_10003486 | 3300031691 | Bacteria | 6145 |
| 539 | Ga0316576_10505678 | 3300031727 | Bacteria | 888 |
| 540 | Ga0316578_10019379 | 3300031728 | Bacteria | 3744 |
| 541 | Ga0316578_10038835 | 3300031728 | Bacteria | 2748 |
| 542 | Ga0307405_10302791 | 3300031731 | Bacteria | 1213 |
| 543 | Ga0307405_11720673 | 3300031731 | Bacteria | 556 |
| 544 | Ga0307413_10775714 | 3300031824 | Bacteria | 803 |
| 545 | Ga0307410_10137989 | 3300031852 | Bacteria | 1800 |
| 546 | Ga0307410_10643308 | 3300031852 | Bacteria | 889 |
| 547 | Ga0307406_10053066 | 3300031901 | Bacteria | 2581 |
| 548 | Ga0307406_10124064 | 3300031901 | Bacteria | 1801 |
| 549 | Ga0307406_10333259 | 3300031901 | Bacteria | 1179 |
| 550 | Ga0307406_11680663 | 3300031901 | Bacteria | 562 |
| 551 | Ga0307412_10388759 | 3300031911 | Bacteria | 1132 |
| 552 | Ga0307412_11207745 | 3300031911 | Bacteria | 677 |
| 553 | Ga0307409_100321415 | 3300031995 | Bacteria | 1448 |
| 554 | Ga0307409_100725525 | 3300031995 | Bacteria | 995 |
| 555 | Ga0307409_100959655 | 3300031995 | Bacteria | 871 |
| 556 | Ga0307409_101849815 | 3300031995 | Bacteria | 633 |
| 557 | Ga0307409_102158352 | 3300031995 | Bacteria | 587 |
| 558 | Ga0307416_100071671 | 3300032002 | Bacteria | 2880 |
| 559 | Ga0307416_100094290 | 3300032002 | Bacteria | 2581 |
| 560 | Ga0307416_100995760 | 3300032002 | Bacteria | 941 |
| 561 | Ga0307416_101643754 | 3300032002 | Bacteria | 747 |
| 562 | Ga0307416_101978192 | 3300032002 | Bacteria | 686 |
| 563 | Ga0307416_102411812 | 3300032002 | Bacteria | 625 |
| 564 | Ga0307416_102631432 | 3300032002 | Bacteria | 600 |
| 565 | Ga0307414_10201808 | 3300032004 | Bacteria | 1618 |
| 566 | Ga0307414_11979702 | 3300032004 | Bacteria | 544 |
| 567 | Ga0307414_12178846 | 3300032004 | Bacteria | 518 |
| 568 | Ga0307411_10189389 | 3300032005 | Bacteria | 1569 |
| 569 | Ga0307411_10244153 | 3300032005 | Bacteria | 1408 |
| 570 | Ga0307411_10288180 | 3300032005 | Bacteria | 1310 |
| 571 | Ga0307415_100523335 | 3300032126 | Bacteria | 1041 |
| 572 | Ga0307415_100606156 | 3300032126 | Bacteria | 975 |
| 573 | Ga0307415_100911094 | 3300032126 | Bacteria | 811 |
| 574 | Ga0307415_101085684 | 3300032126 | Bacteria | 748 |
| 575 | Ga0316583_10003578 | 3300032133 | Bacteria | 5488 |
| 576 | Ga0316583_10012848 | 3300032133 | Bacteria | 3021 |
| 577 | Ga0316583_10110681 | 3300032133 | Bacteria | 957 |
| 578 | Ga0316593_10236263 | 3300032168 | Bacteria | 681 |
| 579 | Ga0373926_0012427 | 3300035083 | Bacteria | 2878 |
| 580 | Ga0373926_0081631 | 3300035083 | Bacteria | 1196 |
| 581 | Ga0373934_0000613 | 3300035086 | Bacteria | 12584 |
| 582 | Ga0373944_0043393 | 3300035089 | Bacteria | 1397 |
| 583 | Ga0373952_0161086 | 3300035092 | Bacteria | 636 |
| 584 | Ga0373923_0021276 | 3300035111 | Bacteria | 2530 |
| 585 | Ga0373945_0096315 | 3300035116 | Bacteria | 1153 |
| 586 | Ga0373956_0097835 | 3300035119 | Bacteria | 1358 |
| 587 | Ga0373957_0011425 | 3300035120 | Bacteria | 2964 |
| 588 | Ga0373960_0038491 | 3300035121 | Bacteria | 1371 |
| 589 | Ga0373943_0967145 | 3300035170 | Bacteria | 510 |
| 590 | Ga0373946_0066655 | 3300035171 | Bacteria | 1544 |
| 591 | Ga0373955_0000555 | 3300035172 | Bacteria | 15870 |
| 592 | Ga0373942_0160572 | 3300035207 | Bacteria | 727 |
| 593 | Ga0316574_0311636 | 3300035398 | Bacteria | 1000 |
| 594 | Ga0373924_0031046 | 3300035410 | Bacteria | 2146 |
| 595 | Ga0373935_0015507 | 3300035692 | Bacteria | 4607 |
| 596 | Ga0373935_0518439 | 3300035692 | Bacteria | 867 |
| 597 | Ga0373935_0568069 | 3300035692 | Bacteria | 828 |
| 598 | Ga0373935_1182297 | 3300035692 | Bacteria | 570 |
| 599 | Ga0373927_0027933 | 3300035695 | Bacteria | 3682 |
| 600 | Ga0373927_0104013 | 3300035695 | Bacteria | 1848 |
| 601 | Ga0373927_0164642 | 3300035695 | Bacteria | 1453 |
| 602 | Ga0373933_0000055 | 3300035724 | Bacteria | 67484 |
| 603 | Ga0373947_0037687 | 3300035725 | Bacteria | 2870 |
| 604 | Ga0373947_0043390 | 3300035725 | Bacteria | 2686 |
| 605 | Ga0373937_0000450 | 3300036401 | Bacteria | 37946 |
| 606 | Ga0373937_0386729 | 3300036401 | Bacteria | 1327 |
| 607 | Ga0316582_0000229 | 3300036647 | Bacteria | 18476 |
| 608 | Ga0316582_0010275 | 3300036647 | Bacteria | 5119 |
| 609 | Ga0316582_0131791 | 3300036647 | Bacteria | 1680 |
| 610 | Ga0316584_0062296 | 3300036712 | Bacteria | 2794 |
| 611 | Ga0316584_0124699 | 3300036712 | Bacteria | 1924 |
| 612 | Ga0373925_0533729 | 3300037068 | Bacteria | 964 |
| 613 | Ga0373925_0743704 | 3300037068 | Bacteria | 808 |
| 614 | Ga0373925_1281198 | 3300037068 | Bacteria | 602 |
| 615 | Ga0316581_0016222 | 3300037588 | Bacteria | 2137 |
| 616 | Ga0316581_0018143 | 3300037588 | Bacteria | 2040 |
| 617 | Ga0436364_0497955 | 3300037853 | Bacteria | 739 |
| 618 | Ga0395901_0933184 | 3300038443 | Bacteria | 848 |
| 619 | Ga0395901_1686137 | 3300038443 | Bacteria | 585 |
| 620 | Ga0436365_0350682 | 3300039437 | Bacteria | 711 |
| 621 | Ga0436365_1200738 | 3300039437 | Bacteria | 961 |
| 622 | Ga0436365_1592469 | 3300039437 | Bacteria | 1269 |
| 623 | Ga0436361_0730207 | 3300039447 | Bacteria | 2322 |
| 624 | Ga0436361_1079523 | 3300039447 | Bacteria | 3333 |
| 625 | Ga0439436_0140609 | 3300041404 | Bacteria | 679 |
| 626 | Ga0439439_0249705 | 3300041406 | Bacteria | 526 |
| 627 | Ga0439461_0062686 | 3300041410 | Bacteria | 847 |
| 628 | Ga0451841_0300790 | 3300041498 | Bacteria | 582 |
| 629 | Ga0451845_0910423 | 3300041501 | Bacteria | 676 |
| 630 | Ga0451847_0780003 | 3300041503 | Bacteria | 529 |
| 631 | Ga0451853_3739149 | 3300041512 | Bacteria | 817 |
| 632 | Ga0439445_0190724 | 3300042004 | Bacteria | 604 |
| 633 | Ga0439445_0224983 | 3300042004 | Bacteria | 557 |
| 634 | Ga0439449_0046339 | 3300042007 | Bacteria | 1611 |
| 635 | Ga0439452_034928 | 3300042010 | Bacteria | 1212 |
| 636 | Ga0439455_0033113 | 3300042012 | Bacteria | 1295 |
| 637 | Ga0439457_100883 | 3300042014 | Bacteria | 673 |
| 638 | Ga0450912_004316 | 3300042116 | Bacteria | 1050 |
| 639 | Ga0450917_003459 | 3300042120 | Bacteria | 1144 |
| 640 | Ga0450923_116922 | 3300042125 | Bacteria | 626 |
| 641 | Ga0450888_002272 | 3300042126 | Bacteria | 1889 |
| 642 | Ga0450890_009447 | 3300042127 | Bacteria | 1249 |
| 643 | Ga0450891_000222 | 3300042129 | Bacteria | 5702 |
| 644 | Ga0450892_001107 | 3300042130 | Bacteria | 2814 |
| 645 | Ga0450903_020990 | 3300042138 | Bacteria | 1010 |
| 646 | Ga0439434_0095027 | 3300042435 | Bacteria | 956 |
| 647 | Ga0439444_0002332 | 3300042437 | Bacteria | 2584 |
| 648 | Ga0439459_0017764 | 3300042438 | Bacteria | 1330 |
| 649 | Ga0450893_0000472 | 3300042532 | Bacteria | 5678 |
| 650 | Ga0451577_0804129 | 3300042876 | Bacteria | 849 |
| 651 | Ga0439440_0114816 | 3300042993 | Bacteria | 744 |
| 652 | Ga0439440_0140568 | 3300042993 | Bacteria | 685 |
| 653 | Ga0453683_0074998 | 3300044673 | Bacteria | 2118 |
| 654 | Ga0453683_0518135 | 3300044673 | Bacteria | 774 |
| 655 | Ga0453684_0743783 | 3300044712 | Bacteria | 1062 |
| 656 | Ga0453684_0872633 | 3300044712 | Bacteria | 965 |
| 657 | Ga0451576_0072908 | 3300045051 | Bacteria | 3573 |
| 658 | Ga0451576_1661229 | 3300045051 | Bacteria | 662 |
| 659 | Ga0451576_2252183 | 3300045051 | Bacteria | 559 |
| 660 | Ga0466967_1666302 | 3300045976 | Bacteria | 635 |
| 661 | Ga0495592_0002705 | 3300046454 | Bacteria | 12543 |
| 662 | Ga0495592_0825445 | 3300046454 | Bacteria | 549 |
| 663 | Ga0495629_0011314 | 3300046459 | Bacteria | 6483 |
| 664 | Ga0495629_0064592 | 3300046459 | Bacteria | 2556 |
| 665 | Ga0495629_0142153 | 3300046459 | Bacteria | 1669 |
| 666 | Ga0495651_0000996 | 3300046462 | Bacteria | 21980 |
| 667 | Ga0495651_0647505 | 3300046462 | Bacteria | 663 |
| 668 | Ga0495653_0000195 | 3300046463 | Bacteria | 49244 |
| 669 | Ga0495650_0012788 | 3300046471 | Bacteria | 4492 |
| 670 | Ga0495580_0008769 | 3300046472 | Bacteria | 8008 |
| 671 | Ga0495580_0048643 | 3300046472 | Bacteria | 3001 |
| 672 | Ga0495580_0068932 | 3300046472 | Bacteria | 2472 |
| 673 | Ga0495582_0041545 | 3300046473 | Bacteria | 2534 |
| 674 | Ga0495582_0215716 | 3300046473 | Bacteria | 1097 |
| 675 | Ga0495582_0538044 | 3300046473 | Bacteria | 675 |
| 676 | Ga0495582_0725799 | 3300046473 | Bacteria | 575 |
| 677 | Ga0495639_0008494 | 3300046475 | Bacteria | 4403 |
| 678 | Ga0495639_0089033 | 3300046475 | Bacteria | 1446 |
| 679 | Ga0495639_0120029 | 3300046475 | Bacteria | 1254 |
| 680 | Ga0495664_0054273 | 3300046477 | Bacteria | 2383 |
| 681 | Ga0495594_0036114 | 3300046499 | Bacteria | 2694 |
| 682 | Ga0495594_0274194 | 3300046499 | Bacteria | 961 |
| 683 | Ga0495594_0695554 | 3300046499 | Bacteria | 575 |
| 684 | Ga0495596_0103789 | 3300046500 | Bacteria | 1104 |
| 685 | Ga0495596_0334621 | 3300046500 | Bacteria | 589 |
| 686 | Ga0495583_0008785 | 3300046506 | Bacteria | 6126 |
| 687 | Ga0495606_0006532 | 3300046507 | Bacteria | 10727 |
| 688 | Ga0495608_0000085 | 3300046511 | Bacteria | 68124 |
| 689 | Ga0495608_0662561 | 3300046511 | Bacteria | 623 |
| 690 | Ga0495628_0034222 | 3300046516 | Bacteria | 4088 |
| 691 | Ga0495630_0011652 | 3300046517 | Bacteria | 6372 |
| 692 | Ga0495630_0022736 | 3300046517 | Bacteria | 4631 |
| 693 | Ga0495630_0155017 | 3300046517 | Bacteria | 1743 |
| 694 | Ga0495630_1355860 | 3300046517 | Bacteria | 535 |
| 695 | Ga0495663_0062093 | 3300046525 | Bacteria | 1176 |
| 696 | Ga0495663_0082676 | 3300046525 | Bacteria | 1036 |
| 697 | Ga0495663_0213062 | 3300046525 | Bacteria | 677 |
| 698 | Ga0495666_0184231 | 3300046526 | Bacteria | 963 |
| 699 | Ga0495642_0053050 | 3300046528 | Bacteria | 1670 |
| 700 | Ga0495652_0008685 | 3300046529 | Bacteria | 9262 |
| 701 | Ga0495654_0368700 | 3300046530 | Bacteria | 575 |
| 702 | Ga0495665_0005306 | 3300046531 | Bacteria | 6945 |
| 703 | Ga0495665_0103981 | 3300046531 | Bacteria | 1490 |
| 704 | Ga0495665_0106728 | 3300046531 | Bacteria | 1469 |
| 705 | Ga0495665_0652993 | 3300046531 | Bacteria | 523 |
| 706 | Ga0495640_0304947 | 3300046533 | Bacteria | 988 |
| 707 | Ga0495587_0000114 | 3300046536 | Bacteria | 61671 |
| 708 | Ga0495598_0189898 | 3300046537 | Bacteria | 737 |
| 709 | Ga0495621_0006211 | 3300046539 | Bacteria | 3475 |
| 710 | Ga0495621_0204629 | 3300046539 | Bacteria | 795 |
| 711 | Ga0495621_0254339 | 3300046539 | Bacteria | 718 |
| 712 | Ga0495645_0000144 | 3300046543 | Bacteria | 48490 |
| 713 | Ga0495645_0629896 | 3300046543 | Bacteria | 657 |
| 714 | Ga0495667_0000241 | 3300046559 | Bacteria | 35516 |
| 715 | Ga0495667_0082166 | 3300046559 | Bacteria | 2094 |
| 716 | Ga0495667_0459167 | 3300046559 | Bacteria | 800 |
| 717 | Ga0495668_0107838 | 3300046616 | Bacteria | 1523 |
| 718 | Ga0495634_0261307 | 3300046642 | Bacteria | 1056 |
| 719 | Ga0495625_0152379 | 3300046660 | Bacteria | 1553 |
| 720 | Ga0495625_0534897 | 3300046660 | Bacteria | 712 |
| 721 | Ga0495635_0000253 | 3300046663 | Bacteria | 34161 |
| 722 | Ga0495635_0336897 | 3300046663 | Bacteria | 1008 |
| 723 | Ga0495635_0889632 | 3300046663 | Bacteria | 571 |
| 724 | Ga0495659_0241169 | 3300046664 | Bacteria | 751 |
| 725 | Ga0495659_0302271 | 3300046664 | Bacteria | 676 |
| 726 | Ga0495588_0066857 | 3300046674 | Bacteria | 1866 |
| 727 | Ga0495588_0126015 | 3300046674 | Bacteria | 1350 |
| 728 | Ga0495588_0298141 | 3300046674 | Bacteria | 849 |
| 729 | Ga0495588_0439476 | 3300046674 | Bacteria | 685 |
| 730 | Ga0495657_0000210 | 3300046675 | Bacteria | 52663 |
| 731 | Ga0495657_0254549 | 3300046675 | Bacteria | 1056 |
| 732 | Ga0495599_0000436 | 3300046678 | Bacteria | 23725 |
| 733 | Ga0495623_0000305 | 3300046679 | Bacteria | 31845 |
| 734 | Ga0495646_0011487 | 3300046680 | Bacteria | 5621 |
| 735 | Ga0495658_0001556 | 3300046683 | Bacteria | 11985 |
| 736 | Ga0495658_0489290 | 3300046683 | Bacteria | 787 |
| 737 | Ga0495669_0003327 | 3300046684 | Bacteria | 6614 |
| 738 | Ga0495669_0162795 | 3300046684 | Bacteria | 1059 |
| 739 | Ga0495669_0366748 | 3300046684 | Bacteria | 697 |
| 740 | Ga0495669_0560199 | 3300046684 | Bacteria | 556 |
| 741 | Ga0495613_0065654 | 3300046689 | Bacteria | 2652 |
| 742 | Ga0495613_0068004 | 3300046689 | Bacteria | 2599 |
| 743 | Ga0495613_0694257 | 3300046689 | Bacteria | 670 |
| 744 | Ga0495649_0012212 | 3300046694 | Bacteria | 5008 |
| 745 | Ga0495589_0045800 | 3300046794 | Bacteria | 2172 |
| 746 | Ga0495600_0000023 | 3300046809 | Bacteria | 94401 |
| 747 | Ga0495581_0009338 | 3300047315 | Bacteria | 5676 |
| 748 | Ga0495604_0000251 | 3300047317 | Bacteria | 47665 |
| 749 | Ga0495604_0245664 | 3300047317 | Bacteria | 1222 |
| 750 | Ga0495604_0567091 | 3300047317 | Bacteria | 731 |
| 751 | Ga0495636_0077133 | 3300047318 | Bacteria | 1430 |
| 752 | Ga0495674_0040004 | 3300047319 | Bacteria | 4197 |
| 753 | Ga0495674_0461643 | 3300047319 | Bacteria | 1019 |
| 754 | Ga0495672_0003697 | 3300047320 | Bacteria | 12916 |
| 755 | Ga0495672_0167004 | 3300047320 | Bacteria | 1126 |
| 756 | Ga0495680_0006224 | 3300047322 | Bacteria | 11126 |
| 757 | Ga0495675_0005468 | 3300047444 | Bacteria | 7750 |
| 758 | Ga0495675_0416813 | 3300047444 | Bacteria | 781 |
| 759 | Ga0495685_054585 | 3300047447 | Bacteria | 1352 |
| 760 | Ga0495684_0000037 | 3300047471 | Bacteria | 106933 |
| 761 | Ga0495686_0009043 | 3300047472 | Bacteria | 7228 |
| 762 | Ga0495593_0153212 | 3300047673 | Bacteria | 1165 |
| 763 | Ga0495593_0172241 | 3300047673 | Bacteria | 1091 |
| 764 | Ga0495593_0659117 | 3300047673 | Bacteria | 525 |
| 765 | Ga0495602_0002980 | 3300048088 | Bacteria | 17361 |
| 766 | Ga0495602_0523073 | 3300048088 | Bacteria | 826 |
| 767 | Ga0495602_0661447 | 3300048088 | Bacteria | 712 |
| 768 | Ga0495614_0003629 | 3300048089 | Bacteria | 6920 |
| 769 | Ga0495615_0030918 | 3300048090 | Bacteria | 1281 |
| 770 | Ga0496100_0338633 | 3300048903 | Bacteria | 1134 |
| 771 | Ga0496100_0706097 | 3300048903 | Bacteria | 787 |
| 772 | Ga0496101_1373097 | 3300048904 | Bacteria | 551 |
| 773 | Ga0496104_0115322 | 3300048907 | Bacteria | 2577 |
| 774 | Ga0496104_0405684 | 3300048907 | Bacteria | 1275 |
| 775 | Ga0496104_0433022 | 3300048907 | Bacteria | 1227 |
| 776 | Ga0496104_0708472 | 3300048907 | Bacteria | 914 |
| 777 | Ga0496105_0008533 | 3300048908 | Bacteria | 7960 |
| 778 | Ga0496105_0179939 | 3300048908 | Bacteria | 1732 |
| 779 | Ga0496106_0076551 | 3300048909 | Bacteria | 2565 |
| 780 | Ga0496106_1420676 | 3300048909 | Bacteria | 536 |
| 781 | Ga0496107_0170082 | 3300048910 | Bacteria | 1617 |
| 782 | Ga0496108_0270466 | 3300048911 | Bacteria | 1479 |
| 783 | Ga0496109_0186466 | 3300048912 | Bacteria | 1949 |
| 784 | Ga0496109_0706940 | 3300048912 | Bacteria | 945 |
| 785 | Ga0496110_0385554 | 3300048913 | Bacteria | 1277 |
| 786 | Ga0496111_0659780 | 3300048914 | Bacteria | 763 |
| 787 | Ga0496111_1077685 | 3300048914 | Bacteria | 573 |
| 788 | Ga0496112_0016641 | 3300048915 | Bacteria | 6895 |
| 789 | Ga0496113_0301778 | 3300048916 | Bacteria | 1282 |
| 790 | Ga0496114_0110142 | 3300048917 | Bacteria | 2358 |
| 791 | Ga0496114_0451355 | 3300048917 | Bacteria | 1139 |
| 792 | Ga0496115_0218617 | 3300048918 | Bacteria | 1572 |
| 793 | Ga0496115_0385705 | 3300048918 | Bacteria | 1139 |
| 794 | Ga0496115_0640522 | 3300048918 | Bacteria | 841 |
| 795 | Ga0496115_0669474 | 3300048918 | Bacteria | 819 |
| 796 | Ga0496117_0000278 | 3300048920 | Bacteria | 95496 |
| 797 | Ga0496124_0875548 | 3300048927 | Bacteria | 548 |
| 798 | Ga0496125_0113300 | 3300048928 | Bacteria | 1957 |
| 799 | Ga0501306_053080 | 3300049127 | Bacteria | 654 |
| 800 | Ga0501308_005184 | 3300049128 | Bacteria | 1287 |
| 801 | Ga0501309_000129 | 3300049129 | Bacteria | 4661 |
| 802 | Ga0501310_000219 | 3300049130 | Bacteria | 5455 |
| 803 | Ga0501304_001129 | 3300049160 | Bacteria | 1642 |
| 804 | Ga0501305_000428 | 3300049161 | Bacteria | 3421 |
| 805 | Ga0501307_005139 | 3300049162 | Bacteria | 1368 |
| 806 | Ga0501292_053519 | 3300049515 | Bacteria | 720 |
| 807 | Ga0501294_024649 | 3300049517 | Bacteria | 672 |
| 808 | Ga0501299_050248 | 3300049522 | Bacteria | 860 |
| 809 | Ga0501299_215354 | 3300049522 | Bacteria | 516 |
| 810 | Ga0501300_000306 | 3300049523 | Bacteria | 7395 |
| 811 | Ga0501311_000655 | 3300049527 | Bacteria | 2575 |
| 812 | Ga0501311_038849 | 3300049527 | Bacteria | 716 |
| 813 | Ga0501312_001901 | 3300049528 | Bacteria | 2163 |
| 814 | Ga0501313_005114 | 3300049529 | Bacteria | 1373 |
| 815 | Ga0501314_000050 | 3300049530 | Bacteria | 5184 |
| 816 | Ga0501315_001210 | 3300049531 | Bacteria | 2135 |
| 817 | Ga0501315_027922 | 3300049531 | Bacteria | 799 |
| 818 | Ga0501316_030814 | 3300049532 | Bacteria | 717 |
| 819 | Ga0501317_002747 | 3300049533 | Bacteria | 1692 |
| 820 | Ga0501318_012445 | 3300049534 | Bacteria | 975 |
| 821 | Ga0501321_027411 | 3300049537 | Bacteria | 744 |
| 822 | Ga0501325_017376 | 3300049541 | Bacteria | 728 |
| 823 | Ga0501033_0040060 | 3300049570 | Bacteria | 3498 |
| 824 | Ga0501033_0932162 | 3300049570 | Bacteria | 583 |
| 825 | Ga0501034_0126349 | 3300049571 | Bacteria | 2542 |
| 826 | Ga0501034_0252901 | 3300049571 | Bacteria | 1706 |
| 827 | Ga0501036_0058733 | 3300049572 | Bacteria | 3259 |
| 828 | Ga0501036_0310142 | 3300049572 | Bacteria | 1319 |
| 829 | Ga0501036_0956207 | 3300049572 | Bacteria | 702 |
| 830 | Ga0501037_0033043 | 3300049573 | Bacteria | 3822 |
| 831 | Ga0501037_0474293 | 3300049573 | Bacteria | 851 |
| 832 | Ga0501038_0030062 | 3300049574 | Bacteria | 4810 |
| 833 | Ga0501039_0129507 | 3300049575 | Bacteria | 1980 |
| 834 | Ga0501039_0138074 | 3300049575 | Bacteria | 1915 |
| 835 | Ga0501039_0558671 | 3300049575 | Bacteria | 898 |
| 836 | Ga0501041_0461416 | 3300049577 | Bacteria | 807 |
| 837 | Ga0501042_0759586 | 3300049578 | Bacteria | 705 |
| 838 | Ga0501043_0007959 | 3300049579 | Bacteria | 8372 |
| 839 | Ga0501043_0445092 | 3300049579 | Bacteria | 974 |
| 840 | Ga0501046_0195899 | 3300049580 | Bacteria | 1505 |
| 841 | Ga0501046_0299501 | 3300049580 | Bacteria | 1175 |
| 842 | Ga0501047_0034967 | 3300049581 | Bacteria | 4852 |
| 843 | Ga0501047_0694399 | 3300049581 | Bacteria | 835 |
| 844 | Ga0501048_0282626 | 3300049582 | Bacteria | 1180 |
| 845 | Ga0501048_1094189 | 3300049582 | Bacteria | 573 |
| 846 | Ga0501068_0126379 | 3300049584 | Bacteria | 1597 |
| 847 | Ga0501069_0278331 | 3300049585 | Bacteria | 979 |
| 848 | Ga0501070_0712859 | 3300049586 | Bacteria | 793 |
| 849 | Ga0501071_0119317 | 3300049587 | Bacteria | 1954 |
| 850 | Ga0501071_0233595 | 3300049587 | Bacteria | 1386 |
| 851 | Ga0501071_1007948 | 3300049587 | Bacteria | 643 |
| 852 | Ga0501072_0275302 | 3300049588 | Bacteria | 1339 |
| 853 | Ga0501073_0009894 | 3300049589 | Bacteria | 7018 |
| 854 | Ga0501073_0238113 | 3300049589 | Bacteria | 1257 |
| 855 | Ga0501074_0016929 | 3300049590 | Bacteria | 5289 |
| 856 | Ga0501074_0470645 | 3300049590 | Bacteria | 891 |
| 857 | Ga0501075_0712888 | 3300049591 | Bacteria | 764 |
| 858 | Ga0501075_1055326 | 3300049591 | Bacteria | 617 |
| 859 | Ga0501076_0361483 | 3300049592 | Bacteria | 1192 |
| 860 | Ga0501076_0620888 | 3300049592 | Bacteria | 892 |
| 861 | Ga0501077_0325612 | 3300049593 | Bacteria | 980 |
| 862 | Ga0501077_1040063 | 3300049593 | Bacteria | 527 |
| 863 | Ga0501198_128946 | 3300049649 | Bacteria | 540 |
| 864 | Ga0501206_014163 | 3300049653 | Bacteria | 1094 |
| 865 | Ga0501210_001725 | 3300049657 | Bacteria | 1287 |
| 866 | Ga0501211_004106 | 3300049658 | Bacteria | 1490 |
| 867 | Ga0501216_109924 | 3300049660 | Bacteria | 618 |
| 868 | Ga0501222_020639 | 3300049662 | Bacteria | 881 |
| 869 | Ga0501223_024425 | 3300049663 | Bacteria | 1176 |
| 870 | Ga0501223_046172 | 3300049663 | Bacteria | 845 |
| 871 | Ga0501223_135690 | 3300049663 | Bacteria | 527 |
| 872 | Ga0501227_004174 | 3300049665 | Bacteria | 3107 |
| 873 | Ga0501233_003475 | 3300049668 | Bacteria | 2834 |
| 874 | Ga0501235_003946 | 3300049669 | Bacteria | 3210 |
| 875 | Ga0501239_039619 | 3300049672 | Bacteria | 648 |
| 876 | Ga0501243_109855 | 3300049675 | Bacteria | 564 |
| 877 | Ga0501243_137035 | 3300049675 | Bacteria | 515 |
| 878 | Ga0501249_008085 | 3300049679 | Bacteria | 2182 |
| 879 | Ga0501253_063853 | 3300049683 | Bacteria | 799 |
| 880 | Ga0501255_016054 | 3300049684 | Bacteria | 921 |
| 881 | Ga0501258_002063 | 3300049687 | Bacteria | 1728 |
| 882 | Ga0501221_003510 | 3300049704 | Bacteria | 2582 |
| 883 | Ga0501225_0003592 | 3300049705 | Bacteria | 4676 |
| 884 | Ga0501229_038397 | 3300049706 | Bacteria | 676 |
| 885 | Ga0501234_077211 | 3300049707 | Bacteria | 583 |
| 886 | Ga0501079_0264274 | 3300049741 | Bacteria | 1345 |
| 887 | Ga0501079_1522117 | 3300049741 | Bacteria | 526 |
| 888 | Ga0501080_0008652 | 3300049742 | Bacteria | 9241 |
| 889 | Ga0501080_0057515 | 3300049742 | Bacteria | 3620 |
| 890 | Ga0501081_0119454 | 3300049743 | Bacteria | 1876 |
| 891 | Ga0501083_0035946 | 3300049744 | Bacteria | 3382 |
| 892 | Ga0501262_004570 | 3300049759 | Bacteria | 1609 |
| 893 | Ga0501267_000175 | 3300049764 | Bacteria | 4374 |
| 894 | Ga0501271_006347 | 3300049768 | Bacteria | 1172 |
| 895 | Ga0501272_032672 | 3300049769 | Bacteria | 667 |
| 896 | Ga0501275_076951 | 3300049772 | Bacteria | 535 |
| 897 | Ga0501283_048226 | 3300049779 | Bacteria | 750 |
| 898 | Ga0501035_0268059 | 3300049822 | Bacteria | 1446 |
| 899 | Ga0501035_0674645 | 3300049822 | Bacteria | 836 |
| 900 | Ga0501044_0015304 | 3300049823 | Bacteria | 8262 |
| 901 | Ga0501044_0525921 | 3300049823 | Bacteria | 1082 |
| 902 | nmdc:mga03683_622358_c1 | 3300050489 | Bacteria | 530 |
| 903 | nmdc:mga0k408_25245_c2 | 3300050493 | Bacteria | 2413 |
| 904 | nmdc:mga07m45_7457_c1 | 3300050496 | Bacteria | 5592 |
| 905 | nmdc:mga09592_852973_c1 | 3300050508 | Bacteria | 768 |
| 906 | nmdc:mga0qj67_60894_c1 | 3300050509 | Bacteria | 2996 |
| 907 | nmdc:mga0qj67_638307_c1 | 3300050509 | Bacteria | 850 |
| 908 | nmdc:mga0qj67_643432_c1 | 3300050509 | Bacteria | 846 |
| 909 | nmdc:mga06r32_441888_c1 | 3300050510 | Bacteria | 1281 |
| 910 | nmdc:mga06r32_687524_c1 | 3300050510 | Bacteria | 989 |
| 911 | nmdc:mga08y16_107923_c1 | 3300050511 | Bacteria | 2898 |
| 912 | nmdc:mga0n895_2003095_c1 | 3300050512 | Bacteria | 537 |
| 913 | nmdc:mga0n895_766365_c1 | 3300050512 | Bacteria | 957 |
| 914 | nmdc:mga0rr50_1745688_c1 | 3300050513 | Bacteria | 524 |
| 915 | nmdc:mga0rr50_385862_c1 | 3300050513 | Bacteria | 1182 |
| 916 | nmdc:mga08x19_192665_c1 | 3300050514 | Bacteria | 1395 |
| 917 | nmdc:mga08x19_312301_c1 | 3300050514 | Bacteria | 1093 |
| 918 | nmdc:mga0a205_238225_c1 | 3300050515 | Bacteria | 1701 |
| 919 | Ga0495601_0002235 | 3300053077 | Bacteria | 10903 |
| 920 | Ga0495601_0590726 | 3300053077 | Bacteria | 713 |
| 921 | Ga0495612_0000577 | 3300053078 | Bacteria | 14757 |
| 922 | Ga0495612_0478171 | 3300053078 | Bacteria | 570 |
| 923 | Ga0495655_0297108 | 3300053083 | Bacteria | 554 |
| 924 | Ga0495595_0011132 | 3300053084 | Bacteria | 3756 |
| 925 | Ga0495619_0006426 | 3300053085 | Bacteria | 7446 |
| 926 | Ga0500651_0700854 | 3300053093 | Bacteria | 541 |
| 927 | Ga0500608_199548 | 3300053122 | Bacteria | 828 |
| 928 | Ga0500568_0168736 | 3300053139 | Bacteria | 806 |
| 929 | Ga0500604_0064906 | 3300053151 | Bacteria | 1154 |
| 930 | Ga0500627_0292841 | 3300053158 | Bacteria | 712 |
| 931 | Ga0500633_0277547 | 3300053160 | Bacteria | 620 |
| 932 | Ga0500636_0105745 | 3300053177 | Bacteria | 1595 |
| 933 | Ga0500636_0495408 | 3300053177 | Bacteria | 541 |
| 934 | Ga0501084_0547311 | 3300054114 | Bacteria | 978 |
| 935 | Ga0590071_032829 | 3300059421 | Bacteria | 1240 |
| 936 | Ga0590074_029865 | 3300059423 | Bacteria | 961 |
| 937 | Ga0590075_170084 | 3300059424 | Bacteria | 576 |
| 938 | Ga0587076_016241 | 3300059645 | Bacteria | 1172 |
| 939 | Ga0501082_0653376 | 3300060353 | Bacteria | 920 |
| 940 | Ga0501082_0717548 | 3300060353 | Bacteria | 875 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005842 | Ga0068858_100020744 | Ga0068858_1000207443 | 86 |
| 2 | 3300013104 | Ga0157370_10315306 | Ga0157370_103153061 | 88 |
| 3 | 3300013307 | Ga0157372_10079293 | Ga0157372_100792932 | 88 |
| 4 | 3300025917 | Ga0207660_10473100 | Ga0207660_104731002 | 88 |
| 5 | 3300005444 | Ga0070694_100050054 | Ga0070694_1000500545 | 89 |
| 6 | 3300045051 | Ga0451576_2252183 | Ga0451576_2252183_110_406 | 89 |
| 7 | 3300005563 | Ga0068855_100068633 | Ga0068855_1000686333 | 90 |
| 8 | 3300005614 | Ga0068856_100358922 | Ga0068856_1003589222 | 90 |
| 9 | 3300005617 | Ga0068859_100531651 | Ga0068859_1005316512 | 90 |
| 10 | 3300006931 | Ga0097620_100531639 | Ga0097620_1005316392 | 90 |
| 11 | 3300009093 | Ga0105240_10880214 | Ga0105240_108802142 | 90 |
| 12 | 3300009551 | Ga0105238_10657967 | Ga0105238_106579672 | 90 |
| 13 | 3300010375 | Ga0105239_12174877 | Ga0105239_121748772 | 90 |
| 14 | 3300025949 | Ga0207667_10054147 | Ga0207667_100541474 | 90 |
| 15 | 3300026078 | Ga0207702_10297815 | Ga0207702_102978153 | 90 |
| 16 | 3300049580 | Ga0501046_0299501 | Ga0501046_0299501_878_1159 | 91 |
| 17 | 3300009094 | Ga0111539_10196609 | Ga0111539_101966093 | 92 |
| 18 | 3300025893 | Ga0207682_10383952 | Ga0207682_103839521 | 93 |
| 19 | iso_pu_bacteria | 2593339238 | 2595446621 | 95 |
| 20 | iso_pu_bacteria | 2593339239 | 2595451887 | 95 |
| 21 | iso_pu_bacteria | 2718218334 | 2721026753 | 95 |
| 22 | iso_pu_bacteria | 2734482264 | 2735837693 | 95 |
| 23 | iso_pu_bacteria | 2738543009 | 2739228298 | 95 |
| 24 | iso_pu_bacteria | 2842914999 | 2842918033 | 95 |
| 25 | iso_pu_bacteria | 2842918807 | 2842919508 | 95 |
| 26 | iso_pu_bacteria | 2919085039 | 2919087717 | 95 |
| 27 | iso_pu_bacteria | 2919404418 | 2919404961 | 95 |
| 28 | iso_pu_bacteria | 2953994433 | 2953998027 | 95 |
| 29 | 3300009148 | Ga0105243_11778904 | Ga0105243_117789042 | 96 |
| 30 | 3300009545 | Ga0105237_12592574 | Ga0105237_125925742 | 96 |
| 31 | 3300014969 | Ga0157376_11997844 | Ga0157376_119978442 | 96 |
| 32 | 3300035092 | Ga0373952_0161086 | Ga0373952_0161086_185_484 | 96 |
| 33 | 3300046462 | Ga0495651_0647505 | Ga0495651_0647505_11_307 | 96 |
| 34 | iso_pu_bacteria | 2511231026 | 2511385534 | 96 |
| 35 | iso_pu_bacteria | 2521172590 | 2521557732 | 96 |
| 36 | iso_pu_bacteria | 2551306416 | 2553002847 | 96 |
| 37 | iso_pu_bacteria | 2765235838 | 2765570096 | 96 |
| 38 | iso_pu_bacteria | 2818991449 | 2819615135 | 96 |
| 39 | iso_pu_bacteria | 2839094727 | 2839096964 | 96 |
| 40 | iso_pu_bacteria | 2904439833 | 2904441528 | 96 |
| 41 | iso_pu_bacteria | 2904530477 | 2904531542 | 96 |
| 42 | iso_pu_bacteria | 2904584206 | 2904586821 | 96 |
| 43 | iso_pu_bacteria | 2904589729 | 2904593146 | 96 |
| 44 | iso_pu_bacteria | 2904601388 | 2904603008 | 96 |
| 45 | iso_pu_bacteria | 2919046199 | 2919050833 | 96 |
| 46 | iso_pu_bacteria | 2919079590 | 2919083971 | 96 |
| 47 | iso_pu_bacteria | 2923510766 | 2923510937 | 96 |
| 48 | iso_pu_bacteria | 2928130867 | 2928130909 | 96 |
| 49 | 3300000549 | LJQas_1020049 | LJQas_10200492 | 97 |
| 50 | 3300002075 | JGI24738J21930_10006379 | JGI24738J21930_100063792 | 97 |
| 51 | 3300002773 | JGI25152J39213_1025333 | JGI25152J39213_10253332 | 97 |
| 52 | 3300003203 | JGI25406J46586_10017790 | JGI25406J46586_100177902 | 97 |
| 53 | 3300003215 | JGI25153J46596_10055107 | JGI25153J46596_100551072 | 97 |
| 54 | 3300003567 | Ga0006554J51385_1033774 | Ga0006554J51385_10337744 | 97 |
| 55 | 3300003578 | Ga0006562J51391_1061648 | Ga0006562J51391_10616482 | 97 |
| 56 | 3300003751 | Ga0055538_1000155 | Ga0055538_100015542 | 97 |
| 57 | 3300003752 | Ga0055539_1000205 | Ga0055539_100020542 | 97 |
| 58 | 3300003756 | Ga0055533_1000100 | Ga0055533_100010060 | 97 |
| 59 | 3300003756 | Ga0055533_1000207 | Ga0055533_100020742 | 97 |
| 60 | 3300003759 | Ga0055525_1000284 | Ga0055525_100028442 | 97 |
| 61 | 3300003759 | Ga0055525_1000947 | Ga0055525_10009474 | 97 |
| 62 | 3300003791 | Ga0055530_10014353 | Ga0055530_100143531 | 97 |
| 63 | 3300003794 | Ga0055531_10000310 | Ga0055531_100003108 | 97 |
| 64 | 3300003841 | Ga0055541_1000133 | Ga0055541_10001337 | 97 |
| 65 | 3300004625 | Ga0055543_1030932 | Ga0055543_10309322 | 97 |
| 66 | 3300005262 | Ga0065165_1000028 | Ga0065165_10000285 | 97 |
| 67 | 3300005290 | Ga0065712_10391693 | Ga0065712_103916931 | 97 |
| 68 | 3300005327 | Ga0070658_10003448 | Ga0070658_100034487 | 97 |
| 69 | 3300005327 | Ga0070658_10011571 | Ga0070658_100115716 | 97 |
| 70 | 3300005327 | Ga0070658_10238554 | Ga0070658_102385542 | 97 |
| 71 | 3300005327 | Ga0070658_10339180 | Ga0070658_103391802 | 97 |
| 72 | 3300005327 | Ga0070658_10368122 | Ga0070658_103681222 | 97 |
| 73 | 3300005327 | Ga0070658_10564196 | Ga0070658_105641962 | 97 |
| 74 | 3300005327 | Ga0070658_10691620 | Ga0070658_106916202 | 97 |
| 75 | 3300005327 | Ga0070658_11388562 | Ga0070658_113885621 | 97 |
| 76 | 3300005328 | Ga0070676_10045115 | Ga0070676_100451152 | 97 |
| 77 | 3300005328 | Ga0070676_10126377 | Ga0070676_101263772 | 97 |
| 78 | 3300005328 | Ga0070676_10327830 | Ga0070676_103278301 | 97 |
| 79 | 3300005329 | Ga0070683_100026589 | Ga0070683_1000265895 | 97 |
| 80 | 3300005329 | Ga0070683_100042213 | Ga0070683_1000422132 | 97 |
| 81 | 3300005329 | Ga0070683_100053034 | Ga0070683_1000530344 | 97 |
| 82 | 3300005329 | Ga0070683_100244034 | Ga0070683_1002440342 | 97 |
| 83 | 3300005329 | Ga0070683_100361467 | Ga0070683_1003614672 | 97 |
| 84 | 3300005329 | Ga0070683_100583988 | Ga0070683_1005839882 | 97 |
| 85 | 3300005329 | Ga0070683_101823334 | Ga0070683_1018233342 | 97 |
| 86 | 3300005329 | Ga0070683_102390580 | Ga0070683_1023905801 | 97 |
| 87 | 3300005330 | Ga0070690_100117944 | Ga0070690_1001179441 | 97 |
| 88 | 3300005330 | Ga0070690_100254849 | Ga0070690_1002548492 | 97 |
| 89 | 3300005331 | Ga0070670_100194310 | Ga0070670_1001943102 | 97 |
| 90 | 3300005331 | Ga0070670_100559842 | Ga0070670_1005598422 | 97 |
| 91 | 3300005331 | Ga0070670_100814984 | Ga0070670_1008149842 | 97 |
| 92 | 3300005331 | Ga0070670_101004883 | Ga0070670_1010048832 | 97 |
| 93 | 3300005331 | Ga0070670_101581087 | Ga0070670_1015810872 | 97 |
| 94 | 3300005334 | Ga0068869_100052726 | Ga0068869_1000527264 | 97 |
| 95 | 3300005335 | Ga0070666_10669473 | Ga0070666_106694732 | 97 |
| 96 | 3300005336 | Ga0070680_100001111 | Ga0070680_10000111115 | 97 |
| 97 | 3300005336 | Ga0070680_100048545 | Ga0070680_1000485455 | 97 |
| 98 | 3300005336 | Ga0070680_101719489 | Ga0070680_1017194891 | 97 |
| 99 | 3300005336 | Ga0070680_101944804 | Ga0070680_1019448042 | 97 |
| 100 | 3300005338 | Ga0068868_101508223 | Ga0068868_1015082232 | 97 |
| 101 | 3300005338 | Ga0068868_101613833 | Ga0068868_1016138332 | 97 |
| 102 | 3300005339 | Ga0070660_100541286 | Ga0070660_1005412862 | 97 |
| 103 | 3300005339 | Ga0070660_101180715 | Ga0070660_1011807151 | 97 |
| 104 | 3300005340 | Ga0070689_100040508 | Ga0070689_1000405082 | 97 |
| 105 | 3300005340 | Ga0070689_101276798 | Ga0070689_1012767981 | 97 |
| 106 | 3300005340 | Ga0070689_101992526 | Ga0070689_1019925262 | 97 |
| 107 | 3300005344 | Ga0070661_100164706 | Ga0070661_1001647062 | 97 |
| 108 | 3300005344 | Ga0070661_100167277 | Ga0070661_1001672773 | 97 |
| 109 | 3300005344 | Ga0070661_100275338 | Ga0070661_1002753382 | 97 |
| 110 | 3300005344 | Ga0070661_100303941 | Ga0070661_1003039412 | 97 |
| 111 | 3300005344 | Ga0070661_101198879 | Ga0070661_1011988791 | 97 |
| 112 | 3300005344 | Ga0070661_101247530 | Ga0070661_1012475301 | 97 |
| 113 | 3300005344 | Ga0070661_101903415 | Ga0070661_1019034152 | 97 |
| 114 | 3300005345 | Ga0070692_10054841 | Ga0070692_100548414 | 97 |
| 115 | 3300005347 | Ga0070668_100116431 | Ga0070668_1001164312 | 97 |
| 116 | 3300005347 | Ga0070668_100813502 | Ga0070668_1008135022 | 97 |
| 117 | 3300005347 | Ga0070668_100946918 | Ga0070668_1009469182 | 97 |
| 118 | 3300005353 | Ga0070669_100095390 | Ga0070669_1000953901 | 97 |
| 119 | 3300005354 | Ga0070675_100004759 | Ga0070675_1000047595 | 97 |
| 120 | 3300005354 | Ga0070675_100230725 | Ga0070675_1002307252 | 97 |
| 121 | 3300005354 | Ga0070675_100245717 | Ga0070675_1002457172 | 97 |
| 122 | 3300005354 | Ga0070675_100309384 | Ga0070675_1003093842 | 97 |
| 123 | 3300005354 | Ga0070675_101587900 | Ga0070675_1015879001 | 97 |
| 124 | 3300005354 | Ga0070675_101730905 | Ga0070675_1017309051 | 97 |
| 125 | 3300005355 | Ga0070671_100175628 | Ga0070671_1001756282 | 97 |
| 126 | 3300005355 | Ga0070671_100407398 | Ga0070671_1004073982 | 97 |
| 127 | 3300005355 | Ga0070671_100516138 | Ga0070671_1005161382 | 97 |
| 128 | 3300005355 | Ga0070671_100525976 | Ga0070671_1005259762 | 97 |
| 129 | 3300005355 | Ga0070671_100945627 | Ga0070671_1009456272 | 97 |
| 130 | 3300005356 | Ga0070674_100401045 | Ga0070674_1004010453 | 97 |
| 131 | 3300005364 | Ga0070673_100391182 | Ga0070673_1003911822 | 97 |
| 132 | 3300005364 | Ga0070673_100663455 | Ga0070673_1006634551 | 97 |
| 133 | 3300005364 | Ga0070673_100770639 | Ga0070673_1007706392 | 97 |
| 134 | 3300005364 | Ga0070673_102002971 | Ga0070673_1020029711 | 97 |
| 135 | 3300005365 | Ga0070688_100018584 | Ga0070688_1000185842 | 97 |
| 136 | 3300005366 | Ga0070659_100048436 | Ga0070659_1000484362 | 97 |
| 137 | 3300005366 | Ga0070659_100184565 | Ga0070659_1001845651 | 97 |
| 138 | 3300005366 | Ga0070659_100297699 | Ga0070659_1002976992 | 97 |
| 139 | 3300005366 | Ga0070659_100308167 | Ga0070659_1003081672 | 97 |
| 140 | 3300005366 | Ga0070659_100920587 | Ga0070659_1009205871 | 97 |
| 141 | 3300005367 | Ga0070667_100137301 | Ga0070667_1001373012 | 97 |
| 142 | 3300005367 | Ga0070667_100654787 | Ga0070667_1006547872 | 97 |
| 143 | 3300005434 | Ga0070709_10009593 | Ga0070709_100095934 | 97 |
| 144 | 3300005434 | Ga0070709_10036089 | Ga0070709_100360892 | 97 |
| 145 | 3300005434 | Ga0070709_10056629 | Ga0070709_100566294 | 97 |
| 146 | 3300005434 | Ga0070709_11591162 | Ga0070709_115911621 | 97 |
| 147 | 3300005435 | Ga0070714_100004697 | Ga0070714_1000046972 | 97 |
| 148 | 3300005435 | Ga0070714_100029810 | Ga0070714_1000298103 | 97 |
| 149 | 3300005435 | Ga0070714_100392216 | Ga0070714_1003922161 | 97 |
| 150 | 3300005435 | Ga0070714_101598920 | Ga0070714_1015989201 | 97 |
| 151 | 3300005436 | Ga0070713_100000168 | Ga0070713_10000016820 | 97 |
| 152 | 3300005436 | Ga0070713_100051526 | Ga0070713_1000515262 | 97 |
| 153 | 3300005436 | Ga0070713_102055622 | Ga0070713_1020556222 | 97 |
| 154 | 3300005437 | Ga0070710_10106524 | Ga0070710_101065242 | 97 |
| 155 | 3300005437 | Ga0070710_10175492 | Ga0070710_101754922 | 97 |
| 156 | 3300005439 | Ga0070711_100115217 | Ga0070711_1001152174 | 97 |
| 157 | 3300005439 | Ga0070711_100884414 | Ga0070711_1008844142 | 97 |
| 158 | 3300005441 | Ga0070700_100719378 | Ga0070700_1007193782 | 97 |
| 159 | 3300005444 | Ga0070694_100092890 | Ga0070694_1000928903 | 97 |
| 160 | 3300005455 | Ga0070663_100032502 | Ga0070663_1000325022 | 97 |
| 161 | 3300005455 | Ga0070663_100114062 | Ga0070663_1001140622 | 97 |
| 162 | 3300005456 | Ga0070678_100090584 | Ga0070678_1000905842 | 97 |
| 163 | 3300005456 | Ga0070678_101610695 | Ga0070678_1016106952 | 97 |
| 164 | 3300005456 | Ga0070678_101705827 | Ga0070678_1017058271 | 97 |
| 165 | 3300005457 | Ga0070662_100146176 | Ga0070662_1001461762 | 97 |
| 166 | 3300005457 | Ga0070662_100269442 | Ga0070662_1002694422 | 97 |
| 167 | 3300005457 | Ga0070662_100840166 | Ga0070662_1008401662 | 97 |
| 168 | 3300005457 | Ga0070662_101342267 | Ga0070662_1013422672 | 97 |
| 169 | 3300005458 | Ga0070681_10023492 | Ga0070681_100234924 | 97 |
| 170 | 3300005458 | Ga0070681_10077854 | Ga0070681_100778543 | 97 |
| 171 | 3300005458 | Ga0070681_10324270 | Ga0070681_103242702 | 97 |
| 172 | 3300005458 | Ga0070681_10401530 | Ga0070681_104015302 | 97 |
| 173 | 3300005458 | Ga0070681_10791978 | Ga0070681_107919782 | 97 |
| 174 | 3300005459 | Ga0068867_100010986 | Ga0068867_1000109865 | 97 |
| 175 | 3300005466 | Ga0070685_10087289 | Ga0070685_100872892 | 97 |
| 176 | 3300005466 | Ga0070685_10093785 | Ga0070685_100937853 | 97 |
| 177 | 3300005467 | Ga0070706_100454631 | Ga0070706_1004546311 | 97 |
| 178 | 3300005518 | Ga0070699_100230574 | Ga0070699_1002305742 | 97 |
| 179 | 3300005530 | Ga0070679_100032089 | Ga0070679_1000320895 | 97 |
| 180 | 3300005530 | Ga0070679_100888116 | Ga0070679_1008881162 | 97 |
| 181 | 3300005530 | Ga0070679_101108943 | Ga0070679_1011089431 | 97 |
| 182 | 3300005530 | Ga0070679_101290837 | Ga0070679_1012908371 | 97 |
| 183 | 3300005535 | Ga0070684_100017327 | Ga0070684_1000173274 | 97 |
| 184 | 3300005535 | Ga0070684_100027011 | Ga0070684_1000270112 | 97 |
| 185 | 3300005535 | Ga0070684_100063417 | Ga0070684_1000634173 | 97 |
| 186 | 3300005535 | Ga0070684_100310942 | Ga0070684_1003109422 | 97 |
| 187 | 3300005535 | Ga0070684_100562247 | Ga0070684_1005622472 | 97 |
| 188 | 3300005535 | Ga0070684_100920190 | Ga0070684_1009201902 | 97 |
| 189 | 3300005539 | Ga0068853_100576328 | Ga0068853_1005763282 | 97 |
| 190 | 3300005539 | Ga0068853_101749056 | Ga0068853_1017490561 | 97 |
| 191 | 3300005543 | Ga0070672_100114001 | Ga0070672_1001140011 | 97 |
| 192 | 3300005543 | Ga0070672_100166475 | Ga0070672_1001664752 | 97 |
| 193 | 3300005543 | Ga0070672_100265732 | Ga0070672_1002657322 | 97 |
| 194 | 3300005543 | Ga0070672_100300661 | Ga0070672_1003006612 | 97 |
| 195 | 3300005543 | Ga0070672_100567463 | Ga0070672_1005674632 | 97 |
| 196 | 3300005543 | Ga0070672_101092428 | Ga0070672_1010924282 | 97 |
| 197 | 3300005543 | Ga0070672_101306804 | Ga0070672_1013068041 | 97 |
| 198 | 3300005544 | Ga0070686_100639050 | Ga0070686_1006390502 | 97 |
| 199 | 3300005544 | Ga0070686_100971405 | Ga0070686_1009714052 | 97 |
| 200 | 3300005545 | Ga0070695_100318783 | Ga0070695_1003187832 | 97 |
| 201 | 3300005545 | Ga0070695_100327524 | Ga0070695_1003275242 | 97 |
| 202 | 3300005545 | Ga0070695_100520785 | Ga0070695_1005207852 | 97 |
| 203 | 3300005545 | Ga0070695_101534646 | Ga0070695_1015346462 | 97 |
| 204 | 3300005545 | Ga0070695_101637135 | Ga0070695_1016371351 | 97 |
| 205 | 3300005546 | Ga0070696_100113732 | Ga0070696_1001137322 | 97 |
| 206 | 3300005546 | Ga0070696_100122741 | Ga0070696_1001227412 | 97 |
| 207 | 3300005547 | Ga0070693_100012610 | Ga0070693_1000126103 | 97 |
| 208 | 3300005547 | Ga0070693_100797629 | Ga0070693_1007976292 | 97 |
| 209 | 3300005549 | Ga0070704_100003924 | Ga0070704_1000039244 | 97 |
| 210 | 3300005549 | Ga0070704_101408657 | Ga0070704_1014086571 | 97 |
| 211 | 3300005563 | Ga0068855_100004465 | Ga0068855_10000446513 | 97 |
| 212 | 3300005563 | Ga0068855_100334991 | Ga0068855_1003349911 | 97 |
| 213 | 3300005564 | Ga0070664_100046540 | Ga0070664_1000465403 | 97 |
| 214 | 3300005564 | Ga0070664_100071150 | Ga0070664_1000711502 | 97 |
| 215 | 3300005564 | Ga0070664_100377929 | Ga0070664_1003779292 | 97 |
| 216 | 3300005564 | Ga0070664_100402657 | Ga0070664_1004026573 | 97 |
| 217 | 3300005564 | Ga0070664_100428124 | Ga0070664_1004281242 | 97 |
| 218 | 3300005564 | Ga0070664_100492270 | Ga0070664_1004922702 | 97 |
| 219 | 3300005564 | Ga0070664_101350123 | Ga0070664_1013501231 | 97 |
| 220 | 3300005564 | Ga0070664_101799579 | Ga0070664_1017995792 | 97 |
| 221 | 3300005577 | Ga0068857_100036956 | Ga0068857_1000369562 | 97 |
| 222 | 3300005577 | Ga0068857_100091619 | Ga0068857_1000916194 | 97 |
| 223 | 3300005577 | Ga0068857_100672225 | Ga0068857_1006722252 | 97 |
| 224 | 3300005578 | Ga0068854_100029527 | Ga0068854_1000295272 | 97 |
| 225 | 3300005578 | Ga0068854_100395260 | Ga0068854_1003952602 | 97 |
| 226 | 3300005614 | Ga0068856_100348838 | Ga0068856_1003488382 | 97 |
| 227 | 3300005614 | Ga0068856_100398126 | Ga0068856_1003981262 | 97 |
| 228 | 3300005615 | Ga0070702_100973644 | Ga0070702_1009736442 | 97 |
| 229 | 3300005616 | Ga0068852_100228011 | Ga0068852_1002280112 | 97 |
| 230 | 3300005616 | Ga0068852_100249695 | Ga0068852_1002496953 | 97 |
| 231 | 3300005616 | Ga0068852_100345930 | Ga0068852_1003459303 | 97 |
| 232 | 3300005616 | Ga0068852_100803720 | Ga0068852_1008037202 | 97 |
| 233 | 3300005617 | Ga0068859_100020486 | Ga0068859_1000204862 | 97 |
| 234 | 3300005617 | Ga0068859_102185738 | Ga0068859_1021857382 | 97 |
| 235 | 3300005618 | Ga0068864_100048790 | Ga0068864_1000487904 | 97 |
| 236 | 3300005718 | Ga0068866_11271712 | Ga0068866_112717122 | 97 |
| 237 | 3300005719 | Ga0068861_100248109 | Ga0068861_1002481092 | 97 |
| 238 | 3300005719 | Ga0068861_100265826 | Ga0068861_1002658263 | 97 |
| 239 | 3300005719 | Ga0068861_101091389 | Ga0068861_1010913892 | 97 |
| 240 | 3300005834 | Ga0068851_10233002 | Ga0068851_102330022 | 97 |
| 241 | 3300005834 | Ga0068851_10310274 | Ga0068851_103102742 | 97 |
| 242 | 3300005840 | Ga0068870_10001350 | Ga0068870_100013504 | 97 |
| 243 | 3300005841 | Ga0068863_100345344 | Ga0068863_1003453442 | 97 |
| 244 | 3300005841 | Ga0068863_101500322 | Ga0068863_1015003222 | 97 |
| 245 | 3300005842 | Ga0068858_100086515 | Ga0068858_1000865152 | 97 |
| 246 | 3300005842 | Ga0068858_102211906 | Ga0068858_1022119062 | 97 |
| 247 | 3300005843 | Ga0068860_100038331 | Ga0068860_1000383315 | 97 |
| 248 | 3300005844 | Ga0068862_100088865 | Ga0068862_1000888652 | 97 |
| 249 | 3300005844 | Ga0068862_100607312 | Ga0068862_1006073122 | 97 |
| 250 | 3300005985 | Ga0081539_10000103 | Ga0081539_10000103109 | 97 |
| 251 | 3300006028 | Ga0070717_10058340 | Ga0070717_100583402 | 97 |
| 252 | 3300006028 | Ga0070717_10471490 | Ga0070717_104714903 | 97 |
| 253 | 3300006028 | Ga0070717_10724409 | Ga0070717_107244092 | 97 |
| 254 | 3300006175 | Ga0070712_100003656 | Ga0070712_10000365611 | 97 |
| 255 | 3300006175 | Ga0070712_100211655 | Ga0070712_1002116552 | 97 |
| 256 | 3300006175 | Ga0070712_100257583 | Ga0070712_1002575833 | 97 |
| 257 | 3300006186 | Ga0075369_10019451 | Ga0075369_100194512 | 97 |
| 258 | 3300006195 | Ga0075366_10027909 | Ga0075366_100279095 | 97 |
| 259 | 3300006353 | Ga0075370_10050067 | Ga0075370_100500674 | 97 |
| 260 | 3300006358 | Ga0068871_100288671 | Ga0068871_1002886712 | 97 |
| 261 | 3300006846 | Ga0075430_100191765 | Ga0075430_1001917652 | 97 |
| 262 | 3300006846 | Ga0075430_100655505 | Ga0075430_1006555052 | 97 |
| 263 | 3300006846 | Ga0075430_101006359 | Ga0075430_1010063592 | 97 |
| 264 | 3300006847 | Ga0075431_100075350 | Ga0075431_1000753503 | 97 |
| 265 | 3300006847 | Ga0075431_100204773 | Ga0075431_1002047733 | 97 |
| 266 | 3300006847 | Ga0075431_101245805 | Ga0075431_1012458052 | 97 |
| 267 | 3300006852 | Ga0075433_10339054 | Ga0075433_103390543 | 97 |
| 268 | 3300006880 | Ga0075429_101055457 | Ga0075429_1010554572 | 97 |
| 269 | 3300006880 | Ga0075429_101408755 | Ga0075429_1014087552 | 97 |
| 270 | 3300006881 | Ga0068865_100236802 | Ga0068865_1002368023 | 97 |
| 271 | 3300006914 | Ga0075436_100100836 | Ga0075436_1001008363 | 97 |
| 272 | 3300006914 | Ga0075436_100560910 | Ga0075436_1005609102 | 97 |
| 273 | 3300006931 | Ga0097620_100020486 | Ga0097620_1000204862 | 97 |
| 274 | 3300006931 | Ga0097620_102185929 | Ga0097620_1021859292 | 97 |
| 275 | 3300006946 | Ga0079104_1016283 | Ga0079104_10162832 | 97 |
| 276 | 3300007076 | Ga0075435_100004837 | Ga0075435_1000048372 | 97 |
| 277 | 3300007076 | Ga0075435_100483296 | Ga0075435_1004832961 | 97 |
| 278 | 3300007265 | Ga0099794_10023946 | Ga0099794_100239462 | 97 |
| 279 | 3300007788 | Ga0099795_10003070 | Ga0099795_100030704 | 97 |
| 280 | 3300007788 | Ga0099795_10280020 | Ga0099795_102800201 | 97 |
| 281 | 3300009011 | Ga0105251_10350811 | Ga0105251_103508112 | 97 |
| 282 | 3300009093 | Ga0105240_10013785 | Ga0105240_100137857 | 97 |
| 283 | 3300009093 | Ga0105240_10302459 | Ga0105240_103024592 | 97 |
| 284 | 3300009093 | Ga0105240_12381192 | Ga0105240_123811922 | 97 |
| 285 | 3300009094 | Ga0111539_10458223 | Ga0111539_104582232 | 97 |
| 286 | 3300009098 | Ga0105245_12011763 | Ga0105245_120117631 | 97 |
| 287 | 3300009101 | Ga0105247_11298443 | Ga0105247_112984432 | 97 |
| 288 | 3300009147 | Ga0114129_11524445 | Ga0114129_115244452 | 97 |
| 289 | 3300009147 | Ga0114129_12938087 | Ga0114129_129380872 | 97 |
| 290 | 3300009148 | Ga0105243_10046635 | Ga0105243_100466355 | 97 |
| 291 | 3300009176 | Ga0105242_12427266 | Ga0105242_124272662 | 97 |
| 292 | 3300009177 | Ga0105248_10187820 | Ga0105248_101878202 | 97 |
| 293 | 3300009177 | Ga0105248_11247886 | Ga0105248_112478862 | 97 |
| 294 | 3300009545 | Ga0105237_10039956 | Ga0105237_100399563 | 97 |
| 295 | 3300009551 | Ga0105238_10061680 | Ga0105238_100616803 | 97 |
| 296 | 3300009551 | Ga0105238_10434183 | Ga0105238_104341832 | 97 |
| 297 | 3300009551 | Ga0105238_10797331 | Ga0105238_107973312 | 97 |
| 298 | 3300009551 | Ga0105238_11095629 | Ga0105238_110956292 | 97 |
| 299 | 3300009553 | Ga0105249_10948572 | Ga0105249_109485722 | 97 |
| 300 | 3300009553 | Ga0105249_11055526 | Ga0105249_110555262 | 97 |
| 301 | 3300009553 | Ga0105249_13487615 | Ga0105249_134876151 | 97 |
| 302 | 3300010159 | Ga0099796_10458075 | Ga0099796_104580752 | 97 |
| 303 | 3300010375 | Ga0105239_10025227 | Ga0105239_100252272 | 97 |
| 304 | 3300010375 | Ga0105239_11405377 | Ga0105239_114053772 | 97 |
| 305 | 3300011119 | Ga0105246_10411305 | Ga0105246_104113052 | 97 |
| 306 | 3300011119 | Ga0105246_10852407 | Ga0105246_108524072 | 97 |
| 307 | 3300011119 | Ga0105246_11041459 | Ga0105246_110414592 | 97 |
| 308 | 3300012502 | Ga0157347_1020377 | Ga0157347_10203772 | 97 |
| 309 | 3300013100 | Ga0157373_10348239 | Ga0157373_103482392 | 97 |
| 310 | 3300013100 | Ga0157373_10572287 | Ga0157373_105722872 | 97 |
| 311 | 3300013102 | Ga0157371_10111548 | Ga0157371_101115482 | 97 |
| 312 | 3300013102 | Ga0157371_10385107 | Ga0157371_103851072 | 97 |
| 313 | 3300013102 | Ga0157371_11164409 | Ga0157371_111644092 | 97 |
| 314 | 3300013104 | Ga0157370_10027470 | Ga0157370_100274705 | 97 |
| 315 | 3300013104 | Ga0157370_10044296 | Ga0157370_100442963 | 97 |
| 316 | 3300013104 | Ga0157370_10286338 | Ga0157370_102863383 | 97 |
| 317 | 3300013104 | Ga0157370_11789799 | Ga0157370_117897992 | 97 |
| 318 | 3300013105 | Ga0157369_10155261 | Ga0157369_101552612 | 97 |
| 319 | 3300013105 | Ga0157369_10646827 | Ga0157369_106468273 | 97 |
| 320 | 3300013105 | Ga0157369_11329576 | Ga0157369_113295762 | 97 |
| 321 | 3300013105 | Ga0157369_12252195 | Ga0157369_122521952 | 97 |
| 322 | 3300013296 | Ga0157374_11279188 | Ga0157374_112791882 | 97 |
| 323 | 3300013296 | Ga0157374_12313574 | Ga0157374_123135742 | 97 |
| 324 | 3300013297 | Ga0157378_10506210 | Ga0157378_105062102 | 97 |
| 325 | 3300013297 | Ga0157378_10920836 | Ga0157378_109208362 | 97 |
| 326 | 3300013297 | Ga0157378_11115765 | Ga0157378_111157652 | 97 |
| 327 | 3300013297 | Ga0157378_11387265 | Ga0157378_113872652 | 97 |
| 328 | 3300013306 | Ga0163162_10460780 | Ga0163162_104607802 | 97 |
| 329 | 3300013306 | Ga0163162_10555845 | Ga0163162_105558452 | 97 |
| 330 | 3300013306 | Ga0163162_10670238 | Ga0163162_106702382 | 97 |
| 331 | 3300013306 | Ga0163162_11735111 | Ga0163162_117351111 | 97 |
| 332 | 3300013306 | Ga0163162_12903158 | Ga0163162_129031582 | 97 |
| 333 | 3300013307 | Ga0157372_10051984 | Ga0157372_100519842 | 97 |
| 334 | 3300013307 | Ga0157372_10463378 | Ga0157372_104633782 | 97 |
| 335 | 3300013308 | Ga0157375_10141341 | Ga0157375_101413412 | 97 |
| 336 | 3300013308 | Ga0157375_10709640 | Ga0157375_107096402 | 97 |
| 337 | 3300013308 | Ga0157375_11113680 | Ga0157375_111136802 | 97 |
| 338 | 3300014325 | Ga0163163_10352776 | Ga0163163_103527762 | 97 |
| 339 | 3300014325 | Ga0163163_11550547 | Ga0163163_115505472 | 97 |
| 340 | 3300014325 | Ga0163163_12860585 | Ga0163163_128605852 | 97 |
| 341 | 3300014326 | Ga0157380_10396090 | Ga0157380_103960902 | 97 |
| 342 | 3300014326 | Ga0157380_12000636 | Ga0157380_120006362 | 97 |
| 343 | 3300014497 | Ga0182008_10002555 | Ga0182008_100025554 | 97 |
| 344 | 3300014497 | Ga0182008_10013374 | Ga0182008_100133744 | 97 |
| 345 | 3300014497 | Ga0182008_10273328 | Ga0182008_102733282 | 97 |
| 346 | 3300014745 | Ga0157377_10364316 | Ga0157377_103643162 | 97 |
| 347 | 3300014745 | Ga0157377_10657886 | Ga0157377_106578862 | 97 |
| 348 | 3300014745 | Ga0157377_11365740 | Ga0157377_113657402 | 97 |
| 349 | 3300014968 | Ga0157379_10648618 | Ga0157379_106486182 | 97 |
| 350 | 3300014969 | Ga0157376_10605332 | Ga0157376_106053321 | 97 |
| 351 | 3300014969 | Ga0157376_10894730 | Ga0157376_108947302 | 97 |
| 352 | 3300014969 | Ga0157376_11892112 | Ga0157376_118921122 | 97 |
| 353 | 3300014969 | Ga0157376_13009303 | Ga0157376_130093031 | 97 |
| 354 | 3300015261 | Ga0182006_1000465 | Ga0182006_100046527 | 97 |
| 355 | 3300015262 | Ga0182007_10007704 | Ga0182007_100077042 | 97 |
| 356 | 3300015262 | Ga0182007_10282251 | Ga0182007_102822511 | 97 |
| 357 | 3300015265 | Ga0182005_1000078 | Ga0182005_100007888 | 97 |
| 358 | 3300025224 | Ga0209784_100002 | Ga0209784_1000021160 | 97 |
| 359 | 3300025225 | Ga0209566_100003 | Ga0209566_1000031160 | 97 |
| 360 | 3300025226 | Ga0209674_100003 | Ga0209674_1000031918 | 97 |
| 361 | 3300025226 | Ga0209674_100004 | Ga0209674_1000041160 | 97 |
| 362 | 3300025230 | Ga0209563_100006 | Ga0209563_1000061160 | 97 |
| 363 | 3300025230 | Ga0209563_100017 | Ga0209563_10001752 | 97 |
| 364 | 3300025253 | Ga0209677_100003 | Ga0209677_1000031160 | 97 |
| 365 | 3300025253 | Ga0209677_100467 | Ga0209677_10046720 | 97 |
| 366 | 3300025303 | Ga0209051_1011278 | Ga0209051_10112783 | 97 |
| 367 | 3300025304 | Ga0209257_1000032 | Ga0209257_1000032243 | 97 |
| 368 | 3300025315 | Ga0207697_10117564 | Ga0207697_101175642 | 97 |
| 369 | 3300025321 | Ga0207656_10131262 | Ga0207656_101312622 | 97 |
| 370 | 3300025321 | Ga0207656_10303200 | Ga0207656_103032002 | 97 |
| 371 | 3300025321 | Ga0207656_10485358 | Ga0207656_104853581 | 97 |
| 372 | 3300025321 | Ga0207656_10497700 | Ga0207656_104977002 | 97 |
| 373 | 3300025893 | Ga0207682_10301251 | Ga0207682_103012512 | 97 |
| 374 | 3300025893 | Ga0207682_10495084 | Ga0207682_104950842 | 97 |
| 375 | 3300025898 | Ga0207692_10081066 | Ga0207692_100810662 | 97 |
| 376 | 3300025898 | Ga0207692_10283405 | Ga0207692_102834051 | 97 |
| 377 | 3300025899 | Ga0207642_10198671 | Ga0207642_101986713 | 97 |
| 378 | 3300025904 | Ga0207647_10068185 | Ga0207647_100681852 | 97 |
| 379 | 3300025905 | Ga0207685_10219732 | Ga0207685_102197322 | 97 |
| 380 | 3300025906 | Ga0207699_10010032 | Ga0207699_100100322 | 97 |
| 381 | 3300025906 | Ga0207699_10019110 | Ga0207699_100191104 | 97 |
| 382 | 3300025906 | Ga0207699_10074048 | Ga0207699_100740482 | 97 |
| 383 | 3300025906 | Ga0207699_10391367 | Ga0207699_103913672 | 97 |
| 384 | 3300025907 | Ga0207645_10117231 | Ga0207645_101172313 | 97 |
| 385 | 3300025907 | Ga0207645_10128707 | Ga0207645_101287072 | 97 |
| 386 | 3300025907 | Ga0207645_10196254 | Ga0207645_101962542 | 97 |
| 387 | 3300025908 | Ga0207643_10008540 | Ga0207643_100085401 | 97 |
| 388 | 3300025909 | Ga0207705_10020296 | Ga0207705_100202962 | 97 |
| 389 | 3300025909 | Ga0207705_10066042 | Ga0207705_100660422 | 97 |
| 390 | 3300025909 | Ga0207705_10083344 | Ga0207705_100833442 | 97 |
| 391 | 3300025909 | Ga0207705_10480128 | Ga0207705_104801282 | 97 |
| 392 | 3300025909 | Ga0207705_10480231 | Ga0207705_104802312 | 97 |
| 393 | 3300025909 | Ga0207705_10563023 | Ga0207705_105630232 | 97 |
| 394 | 3300025912 | Ga0207707_10008443 | Ga0207707_100084431 | 97 |
| 395 | 3300025912 | Ga0207707_10188488 | Ga0207707_101884883 | 97 |
| 396 | 3300025912 | Ga0207707_10681211 | Ga0207707_106812112 | 97 |
| 397 | 3300025912 | Ga0207707_11121705 | Ga0207707_111217052 | 97 |
| 398 | 3300025913 | Ga0207695_10001853 | Ga0207695_100018533 | 97 |
| 399 | 3300025913 | Ga0207695_10003759 | Ga0207695_1000375914 | 97 |
| 400 | 3300025913 | Ga0207695_10037174 | Ga0207695_100371743 | 97 |
| 401 | 3300025914 | Ga0207671_10013287 | Ga0207671_100132872 | 97 |
| 402 | 3300025915 | Ga0207693_10003536 | Ga0207693_1000353614 | 97 |
| 403 | 3300025915 | Ga0207693_10113785 | Ga0207693_101137853 | 97 |
| 404 | 3300025915 | Ga0207693_10122685 | Ga0207693_101226852 | 97 |
| 405 | 3300025916 | Ga0207663_10004765 | Ga0207663_100047657 | 97 |
| 406 | 3300025916 | Ga0207663_10088813 | Ga0207663_100888134 | 97 |
| 407 | 3300025917 | Ga0207660_10000108 | Ga0207660_1000010838 | 97 |
| 408 | 3300025917 | Ga0207660_10184576 | Ga0207660_101845762 | 97 |
| 409 | 3300025917 | Ga0207660_10187336 | Ga0207660_101873362 | 97 |
| 410 | 3300025917 | Ga0207660_11189932 | Ga0207660_111899322 | 97 |
| 411 | 3300025917 | Ga0207660_11726346 | Ga0207660_117263461 | 97 |
| 412 | 3300025918 | Ga0207662_10040598 | Ga0207662_100405984 | 97 |
| 413 | 3300025918 | Ga0207662_10823619 | Ga0207662_108236192 | 97 |
| 414 | 3300025919 | Ga0207657_10134465 | Ga0207657_101344653 | 97 |
| 415 | 3300025919 | Ga0207657_10192341 | Ga0207657_101923412 | 97 |
| 416 | 3300025919 | Ga0207657_10624397 | Ga0207657_106243972 | 97 |
| 417 | 3300025920 | Ga0207649_10059611 | Ga0207649_100596112 | 97 |
| 418 | 3300025920 | Ga0207649_10284652 | Ga0207649_102846522 | 97 |
| 419 | 3300025920 | Ga0207649_10448539 | Ga0207649_104485392 | 97 |
| 420 | 3300025921 | Ga0207652_10461974 | Ga0207652_104619743 | 97 |
| 421 | 3300025921 | Ga0207652_11793562 | Ga0207652_117935621 | 97 |
| 422 | 3300025922 | Ga0207646_11875752 | Ga0207646_118757521 | 97 |
| 423 | 3300025923 | Ga0207681_10037004 | Ga0207681_100370045 | 97 |
| 424 | 3300025924 | Ga0207694_10037025 | Ga0207694_100370253 | 97 |
| 425 | 3300025925 | Ga0207650_10039405 | Ga0207650_100394052 | 97 |
| 426 | 3300025925 | Ga0207650_10163241 | Ga0207650_101632412 | 97 |
| 427 | 3300025925 | Ga0207650_10172409 | Ga0207650_101724092 | 97 |
| 428 | 3300025925 | Ga0207650_11455561 | Ga0207650_114555612 | 97 |
| 429 | 3300025926 | Ga0207659_10037462 | Ga0207659_100374622 | 97 |
| 430 | 3300025926 | Ga0207659_10216485 | Ga0207659_102164853 | 97 |
| 431 | 3300025926 | Ga0207659_10574573 | Ga0207659_105745732 | 97 |
| 432 | 3300025926 | Ga0207659_11323980 | Ga0207659_113239802 | 97 |
| 433 | 3300025927 | Ga0207687_11615204 | Ga0207687_116152042 | 97 |
| 434 | 3300025927 | Ga0207687_11800710 | Ga0207687_118007101 | 97 |
| 435 | 3300025928 | Ga0207700_10026068 | Ga0207700_100260683 | 97 |
| 436 | 3300025928 | Ga0207700_10143131 | Ga0207700_101431312 | 97 |
| 437 | 3300025928 | Ga0207700_10153827 | Ga0207700_101538272 | 97 |
| 438 | 3300025928 | Ga0207700_10694998 | Ga0207700_106949982 | 97 |
| 439 | 3300025929 | Ga0207664_10026276 | Ga0207664_100262762 | 97 |
| 440 | 3300025929 | Ga0207664_10040338 | Ga0207664_100403384 | 97 |
| 441 | 3300025931 | Ga0207644_10607647 | Ga0207644_106076472 | 97 |
| 442 | 3300025932 | Ga0207690_10181149 | Ga0207690_101811494 | 97 |
| 443 | 3300025932 | Ga0207690_10213555 | Ga0207690_102135552 | 97 |
| 444 | 3300025932 | Ga0207690_11402236 | Ga0207690_114022361 | 97 |
| 445 | 3300025933 | Ga0207706_10120698 | Ga0207706_101206982 | 97 |
| 446 | 3300025933 | Ga0207706_10249799 | Ga0207706_102497992 | 97 |
| 447 | 3300025933 | Ga0207706_10427236 | Ga0207706_104272362 | 97 |
| 448 | 3300025933 | Ga0207706_10612496 | Ga0207706_106124962 | 97 |
| 449 | 3300025934 | Ga0207686_10211190 | Ga0207686_102111902 | 97 |
| 450 | 3300025935 | Ga0207709_10834611 | Ga0207709_108346111 | 97 |
| 451 | 3300025935 | Ga0207709_11242391 | Ga0207709_112423912 | 97 |
| 452 | 3300025935 | Ga0207709_11347797 | Ga0207709_113477972 | 97 |
| 453 | 3300025936 | Ga0207670_10015446 | Ga0207670_100154463 | 97 |
| 454 | 3300025936 | Ga0207670_11220513 | Ga0207670_112205132 | 97 |
| 455 | 3300025937 | Ga0207669_10330718 | Ga0207669_103307181 | 97 |
| 456 | 3300025937 | Ga0207669_10509609 | Ga0207669_105096091 | 97 |
| 457 | 3300025938 | Ga0207704_10061975 | Ga0207704_100619754 | 97 |
| 458 | 3300025938 | Ga0207704_10432381 | Ga0207704_104323812 | 97 |
| 459 | 3300025939 | Ga0207665_10844310 | Ga0207665_108443102 | 97 |
| 460 | 3300025939 | Ga0207665_11212508 | Ga0207665_112125082 | 97 |
| 461 | 3300025940 | Ga0207691_10003241 | Ga0207691_100032417 | 97 |
| 462 | 3300025940 | Ga0207691_10034050 | Ga0207691_100340505 | 97 |
| 463 | 3300025940 | Ga0207691_10159600 | Ga0207691_101596002 | 97 |
| 464 | 3300025940 | Ga0207691_10464926 | Ga0207691_104649263 | 97 |
| 465 | 3300025940 | Ga0207691_10541450 | Ga0207691_105414502 | 97 |
| 466 | 3300025940 | Ga0207691_11410422 | Ga0207691_114104222 | 97 |
| 467 | 3300025941 | Ga0207711_10116293 | Ga0207711_101162934 | 97 |
| 468 | 3300025941 | Ga0207711_10148571 | Ga0207711_101485712 | 97 |
| 469 | 3300025941 | Ga0207711_10263813 | Ga0207711_102638133 | 97 |
| 470 | 3300025942 | Ga0207689_10060980 | Ga0207689_100609804 | 97 |
| 471 | 3300025944 | Ga0207661_10046637 | Ga0207661_100466375 | 97 |
| 472 | 3300025944 | Ga0207661_10148680 | Ga0207661_101486802 | 97 |
| 473 | 3300025944 | Ga0207661_10440636 | Ga0207661_104406363 | 97 |
| 474 | 3300025944 | Ga0207661_10453473 | Ga0207661_104534732 | 97 |
| 475 | 3300025944 | Ga0207661_10538442 | Ga0207661_105384422 | 97 |
| 476 | 3300025945 | Ga0207679_10094142 | Ga0207679_100941422 | 97 |
| 477 | 3300025945 | Ga0207679_10115434 | Ga0207679_101154342 | 97 |
| 478 | 3300025945 | Ga0207679_10275936 | Ga0207679_102759362 | 97 |
| 479 | 3300025945 | Ga0207679_10369007 | Ga0207679_103690072 | 97 |
| 480 | 3300025945 | Ga0207679_10469775 | Ga0207679_104697751 | 97 |
| 481 | 3300025945 | Ga0207679_11832344 | Ga0207679_118323442 | 97 |
| 482 | 3300025949 | Ga0207667_10000438 | Ga0207667_1000043843 | 97 |
| 483 | 3300025949 | Ga0207667_10080431 | Ga0207667_100804315 | 97 |
| 484 | 3300025949 | Ga0207667_10120706 | Ga0207667_101207064 | 97 |
| 485 | 3300025949 | Ga0207667_10532629 | Ga0207667_105326292 | 97 |
| 486 | 3300025949 | Ga0207667_11078949 | Ga0207667_110789492 | 97 |
| 487 | 3300025949 | Ga0207667_11779875 | Ga0207667_117798752 | 97 |
| 488 | 3300025960 | Ga0207651_10044954 | Ga0207651_100449542 | 97 |
| 489 | 3300025960 | Ga0207651_10049833 | Ga0207651_100498332 | 97 |
| 490 | 3300025960 | Ga0207651_10592134 | Ga0207651_105921342 | 97 |
| 491 | 3300025960 | Ga0207651_11912507 | Ga0207651_119125072 | 97 |
| 492 | 3300025961 | Ga0207712_11111599 | Ga0207712_111115992 | 97 |
| 493 | 3300025961 | Ga0207712_11180360 | Ga0207712_111803602 | 97 |
| 494 | 3300025961 | Ga0207712_11858715 | Ga0207712_118587152 | 97 |
| 495 | 3300025972 | Ga0207668_10170685 | Ga0207668_101706851 | 97 |
| 496 | 3300025972 | Ga0207668_10813330 | Ga0207668_108133302 | 97 |
| 497 | 3300025972 | Ga0207668_11650884 | Ga0207668_116508842 | 97 |
| 498 | 3300025981 | Ga0207640_10164010 | Ga0207640_101640102 | 97 |
| 499 | 3300025986 | Ga0207658_10207146 | Ga0207658_102071462 | 97 |
| 500 | 3300025986 | Ga0207658_10334431 | Ga0207658_103344311 | 97 |
| 501 | 3300025986 | Ga0207658_10553881 | Ga0207658_105538812 | 97 |
| 502 | 3300026023 | Ga0207677_10558543 | Ga0207677_105585432 | 97 |
| 503 | 3300026023 | Ga0207677_10874560 | Ga0207677_108745602 | 97 |
| 504 | 3300026023 | Ga0207677_11010063 | Ga0207677_110100632 | 97 |
| 505 | 3300026035 | Ga0207703_10320070 | Ga0207703_103200702 | 97 |
| 506 | 3300026041 | Ga0207639_10335709 | Ga0207639_103357092 | 97 |
| 507 | 3300026067 | Ga0207678_10228246 | Ga0207678_102282462 | 97 |
| 508 | 3300026067 | Ga0207678_10286314 | Ga0207678_102863142 | 97 |
| 509 | 3300026067 | Ga0207678_11119896 | Ga0207678_111198962 | 97 |
| 510 | 3300026067 | Ga0207678_11339925 | Ga0207678_113399252 | 97 |
| 511 | 3300026075 | Ga0207708_10567734 | Ga0207708_105677342 | 97 |
| 512 | 3300026075 | Ga0207708_11487935 | Ga0207708_114879352 | 97 |
| 513 | 3300026075 | Ga0207708_11562456 | Ga0207708_115624562 | 97 |
| 514 | 3300026078 | Ga0207702_10100428 | Ga0207702_101004282 | 97 |
| 515 | 3300026078 | Ga0207702_10714697 | Ga0207702_107146972 | 97 |
| 516 | 3300026078 | Ga0207702_12128198 | Ga0207702_121281982 | 97 |
| 517 | 3300026088 | Ga0207641_10234602 | Ga0207641_102346023 | 97 |
| 518 | 3300026088 | Ga0207641_10605511 | Ga0207641_106055112 | 97 |
| 519 | 3300026089 | Ga0207648_10009384 | Ga0207648_100093844 | 97 |
| 520 | 3300026089 | Ga0207648_11342871 | Ga0207648_113428711 | 97 |
| 521 | 3300026095 | Ga0207676_10528943 | Ga0207676_105289432 | 97 |
| 522 | 3300026116 | Ga0207674_10019328 | Ga0207674_100193286 | 97 |
| 523 | 3300026116 | Ga0207674_10030258 | Ga0207674_100302584 | 97 |
| 524 | 3300026116 | Ga0207674_10471185 | Ga0207674_104711851 | 97 |
| 525 | 3300026116 | Ga0207674_11842393 | Ga0207674_118423932 | 97 |
| 526 | 3300026118 | Ga0207675_100281049 | Ga0207675_1002810493 | 97 |
| 527 | 3300026118 | Ga0207675_100560854 | Ga0207675_1005608542 | 97 |
| 528 | 3300026118 | Ga0207675_100702801 | Ga0207675_1007028012 | 97 |
| 529 | 3300026118 | Ga0207675_100762188 | Ga0207675_1007621882 | 97 |
| 530 | 3300026121 | Ga0207683_10188565 | Ga0207683_101885652 | 97 |
| 531 | 3300026121 | Ga0207683_10227218 | Ga0207683_102272182 | 97 |
| 532 | 3300026121 | Ga0207683_10406459 | Ga0207683_104064592 | 97 |
| 533 | 3300026142 | Ga0207698_10203459 | Ga0207698_102034592 | 97 |
| 534 | 3300026142 | Ga0207698_10212653 | Ga0207698_102126532 | 97 |
| 535 | 3300026142 | Ga0207698_10577776 | Ga0207698_105777761 | 97 |
| 536 | 3300026142 | Ga0207698_11302213 | Ga0207698_113022132 | 97 |
| 537 | 3300027111 | Ga0209281_1015504 | Ga0209281_10155042 | 97 |
| 538 | 3300027360 | Ga0209969_1006876 | Ga0209969_10068762 | 97 |
| 539 | 3300027360 | Ga0209969_1064622 | Ga0209969_10646222 | 97 |
| 540 | 3300027364 | Ga0209967_1002057 | Ga0209967_10020571 | 97 |
| 541 | 3300027395 | Ga0209996_1012602 | Ga0209996_10126022 | 97 |
| 542 | 3300027462 | Ga0210000_1000359 | Ga0210000_10003594 | 97 |
| 543 | 3300027462 | Ga0210000_1021166 | Ga0210000_10211662 | 97 |
| 544 | 3300027512 | Ga0209179_1076816 | Ga0209179_10768161 | 97 |
| 545 | 3300027526 | Ga0209968_1057529 | Ga0209968_10575292 | 97 |
| 546 | 3300027526 | Ga0209968_1076531 | Ga0209968_10765312 | 97 |
| 547 | 3300027543 | Ga0209999_1000555 | Ga0209999_10005553 | 97 |
| 548 | 3300027665 | Ga0209983_1046924 | Ga0209983_10469242 | 97 |
| 549 | 3300027666 | Ga0209282_1125663 | Ga0209282_11256632 | 97 |
| 550 | 3300027671 | Ga0209588_1035122 | Ga0209588_10351222 | 97 |
| 551 | 3300027682 | Ga0209971_1006039 | Ga0209971_10060392 | 97 |
| 552 | 3300027876 | Ga0209974_10006308 | Ga0209974_100063083 | 97 |
| 553 | 3300027876 | Ga0209974_10016099 | Ga0209974_100160992 | 97 |
| 554 | 3300028036 | Ga0265355_1020574 | Ga0265355_10205742 | 97 |
| 555 | 3300028380 | Ga0268265_10974493 | Ga0268265_109744932 | 97 |
| 556 | 3300028380 | Ga0268265_11266507 | Ga0268265_112665072 | 97 |
| 557 | 3300028381 | Ga0268264_10359998 | Ga0268264_103599982 | 97 |
| 558 | 3300028800 | Ga0265338_10460300 | Ga0265338_104603002 | 97 |
| 559 | 3300030745 | Ga0316182_1388674 | Ga0316182_13886744 | 97 |
| 560 | 3300031548 | Ga0307408_100542836 | Ga0307408_1005428362 | 97 |
| 561 | 3300031548 | Ga0307408_101042820 | Ga0307408_1010428202 | 97 |
| 562 | 3300031548 | Ga0307408_101318191 | Ga0307408_1013181912 | 97 |
| 563 | 3300031665 | Ga0316575_10000032 | Ga0316575_1000003225 | 97 |
| 564 | 3300031665 | Ga0316575_10007166 | Ga0316575_100071663 | 97 |
| 565 | 3300031665 | Ga0316575_10208096 | Ga0316575_102080961 | 97 |
| 566 | 3300031691 | Ga0316579_10000922 | Ga0316579_100009224 | 97 |
| 567 | 3300031691 | Ga0316579_10003486 | Ga0316579_100034863 | 97 |
| 568 | 3300031727 | Ga0316576_10505678 | Ga0316576_105056781 | 97 |
| 569 | 3300031728 | Ga0316578_10019379 | Ga0316578_100193795 | 97 |
| 570 | 3300031728 | Ga0316578_10038835 | Ga0316578_100388354 | 97 |
| 571 | 3300031731 | Ga0307405_10302791 | Ga0307405_103027912 | 97 |
| 572 | 3300031731 | Ga0307405_11720673 | Ga0307405_117206732 | 97 |
| 573 | 3300031824 | Ga0307413_10775714 | Ga0307413_107757142 | 97 |
| 574 | 3300031852 | Ga0307410_10137989 | Ga0307410_101379894 | 97 |
| 575 | 3300031852 | Ga0307410_10643308 | Ga0307410_106433082 | 97 |
| 576 | 3300031901 | Ga0307406_10053066 | Ga0307406_100530662 | 97 |
| 577 | 3300031901 | Ga0307406_10124064 | Ga0307406_101240642 | 97 |
| 578 | 3300031901 | Ga0307406_10333259 | Ga0307406_103332593 | 97 |
| 579 | 3300031901 | Ga0307406_11680663 | Ga0307406_116806632 | 97 |
| 580 | 3300031911 | Ga0307412_10388759 | Ga0307412_103887592 | 97 |
| 581 | 3300031911 | Ga0307412_11207745 | Ga0307412_112077452 | 97 |
| 582 | 3300031995 | Ga0307409_100321415 | Ga0307409_1003214153 | 97 |
| 583 | 3300031995 | Ga0307409_100725525 | Ga0307409_1007255253 | 97 |
| 584 | 3300031995 | Ga0307409_100959655 | Ga0307409_1009596552 | 97 |
| 585 | 3300031995 | Ga0307409_101849815 | Ga0307409_1018498152 | 97 |
| 586 | 3300031995 | Ga0307409_102158352 | Ga0307409_1021583521 | 97 |
| 587 | 3300032002 | Ga0307416_100071671 | Ga0307416_1000716712 | 97 |
| 588 | 3300032002 | Ga0307416_100094290 | Ga0307416_1000942902 | 97 |
| 589 | 3300032002 | Ga0307416_100995760 | Ga0307416_1009957602 | 97 |
| 590 | 3300032002 | Ga0307416_101643754 | Ga0307416_1016437542 | 97 |
| 591 | 3300032002 | Ga0307416_101978192 | Ga0307416_1019781922 | 97 |
| 592 | 3300032002 | Ga0307416_102411812 | Ga0307416_1024118122 | 97 |
| 593 | 3300032002 | Ga0307416_102631432 | Ga0307416_1026314322 | 97 |
| 594 | 3300032004 | Ga0307414_10201808 | Ga0307414_102018082 | 97 |
| 595 | 3300032004 | Ga0307414_11979702 | Ga0307414_119797022 | 97 |
| 596 | 3300032004 | Ga0307414_12178846 | Ga0307414_121788461 | 97 |
| 597 | 3300032005 | Ga0307411_10189389 | Ga0307411_101893892 | 97 |
| 598 | 3300032005 | Ga0307411_10244153 | Ga0307411_102441533 | 97 |
| 599 | 3300032005 | Ga0307411_10288180 | Ga0307411_102881801 | 97 |
| 600 | 3300032126 | Ga0307415_100523335 | Ga0307415_1005233352 | 97 |
| 601 | 3300032126 | Ga0307415_100606156 | Ga0307415_1006061562 | 97 |
| 602 | 3300032126 | Ga0307415_100911094 | Ga0307415_1009110942 | 97 |
| 603 | 3300032126 | Ga0307415_101085684 | Ga0307415_1010856842 | 97 |
| 604 | 3300032133 | Ga0316583_10003578 | Ga0316583_100035781 | 97 |
| 605 | 3300032133 | Ga0316583_10012848 | Ga0316583_100128482 | 97 |
| 606 | 3300032133 | Ga0316583_10110681 | Ga0316583_101106812 | 97 |
| 607 | 3300032168 | Ga0316593_10236263 | Ga0316593_102362632 | 97 |
| 608 | 3300035083 | Ga0373926_0012427 | Ga0373926_0012427_1513_1806 | 97 |
| 609 | 3300035083 | Ga0373926_0081631 | Ga0373926_0081631_357_650 | 97 |
| 610 | 3300035086 | Ga0373934_0000613 | Ga0373934_0000613_1547_1840 | 97 |
| 611 | 3300035089 | Ga0373944_0043393 | Ga0373944_0043393_507_800 | 97 |
| 612 | 3300035111 | Ga0373923_0021276 | Ga0373923_0021276_1021_1314 | 97 |
| 613 | 3300035116 | Ga0373945_0096315 | Ga0373945_0096315_606_899 | 97 |
| 614 | 3300035119 | Ga0373956_0097835 | Ga0373956_0097835_714_1007 | 97 |
| 615 | 3300035120 | Ga0373957_0011425 | Ga0373957_0011425_1726_2019 | 97 |
| 616 | 3300035121 | Ga0373960_0038491 | Ga0373960_0038491_509_817 | 97 |
| 617 | 3300035170 | Ga0373943_0967145 | Ga0373943_0967145_165_458 | 97 |
| 618 | 3300035171 | Ga0373946_0066655 | Ga0373946_0066655_981_1274 | 97 |
| 619 | 3300035172 | Ga0373955_0000555 | Ga0373955_0000555_15020_15313 | 97 |
| 620 | 3300035207 | Ga0373942_0160572 | Ga0373942_0160572_333_635 | 97 |
| 621 | 3300035398 | Ga0316574_0311636 | Ga0316574_0311636_265_576 | 97 |
| 622 | 3300035410 | Ga0373924_0031046 | Ga0373924_0031046_1723_2016 | 97 |
| 623 | 3300035692 | Ga0373935_0015507 | Ga0373935_0015507_2892_3185 | 97 |
| 624 | 3300035692 | Ga0373935_0518439 | Ga0373935_0518439_122_439 | 97 |
| 625 | 3300035692 | Ga0373935_0568069 | Ga0373935_0568069_393_686 | 97 |
| 626 | 3300035692 | Ga0373935_1182297 | Ga0373935_1182297_249_542 | 97 |
| 627 | 3300035695 | Ga0373927_0027933 | Ga0373927_0027933_1159_1452 | 97 |
| 628 | 3300035695 | Ga0373927_0104013 | Ga0373927_0104013_1181_1474 | 97 |
| 629 | 3300035695 | Ga0373927_0164642 | Ga0373927_0164642_474_767 | 97 |
| 630 | 3300035724 | Ga0373933_0000055 | Ga0373933_0000055_11593_11886 | 97 |
| 631 | 3300035725 | Ga0373947_0037687 | Ga0373947_0037687_2514_2807 | 97 |
| 632 | 3300035725 | Ga0373947_0043390 | Ga0373947_0043390_762_1055 | 97 |
| 633 | 3300036401 | Ga0373937_0000450 | Ga0373937_0000450_30172_30465 | 97 |
| 634 | 3300036401 | Ga0373937_0386729 | Ga0373937_0386729_582_875 | 97 |
| 635 | 3300036647 | Ga0316582_0000229 | Ga0316582_0000229_4501_4806 | 97 |
| 636 | 3300036647 | Ga0316582_0010275 | Ga0316582_0010275_3275_3586 | 97 |
| 637 | 3300036647 | Ga0316582_0131791 | Ga0316582_0131791_917_1219 | 97 |
| 638 | 3300036712 | Ga0316584_0062296 | Ga0316584_0062296_2455_2760 | 97 |
| 639 | 3300036712 | Ga0316584_0124699 | Ga0316584_0124699_1499_1801 | 97 |
| 640 | 3300037068 | Ga0373925_0533729 | Ga0373925_0533729_285_578 | 97 |
| 641 | 3300037068 | Ga0373925_0743704 | Ga0373925_0743704_261_554 | 97 |
| 642 | 3300037068 | Ga0373925_1281198 | Ga0373925_1281198_193_501 | 97 |
| 643 | 3300037588 | Ga0316581_0016222 | Ga0316581_0016222_693_1004 | 97 |
| 644 | 3300037588 | Ga0316581_0018143 | Ga0316581_0018143_1044_1349 | 97 |
| 645 | 3300037853 | Ga0436364_0497955 | Ga0436364_0497955_21_338 | 97 |
| 646 | 3300038443 | Ga0395901_0933184 | Ga0395901_0933184_208_501 | 97 |
| 647 | 3300038443 | Ga0395901_1686137 | Ga0395901_1686137_264_557 | 97 |
| 648 | 3300039437 | Ga0436365_0350682 | Ga0436365_0350682_134_427 | 97 |
| 649 | 3300039437 | Ga0436365_1200738 | Ga0436365_1200738_107_400 | 97 |
| 650 | 3300039437 | Ga0436365_1592469 | Ga0436365_1592469_18_323 | 97 |
| 651 | 3300039447 | Ga0436361_0730207 | Ga0436361_0730207_1680_1985 | 97 |
| 652 | 3300039447 | Ga0436361_1079523 | Ga0436361_1079523_1630_1938 | 97 |
| 653 | 3300041404 | Ga0439436_0140609 | Ga0439436_0140609_221_526 | 97 |
| 654 | 3300041406 | Ga0439439_0249705 | Ga0439439_0249705_162_467 | 97 |
| 655 | 3300041410 | Ga0439461_0062686 | Ga0439461_0062686_344_664 | 97 |
| 656 | 3300041498 | Ga0451841_0300790 | Ga0451841_0300790_224_541 | 97 |
| 657 | 3300041501 | Ga0451845_0910423 | Ga0451845_0910423_69_389 | 97 |
| 658 | 3300041503 | Ga0451847_0780003 | Ga0451847_0780003_89_409 | 97 |
| 659 | 3300041512 | Ga0451853_3739149 | Ga0451853_3739149_470_790 | 97 |
| 660 | 3300042004 | Ga0439445_0190724 | Ga0439445_0190724_134_439 | 97 |
| 661 | 3300042004 | Ga0439445_0224983 | Ga0439445_0224983_135_455 | 97 |
| 662 | 3300042007 | Ga0439449_0046339 | Ga0439449_0046339_366_671 | 97 |
| 663 | 3300042010 | Ga0439452_034928 | Ga0439452_034928_437_742 | 97 |
| 664 | 3300042012 | Ga0439455_0033113 | Ga0439455_0033113_35_355 | 97 |
| 665 | 3300042014 | Ga0439457_100883 | Ga0439457_100883_214_519 | 97 |
| 666 | 3300042116 | Ga0450912_004316 | Ga0450912_004316_162_482 | 97 |
| 667 | 3300042120 | Ga0450917_003459 | Ga0450917_003459_554_874 | 97 |
| 668 | 3300042125 | Ga0450923_116922 | Ga0450923_116922_182_487 | 97 |
| 669 | 3300042126 | Ga0450888_002272 | Ga0450888_002272_756_1076 | 97 |
| 670 | 3300042127 | Ga0450890_009447 | Ga0450890_009447_30_350 | 97 |
| 671 | 3300042129 | Ga0450891_000222 | Ga0450891_000222_936_1256 | 97 |
| 672 | 3300042130 | Ga0450892_001107 | Ga0450892_001107_799_1119 | 97 |
| 673 | 3300042138 | Ga0450903_020990 | Ga0450903_020990_494_814 | 97 |
| 674 | 3300042435 | Ga0439434_0095027 | Ga0439434_0095027_362_664 | 97 |
| 675 | 3300042437 | Ga0439444_0002332 | Ga0439444_0002332_225_533 | 97 |
| 676 | 3300042438 | Ga0439459_0017764 | Ga0439459_0017764_388_708 | 97 |
| 677 | 3300042532 | Ga0450893_0000472 | Ga0450893_0000472_3766_4086 | 97 |
| 678 | 3300042876 | Ga0451577_0804129 | Ga0451577_0804129_102_407 | 97 |
| 679 | 3300042993 | Ga0439440_0114816 | Ga0439440_0114816_332_652 | 97 |
| 680 | 3300042993 | Ga0439440_0140568 | Ga0439440_0140568_55_348 | 97 |
| 681 | 3300044673 | Ga0453683_0074998 | Ga0453683_0074998_1069_1380 | 97 |
| 682 | 3300044673 | Ga0453683_0518135 | Ga0453683_0518135_68_364 | 97 |
| 683 | 3300044712 | Ga0453684_0743783 | Ga0453684_0743783_271_576 | 97 |
| 684 | 3300044712 | Ga0453684_0872633 | Ga0453684_0872633_23_328 | 97 |
| 685 | 3300045051 | Ga0451576_0072908 | Ga0451576_0072908_3026_3337 | 97 |
| 686 | 3300045051 | Ga0451576_1661229 | Ga0451576_1661229_275_589 | 97 |
| 687 | 3300045976 | Ga0466967_1666302 | Ga0466967_1666302_19_312 | 97 |
| 688 | 3300046454 | Ga0495592_0002705 | Ga0495592_0002705_4447_4740 | 97 |
| 689 | 3300046454 | Ga0495592_0825445 | Ga0495592_0825445_63_356 | 97 |
| 690 | 3300046459 | Ga0495629_0011314 | Ga0495629_0011314_4529_4822 | 97 |
| 691 | 3300046459 | Ga0495629_0064592 | Ga0495629_0064592_1650_1943 | 97 |
| 692 | 3300046459 | Ga0495629_0142153 | Ga0495629_0142153_593_886 | 97 |
| 693 | 3300046462 | Ga0495651_0000996 | Ga0495651_0000996_16847_17140 | 97 |
| 694 | 3300046463 | Ga0495653_0000195 | Ga0495653_0000195_28064_28357 | 97 |
| 695 | 3300046471 | Ga0495650_0012788 | Ga0495650_0012788_1327_1644 | 97 |
| 696 | 3300046472 | Ga0495580_0008769 | Ga0495580_0008769_372_665 | 97 |
| 697 | 3300046472 | Ga0495580_0048643 | Ga0495580_0048643_2157_2450 | 97 |
| 698 | 3300046472 | Ga0495580_0068932 | Ga0495580_0068932_1919_2212 | 97 |
| 699 | 3300046473 | Ga0495582_0041545 | Ga0495582_0041545_789_1082 | 97 |
| 700 | 3300046473 | Ga0495582_0215716 | Ga0495582_0215716_737_1030 | 97 |
| 701 | 3300046473 | Ga0495582_0538044 | Ga0495582_0538044_368_661 | 97 |
| 702 | 3300046473 | Ga0495582_0725799 | Ga0495582_0725799_107_400 | 97 |
| 703 | 3300046475 | Ga0495639_0008494 | Ga0495639_0008494_494_787 | 97 |
| 704 | 3300046475 | Ga0495639_0089033 | Ga0495639_0089033_986_1279 | 97 |
| 705 | 3300046475 | Ga0495639_0120029 | Ga0495639_0120029_823_1116 | 97 |
| 706 | 3300046477 | Ga0495664_0054273 | Ga0495664_0054273_1574_1867 | 97 |
| 707 | 3300046499 | Ga0495594_0036114 | Ga0495594_0036114_592_885 | 97 |
| 708 | 3300046499 | Ga0495594_0274194 | Ga0495594_0274194_353_646 | 97 |
| 709 | 3300046499 | Ga0495594_0695554 | Ga0495594_0695554_233_526 | 97 |
| 710 | 3300046500 | Ga0495596_0103789 | Ga0495596_0103789_160_453 | 97 |
| 711 | 3300046500 | Ga0495596_0334621 | Ga0495596_0334621_132_425 | 97 |
| 712 | 3300046506 | Ga0495583_0008785 | Ga0495583_0008785_4979_5296 | 97 |
| 713 | 3300046507 | Ga0495606_0006532 | Ga0495606_0006532_9431_9748 | 97 |
| 714 | 3300046511 | Ga0495608_0000085 | Ga0495608_0000085_61195_61488 | 97 |
| 715 | 3300046511 | Ga0495608_0662561 | Ga0495608_0662561_203_496 | 97 |
| 716 | 3300046516 | Ga0495628_0034222 | Ga0495628_0034222_2948_3241 | 97 |
| 717 | 3300046517 | Ga0495630_0011652 | Ga0495630_0011652_718_1011 | 97 |
| 718 | 3300046517 | Ga0495630_0022736 | Ga0495630_0022736_473_766 | 97 |
| 719 | 3300046517 | Ga0495630_0155017 | Ga0495630_0155017_113_406 | 97 |
| 720 | 3300046517 | Ga0495630_1355860 | Ga0495630_1355860_149_442 | 97 |
| 721 | 3300046525 | Ga0495663_0062093 | Ga0495663_0062093_656_949 | 97 |
| 722 | 3300046525 | Ga0495663_0082676 | Ga0495663_0082676_165_479 | 97 |
| 723 | 3300046525 | Ga0495663_0213062 | Ga0495663_0213062_149_442 | 97 |
| 724 | 3300046526 | Ga0495666_0184231 | Ga0495666_0184231_437_730 | 97 |
| 725 | 3300046528 | Ga0495642_0053050 | Ga0495642_0053050_383_691 | 97 |
| 726 | 3300046529 | Ga0495652_0008685 | Ga0495652_0008685_7804_8097 | 97 |
| 727 | 3300046530 | Ga0495654_0368700 | Ga0495654_0368700_12_317 | 97 |
| 728 | 3300046531 | Ga0495665_0005306 | Ga0495665_0005306_3228_3521 | 97 |
| 729 | 3300046531 | Ga0495665_0103981 | Ga0495665_0103981_639_932 | 97 |
| 730 | 3300046531 | Ga0495665_0106728 | Ga0495665_0106728_31_324 | 97 |
| 731 | 3300046531 | Ga0495665_0652993 | Ga0495665_0652993_175_468 | 97 |
| 732 | 3300046533 | Ga0495640_0304947 | Ga0495640_0304947_572_865 | 97 |
| 733 | 3300046536 | Ga0495587_0000114 | Ga0495587_0000114_9257_9550 | 97 |
| 734 | 3300046537 | Ga0495598_0189898 | Ga0495598_0189898_303_596 | 97 |
| 735 | 3300046539 | Ga0495621_0006211 | Ga0495621_0006211_997_1290 | 97 |
| 736 | 3300046539 | Ga0495621_0204629 | Ga0495621_0204629_382_702 | 97 |
| 737 | 3300046539 | Ga0495621_0254339 | Ga0495621_0254339_219_512 | 97 |
| 738 | 3300046543 | Ga0495645_0000144 | Ga0495645_0000144_28146_28439 | 97 |
| 739 | 3300046543 | Ga0495645_0629896 | Ga0495645_0629896_325_618 | 97 |
| 740 | 3300046559 | Ga0495667_0000241 | Ga0495667_0000241_9072_9365 | 97 |
| 741 | 3300046559 | Ga0495667_0082166 | Ga0495667_0082166_247_540 | 97 |
| 742 | 3300046559 | Ga0495667_0459167 | Ga0495667_0459167_433_726 | 97 |
| 743 | 3300046616 | Ga0495668_0107838 | Ga0495668_0107838_336_653 | 97 |
| 744 | 3300046642 | Ga0495634_0261307 | Ga0495634_0261307_383_676 | 97 |
| 745 | 3300046660 | Ga0495625_0152379 | Ga0495625_0152379_866_1183 | 97 |
| 746 | 3300046660 | Ga0495625_0534897 | Ga0495625_0534897_28_333 | 97 |
| 747 | 3300046663 | Ga0495635_0000253 | Ga0495635_0000253_13206_13499 | 97 |
| 748 | 3300046663 | Ga0495635_0336897 | Ga0495635_0336897_502_795 | 97 |
| 749 | 3300046663 | Ga0495635_0889632 | Ga0495635_0889632_147_440 | 97 |
| 750 | 3300046664 | Ga0495659_0241169 | Ga0495659_0241169_83_391 | 97 |
| 751 | 3300046664 | Ga0495659_0302271 | Ga0495659_0302271_336_629 | 97 |
| 752 | 3300046674 | Ga0495588_0066857 | Ga0495588_0066857_813_1106 | 97 |
| 753 | 3300046674 | Ga0495588_0126015 | Ga0495588_0126015_710_1003 | 97 |
| 754 | 3300046674 | Ga0495588_0298141 | Ga0495588_0298141_260_553 | 97 |
| 755 | 3300046674 | Ga0495588_0439476 | Ga0495588_0439476_173_466 | 97 |
| 756 | 3300046675 | Ga0495657_0000210 | Ga0495657_0000210_28783_29076 | 97 |
| 757 | 3300046675 | Ga0495657_0254549 | Ga0495657_0254549_399_692 | 97 |
| 758 | 3300046678 | Ga0495599_0000436 | Ga0495599_0000436_491_784 | 97 |
| 759 | 3300046679 | Ga0495623_0000305 | Ga0495623_0000305_22477_22770 | 97 |
| 760 | 3300046680 | Ga0495646_0011487 | Ga0495646_0011487_3022_3315 | 97 |
| 761 | 3300046683 | Ga0495658_0001556 | Ga0495658_0001556_9224_9517 | 97 |
| 762 | 3300046683 | Ga0495658_0489290 | Ga0495658_0489290_128_421 | 97 |
| 763 | 3300046684 | Ga0495669_0003327 | Ga0495669_0003327_5335_5643 | 97 |
| 764 | 3300046684 | Ga0495669_0162795 | Ga0495669_0162795_81_374 | 97 |
| 765 | 3300046684 | Ga0495669_0366748 | Ga0495669_0366748_315_608 | 97 |
| 766 | 3300046684 | Ga0495669_0560199 | Ga0495669_0560199_79_387 | 97 |
| 767 | 3300046689 | Ga0495613_0065654 | Ga0495613_0065654_720_1013 | 97 |
| 768 | 3300046689 | Ga0495613_0068004 | Ga0495613_0068004_1938_2231 | 97 |
| 769 | 3300046689 | Ga0495613_0694257 | Ga0495613_0694257_81_374 | 97 |
| 770 | 3300046694 | Ga0495649_0012212 | Ga0495649_0012212_3869_4186 | 97 |
| 771 | 3300046794 | Ga0495589_0045800 | Ga0495589_0045800_482_799 | 97 |
| 772 | 3300046809 | Ga0495600_0000023 | Ga0495600_0000023_57657_57950 | 97 |
| 773 | 3300047315 | Ga0495581_0009338 | Ga0495581_0009338_4011_4304 | 97 |
| 774 | 3300047317 | Ga0495604_0000251 | Ga0495604_0000251_24372_24665 | 97 |
| 775 | 3300047317 | Ga0495604_0245664 | Ga0495604_0245664_187_480 | 97 |
| 776 | 3300047317 | Ga0495604_0567091 | Ga0495604_0567091_259_552 | 97 |
| 777 | 3300047318 | Ga0495636_0077133 | Ga0495636_0077133_1039_1332 | 97 |
| 778 | 3300047319 | Ga0495674_0040004 | Ga0495674_0040004_3333_3626 | 97 |
| 779 | 3300047319 | Ga0495674_0461643 | Ga0495674_0461643_677_970 | 97 |
| 780 | 3300047320 | Ga0495672_0003697 | Ga0495672_0003697_8636_8929 | 97 |
| 781 | 3300047320 | Ga0495672_0167004 | Ga0495672_0167004_805_1110 | 97 |
| 782 | 3300047322 | Ga0495680_0006224 | Ga0495680_0006224_5388_5681 | 97 |
| 783 | 3300047444 | Ga0495675_0005468 | Ga0495675_0005468_4854_5147 | 97 |
| 784 | 3300047444 | Ga0495675_0416813 | Ga0495675_0416813_239_532 | 97 |
| 785 | 3300047447 | Ga0495685_054585 | Ga0495685_054585_453_746 | 97 |
| 786 | 3300047471 | Ga0495684_0000037 | Ga0495684_0000037_73178_73471 | 97 |
| 787 | 3300047472 | Ga0495686_0009043 | Ga0495686_0009043_1333_1650 | 97 |
| 788 | 3300047673 | Ga0495593_0153212 | Ga0495593_0153212_55_348 | 97 |
| 789 | 3300047673 | Ga0495593_0172241 | Ga0495593_0172241_360_653 | 97 |
| 790 | 3300047673 | Ga0495593_0659117 | Ga0495593_0659117_214_507 | 97 |
| 791 | 3300048088 | Ga0495602_0002980 | Ga0495602_0002980_12100_12393 | 97 |
| 792 | 3300048088 | Ga0495602_0523073 | Ga0495602_0523073_465_758 | 97 |
| 793 | 3300048088 | Ga0495602_0661447 | Ga0495602_0661447_83_376 | 97 |
| 794 | 3300048089 | Ga0495614_0003629 | Ga0495614_0003629_1631_1924 | 97 |
| 795 | 3300048090 | Ga0495615_0030918 | Ga0495615_0030918_717_1010 | 97 |
| 796 | 3300048903 | Ga0496100_0338633 | Ga0496100_0338633_458_775 | 97 |
| 797 | 3300048903 | Ga0496100_0706097 | Ga0496100_0706097_305_610 | 97 |
| 798 | 3300048904 | Ga0496101_1373097 | Ga0496101_1373097_63_356 | 97 |
| 799 | 3300048907 | Ga0496104_0115322 | Ga0496104_0115322_232_537 | 97 |
| 800 | 3300048907 | Ga0496104_0405684 | Ga0496104_0405684_291_608 | 97 |
| 801 | 3300048907 | Ga0496104_0433022 | Ga0496104_0433022_207_500 | 97 |
| 802 | 3300048907 | Ga0496104_0708472 | Ga0496104_0708472_593_886 | 97 |
| 803 | 3300048908 | Ga0496105_0008533 | Ga0496105_0008533_5138_5443 | 97 |
| 804 | 3300048908 | Ga0496105_0179939 | Ga0496105_0179939_822_1139 | 97 |
| 805 | 3300048909 | Ga0496106_0076551 | Ga0496106_0076551_1937_2230 | 97 |
| 806 | 3300048909 | Ga0496106_1420676 | Ga0496106_1420676_171_488 | 97 |
| 807 | 3300048910 | Ga0496107_0170082 | Ga0496107_0170082_930_1235 | 97 |
| 808 | 3300048911 | Ga0496108_0270466 | Ga0496108_0270466_603_896 | 97 |
| 809 | 3300048912 | Ga0496109_0186466 | Ga0496109_0186466_397_690 | 97 |
| 810 | 3300048912 | Ga0496109_0706940 | Ga0496109_0706940_464_784 | 97 |
| 811 | 3300048913 | Ga0496110_0385554 | Ga0496110_0385554_910_1203 | 97 |
| 812 | 3300048914 | Ga0496111_0659780 | Ga0496111_0659780_133_450 | 97 |
| 813 | 3300048914 | Ga0496111_1077685 | Ga0496111_1077685_234_527 | 97 |
| 814 | 3300048915 | Ga0496112_0016641 | Ga0496112_0016641_1848_2141 | 97 |
| 815 | 3300048916 | Ga0496113_0301778 | Ga0496113_0301778_369_662 | 97 |
| 816 | 3300048917 | Ga0496114_0110142 | Ga0496114_0110142_1227_1532 | 97 |
| 817 | 3300048917 | Ga0496114_0451355 | Ga0496114_0451355_812_1105 | 97 |
| 818 | 3300048918 | Ga0496115_0218617 | Ga0496115_0218617_751_1056 | 97 |
| 819 | 3300048918 | Ga0496115_0385705 | Ga0496115_0385705_59_352 | 97 |
| 820 | 3300048918 | Ga0496115_0640522 | Ga0496115_0640522_255_548 | 97 |
| 821 | 3300048918 | Ga0496115_0669474 | Ga0496115_0669474_402_719 | 97 |
| 822 | 3300048920 | Ga0496117_0000278 | Ga0496117_0000278_25087_25392 | 97 |
| 823 | 3300048927 | Ga0496124_0875548 | Ga0496124_0875548_15_320 | 97 |
| 824 | 3300048928 | Ga0496125_0113300 | Ga0496125_0113300_1553_1858 | 97 |
| 825 | 3300049127 | Ga0501306_053080 | Ga0501306_053080_255_563 | 97 |
| 826 | 3300049128 | Ga0501308_005184 | Ga0501308_005184_440_769 | 97 |
| 827 | 3300049129 | Ga0501309_000129 | Ga0501309_000129_3515_3844 | 97 |
| 828 | 3300049130 | Ga0501310_000219 | Ga0501310_000219_4309_4638 | 97 |
| 829 | 3300049160 | Ga0501304_001129 | Ga0501304_001129_1180_1509 | 97 |
| 830 | 3300049161 | Ga0501305_000428 | Ga0501305_000428_2740_3069 | 97 |
| 831 | 3300049162 | Ga0501307_005139 | Ga0501307_005139_879_1208 | 97 |
| 832 | 3300049515 | Ga0501292_053519 | Ga0501292_053519_206_511 | 97 |
| 833 | 3300049517 | Ga0501294_024649 | Ga0501294_024649_134_463 | 97 |
| 834 | 3300049522 | Ga0501299_050248 | Ga0501299_050248_208_501 | 97 |
| 835 | 3300049522 | Ga0501299_215354 | Ga0501299_215354_138_431 | 97 |
| 836 | 3300049523 | Ga0501300_000306 | Ga0501300_000306_4688_5017 | 97 |
| 837 | 3300049527 | Ga0501311_000655 | Ga0501311_000655_726_1055 | 97 |
| 838 | 3300049527 | Ga0501311_038849 | Ga0501311_038849_334_642 | 97 |
| 839 | 3300049528 | Ga0501312_001901 | Ga0501312_001901_39_368 | 97 |
| 840 | 3300049529 | Ga0501313_005114 | Ga0501313_005114_191_520 | 97 |
| 841 | 3300049530 | Ga0501314_000050 | Ga0501314_000050_754_1083 | 97 |
| 842 | 3300049531 | Ga0501315_001210 | Ga0501315_001210_174_503 | 97 |
| 843 | 3300049531 | Ga0501315_027922 | Ga0501315_027922_438_758 | 97 |
| 844 | 3300049532 | Ga0501316_030814 | Ga0501316_030814_224_553 | 97 |
| 845 | 3300049533 | Ga0501317_002747 | Ga0501317_002747_1214_1543 | 97 |
| 846 | 3300049534 | Ga0501318_012445 | Ga0501318_012445_538_867 | 97 |
| 847 | 3300049537 | Ga0501321_027411 | Ga0501321_027411_165_494 | 97 |
| 848 | 3300049541 | Ga0501325_017376 | Ga0501325_017376_386_694 | 97 |
| 849 | 3300049570 | Ga0501033_0040060 | Ga0501033_0040060_2090_2395 | 97 |
| 850 | 3300049570 | Ga0501033_0932162 | Ga0501033_0932162_99_404 | 97 |
| 851 | 3300049571 | Ga0501034_0126349 | Ga0501034_0126349_2090_2395 | 97 |
| 852 | 3300049571 | Ga0501034_0252901 | Ga0501034_0252901_1009_1317 | 97 |
| 853 | 3300049572 | Ga0501036_0058733 | Ga0501036_0058733_2585_2890 | 97 |
| 854 | 3300049572 | Ga0501036_0310142 | Ga0501036_0310142_604_918 | 97 |
| 855 | 3300049572 | Ga0501036_0956207 | Ga0501036_0956207_330_644 | 97 |
| 856 | 3300049573 | Ga0501037_0033043 | Ga0501037_0033043_3084_3389 | 97 |
| 857 | 3300049573 | Ga0501037_0474293 | Ga0501037_0474293_141_452 | 97 |
| 858 | 3300049574 | Ga0501038_0030062 | Ga0501038_0030062_1194_1499 | 97 |
| 859 | 3300049575 | Ga0501039_0129507 | Ga0501039_0129507_1263_1568 | 97 |
| 860 | 3300049575 | Ga0501039_0138074 | Ga0501039_0138074_182_493 | 97 |
| 861 | 3300049575 | Ga0501039_0558671 | Ga0501039_0558671_451_765 | 97 |
| 862 | 3300049577 | Ga0501041_0461416 | Ga0501041_0461416_261_572 | 97 |
| 863 | 3300049578 | Ga0501042_0759586 | Ga0501042_0759586_12_317 | 97 |
| 864 | 3300049579 | Ga0501043_0007959 | Ga0501043_0007959_3277_3582 | 97 |
| 865 | 3300049579 | Ga0501043_0445092 | Ga0501043_0445092_294_590 | 97 |
| 866 | 3300049580 | Ga0501046_0195899 | Ga0501046_0195899_461_766 | 97 |
| 867 | 3300049581 | Ga0501047_0034967 | Ga0501047_0034967_1798_2103 | 97 |
| 868 | 3300049581 | Ga0501047_0694399 | Ga0501047_0694399_16_321 | 97 |
| 869 | 3300049582 | Ga0501048_0282626 | Ga0501048_0282626_114_425 | 97 |
| 870 | 3300049582 | Ga0501048_1094189 | Ga0501048_1094189_258_563 | 97 |
| 871 | 3300049584 | Ga0501068_0126379 | Ga0501068_0126379_520_825 | 97 |
| 872 | 3300049585 | Ga0501069_0278331 | Ga0501069_0278331_255_560 | 97 |
| 873 | 3300049586 | Ga0501070_0712859 | Ga0501070_0712859_457_765 | 97 |
| 874 | 3300049587 | Ga0501071_0119317 | Ga0501071_0119317_472_783 | 97 |
| 875 | 3300049587 | Ga0501071_0233595 | Ga0501071_0233595_346_657 | 97 |
| 876 | 3300049587 | Ga0501071_1007948 | Ga0501071_1007948_216_521 | 97 |
| 877 | 3300049588 | Ga0501072_0275302 | Ga0501072_0275302_240_551 | 97 |
| 878 | 3300049589 | Ga0501073_0009894 | Ga0501073_0009894_5898_6203 | 97 |
| 879 | 3300049589 | Ga0501073_0238113 | Ga0501073_0238113_730_1041 | 97 |
| 880 | 3300049590 | Ga0501074_0016929 | Ga0501074_0016929_2172_2477 | 97 |
| 881 | 3300049590 | Ga0501074_0470645 | Ga0501074_0470645_174_506 | 97 |
| 882 | 3300049591 | Ga0501075_0712888 | Ga0501075_0712888_384_677 | 97 |
| 883 | 3300049591 | Ga0501075_1055326 | Ga0501075_1055326_45_338 | 97 |
| 884 | 3300049592 | Ga0501076_0361483 | Ga0501076_0361483_68_379 | 97 |
| 885 | 3300049592 | Ga0501076_0620888 | Ga0501076_0620888_83_376 | 97 |
| 886 | 3300049593 | Ga0501077_0325612 | Ga0501077_0325612_287_604 | 97 |
| 887 | 3300049593 | Ga0501077_1040063 | Ga0501077_1040063_72_392 | 97 |
| 888 | 3300049649 | Ga0501198_128946 | Ga0501198_128946_198_491 | 97 |
| 889 | 3300049653 | Ga0501206_014163 | Ga0501206_014163_388_717 | 97 |
| 890 | 3300049657 | Ga0501210_001725 | Ga0501210_001725_827_1156 | 97 |
| 891 | 3300049658 | Ga0501211_004106 | Ga0501211_004106_770_1099 | 97 |
| 892 | 3300049660 | Ga0501216_109924 | Ga0501216_109924_235_528 | 97 |
| 893 | 3300049662 | Ga0501222_020639 | Ga0501222_020639_121_450 | 97 |
| 894 | 3300049663 | Ga0501223_024425 | Ga0501223_024425_359_688 | 97 |
| 895 | 3300049663 | Ga0501223_046172 | Ga0501223_046172_155_448 | 97 |
| 896 | 3300049663 | Ga0501223_135690 | Ga0501223_135690_142_435 | 97 |
| 897 | 3300049665 | Ga0501227_004174 | Ga0501227_004174_368_688 | 97 |
| 898 | 3300049668 | Ga0501233_003475 | Ga0501233_003475_1698_2027 | 97 |
| 899 | 3300049669 | Ga0501235_003946 | Ga0501235_003946_1839_2168 | 97 |
| 900 | 3300049672 | Ga0501239_039619 | Ga0501239_039619_181_474 | 97 |
| 901 | 3300049675 | Ga0501243_109855 | Ga0501243_109855_107_406 | 97 |
| 902 | 3300049675 | Ga0501243_137035 | Ga0501243_137035_157_450 | 97 |
| 903 | 3300049679 | Ga0501249_008085 | Ga0501249_008085_1036_1365 | 97 |
| 904 | 3300049683 | Ga0501253_063853 | Ga0501253_063853_75_404 | 97 |
| 905 | 3300049684 | Ga0501255_016054 | Ga0501255_016054_471_800 | 97 |
| 906 | 3300049687 | Ga0501258_002063 | Ga0501258_002063_913_1242 | 97 |
| 907 | 3300049704 | Ga0501221_003510 | Ga0501221_003510_135_464 | 97 |
| 908 | 3300049705 | Ga0501225_0003592 | Ga0501225_0003592_817_1146 | 97 |
| 909 | 3300049706 | Ga0501229_038397 | Ga0501229_038397_47_355 | 97 |
| 910 | 3300049707 | Ga0501234_077211 | Ga0501234_077211_164_493 | 97 |
| 911 | 3300049741 | Ga0501079_0264274 | Ga0501079_0264274_796_1107 | 97 |
| 912 | 3300049741 | Ga0501079_1522117 | Ga0501079_1522117_183_503 | 97 |
| 913 | 3300049742 | Ga0501080_0008652 | Ga0501080_0008652_1086_1397 | 97 |
| 914 | 3300049742 | Ga0501080_0057515 | Ga0501080_0057515_3085_3390 | 97 |
| 915 | 3300049743 | Ga0501081_0119454 | Ga0501081_0119454_1126_1437 | 97 |
| 916 | 3300049744 | Ga0501083_0035946 | Ga0501083_0035946_2719_3024 | 97 |
| 917 | 3300049759 | Ga0501262_004570 | Ga0501262_004570_1023_1343 | 97 |
| 918 | 3300049764 | Ga0501267_000175 | Ga0501267_000175_2982_3311 | 97 |
| 919 | 3300049768 | Ga0501271_006347 | Ga0501271_006347_450_779 | 97 |
| 920 | 3300049769 | Ga0501272_032672 | Ga0501272_032672_224_553 | 97 |
| 921 | 3300049772 | Ga0501275_076951 | Ga0501275_076951_13_327 | 97 |
| 922 | 3300049779 | Ga0501283_048226 | Ga0501283_048226_154_483 | 97 |
| 923 | 3300049822 | Ga0501035_0268059 | Ga0501035_0268059_969_1274 | 97 |
| 924 | 3300049822 | Ga0501035_0674645 | Ga0501035_0674645_244_555 | 97 |
| 925 | 3300049823 | Ga0501044_0015304 | Ga0501044_0015304_1371_1676 | 97 |
| 926 | 3300049823 | Ga0501044_0525921 | Ga0501044_0525921_598_903 | 97 |
| 927 | 3300050489 | nmdc:mga03683_622358_c1 | nmdc:mga03683_622358_c1_188_517 | 97 |
| 928 | 3300050493 | nmdc:mga0k408_25245_c2 | nmdc:mga0k408_25245_c2_794_1111 | 97 |
| 929 | 3300050496 | nmdc:mga07m45_7457_c1 | nmdc:mga07m45_7457_c1_4884_5201 | 97 |
| 930 | 3300050508 | nmdc:mga09592_852973_c1 | nmdc:mga09592_852973_c1_295_588 | 97 |
| 931 | 3300050509 | nmdc:mga0qj67_60894_c1 | nmdc:mga0qj67_60894_c1_1243_1551 | 97 |
| 932 | 3300050509 | nmdc:mga0qj67_638307_c1 | nmdc:mga0qj67_638307_c1_350_658 | 97 |
| 933 | 3300050509 | nmdc:mga0qj67_643432_c1 | nmdc:mga0qj67_643432_c1_393_686 | 97 |
| 934 | 3300050510 | nmdc:mga06r32_441888_c1 | nmdc:mga06r32_441888_c1_328_639 | 97 |
| 935 | 3300050510 | nmdc:mga06r32_687524_c1 | nmdc:mga06r32_687524_c1_320_628 | 97 |
| 936 | 3300050511 | nmdc:mga08y16_107923_c1 | nmdc:mga08y16_107923_c1_1983_2276 | 97 |
| 937 | 3300050512 | nmdc:mga0n895_2003095_c1 | nmdc:mga0n895_2003095_c1_188_481 | 97 |
| 938 | 3300050512 | nmdc:mga0n895_766365_c1 | nmdc:mga0n895_766365_c1_460_753 | 97 |
| 939 | 3300050513 | nmdc:mga0rr50_1745688_c1 | nmdc:mga0rr50_1745688_c1_101_394 | 97 |
| 940 | 3300050513 | nmdc:mga0rr50_385862_c1 | nmdc:mga0rr50_385862_c1_12_314 | 97 |
| 941 | 3300050514 | nmdc:mga08x19_192665_c1 | nmdc:mga08x19_192665_c1_219_512 | 97 |
| 942 | 3300050514 | nmdc:mga08x19_312301_c1 | nmdc:mga08x19_312301_c1_44_364 | 97 |
| 943 | 3300050515 | nmdc:mga0a205_238225_c1 | nmdc:mga0a205_238225_c1_888_1190 | 97 |
| 944 | 3300053077 | Ga0495601_0002235 | Ga0495601_0002235_7093_7386 | 97 |
| 945 | 3300053077 | Ga0495601_0590726 | Ga0495601_0590726_227_520 | 97 |
| 946 | 3300053078 | Ga0495612_0000577 | Ga0495612_0000577_10080_10373 | 97 |
| 947 | 3300053078 | Ga0495612_0478171 | Ga0495612_0478171_114_407 | 97 |
| 948 | 3300053083 | Ga0495655_0297108 | Ga0495655_0297108_21_320 | 97 |
| 949 | 3300053084 | Ga0495595_0011132 | Ga0495595_0011132_1419_1712 | 97 |
| 950 | 3300053085 | Ga0495619_0006426 | Ga0495619_0006426_6307_6600 | 97 |
| 951 | 3300053093 | Ga0500651_0700854 | Ga0500651_0700854_208_513 | 97 |
| 952 | 3300053122 | Ga0500608_199548 | Ga0500608_199548_332_649 | 97 |
| 953 | 3300053139 | Ga0500568_0168736 | Ga0500568_0168736_121_426 | 97 |
| 954 | 3300053151 | Ga0500604_0064906 | Ga0500604_0064906_361_666 | 97 |
| 955 | 3300053158 | Ga0500627_0292841 | Ga0500627_0292841_109_414 | 97 |
| 956 | 3300053160 | Ga0500633_0277547 | Ga0500633_0277547_214_519 | 97 |
| 957 | 3300053177 | Ga0500636_0105745 | Ga0500636_0105745_366_683 | 97 |
| 958 | 3300053177 | Ga0500636_0495408 | Ga0500636_0495408_15_338 | 97 |
| 959 | 3300054114 | Ga0501084_0547311 | Ga0501084_0547311_316_621 | 97 |
| 960 | 3300059421 | Ga0590071_032829 | Ga0590071_032829_174_479 | 97 |
| 961 | 3300059423 | Ga0590074_029865 | Ga0590074_029865_163_477 | 97 |
| 962 | 3300059424 | Ga0590075_170084 | Ga0590075_170084_152_445 | 97 |
| 963 | 3300059645 | Ga0587076_016241 | Ga0587076_016241_97_414 | 97 |
| 964 | 3300060353 | Ga0501082_0653376 | Ga0501082_0653376_603_908 | 97 |
| 965 | 3300060353 | Ga0501082_0717548 | Ga0501082_0717548_442_753 | 97 |
| 966 | iso_pu_bacteria | 2643221585 | 2643935861 | 97 |
| 967 | iso_pu_bacteria | 2643221639 | 2644221322 | 97 |
| 968 | iso_pu_bacteria | 2643221646 | 2644257920 | 97 |
| 969 | iso_pu_bacteria | 2643221656 | 2644317644 | 97 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6nci-assembly1.cif.gz_B | crystal structure of cdp-chase: vector data collection | 0.9268 | 8 | 41 |
| 6nch-assembly1.cif.gz_B | crystal structure of cdp-chase: raster data collection | 0.9251 | 8 | 41 |
| 4hfq-assembly1.cif.gz_B | crystal structure of udp-x diphosphatase | 0.9062 | 2 | 46 |
| 6inr-assembly1.cif.gz_A | the crystal structure of phytoplasmal effector causing phyllody symptoms 1 (phyl1) | 0.8833 | 2 | 49 |
| 4k2p-assembly2.cif.gz_B | the structure of a quintuple mutant of the tiam1 ph-cc-ex domain | 0.8722 | 2 | 44 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3q4iA01 | Special;Helix non-globular;Single alpha-helices involved in coiled-coils or other helix-helix interfaces; | 0.9747 | 8 | 39 | 6.10.250.1120 |
| 3q1pA01 | Special;Helix non-globular;Single alpha-helices involved in coiled-coils or other helix-helix interfaces; | 0.9714 | 8 | 39 | 6.10.250.1120 |
| 6nciA01 | Special;Helix non-globular;Single alpha-helices involved in coiled-coils or other helix-helix interfaces; | 0.9607 | 8 | 39 | 6.10.250.1120 |
| af_Q2FX96_176_237_1.20.5.1930 | Mainly Alpha;Up-down Bundle;Single alpha-helices involved in coiled-coils or other helix-helix interfaces; | 0.9438 | 6 | 46 | 1.20.5.1930 |
| 6nciB01 | Special;Helix non-globular;Single alpha-helices involved in coiled-coils or other helix-helix interfaces; | 0.938 | 8 | 39 | 6.10.250.1120 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3R6Z6P1-F1-model_v4 | ER membrane protein complex subunit 6 | 0.8855 | 2 | 49 |
GO:0016020
|
| AF-A0A7J4NUR5-F1-model_v4 | NADH-quinone oxidoreductase subunit NuoK (EC 1.6.5.11) | 0.8737 | 1 | 59 |
GO:0016020
GO:0016491 |
| AF-A0A3A9AE88-F1-model_v4 | DUF2508 family protein | 0.871 | 1 | 50 |
|
| AF-A0A534KFM0-F1-model_v4 | NADH-quinone oxidoreductase subunit NuoK (EC 1.6.5.11) | 0.8363 | 1 | 61 |
GO:0016651
GO:0030964 GO:0042773 |
| AF-A0A7J4NUR5-F1-model_v4 | NADH-quinone oxidoreductase subunit NuoK (EC 1.6.5.11) | 0.8078 | 1 | 59 |
GO:0016020
GO:0016491 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar