F487066

General Info

Members Datasets Scaffolds Average Seq Length
969 502 940 100

Family's Representative Sequence

Representative Sequence 3300014969|Ga0157376_11997844|Ga0157376_119978442
Length 109
Sequence MNLAIIAAAPKPTTTWYLILSAVLFGVGTLGVMVRRNPLVLFMCVELMLNAVNLSFVAFAQAYGVGGQVFVFFVMTVAAAEAAVGLAIIIALFRHKQTVDLQNINLLKG

Samples

Sample ID Description Type Environment
1 2511231026 Herbaspirillum sp. YR522 Isolate Rhizosphere
2 2521172590 Herbaspirillum sp. GW103 Isolate Rhizosphere
3 2551306416 Herbaspirillum seropedicae Os34 Isolate Unclassified
4 2593339238 Luteibacter sp. UNCMF366Tsu5.1 Isolate Unclassified
5 2593339239 Luteibacter sp. UNCMF331Sha3.1 Isolate Unclassified
6 2643221585 Pelomonas sp. Root662 Isolate Unclassified
7 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
8 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
9 2643221656 Pelomonas sp. Root405 Isolate Unclassified
10 2718218334 Luteibacter rhizovicinus LJ96 Isolate Rhizosphere
11 2734482264 Dyella sp. AD052 Isolate Unclassified
12 2738543009 Luteibacter sp. OK325 Isolate Unclassified
13 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
14 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
15 2839094727 Herbaspirillum robiniae HZ10 Isolate Nodule
16 2842914999 Luteibacter sp. R-72151 Isolate Unclassified
17 2842918807 Luteibacter sp. R-73110 Isolate Unclassified
18 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
19 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
20 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
21 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
22 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
23 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
24 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
25 2919085039 Luteibacter sp. 1214 Isolate Unclassified
26 2919404418 Luteibacter sp. 3190 Isolate Unclassified
27 2923510766 Herbaspirillum rubrisubalbicans SLBN-127 Isolate Rhizosphere
28 2928130867 Herbaspirillum seropedicae 1977 Isolate Unclassified
29 2953994433 Luteibacter sp. W1I16 Isolate Rhizosphere
30 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
31 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
32 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
33 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
34 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
35 3300003567 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_04_fullP_mix3_d1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
36 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
37 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
38 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
39 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
40 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
41 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
42 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
43 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
44 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
45 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
46 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
47 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
48 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
49 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
50 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
51 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
52 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
53 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
54 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
55 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
56 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
57 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
58 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
59 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
60 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
61 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
62 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
63 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
64 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
65 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
66 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
67 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
68 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
69 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
70 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
71 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
72 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
73 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
74 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
75 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
76 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
77 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
78 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
79 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
80 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
81 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
82 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
83 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
84 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
85 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
86 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
87 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
88 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
89 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
90 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
91 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
92 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
93 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
94 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
95 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
96 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
97 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
98 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
99 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
100 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
101 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
102 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
103 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
104 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
105 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
106 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
107 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
108 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
109 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
110 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
111 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
112 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
113 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
114 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
115 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
116 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
117 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
118 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
119 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
120 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
121 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
122 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
123 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
124 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
125 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
126 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
127 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
128 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
129 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
130 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
131 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
132 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
133 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
134 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
135 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
136 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
137 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
138 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
139 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
140 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
141 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
142 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
143 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
144 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
145 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
146 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
147 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
148 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
149 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
150 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
151 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
152 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
153 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
154 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
155 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
156 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
157 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
158 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
159 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
160 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
161 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
162 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
163 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
164 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
165 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
166 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
167 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
168 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
169 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
232 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
233 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
234 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
235 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
236 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
238 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
239 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
240 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
241 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
242 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
243 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
244 3300028036 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 Metagenome Rhizosphere
245 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
246 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
247 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
248 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
249 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
250 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
251 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
252 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
253 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
254 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
255 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
256 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
257 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
258 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
259 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
260 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
261 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
262 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
263 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
264 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
265 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
266 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
267 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
268 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
269 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
270 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
271 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
272 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
273 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
274 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
275 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
276 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
277 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
278 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
279 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
280 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
281 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
282 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
283 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
284 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
285 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
286 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
287 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
288 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
289 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
290 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
291 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
292 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
293 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
294 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
295 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
296 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
297 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
298 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
299 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
300 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
301 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
302 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
303 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
304 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
305 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
306 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
307 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
308 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
309 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
310 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
311 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
312 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
313 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
314 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
315 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
316 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
317 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
318 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
319 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
320 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
321 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
322 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
323 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
324 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
325 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
326 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
327 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
328 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
329 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
330 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
331 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
332 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
333 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
334 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
335 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
336 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
337 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
338 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
339 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
340 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
341 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
342 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
343 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
344 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
345 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
346 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
347 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
348 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
349 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
350 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
351 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
352 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
353 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
354 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
355 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
356 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
357 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
358 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
359 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
360 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
361 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
362 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
363 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
364 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
365 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
366 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
367 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
368 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
369 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
370 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
371 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
372 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
373 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
374 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
375 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
376 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
377 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
378 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
379 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
380 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
381 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
382 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
383 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
384 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
385 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
386 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
387 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
388 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
389 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
390 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
391 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
392 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
393 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
394 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
395 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
396 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
397 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
398 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
399 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
400 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
401 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
402 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
403 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
404 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
405 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
406 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
407 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
408 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
409 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
410 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
411 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
412 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
413 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
414 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
415 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
416 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
417 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
418 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
419 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
420 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
421 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
422 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
423 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
424 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
425 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
426 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
427 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
428 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
429 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
430 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
431 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
432 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
433 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
434 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
435 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
436 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
437 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
438 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
439 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
440 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
441 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
442 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
443 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
444 3300049657 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought Metagenome Rhizosphere
445 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
446 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
447 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
448 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
449 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
450 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
451 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
452 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
453 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
454 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
455 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
456 3300049684 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control Metagenome Rhizosphere
457 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
458 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
459 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
460 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
461 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
462 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
463 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
464 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
465 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
466 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
467 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
468 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
469 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
470 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
471 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
472 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
473 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
474 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
475 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
476 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
477 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
478 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
479 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
480 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
481 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
482 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
483 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
484 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
485 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
486 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
487 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
488 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
489 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
490 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
491 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
492 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
493 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
494 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
495 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
496 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
497 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
498 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
499 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
500 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
501 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
502 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.63
Metatranscriptomes 2.37
Isolates 2.99

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.82
Nodule 0.41
Rhizoplane 2.68
Rhizosphere 89.68
Stem 0
Stem Tuber 0
Unclassified 3.41

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJQas_1020049 3300000549 Bacteria 778
2 JGI24738J21930_10006379 3300002075 Bacteria 2772
3 JGI25152J39213_1025333 3300002773 Bacteria 983
4 JGI25406J46586_10017790 3300003203 Bacteria 2932
5 JGI25153J46596_10055107 3300003215 Bacteria 1114
6 Ga0006554J51385_1033774 3300003567 Bacteria 2186
7 Ga0006562J51391_1061648 3300003578 Bacteria 4010
8 Ga0055538_1000155 3300003751 Bacteria 46426
9 Ga0055539_1000205 3300003752 Bacteria 46426
10 Ga0055533_1000100 3300003756 Bacteria 111692
11 Ga0055533_1000207 3300003756 Bacteria 46426
12 Ga0055525_1000284 3300003759 Bacteria 46426
13 Ga0055525_1000947 3300003759 Bacteria 8022
14 Ga0055530_10014353 3300003791 Bacteria 2644
15 Ga0055531_10000310 3300003794 Bacteria 47933
16 Ga0055541_1000133 3300003841 Bacteria 46426
17 Ga0055543_1030932 3300004625 Bacteria 935
18 Ga0065165_1000028 3300005262 Bacteria 224430
19 Ga0065712_10391693 3300005290 Bacteria 741
20 Ga0070658_10003448 3300005327 Bacteria 12998
21 Ga0070658_10011571 3300005327 Bacteria 7077
22 Ga0070658_10238554 3300005327 Bacteria 1541
23 Ga0070658_10339180 3300005327 Bacteria 1285
24 Ga0070658_10368122 3300005327 Bacteria 1232
25 Ga0070658_10564196 3300005327 Bacteria 985
26 Ga0070658_10691620 3300005327 Bacteria 885
27 Ga0070658_11388562 3300005327 Bacteria 609
28 Ga0070676_10045115 3300005328 Bacteria 2567
29 Ga0070676_10126377 3300005328 Bacteria 1612
30 Ga0070676_10327830 3300005328 Bacteria 1046
31 Ga0070683_100026589 3300005329 Bacteria 5213
32 Ga0070683_100042213 3300005329 Bacteria 4199
33 Ga0070683_100053034 3300005329 Bacteria 3758
34 Ga0070683_100244034 3300005329 Bacteria 1708
35 Ga0070683_100361467 3300005329 Bacteria 1382
36 Ga0070683_100583988 3300005329 Bacteria 1069
37 Ga0070683_101823334 3300005329 Bacteria 585
38 Ga0070683_102390580 3300005329 Bacteria 506
39 Ga0070690_100117944 3300005330 Bacteria 1778
40 Ga0070690_100254849 3300005330 Bacteria 1242
41 Ga0070670_100194310 3300005331 Bacteria 1763
42 Ga0070670_100559842 3300005331 Bacteria 1020
43 Ga0070670_100814984 3300005331 Bacteria 843
44 Ga0070670_101004883 3300005331 Bacteria 759
45 Ga0070670_101581087 3300005331 Bacteria 603
46 Ga0068869_100052726 3300005334 Bacteria 2954
47 Ga0070666_10669473 3300005335 Bacteria 760
48 Ga0070680_100001111 3300005336 Bacteria 19323
49 Ga0070680_100048545 3300005336 Bacteria 3460
50 Ga0070680_101719489 3300005336 Bacteria 544
51 Ga0070680_101944804 3300005336 Bacteria 510
52 Ga0068868_101508223 3300005338 Bacteria 629
53 Ga0068868_101613833 3300005338 Bacteria 610
54 Ga0070660_100541286 3300005339 Bacteria 971
55 Ga0070660_101180715 3300005339 Bacteria 649
56 Ga0070689_100040508 3300005340 Bacteria 3572
57 Ga0070689_101276798 3300005340 Bacteria 661
58 Ga0070689_101992526 3300005340 Bacteria 531
59 Ga0070661_100164706 3300005344 Bacteria 1681
60 Ga0070661_100167277 3300005344 Bacteria 1668
61 Ga0070661_100275338 3300005344 Bacteria 1304
62 Ga0070661_100303941 3300005344 Bacteria 1242
63 Ga0070661_101198879 3300005344 Bacteria 635
64 Ga0070661_101247530 3300005344 Bacteria 623
65 Ga0070661_101903415 3300005344 Bacteria 506
66 Ga0070692_10054841 3300005345 Bacteria 2082
67 Ga0070668_100116431 3300005347 Bacteria 2131
68 Ga0070668_100813502 3300005347 Bacteria 831
69 Ga0070668_100946918 3300005347 Bacteria 772
70 Ga0070669_100095390 3300005353 Bacteria 2237
71 Ga0070675_100004759 3300005354 Bacteria 10361
72 Ga0070675_100230725 3300005354 Bacteria 1615
73 Ga0070675_100245717 3300005354 Bacteria 1565
74 Ga0070675_100309384 3300005354 Bacteria 1394
75 Ga0070675_101587900 3300005354 Bacteria 603
76 Ga0070675_101730905 3300005354 Bacteria 577
77 Ga0070671_100175628 3300005355 Bacteria 1812
78 Ga0070671_100407398 3300005355 Bacteria 1164
79 Ga0070671_100516138 3300005355 Bacteria 1029
80 Ga0070671_100525976 3300005355 Bacteria 1019
81 Ga0070671_100945627 3300005355 Bacteria 754
82 Ga0070674_100401045 3300005356 Bacteria 1121
83 Ga0070673_100391182 3300005364 Bacteria 1241
84 Ga0070673_100663455 3300005364 Bacteria 955
85 Ga0070673_100770639 3300005364 Bacteria 887
86 Ga0070673_102002971 3300005364 Bacteria 550
87 Ga0070688_100018584 3300005365 Bacteria 4013
88 Ga0070659_100048436 3300005366 Bacteria 3339
89 Ga0070659_100184565 3300005366 Bacteria 1713
90 Ga0070659_100297699 3300005366 Bacteria 1345
91 Ga0070659_100308167 3300005366 Bacteria 1322
92 Ga0070659_100920587 3300005366 Bacteria 765
93 Ga0070667_100137301 3300005367 Bacteria 2138
94 Ga0070667_100654787 3300005367 Bacteria 970
95 Ga0070709_10009593 3300005434 Bacteria 5344
96 Ga0070709_10036089 3300005434 Bacteria 3009
97 Ga0070709_10056629 3300005434 Bacteria 2480
98 Ga0070709_11591162 3300005434 Bacteria 532
99 Ga0070714_100004697 3300005435 Bacteria 10327
100 Ga0070714_100029810 3300005435 Bacteria 4538
101 Ga0070714_100392216 3300005435 Bacteria 1311
102 Ga0070714_101598920 3300005435 Bacteria 637
103 Ga0070713_100000168 3300005436 Bacteria 43646
104 Ga0070713_100051526 3300005436 Bacteria 3404
105 Ga0070713_102055622 3300005436 Bacteria 554
106 Ga0070710_10106524 3300005437 Bacteria 1678
107 Ga0070710_10175492 3300005437 Bacteria 1338
108 Ga0070711_100115217 3300005439 Bacteria 1979
109 Ga0070711_100884414 3300005439 Bacteria 762
110 Ga0070700_100719378 3300005441 Bacteria 796
111 Ga0070694_100050054 3300005444 Bacteria 2815
112 Ga0070694_100092890 3300005444 Bacteria 2120
113 Ga0070663_100032502 3300005455 Bacteria 3597
114 Ga0070663_100114062 3300005455 Bacteria 2034
115 Ga0070678_100090584 3300005456 Bacteria 2345
116 Ga0070678_101610695 3300005456 Bacteria 610
117 Ga0070678_101705827 3300005456 Bacteria 593
118 Ga0070662_100146176 3300005457 Bacteria 1836
119 Ga0070662_100269442 3300005457 Bacteria 1374
120 Ga0070662_100840166 3300005457 Bacteria 782
121 Ga0070662_101342267 3300005457 Bacteria 616
122 Ga0070681_10023492 3300005458 Bacteria 6201
123 Ga0070681_10077854 3300005458 Bacteria 3273
124 Ga0070681_10324270 3300005458 Bacteria 1450
125 Ga0070681_10401530 3300005458 Bacteria 1282
126 Ga0070681_10791978 3300005458 Bacteria 865
127 Ga0068867_100010986 3300005459 Bacteria 6382
128 Ga0070685_10087289 3300005466 Bacteria 1882
129 Ga0070685_10093785 3300005466 Bacteria 1822
130 Ga0070706_100454631 3300005467 Bacteria 1192
131 Ga0070699_100230574 3300005518 Bacteria 1651
132 Ga0070679_100032089 3300005530 Bacteria 5194
133 Ga0070679_100888116 3300005530 Bacteria 835
134 Ga0070679_101108943 3300005530 Bacteria 736
135 Ga0070679_101290837 3300005530 Bacteria 676
136 Ga0070684_100017327 3300005535 Bacteria 5909
137 Ga0070684_100027011 3300005535 Bacteria 4840
138 Ga0070684_100063417 3300005535 Bacteria 3239
139 Ga0070684_100310942 3300005535 Bacteria 1447
140 Ga0070684_100562247 3300005535 Bacteria 1059
141 Ga0070684_100920190 3300005535 Bacteria 820
142 Ga0068853_100576328 3300005539 Bacteria 1067
143 Ga0068853_101749056 3300005539 Bacteria 603
144 Ga0070672_100114001 3300005543 Bacteria 2206
145 Ga0070672_100166475 3300005543 Bacteria 1831
146 Ga0070672_100265732 3300005543 Bacteria 1448
147 Ga0070672_100300661 3300005543 Bacteria 1360
148 Ga0070672_100567463 3300005543 Bacteria 986
149 Ga0070672_101092428 3300005543 Bacteria 709
150 Ga0070672_101306804 3300005543 Bacteria 648
151 Ga0070686_100639050 3300005544 Bacteria 842
152 Ga0070686_100971405 3300005544 Bacteria 695
153 Ga0070695_100318783 3300005545 Bacteria 1155
154 Ga0070695_100327524 3300005545 Bacteria 1141
155 Ga0070695_100520785 3300005545 Bacteria 923
156 Ga0070695_101534646 3300005545 Bacteria 555
157 Ga0070695_101637135 3300005545 Bacteria 538
158 Ga0070696_100113732 3300005546 Bacteria 1951
159 Ga0070696_100122741 3300005546 Bacteria 1882
160 Ga0070693_100012610 3300005547 Bacteria 4280
161 Ga0070693_100797629 3300005547 Bacteria 700
162 Ga0070704_100003924 3300005549 Bacteria 8562
163 Ga0070704_101408657 3300005549 Bacteria 640
164 Ga0068855_100004465 3300005563 Bacteria 17102
165 Ga0068855_100068633 3300005563 Bacteria 4127
166 Ga0068855_100334991 3300005563 Bacteria 1670
167 Ga0070664_100046540 3300005564 Bacteria 3663
168 Ga0070664_100071150 3300005564 Bacteria 2980
169 Ga0070664_100377929 3300005564 Bacteria 1293
170 Ga0070664_100402657 3300005564 Bacteria 1251
171 Ga0070664_100428124 3300005564 Bacteria 1213
172 Ga0070664_100492270 3300005564 Bacteria 1129
173 Ga0070664_101350123 3300005564 Bacteria 674
174 Ga0070664_101799579 3300005564 Bacteria 581
175 Ga0068857_100036956 3300005577 Bacteria 4325
176 Ga0068857_100091619 3300005577 Bacteria 2721
177 Ga0068857_100672225 3300005577 Bacteria 982
178 Ga0068854_100029527 3300005578 Bacteria 3796
179 Ga0068854_100395260 3300005578 Bacteria 1142
180 Ga0068856_100348838 3300005614 Bacteria 1499
181 Ga0068856_100358922 3300005614 Bacteria 1476
182 Ga0068856_100398126 3300005614 Bacteria 1397
183 Ga0070702_100973644 3300005615 Bacteria 670
184 Ga0068852_100228011 3300005616 Bacteria 1775
185 Ga0068852_100249695 3300005616 Bacteria 1699
186 Ga0068852_100345930 3300005616 Bacteria 1450
187 Ga0068852_100803720 3300005616 Bacteria 955
188 Ga0068859_100020486 3300005617 Bacteria 6637
189 Ga0068859_100531651 3300005617 Bacteria 1271
190 Ga0068859_102185738 3300005617 Bacteria 611
191 Ga0068864_100048790 3300005618 Bacteria 3641
192 Ga0068866_11271712 3300005718 Bacteria 534
193 Ga0068861_100248109 3300005719 Bacteria 1518
194 Ga0068861_100265826 3300005719 Bacteria 1471
195 Ga0068861_101091389 3300005719 Bacteria 767
196 Ga0068851_10233002 3300005834 Bacteria 1039
197 Ga0068851_10310274 3300005834 Bacteria 909
198 Ga0068870_10001350 3300005840 Bacteria 9905
199 Ga0068863_100345344 3300005841 Bacteria 1448
200 Ga0068863_101500322 3300005841 Bacteria 683
201 Ga0068858_100020744 3300005842 Bacteria 6139
202 Ga0068858_100086515 3300005842 Bacteria 2916
203 Ga0068858_102211906 3300005842 Bacteria 544
204 Ga0068860_100038331 3300005843 Bacteria 4584
205 Ga0068862_100088865 3300005844 Bacteria 2689
206 Ga0068862_100607312 3300005844 Bacteria 1051
207 Ga0081539_10000103 3300005985 Bacteria 197839
208 Ga0070717_10058340 3300006028 Bacteria 3192
209 Ga0070717_10471490 3300006028 Bacteria 1133
210 Ga0070717_10724409 3300006028 Bacteria 904
211 Ga0070712_100003656 3300006175 Bacteria 9482
212 Ga0070712_100211655 3300006175 Bacteria 1529
213 Ga0070712_100257583 3300006175 Bacteria 1397
214 Ga0075369_10019451 3300006186 Bacteria 2772
215 Ga0075366_10027909 3300006195 Bacteria 3312
216 Ga0075370_10050067 3300006353 Bacteria 2369
217 Ga0068871_100288671 3300006358 Bacteria 1437
218 Ga0075430_100191765 3300006846 Bacteria 1698
219 Ga0075430_100655505 3300006846 Bacteria 866
220 Ga0075430_101006359 3300006846 Bacteria 687
221 Ga0075431_100075350 3300006847 Bacteria 3482
222 Ga0075431_100204773 3300006847 Bacteria 2017
223 Ga0075431_101245805 3300006847 Bacteria 706
224 Ga0075433_10339054 3300006852 Bacteria 1329
225 Ga0075429_101055457 3300006880 Bacteria 710
226 Ga0075429_101408755 3300006880 Bacteria 607
227 Ga0068865_100236802 3300006881 Bacteria 1435
228 Ga0075436_100100836 3300006914 Bacteria 2011
229 Ga0075436_100560910 3300006914 Bacteria 839
230 Ga0097620_100020486 3300006931 Bacteria 6637
231 Ga0097620_100531639 3300006931 Bacteria 1271
232 Ga0097620_102185929 3300006931 Bacteria 611
233 Ga0079104_1016283 3300006946 Bacteria 2179
234 Ga0075435_100004837 3300007076 Bacteria 9322
235 Ga0075435_100483296 3300007076 Bacteria 1070
236 Ga0099794_10023946 3300007265 Bacteria 2798
237 Ga0099795_10003070 3300007788 Bacteria 4073
238 Ga0099795_10280020 3300007788 Bacteria 728
239 Ga0105251_10350811 3300009011 Bacteria 673
240 Ga0105240_10013785 3300009093 Bacteria 11074
241 Ga0105240_10302459 3300009093 Bacteria 1829
242 Ga0105240_10880214 3300009093 Bacteria 965
243 Ga0105240_12381192 3300009093 Bacteria 548
244 Ga0111539_10196609 3300009094 Bacteria 2352
245 Ga0111539_10458223 3300009094 Bacteria 1485
246 Ga0105245_12011763 3300009098 Bacteria 631
247 Ga0105247_11298443 3300009101 Bacteria 584
248 Ga0114129_11524445 3300009147 Bacteria 821
249 Ga0114129_12938087 3300009147 Bacteria 562
250 Ga0105243_10046635 3300009148 Bacteria 3409
251 Ga0105243_11778904 3300009148 Bacteria 647
252 Ga0105242_12427266 3300009176 Bacteria 572
253 Ga0105248_10187820 3300009177 Bacteria 2328
254 Ga0105248_11247886 3300009177 Bacteria 840
255 Ga0105237_10039956 3300009545 Bacteria 4733
256 Ga0105237_12592574 3300009545 Bacteria 518
257 Ga0105238_10061680 3300009551 Bacteria 3751
258 Ga0105238_10434183 3300009551 Bacteria 1309
259 Ga0105238_10657967 3300009551 Bacteria 1058
260 Ga0105238_10797331 3300009551 Bacteria 960
261 Ga0105238_11095629 3300009551 Bacteria 819
262 Ga0105249_10948572 3300009553 Bacteria 928
263 Ga0105249_11055526 3300009553 Bacteria 882
264 Ga0105249_13487615 3300009553 Bacteria 506
265 Ga0099796_10458075 3300010159 Bacteria 568
266 Ga0105239_10025227 3300010375 Bacteria 6547
267 Ga0105239_11405377 3300010375 Bacteria 806
268 Ga0105239_12174877 3300010375 Bacteria 645
269 Ga0105246_10411305 3300011119 Bacteria 1126
270 Ga0105246_10852407 3300011119 Bacteria 813
271 Ga0105246_11041459 3300011119 Bacteria 743
272 Ga0157347_1020377 3300012502 Bacteria 772
273 Ga0157373_10348239 3300013100 Bacteria 1056
274 Ga0157373_10572287 3300013100 Bacteria 821
275 Ga0157371_10111548 3300013102 Bacteria 1941
276 Ga0157371_10385107 3300013102 Bacteria 1024
277 Ga0157371_11164409 3300013102 Bacteria 593
278 Ga0157370_10027470 3300013104 Bacteria 5611
279 Ga0157370_10044296 3300013104 Bacteria 4278
280 Ga0157370_10286338 3300013104 Bacteria 1522
281 Ga0157370_10315306 3300013104 Bacteria 1443
282 Ga0157370_11789799 3300013104 Bacteria 551
283 Ga0157369_10155261 3300013105 Bacteria 2418
284 Ga0157369_10646827 3300013105 Bacteria 1090
285 Ga0157369_11329576 3300013105 Bacteria 732
286 Ga0157369_12252195 3300013105 Bacteria 552
287 Ga0157374_11279188 3300013296 Bacteria 755
288 Ga0157374_12313574 3300013296 Bacteria 565
289 Ga0157378_10506210 3300013297 Bacteria 1207
290 Ga0157378_10920836 3300013297 Bacteria 906
291 Ga0157378_11115765 3300013297 Bacteria 826
292 Ga0157378_11387265 3300013297 Bacteria 745
293 Ga0163162_10460780 3300013306 Bacteria 1403
294 Ga0163162_10555845 3300013306 Bacteria 1276
295 Ga0163162_10670238 3300013306 Bacteria 1160
296 Ga0163162_11735111 3300013306 Bacteria 713
297 Ga0163162_12903158 3300013306 Bacteria 551
298 Ga0157372_10051984 3300013307 Bacteria 4561
299 Ga0157372_10079293 3300013307 Bacteria 3713
300 Ga0157372_10463378 3300013307 Bacteria 1477
301 Ga0157375_10141341 3300013308 Bacteria 2534
302 Ga0157375_10709640 3300013308 Bacteria 1159
303 Ga0157375_11113680 3300013308 Bacteria 924
304 Ga0163163_10352776 3300014325 Bacteria 1527
305 Ga0163163_11550547 3300014325 Bacteria 724
306 Ga0163163_12860585 3300014325 Bacteria 539
307 Ga0157380_10396090 3300014326 Bacteria 1308
308 Ga0157380_12000636 3300014326 Bacteria 641
309 Ga0182008_10002555 3300014497 Bacteria 11332
310 Ga0182008_10013374 3300014497 Bacteria 4316
311 Ga0182008_10273328 3300014497 Bacteria 877
312 Ga0157377_10364316 3300014745 Bacteria 974
313 Ga0157377_10657886 3300014745 Bacteria 755
314 Ga0157377_11365740 3300014745 Bacteria 557
315 Ga0157379_10648618 3300014968 Bacteria 988
316 Ga0157376_10605332 3300014969 Bacteria 1091
317 Ga0157376_10894730 3300014969 Bacteria 905
318 Ga0157376_11892112 3300014969 Bacteria 633
319 Ga0157376_11997844 3300014969 Bacteria 617
320 Ga0157376_13009303 3300014969 Bacteria 510
321 Ga0182006_1000465 3300015261 Bacteria 31795
322 Ga0182007_10007704 3300015262 Bacteria 4484
323 Ga0182007_10282251 3300015262 Bacteria 605
324 Ga0182005_1000078 3300015265 Bacteria 77287
325 Ga0209784_100002 3300025224 Bacteria 1753105
326 Ga0209566_100003 3300025225 Bacteria 1753105
327 Ga0209674_100003 3300025226 Bacteria 2196646
328 Ga0209674_100004 3300025226 Bacteria 1753105
329 Ga0209563_100006 3300025230 Bacteria 1753105
330 Ga0209563_100017 3300025230 Bacteria 796449
331 Ga0209677_100003 3300025253 Bacteria 1753105
332 Ga0209677_100467 3300025253 Bacteria 23243
333 Ga0209051_1011278 3300025303 Bacteria 4427
334 Ga0209257_1000032 3300025304 Bacteria 680354
335 Ga0207697_10117564 3300025315 Bacteria 1142
336 Ga0207656_10131262 3300025321 Bacteria 1174
337 Ga0207656_10303200 3300025321 Bacteria 791
338 Ga0207656_10485358 3300025321 Bacteria 626
339 Ga0207656_10497700 3300025321 Bacteria 618
340 Ga0207682_10301251 3300025893 Bacteria 751
341 Ga0207682_10383952 3300025893 Bacteria 663
342 Ga0207682_10495084 3300025893 Bacteria 579
343 Ga0207692_10081066 3300025898 Bacteria 1736
344 Ga0207692_10283405 3300025898 Bacteria 1003
345 Ga0207642_10198671 3300025899 Bacteria 1106
346 Ga0207647_10068185 3300025904 Bacteria 2154
347 Ga0207685_10219732 3300025905 Bacteria 903
348 Ga0207699_10010032 3300025906 Bacteria 4737
349 Ga0207699_10019110 3300025906 Bacteria 3646
350 Ga0207699_10074048 3300025906 Bacteria 2091
351 Ga0207699_10391367 3300025906 Bacteria 988
352 Ga0207645_10117231 3300025907 Bacteria 1727
353 Ga0207645_10128707 3300025907 Bacteria 1647
354 Ga0207645_10196254 3300025907 Bacteria 1327
355 Ga0207643_10008540 3300025908 Bacteria 5493
356 Ga0207705_10020296 3300025909 Bacteria 4751
357 Ga0207705_10066042 3300025909 Bacteria 2616
358 Ga0207705_10083344 3300025909 Bacteria 2332
359 Ga0207705_10480128 3300025909 Bacteria 965
360 Ga0207705_10480231 3300025909 Bacteria 965
361 Ga0207705_10563023 3300025909 Bacteria 886
362 Ga0207707_10008443 3300025912 Bacteria 8933
363 Ga0207707_10188488 3300025912 Bacteria 1800
364 Ga0207707_10681211 3300025912 Bacteria 865
365 Ga0207707_11121705 3300025912 Bacteria 640
366 Ga0207695_10001853 3300025913 Bacteria 33132
367 Ga0207695_10003759 3300025913 Bacteria 21064
368 Ga0207695_10037174 3300025913 Bacteria 5255
369 Ga0207671_10013287 3300025914 Bacteria 6567
370 Ga0207693_10003536 3300025915 Bacteria 13345
371 Ga0207693_10113785 3300025915 Bacteria 2123
372 Ga0207693_10122685 3300025915 Bacteria 2041
373 Ga0207663_10004765 3300025916 Bacteria 6778
374 Ga0207663_10088813 3300025916 Bacteria 2045
375 Ga0207660_10000108 3300025917 Bacteria 46937
376 Ga0207660_10184576 3300025917 Bacteria 1622
377 Ga0207660_10187336 3300025917 Bacteria 1610
378 Ga0207660_10473100 3300025917 Bacteria 1015
379 Ga0207660_11189932 3300025917 Bacteria 620
380 Ga0207660_11726346 3300025917 Bacteria 503
381 Ga0207662_10040598 3300025918 Bacteria 2736
382 Ga0207662_10823619 3300025918 Bacteria 655
383 Ga0207657_10134465 3300025919 Bacteria 2024
384 Ga0207657_10192341 3300025919 Bacteria 1645
385 Ga0207657_10624397 3300025919 Bacteria 840
386 Ga0207649_10059611 3300025920 Bacteria 2395
387 Ga0207649_10284652 3300025920 Bacteria 1203
388 Ga0207649_10448539 3300025920 Bacteria 973
389 Ga0207652_10461974 3300025921 Bacteria 1144
390 Ga0207652_11793562 3300025921 Bacteria 519
391 Ga0207646_11875752 3300025922 Bacteria 511
392 Ga0207681_10037004 3300025923 Bacteria 3223
393 Ga0207694_10037025 3300025924 Bacteria 3745
394 Ga0207650_10039405 3300025925 Bacteria 3453
395 Ga0207650_10163241 3300025925 Bacteria 1766
396 Ga0207650_10172409 3300025925 Bacteria 1720
397 Ga0207650_11455561 3300025925 Bacteria 583
398 Ga0207659_10037462 3300025926 Bacteria 3368
399 Ga0207659_10216485 3300025926 Bacteria 1538
400 Ga0207659_10574573 3300025926 Bacteria 959
401 Ga0207659_11323980 3300025926 Bacteria 618
402 Ga0207687_11615204 3300025927 Bacteria 556
403 Ga0207687_11800710 3300025927 Bacteria 524
404 Ga0207700_10026068 3300025928 Bacteria 4071
405 Ga0207700_10143131 3300025928 Bacteria 1967
406 Ga0207700_10153827 3300025928 Bacteria 1903
407 Ga0207700_10694998 3300025928 Bacteria 908
408 Ga0207664_10026276 3300025929 Bacteria 4399
409 Ga0207664_10040338 3300025929 Bacteria 3630
410 Ga0207644_10607647 3300025931 Bacteria 908
411 Ga0207690_10181149 3300025932 Bacteria 1586
412 Ga0207690_10213555 3300025932 Bacteria 1472
413 Ga0207690_11402236 3300025932 Bacteria 584
414 Ga0207706_10120698 3300025933 Bacteria 2305
415 Ga0207706_10249799 3300025933 Bacteria 1550
416 Ga0207706_10427236 3300025933 Bacteria 1147
417 Ga0207706_10612496 3300025933 Bacteria 935
418 Ga0207686_10211190 3300025934 Bacteria 1395
419 Ga0207709_10834611 3300025935 Bacteria 746
420 Ga0207709_11242391 3300025935 Bacteria 615
421 Ga0207709_11347797 3300025935 Bacteria 590
422 Ga0207670_10015446 3300025936 Bacteria 4563
423 Ga0207670_11220513 3300025936 Bacteria 637
424 Ga0207669_10330718 3300025937 Bacteria 1170
425 Ga0207669_10509609 3300025937 Bacteria 964
426 Ga0207704_10061975 3300025938 Bacteria 2323
427 Ga0207704_10432381 3300025938 Bacteria 1046
428 Ga0207665_10844310 3300025939 Bacteria 725
429 Ga0207665_11212508 3300025939 Bacteria 602
430 Ga0207691_10003241 3300025940 Bacteria 15858
431 Ga0207691_10034050 3300025940 Bacteria 4741
432 Ga0207691_10159600 3300025940 Bacteria 1979
433 Ga0207691_10464926 3300025940 Bacteria 1076
434 Ga0207691_10541450 3300025940 Bacteria 987
435 Ga0207691_11410422 3300025940 Bacteria 572
436 Ga0207711_10116293 3300025941 Bacteria 2384
437 Ga0207711_10148571 3300025941 Bacteria 2113
438 Ga0207711_10263813 3300025941 Bacteria 1584
439 Ga0207689_10060980 3300025942 Bacteria 3102
440 Ga0207661_10046637 3300025944 Bacteria 3436
441 Ga0207661_10148680 3300025944 Bacteria 2023
442 Ga0207661_10440636 3300025944 Bacteria 1185
443 Ga0207661_10453473 3300025944 Bacteria 1168
444 Ga0207661_10538442 3300025944 Bacteria 1069
445 Ga0207679_10094142 3300025945 Bacteria 2325
446 Ga0207679_10115434 3300025945 Bacteria 2127
447 Ga0207679_10275936 3300025945 Bacteria 1440
448 Ga0207679_10369007 3300025945 Bacteria 1256
449 Ga0207679_10469775 3300025945 Bacteria 1118
450 Ga0207679_11832344 3300025945 Bacteria 554
451 Ga0207667_10000438 3300025949 Bacteria 55784
452 Ga0207667_10054147 3300025949 Bacteria 4220
453 Ga0207667_10080431 3300025949 Bacteria 3376
454 Ga0207667_10120706 3300025949 Bacteria 2701
455 Ga0207667_10532629 3300025949 Bacteria 1189
456 Ga0207667_11078949 3300025949 Bacteria 787
457 Ga0207667_11779875 3300025949 Bacteria 581
458 Ga0207651_10044954 3300025960 Bacteria 2959
459 Ga0207651_10049833 3300025960 Bacteria 2840
460 Ga0207651_10592134 3300025960 Bacteria 968
461 Ga0207651_11912507 3300025960 Bacteria 533
462 Ga0207712_11111599 3300025961 Bacteria 704
463 Ga0207712_11180360 3300025961 Bacteria 683
464 Ga0207712_11858715 3300025961 Bacteria 539
465 Ga0207668_10170685 3300025972 Bacteria 1705
466 Ga0207668_10813330 3300025972 Bacteria 828
467 Ga0207668_11650884 3300025972 Bacteria 579
468 Ga0207640_10164010 3300025981 Bacteria 1648
469 Ga0207658_10207146 3300025986 Bacteria 1641
470 Ga0207658_10334431 3300025986 Bacteria 1315
471 Ga0207658_10553881 3300025986 Bacteria 1029
472 Ga0207677_10558543 3300026023 Bacteria 999
473 Ga0207677_10874560 3300026023 Bacteria 809
474 Ga0207677_11010063 3300026023 Bacteria 755
475 Ga0207703_10320070 3300026035 Bacteria 1420
476 Ga0207639_10335709 3300026041 Bacteria 1346
477 Ga0207678_10228246 3300026067 Bacteria 1594
478 Ga0207678_10286314 3300026067 Bacteria 1415
479 Ga0207678_11119896 3300026067 Bacteria 697
480 Ga0207678_11339925 3300026067 Bacteria 633
481 Ga0207708_10567734 3300026075 Bacteria 958
482 Ga0207708_11487935 3300026075 Bacteria 595
483 Ga0207708_11562456 3300026075 Bacteria 580
484 Ga0207702_10100428 3300026078 Bacteria 2553
485 Ga0207702_10297815 3300026078 Bacteria 1530
486 Ga0207702_10714697 3300026078 Bacteria 988
487 Ga0207702_12128198 3300026078 Bacteria 550
488 Ga0207641_10234602 3300026088 Bacteria 1707
489 Ga0207641_10605511 3300026088 Bacteria 1073
490 Ga0207648_10009384 3300026089 Bacteria 9367
491 Ga0207648_11342871 3300026089 Bacteria 672
492 Ga0207676_10528943 3300026095 Bacteria 1123
493 Ga0207674_10019328 3300026116 Bacteria 7380
494 Ga0207674_10030258 3300026116 Bacteria 5694
495 Ga0207674_10471185 3300026116 Bacteria 1214
496 Ga0207674_11842393 3300026116 Bacteria 572
497 Ga0207675_100281049 3300026118 Bacteria 1617
498 Ga0207675_100560854 3300026118 Bacteria 1142
499 Ga0207675_100702801 3300026118 Bacteria 1020
500 Ga0207675_100762188 3300026118 Bacteria 979
501 Ga0207683_10188565 3300026121 Bacteria 1871
502 Ga0207683_10227218 3300026121 Bacteria 1701
503 Ga0207683_10406459 3300026121 Bacteria 1253
504 Ga0207698_10203459 3300026142 Bacteria 1775
505 Ga0207698_10212653 3300026142 Bacteria 1741
506 Ga0207698_10577776 3300026142 Bacteria 1105
507 Ga0207698_11302213 3300026142 Bacteria 741
508 Ga0209281_1015504 3300027111 Bacteria 1587
509 Ga0209969_1006876 3300027360 Bacteria 1603
510 Ga0209969_1064622 3300027360 Bacteria 579
511 Ga0209967_1002057 3300027364 Bacteria 2596
512 Ga0209996_1012602 3300027395 Bacteria 1137
513 Ga0210000_1000359 3300027462 Bacteria 6419
514 Ga0210000_1021166 3300027462 Bacteria 994
515 Ga0209179_1076816 3300027512 Bacteria 735
516 Ga0209968_1057529 3300027526 Bacteria 682
517 Ga0209968_1076531 3300027526 Bacteria 599
518 Ga0209999_1000555 3300027543 Bacteria 5868
519 Ga0209983_1046924 3300027665 Bacteria 941
520 Ga0209282_1125663 3300027666 Bacteria 1276
521 Ga0209588_1035122 3300027671 Bacteria 1611
522 Ga0209971_1006039 3300027682 Bacteria 2871
523 Ga0209974_10006308 3300027876 Bacteria 4145
524 Ga0209974_10016099 3300027876 Bacteria 2482
525 Ga0265355_1020574 3300028036 Bacteria 570
526 Ga0268265_10974493 3300028380 Bacteria 836
527 Ga0268265_11266507 3300028380 Bacteria 737
528 Ga0268264_10359998 3300028381 Bacteria 1387
529 Ga0265338_10460300 3300028800 Bacteria 900
530 Ga0316182_1388674 3300030745 Bacteria 1705
531 Ga0307408_100542836 3300031548 Bacteria 1025
532 Ga0307408_101042820 3300031548 Bacteria 756
533 Ga0307408_101318191 3300031548 Bacteria 677
534 Ga0316575_10000032 3300031665 Bacteria 33845
535 Ga0316575_10007166 3300031665 Bacteria 4035
536 Ga0316575_10208096 3300031665 Bacteria 815
537 Ga0316579_10000922 3300031691 Bacteria 10216
538 Ga0316579_10003486 3300031691 Bacteria 6145
539 Ga0316576_10505678 3300031727 Bacteria 888
540 Ga0316578_10019379 3300031728 Bacteria 3744
541 Ga0316578_10038835 3300031728 Bacteria 2748
542 Ga0307405_10302791 3300031731 Bacteria 1213
543 Ga0307405_11720673 3300031731 Bacteria 556
544 Ga0307413_10775714 3300031824 Bacteria 803
545 Ga0307410_10137989 3300031852 Bacteria 1800
546 Ga0307410_10643308 3300031852 Bacteria 889
547 Ga0307406_10053066 3300031901 Bacteria 2581
548 Ga0307406_10124064 3300031901 Bacteria 1801
549 Ga0307406_10333259 3300031901 Bacteria 1179
550 Ga0307406_11680663 3300031901 Bacteria 562
551 Ga0307412_10388759 3300031911 Bacteria 1132
552 Ga0307412_11207745 3300031911 Bacteria 677
553 Ga0307409_100321415 3300031995 Bacteria 1448
554 Ga0307409_100725525 3300031995 Bacteria 995
555 Ga0307409_100959655 3300031995 Bacteria 871
556 Ga0307409_101849815 3300031995 Bacteria 633
557 Ga0307409_102158352 3300031995 Bacteria 587
558 Ga0307416_100071671 3300032002 Bacteria 2880
559 Ga0307416_100094290 3300032002 Bacteria 2581
560 Ga0307416_100995760 3300032002 Bacteria 941
561 Ga0307416_101643754 3300032002 Bacteria 747
562 Ga0307416_101978192 3300032002 Bacteria 686
563 Ga0307416_102411812 3300032002 Bacteria 625
564 Ga0307416_102631432 3300032002 Bacteria 600
565 Ga0307414_10201808 3300032004 Bacteria 1618
566 Ga0307414_11979702 3300032004 Bacteria 544
567 Ga0307414_12178846 3300032004 Bacteria 518
568 Ga0307411_10189389 3300032005 Bacteria 1569
569 Ga0307411_10244153 3300032005 Bacteria 1408
570 Ga0307411_10288180 3300032005 Bacteria 1310
571 Ga0307415_100523335 3300032126 Bacteria 1041
572 Ga0307415_100606156 3300032126 Bacteria 975
573 Ga0307415_100911094 3300032126 Bacteria 811
574 Ga0307415_101085684 3300032126 Bacteria 748
575 Ga0316583_10003578 3300032133 Bacteria 5488
576 Ga0316583_10012848 3300032133 Bacteria 3021
577 Ga0316583_10110681 3300032133 Bacteria 957
578 Ga0316593_10236263 3300032168 Bacteria 681
579 Ga0373926_0012427 3300035083 Bacteria 2878
580 Ga0373926_0081631 3300035083 Bacteria 1196
581 Ga0373934_0000613 3300035086 Bacteria 12584
582 Ga0373944_0043393 3300035089 Bacteria 1397
583 Ga0373952_0161086 3300035092 Bacteria 636
584 Ga0373923_0021276 3300035111 Bacteria 2530
585 Ga0373945_0096315 3300035116 Bacteria 1153
586 Ga0373956_0097835 3300035119 Bacteria 1358
587 Ga0373957_0011425 3300035120 Bacteria 2964
588 Ga0373960_0038491 3300035121 Bacteria 1371
589 Ga0373943_0967145 3300035170 Bacteria 510
590 Ga0373946_0066655 3300035171 Bacteria 1544
591 Ga0373955_0000555 3300035172 Bacteria 15870
592 Ga0373942_0160572 3300035207 Bacteria 727
593 Ga0316574_0311636 3300035398 Bacteria 1000
594 Ga0373924_0031046 3300035410 Bacteria 2146
595 Ga0373935_0015507 3300035692 Bacteria 4607
596 Ga0373935_0518439 3300035692 Bacteria 867
597 Ga0373935_0568069 3300035692 Bacteria 828
598 Ga0373935_1182297 3300035692 Bacteria 570
599 Ga0373927_0027933 3300035695 Bacteria 3682
600 Ga0373927_0104013 3300035695 Bacteria 1848
601 Ga0373927_0164642 3300035695 Bacteria 1453
602 Ga0373933_0000055 3300035724 Bacteria 67484
603 Ga0373947_0037687 3300035725 Bacteria 2870
604 Ga0373947_0043390 3300035725 Bacteria 2686
605 Ga0373937_0000450 3300036401 Bacteria 37946
606 Ga0373937_0386729 3300036401 Bacteria 1327
607 Ga0316582_0000229 3300036647 Bacteria 18476
608 Ga0316582_0010275 3300036647 Bacteria 5119
609 Ga0316582_0131791 3300036647 Bacteria 1680
610 Ga0316584_0062296 3300036712 Bacteria 2794
611 Ga0316584_0124699 3300036712 Bacteria 1924
612 Ga0373925_0533729 3300037068 Bacteria 964
613 Ga0373925_0743704 3300037068 Bacteria 808
614 Ga0373925_1281198 3300037068 Bacteria 602
615 Ga0316581_0016222 3300037588 Bacteria 2137
616 Ga0316581_0018143 3300037588 Bacteria 2040
617 Ga0436364_0497955 3300037853 Bacteria 739
618 Ga0395901_0933184 3300038443 Bacteria 848
619 Ga0395901_1686137 3300038443 Bacteria 585
620 Ga0436365_0350682 3300039437 Bacteria 711
621 Ga0436365_1200738 3300039437 Bacteria 961
622 Ga0436365_1592469 3300039437 Bacteria 1269
623 Ga0436361_0730207 3300039447 Bacteria 2322
624 Ga0436361_1079523 3300039447 Bacteria 3333
625 Ga0439436_0140609 3300041404 Bacteria 679
626 Ga0439439_0249705 3300041406 Bacteria 526
627 Ga0439461_0062686 3300041410 Bacteria 847
628 Ga0451841_0300790 3300041498 Bacteria 582
629 Ga0451845_0910423 3300041501 Bacteria 676
630 Ga0451847_0780003 3300041503 Bacteria 529
631 Ga0451853_3739149 3300041512 Bacteria 817
632 Ga0439445_0190724 3300042004 Bacteria 604
633 Ga0439445_0224983 3300042004 Bacteria 557
634 Ga0439449_0046339 3300042007 Bacteria 1611
635 Ga0439452_034928 3300042010 Bacteria 1212
636 Ga0439455_0033113 3300042012 Bacteria 1295
637 Ga0439457_100883 3300042014 Bacteria 673
638 Ga0450912_004316 3300042116 Bacteria 1050
639 Ga0450917_003459 3300042120 Bacteria 1144
640 Ga0450923_116922 3300042125 Bacteria 626
641 Ga0450888_002272 3300042126 Bacteria 1889
642 Ga0450890_009447 3300042127 Bacteria 1249
643 Ga0450891_000222 3300042129 Bacteria 5702
644 Ga0450892_001107 3300042130 Bacteria 2814
645 Ga0450903_020990 3300042138 Bacteria 1010
646 Ga0439434_0095027 3300042435 Bacteria 956
647 Ga0439444_0002332 3300042437 Bacteria 2584
648 Ga0439459_0017764 3300042438 Bacteria 1330
649 Ga0450893_0000472 3300042532 Bacteria 5678
650 Ga0451577_0804129 3300042876 Bacteria 849
651 Ga0439440_0114816 3300042993 Bacteria 744
652 Ga0439440_0140568 3300042993 Bacteria 685
653 Ga0453683_0074998 3300044673 Bacteria 2118
654 Ga0453683_0518135 3300044673 Bacteria 774
655 Ga0453684_0743783 3300044712 Bacteria 1062
656 Ga0453684_0872633 3300044712 Bacteria 965
657 Ga0451576_0072908 3300045051 Bacteria 3573
658 Ga0451576_1661229 3300045051 Bacteria 662
659 Ga0451576_2252183 3300045051 Bacteria 559
660 Ga0466967_1666302 3300045976 Bacteria 635
661 Ga0495592_0002705 3300046454 Bacteria 12543
662 Ga0495592_0825445 3300046454 Bacteria 549
663 Ga0495629_0011314 3300046459 Bacteria 6483
664 Ga0495629_0064592 3300046459 Bacteria 2556
665 Ga0495629_0142153 3300046459 Bacteria 1669
666 Ga0495651_0000996 3300046462 Bacteria 21980
667 Ga0495651_0647505 3300046462 Bacteria 663
668 Ga0495653_0000195 3300046463 Bacteria 49244
669 Ga0495650_0012788 3300046471 Bacteria 4492
670 Ga0495580_0008769 3300046472 Bacteria 8008
671 Ga0495580_0048643 3300046472 Bacteria 3001
672 Ga0495580_0068932 3300046472 Bacteria 2472
673 Ga0495582_0041545 3300046473 Bacteria 2534
674 Ga0495582_0215716 3300046473 Bacteria 1097
675 Ga0495582_0538044 3300046473 Bacteria 675
676 Ga0495582_0725799 3300046473 Bacteria 575
677 Ga0495639_0008494 3300046475 Bacteria 4403
678 Ga0495639_0089033 3300046475 Bacteria 1446
679 Ga0495639_0120029 3300046475 Bacteria 1254
680 Ga0495664_0054273 3300046477 Bacteria 2383
681 Ga0495594_0036114 3300046499 Bacteria 2694
682 Ga0495594_0274194 3300046499 Bacteria 961
683 Ga0495594_0695554 3300046499 Bacteria 575
684 Ga0495596_0103789 3300046500 Bacteria 1104
685 Ga0495596_0334621 3300046500 Bacteria 589
686 Ga0495583_0008785 3300046506 Bacteria 6126
687 Ga0495606_0006532 3300046507 Bacteria 10727
688 Ga0495608_0000085 3300046511 Bacteria 68124
689 Ga0495608_0662561 3300046511 Bacteria 623
690 Ga0495628_0034222 3300046516 Bacteria 4088
691 Ga0495630_0011652 3300046517 Bacteria 6372
692 Ga0495630_0022736 3300046517 Bacteria 4631
693 Ga0495630_0155017 3300046517 Bacteria 1743
694 Ga0495630_1355860 3300046517 Bacteria 535
695 Ga0495663_0062093 3300046525 Bacteria 1176
696 Ga0495663_0082676 3300046525 Bacteria 1036
697 Ga0495663_0213062 3300046525 Bacteria 677
698 Ga0495666_0184231 3300046526 Bacteria 963
699 Ga0495642_0053050 3300046528 Bacteria 1670
700 Ga0495652_0008685 3300046529 Bacteria 9262
701 Ga0495654_0368700 3300046530 Bacteria 575
702 Ga0495665_0005306 3300046531 Bacteria 6945
703 Ga0495665_0103981 3300046531 Bacteria 1490
704 Ga0495665_0106728 3300046531 Bacteria 1469
705 Ga0495665_0652993 3300046531 Bacteria 523
706 Ga0495640_0304947 3300046533 Bacteria 988
707 Ga0495587_0000114 3300046536 Bacteria 61671
708 Ga0495598_0189898 3300046537 Bacteria 737
709 Ga0495621_0006211 3300046539 Bacteria 3475
710 Ga0495621_0204629 3300046539 Bacteria 795
711 Ga0495621_0254339 3300046539 Bacteria 718
712 Ga0495645_0000144 3300046543 Bacteria 48490
713 Ga0495645_0629896 3300046543 Bacteria 657
714 Ga0495667_0000241 3300046559 Bacteria 35516
715 Ga0495667_0082166 3300046559 Bacteria 2094
716 Ga0495667_0459167 3300046559 Bacteria 800
717 Ga0495668_0107838 3300046616 Bacteria 1523
718 Ga0495634_0261307 3300046642 Bacteria 1056
719 Ga0495625_0152379 3300046660 Bacteria 1553
720 Ga0495625_0534897 3300046660 Bacteria 712
721 Ga0495635_0000253 3300046663 Bacteria 34161
722 Ga0495635_0336897 3300046663 Bacteria 1008
723 Ga0495635_0889632 3300046663 Bacteria 571
724 Ga0495659_0241169 3300046664 Bacteria 751
725 Ga0495659_0302271 3300046664 Bacteria 676
726 Ga0495588_0066857 3300046674 Bacteria 1866
727 Ga0495588_0126015 3300046674 Bacteria 1350
728 Ga0495588_0298141 3300046674 Bacteria 849
729 Ga0495588_0439476 3300046674 Bacteria 685
730 Ga0495657_0000210 3300046675 Bacteria 52663
731 Ga0495657_0254549 3300046675 Bacteria 1056
732 Ga0495599_0000436 3300046678 Bacteria 23725
733 Ga0495623_0000305 3300046679 Bacteria 31845
734 Ga0495646_0011487 3300046680 Bacteria 5621
735 Ga0495658_0001556 3300046683 Bacteria 11985
736 Ga0495658_0489290 3300046683 Bacteria 787
737 Ga0495669_0003327 3300046684 Bacteria 6614
738 Ga0495669_0162795 3300046684 Bacteria 1059
739 Ga0495669_0366748 3300046684 Bacteria 697
740 Ga0495669_0560199 3300046684 Bacteria 556
741 Ga0495613_0065654 3300046689 Bacteria 2652
742 Ga0495613_0068004 3300046689 Bacteria 2599
743 Ga0495613_0694257 3300046689 Bacteria 670
744 Ga0495649_0012212 3300046694 Bacteria 5008
745 Ga0495589_0045800 3300046794 Bacteria 2172
746 Ga0495600_0000023 3300046809 Bacteria 94401
747 Ga0495581_0009338 3300047315 Bacteria 5676
748 Ga0495604_0000251 3300047317 Bacteria 47665
749 Ga0495604_0245664 3300047317 Bacteria 1222
750 Ga0495604_0567091 3300047317 Bacteria 731
751 Ga0495636_0077133 3300047318 Bacteria 1430
752 Ga0495674_0040004 3300047319 Bacteria 4197
753 Ga0495674_0461643 3300047319 Bacteria 1019
754 Ga0495672_0003697 3300047320 Bacteria 12916
755 Ga0495672_0167004 3300047320 Bacteria 1126
756 Ga0495680_0006224 3300047322 Bacteria 11126
757 Ga0495675_0005468 3300047444 Bacteria 7750
758 Ga0495675_0416813 3300047444 Bacteria 781
759 Ga0495685_054585 3300047447 Bacteria 1352
760 Ga0495684_0000037 3300047471 Bacteria 106933
761 Ga0495686_0009043 3300047472 Bacteria 7228
762 Ga0495593_0153212 3300047673 Bacteria 1165
763 Ga0495593_0172241 3300047673 Bacteria 1091
764 Ga0495593_0659117 3300047673 Bacteria 525
765 Ga0495602_0002980 3300048088 Bacteria 17361
766 Ga0495602_0523073 3300048088 Bacteria 826
767 Ga0495602_0661447 3300048088 Bacteria 712
768 Ga0495614_0003629 3300048089 Bacteria 6920
769 Ga0495615_0030918 3300048090 Bacteria 1281
770 Ga0496100_0338633 3300048903 Bacteria 1134
771 Ga0496100_0706097 3300048903 Bacteria 787
772 Ga0496101_1373097 3300048904 Bacteria 551
773 Ga0496104_0115322 3300048907 Bacteria 2577
774 Ga0496104_0405684 3300048907 Bacteria 1275
775 Ga0496104_0433022 3300048907 Bacteria 1227
776 Ga0496104_0708472 3300048907 Bacteria 914
777 Ga0496105_0008533 3300048908 Bacteria 7960
778 Ga0496105_0179939 3300048908 Bacteria 1732
779 Ga0496106_0076551 3300048909 Bacteria 2565
780 Ga0496106_1420676 3300048909 Bacteria 536
781 Ga0496107_0170082 3300048910 Bacteria 1617
782 Ga0496108_0270466 3300048911 Bacteria 1479
783 Ga0496109_0186466 3300048912 Bacteria 1949
784 Ga0496109_0706940 3300048912 Bacteria 945
785 Ga0496110_0385554 3300048913 Bacteria 1277
786 Ga0496111_0659780 3300048914 Bacteria 763
787 Ga0496111_1077685 3300048914 Bacteria 573
788 Ga0496112_0016641 3300048915 Bacteria 6895
789 Ga0496113_0301778 3300048916 Bacteria 1282
790 Ga0496114_0110142 3300048917 Bacteria 2358
791 Ga0496114_0451355 3300048917 Bacteria 1139
792 Ga0496115_0218617 3300048918 Bacteria 1572
793 Ga0496115_0385705 3300048918 Bacteria 1139
794 Ga0496115_0640522 3300048918 Bacteria 841
795 Ga0496115_0669474 3300048918 Bacteria 819
796 Ga0496117_0000278 3300048920 Bacteria 95496
797 Ga0496124_0875548 3300048927 Bacteria 548
798 Ga0496125_0113300 3300048928 Bacteria 1957
799 Ga0501306_053080 3300049127 Bacteria 654
800 Ga0501308_005184 3300049128 Bacteria 1287
801 Ga0501309_000129 3300049129 Bacteria 4661
802 Ga0501310_000219 3300049130 Bacteria 5455
803 Ga0501304_001129 3300049160 Bacteria 1642
804 Ga0501305_000428 3300049161 Bacteria 3421
805 Ga0501307_005139 3300049162 Bacteria 1368
806 Ga0501292_053519 3300049515 Bacteria 720
807 Ga0501294_024649 3300049517 Bacteria 672
808 Ga0501299_050248 3300049522 Bacteria 860
809 Ga0501299_215354 3300049522 Bacteria 516
810 Ga0501300_000306 3300049523 Bacteria 7395
811 Ga0501311_000655 3300049527 Bacteria 2575
812 Ga0501311_038849 3300049527 Bacteria 716
813 Ga0501312_001901 3300049528 Bacteria 2163
814 Ga0501313_005114 3300049529 Bacteria 1373
815 Ga0501314_000050 3300049530 Bacteria 5184
816 Ga0501315_001210 3300049531 Bacteria 2135
817 Ga0501315_027922 3300049531 Bacteria 799
818 Ga0501316_030814 3300049532 Bacteria 717
819 Ga0501317_002747 3300049533 Bacteria 1692
820 Ga0501318_012445 3300049534 Bacteria 975
821 Ga0501321_027411 3300049537 Bacteria 744
822 Ga0501325_017376 3300049541 Bacteria 728
823 Ga0501033_0040060 3300049570 Bacteria 3498
824 Ga0501033_0932162 3300049570 Bacteria 583
825 Ga0501034_0126349 3300049571 Bacteria 2542
826 Ga0501034_0252901 3300049571 Bacteria 1706
827 Ga0501036_0058733 3300049572 Bacteria 3259
828 Ga0501036_0310142 3300049572 Bacteria 1319
829 Ga0501036_0956207 3300049572 Bacteria 702
830 Ga0501037_0033043 3300049573 Bacteria 3822
831 Ga0501037_0474293 3300049573 Bacteria 851
832 Ga0501038_0030062 3300049574 Bacteria 4810
833 Ga0501039_0129507 3300049575 Bacteria 1980
834 Ga0501039_0138074 3300049575 Bacteria 1915
835 Ga0501039_0558671 3300049575 Bacteria 898
836 Ga0501041_0461416 3300049577 Bacteria 807
837 Ga0501042_0759586 3300049578 Bacteria 705
838 Ga0501043_0007959 3300049579 Bacteria 8372
839 Ga0501043_0445092 3300049579 Bacteria 974
840 Ga0501046_0195899 3300049580 Bacteria 1505
841 Ga0501046_0299501 3300049580 Bacteria 1175
842 Ga0501047_0034967 3300049581 Bacteria 4852
843 Ga0501047_0694399 3300049581 Bacteria 835
844 Ga0501048_0282626 3300049582 Bacteria 1180
845 Ga0501048_1094189 3300049582 Bacteria 573
846 Ga0501068_0126379 3300049584 Bacteria 1597
847 Ga0501069_0278331 3300049585 Bacteria 979
848 Ga0501070_0712859 3300049586 Bacteria 793
849 Ga0501071_0119317 3300049587 Bacteria 1954
850 Ga0501071_0233595 3300049587 Bacteria 1386
851 Ga0501071_1007948 3300049587 Bacteria 643
852 Ga0501072_0275302 3300049588 Bacteria 1339
853 Ga0501073_0009894 3300049589 Bacteria 7018
854 Ga0501073_0238113 3300049589 Bacteria 1257
855 Ga0501074_0016929 3300049590 Bacteria 5289
856 Ga0501074_0470645 3300049590 Bacteria 891
857 Ga0501075_0712888 3300049591 Bacteria 764
858 Ga0501075_1055326 3300049591 Bacteria 617
859 Ga0501076_0361483 3300049592 Bacteria 1192
860 Ga0501076_0620888 3300049592 Bacteria 892
861 Ga0501077_0325612 3300049593 Bacteria 980
862 Ga0501077_1040063 3300049593 Bacteria 527
863 Ga0501198_128946 3300049649 Bacteria 540
864 Ga0501206_014163 3300049653 Bacteria 1094
865 Ga0501210_001725 3300049657 Bacteria 1287
866 Ga0501211_004106 3300049658 Bacteria 1490
867 Ga0501216_109924 3300049660 Bacteria 618
868 Ga0501222_020639 3300049662 Bacteria 881
869 Ga0501223_024425 3300049663 Bacteria 1176
870 Ga0501223_046172 3300049663 Bacteria 845
871 Ga0501223_135690 3300049663 Bacteria 527
872 Ga0501227_004174 3300049665 Bacteria 3107
873 Ga0501233_003475 3300049668 Bacteria 2834
874 Ga0501235_003946 3300049669 Bacteria 3210
875 Ga0501239_039619 3300049672 Bacteria 648
876 Ga0501243_109855 3300049675 Bacteria 564
877 Ga0501243_137035 3300049675 Bacteria 515
878 Ga0501249_008085 3300049679 Bacteria 2182
879 Ga0501253_063853 3300049683 Bacteria 799
880 Ga0501255_016054 3300049684 Bacteria 921
881 Ga0501258_002063 3300049687 Bacteria 1728
882 Ga0501221_003510 3300049704 Bacteria 2582
883 Ga0501225_0003592 3300049705 Bacteria 4676
884 Ga0501229_038397 3300049706 Bacteria 676
885 Ga0501234_077211 3300049707 Bacteria 583
886 Ga0501079_0264274 3300049741 Bacteria 1345
887 Ga0501079_1522117 3300049741 Bacteria 526
888 Ga0501080_0008652 3300049742 Bacteria 9241
889 Ga0501080_0057515 3300049742 Bacteria 3620
890 Ga0501081_0119454 3300049743 Bacteria 1876
891 Ga0501083_0035946 3300049744 Bacteria 3382
892 Ga0501262_004570 3300049759 Bacteria 1609
893 Ga0501267_000175 3300049764 Bacteria 4374
894 Ga0501271_006347 3300049768 Bacteria 1172
895 Ga0501272_032672 3300049769 Bacteria 667
896 Ga0501275_076951 3300049772 Bacteria 535
897 Ga0501283_048226 3300049779 Bacteria 750
898 Ga0501035_0268059 3300049822 Bacteria 1446
899 Ga0501035_0674645 3300049822 Bacteria 836
900 Ga0501044_0015304 3300049823 Bacteria 8262
901 Ga0501044_0525921 3300049823 Bacteria 1082
902 nmdc:mga03683_622358_c1 3300050489 Bacteria 530
903 nmdc:mga0k408_25245_c2 3300050493 Bacteria 2413
904 nmdc:mga07m45_7457_c1 3300050496 Bacteria 5592
905 nmdc:mga09592_852973_c1 3300050508 Bacteria 768
906 nmdc:mga0qj67_60894_c1 3300050509 Bacteria 2996
907 nmdc:mga0qj67_638307_c1 3300050509 Bacteria 850
908 nmdc:mga0qj67_643432_c1 3300050509 Bacteria 846
909 nmdc:mga06r32_441888_c1 3300050510 Bacteria 1281
910 nmdc:mga06r32_687524_c1 3300050510 Bacteria 989
911 nmdc:mga08y16_107923_c1 3300050511 Bacteria 2898
912 nmdc:mga0n895_2003095_c1 3300050512 Bacteria 537
913 nmdc:mga0n895_766365_c1 3300050512 Bacteria 957
914 nmdc:mga0rr50_1745688_c1 3300050513 Bacteria 524
915 nmdc:mga0rr50_385862_c1 3300050513 Bacteria 1182
916 nmdc:mga08x19_192665_c1 3300050514 Bacteria 1395
917 nmdc:mga08x19_312301_c1 3300050514 Bacteria 1093
918 nmdc:mga0a205_238225_c1 3300050515 Bacteria 1701
919 Ga0495601_0002235 3300053077 Bacteria 10903
920 Ga0495601_0590726 3300053077 Bacteria 713
921 Ga0495612_0000577 3300053078 Bacteria 14757
922 Ga0495612_0478171 3300053078 Bacteria 570
923 Ga0495655_0297108 3300053083 Bacteria 554
924 Ga0495595_0011132 3300053084 Bacteria 3756
925 Ga0495619_0006426 3300053085 Bacteria 7446
926 Ga0500651_0700854 3300053093 Bacteria 541
927 Ga0500608_199548 3300053122 Bacteria 828
928 Ga0500568_0168736 3300053139 Bacteria 806
929 Ga0500604_0064906 3300053151 Bacteria 1154
930 Ga0500627_0292841 3300053158 Bacteria 712
931 Ga0500633_0277547 3300053160 Bacteria 620
932 Ga0500636_0105745 3300053177 Bacteria 1595
933 Ga0500636_0495408 3300053177 Bacteria 541
934 Ga0501084_0547311 3300054114 Bacteria 978
935 Ga0590071_032829 3300059421 Bacteria 1240
936 Ga0590074_029865 3300059423 Bacteria 961
937 Ga0590075_170084 3300059424 Bacteria 576
938 Ga0587076_016241 3300059645 Bacteria 1172
939 Ga0501082_0653376 3300060353 Bacteria 920
940 Ga0501082_0717548 3300060353 Bacteria 875

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005842 Ga0068858_100020744 Ga0068858_1000207443 86
2 3300013104 Ga0157370_10315306 Ga0157370_103153061 88
3 3300013307 Ga0157372_10079293 Ga0157372_100792932 88
4 3300025917 Ga0207660_10473100 Ga0207660_104731002 88
5 3300005444 Ga0070694_100050054 Ga0070694_1000500545 89
6 3300045051 Ga0451576_2252183 Ga0451576_2252183_110_406 89
7 3300005563 Ga0068855_100068633 Ga0068855_1000686333 90
8 3300005614 Ga0068856_100358922 Ga0068856_1003589222 90
9 3300005617 Ga0068859_100531651 Ga0068859_1005316512 90
10 3300006931 Ga0097620_100531639 Ga0097620_1005316392 90
11 3300009093 Ga0105240_10880214 Ga0105240_108802142 90
12 3300009551 Ga0105238_10657967 Ga0105238_106579672 90
13 3300010375 Ga0105239_12174877 Ga0105239_121748772 90
14 3300025949 Ga0207667_10054147 Ga0207667_100541474 90
15 3300026078 Ga0207702_10297815 Ga0207702_102978153 90
16 3300049580 Ga0501046_0299501 Ga0501046_0299501_878_1159 91
17 3300009094 Ga0111539_10196609 Ga0111539_101966093 92
18 3300025893 Ga0207682_10383952 Ga0207682_103839521 93
19 iso_pu_bacteria 2593339238 2595446621 95
20 iso_pu_bacteria 2593339239 2595451887 95
21 iso_pu_bacteria 2718218334 2721026753 95
22 iso_pu_bacteria 2734482264 2735837693 95
23 iso_pu_bacteria 2738543009 2739228298 95
24 iso_pu_bacteria 2842914999 2842918033 95
25 iso_pu_bacteria 2842918807 2842919508 95
26 iso_pu_bacteria 2919085039 2919087717 95
27 iso_pu_bacteria 2919404418 2919404961 95
28 iso_pu_bacteria 2953994433 2953998027 95
29 3300009148 Ga0105243_11778904 Ga0105243_117789042 96
30 3300009545 Ga0105237_12592574 Ga0105237_125925742 96
31 3300014969 Ga0157376_11997844 Ga0157376_119978442 96
32 3300035092 Ga0373952_0161086 Ga0373952_0161086_185_484 96
33 3300046462 Ga0495651_0647505 Ga0495651_0647505_11_307 96
34 iso_pu_bacteria 2511231026 2511385534 96
35 iso_pu_bacteria 2521172590 2521557732 96
36 iso_pu_bacteria 2551306416 2553002847 96
37 iso_pu_bacteria 2765235838 2765570096 96
38 iso_pu_bacteria 2818991449 2819615135 96
39 iso_pu_bacteria 2839094727 2839096964 96
40 iso_pu_bacteria 2904439833 2904441528 96
41 iso_pu_bacteria 2904530477 2904531542 96
42 iso_pu_bacteria 2904584206 2904586821 96
43 iso_pu_bacteria 2904589729 2904593146 96
44 iso_pu_bacteria 2904601388 2904603008 96
45 iso_pu_bacteria 2919046199 2919050833 96
46 iso_pu_bacteria 2919079590 2919083971 96
47 iso_pu_bacteria 2923510766 2923510937 96
48 iso_pu_bacteria 2928130867 2928130909 96
49 3300000549 LJQas_1020049 LJQas_10200492 97
50 3300002075 JGI24738J21930_10006379 JGI24738J21930_100063792 97
51 3300002773 JGI25152J39213_1025333 JGI25152J39213_10253332 97
52 3300003203 JGI25406J46586_10017790 JGI25406J46586_100177902 97
53 3300003215 JGI25153J46596_10055107 JGI25153J46596_100551072 97
54 3300003567 Ga0006554J51385_1033774 Ga0006554J51385_10337744 97
55 3300003578 Ga0006562J51391_1061648 Ga0006562J51391_10616482 97
56 3300003751 Ga0055538_1000155 Ga0055538_100015542 97
57 3300003752 Ga0055539_1000205 Ga0055539_100020542 97
58 3300003756 Ga0055533_1000100 Ga0055533_100010060 97
59 3300003756 Ga0055533_1000207 Ga0055533_100020742 97
60 3300003759 Ga0055525_1000284 Ga0055525_100028442 97
61 3300003759 Ga0055525_1000947 Ga0055525_10009474 97
62 3300003791 Ga0055530_10014353 Ga0055530_100143531 97
63 3300003794 Ga0055531_10000310 Ga0055531_100003108 97
64 3300003841 Ga0055541_1000133 Ga0055541_10001337 97
65 3300004625 Ga0055543_1030932 Ga0055543_10309322 97
66 3300005262 Ga0065165_1000028 Ga0065165_10000285 97
67 3300005290 Ga0065712_10391693 Ga0065712_103916931 97
68 3300005327 Ga0070658_10003448 Ga0070658_100034487 97
69 3300005327 Ga0070658_10011571 Ga0070658_100115716 97
70 3300005327 Ga0070658_10238554 Ga0070658_102385542 97
71 3300005327 Ga0070658_10339180 Ga0070658_103391802 97
72 3300005327 Ga0070658_10368122 Ga0070658_103681222 97
73 3300005327 Ga0070658_10564196 Ga0070658_105641962 97
74 3300005327 Ga0070658_10691620 Ga0070658_106916202 97
75 3300005327 Ga0070658_11388562 Ga0070658_113885621 97
76 3300005328 Ga0070676_10045115 Ga0070676_100451152 97
77 3300005328 Ga0070676_10126377 Ga0070676_101263772 97
78 3300005328 Ga0070676_10327830 Ga0070676_103278301 97
79 3300005329 Ga0070683_100026589 Ga0070683_1000265895 97
80 3300005329 Ga0070683_100042213 Ga0070683_1000422132 97
81 3300005329 Ga0070683_100053034 Ga0070683_1000530344 97
82 3300005329 Ga0070683_100244034 Ga0070683_1002440342 97
83 3300005329 Ga0070683_100361467 Ga0070683_1003614672 97
84 3300005329 Ga0070683_100583988 Ga0070683_1005839882 97
85 3300005329 Ga0070683_101823334 Ga0070683_1018233342 97
86 3300005329 Ga0070683_102390580 Ga0070683_1023905801 97
87 3300005330 Ga0070690_100117944 Ga0070690_1001179441 97
88 3300005330 Ga0070690_100254849 Ga0070690_1002548492 97
89 3300005331 Ga0070670_100194310 Ga0070670_1001943102 97
90 3300005331 Ga0070670_100559842 Ga0070670_1005598422 97
91 3300005331 Ga0070670_100814984 Ga0070670_1008149842 97
92 3300005331 Ga0070670_101004883 Ga0070670_1010048832 97
93 3300005331 Ga0070670_101581087 Ga0070670_1015810872 97
94 3300005334 Ga0068869_100052726 Ga0068869_1000527264 97
95 3300005335 Ga0070666_10669473 Ga0070666_106694732 97
96 3300005336 Ga0070680_100001111 Ga0070680_10000111115 97
97 3300005336 Ga0070680_100048545 Ga0070680_1000485455 97
98 3300005336 Ga0070680_101719489 Ga0070680_1017194891 97
99 3300005336 Ga0070680_101944804 Ga0070680_1019448042 97
100 3300005338 Ga0068868_101508223 Ga0068868_1015082232 97
101 3300005338 Ga0068868_101613833 Ga0068868_1016138332 97
102 3300005339 Ga0070660_100541286 Ga0070660_1005412862 97
103 3300005339 Ga0070660_101180715 Ga0070660_1011807151 97
104 3300005340 Ga0070689_100040508 Ga0070689_1000405082 97
105 3300005340 Ga0070689_101276798 Ga0070689_1012767981 97
106 3300005340 Ga0070689_101992526 Ga0070689_1019925262 97
107 3300005344 Ga0070661_100164706 Ga0070661_1001647062 97
108 3300005344 Ga0070661_100167277 Ga0070661_1001672773 97
109 3300005344 Ga0070661_100275338 Ga0070661_1002753382 97
110 3300005344 Ga0070661_100303941 Ga0070661_1003039412 97
111 3300005344 Ga0070661_101198879 Ga0070661_1011988791 97
112 3300005344 Ga0070661_101247530 Ga0070661_1012475301 97
113 3300005344 Ga0070661_101903415 Ga0070661_1019034152 97
114 3300005345 Ga0070692_10054841 Ga0070692_100548414 97
115 3300005347 Ga0070668_100116431 Ga0070668_1001164312 97
116 3300005347 Ga0070668_100813502 Ga0070668_1008135022 97
117 3300005347 Ga0070668_100946918 Ga0070668_1009469182 97
118 3300005353 Ga0070669_100095390 Ga0070669_1000953901 97
119 3300005354 Ga0070675_100004759 Ga0070675_1000047595 97
120 3300005354 Ga0070675_100230725 Ga0070675_1002307252 97
121 3300005354 Ga0070675_100245717 Ga0070675_1002457172 97
122 3300005354 Ga0070675_100309384 Ga0070675_1003093842 97
123 3300005354 Ga0070675_101587900 Ga0070675_1015879001 97
124 3300005354 Ga0070675_101730905 Ga0070675_1017309051 97
125 3300005355 Ga0070671_100175628 Ga0070671_1001756282 97
126 3300005355 Ga0070671_100407398 Ga0070671_1004073982 97
127 3300005355 Ga0070671_100516138 Ga0070671_1005161382 97
128 3300005355 Ga0070671_100525976 Ga0070671_1005259762 97
129 3300005355 Ga0070671_100945627 Ga0070671_1009456272 97
130 3300005356 Ga0070674_100401045 Ga0070674_1004010453 97
131 3300005364 Ga0070673_100391182 Ga0070673_1003911822 97
132 3300005364 Ga0070673_100663455 Ga0070673_1006634551 97
133 3300005364 Ga0070673_100770639 Ga0070673_1007706392 97
134 3300005364 Ga0070673_102002971 Ga0070673_1020029711 97
135 3300005365 Ga0070688_100018584 Ga0070688_1000185842 97
136 3300005366 Ga0070659_100048436 Ga0070659_1000484362 97
137 3300005366 Ga0070659_100184565 Ga0070659_1001845651 97
138 3300005366 Ga0070659_100297699 Ga0070659_1002976992 97
139 3300005366 Ga0070659_100308167 Ga0070659_1003081672 97
140 3300005366 Ga0070659_100920587 Ga0070659_1009205871 97
141 3300005367 Ga0070667_100137301 Ga0070667_1001373012 97
142 3300005367 Ga0070667_100654787 Ga0070667_1006547872 97
143 3300005434 Ga0070709_10009593 Ga0070709_100095934 97
144 3300005434 Ga0070709_10036089 Ga0070709_100360892 97
145 3300005434 Ga0070709_10056629 Ga0070709_100566294 97
146 3300005434 Ga0070709_11591162 Ga0070709_115911621 97
147 3300005435 Ga0070714_100004697 Ga0070714_1000046972 97
148 3300005435 Ga0070714_100029810 Ga0070714_1000298103 97
149 3300005435 Ga0070714_100392216 Ga0070714_1003922161 97
150 3300005435 Ga0070714_101598920 Ga0070714_1015989201 97
151 3300005436 Ga0070713_100000168 Ga0070713_10000016820 97
152 3300005436 Ga0070713_100051526 Ga0070713_1000515262 97
153 3300005436 Ga0070713_102055622 Ga0070713_1020556222 97
154 3300005437 Ga0070710_10106524 Ga0070710_101065242 97
155 3300005437 Ga0070710_10175492 Ga0070710_101754922 97
156 3300005439 Ga0070711_100115217 Ga0070711_1001152174 97
157 3300005439 Ga0070711_100884414 Ga0070711_1008844142 97
158 3300005441 Ga0070700_100719378 Ga0070700_1007193782 97
159 3300005444 Ga0070694_100092890 Ga0070694_1000928903 97
160 3300005455 Ga0070663_100032502 Ga0070663_1000325022 97
161 3300005455 Ga0070663_100114062 Ga0070663_1001140622 97
162 3300005456 Ga0070678_100090584 Ga0070678_1000905842 97
163 3300005456 Ga0070678_101610695 Ga0070678_1016106952 97
164 3300005456 Ga0070678_101705827 Ga0070678_1017058271 97
165 3300005457 Ga0070662_100146176 Ga0070662_1001461762 97
166 3300005457 Ga0070662_100269442 Ga0070662_1002694422 97
167 3300005457 Ga0070662_100840166 Ga0070662_1008401662 97
168 3300005457 Ga0070662_101342267 Ga0070662_1013422672 97
169 3300005458 Ga0070681_10023492 Ga0070681_100234924 97
170 3300005458 Ga0070681_10077854 Ga0070681_100778543 97
171 3300005458 Ga0070681_10324270 Ga0070681_103242702 97
172 3300005458 Ga0070681_10401530 Ga0070681_104015302 97
173 3300005458 Ga0070681_10791978 Ga0070681_107919782 97
174 3300005459 Ga0068867_100010986 Ga0068867_1000109865 97
175 3300005466 Ga0070685_10087289 Ga0070685_100872892 97
176 3300005466 Ga0070685_10093785 Ga0070685_100937853 97
177 3300005467 Ga0070706_100454631 Ga0070706_1004546311 97
178 3300005518 Ga0070699_100230574 Ga0070699_1002305742 97
179 3300005530 Ga0070679_100032089 Ga0070679_1000320895 97
180 3300005530 Ga0070679_100888116 Ga0070679_1008881162 97
181 3300005530 Ga0070679_101108943 Ga0070679_1011089431 97
182 3300005530 Ga0070679_101290837 Ga0070679_1012908371 97
183 3300005535 Ga0070684_100017327 Ga0070684_1000173274 97
184 3300005535 Ga0070684_100027011 Ga0070684_1000270112 97
185 3300005535 Ga0070684_100063417 Ga0070684_1000634173 97
186 3300005535 Ga0070684_100310942 Ga0070684_1003109422 97
187 3300005535 Ga0070684_100562247 Ga0070684_1005622472 97
188 3300005535 Ga0070684_100920190 Ga0070684_1009201902 97
189 3300005539 Ga0068853_100576328 Ga0068853_1005763282 97
190 3300005539 Ga0068853_101749056 Ga0068853_1017490561 97
191 3300005543 Ga0070672_100114001 Ga0070672_1001140011 97
192 3300005543 Ga0070672_100166475 Ga0070672_1001664752 97
193 3300005543 Ga0070672_100265732 Ga0070672_1002657322 97
194 3300005543 Ga0070672_100300661 Ga0070672_1003006612 97
195 3300005543 Ga0070672_100567463 Ga0070672_1005674632 97
196 3300005543 Ga0070672_101092428 Ga0070672_1010924282 97
197 3300005543 Ga0070672_101306804 Ga0070672_1013068041 97
198 3300005544 Ga0070686_100639050 Ga0070686_1006390502 97
199 3300005544 Ga0070686_100971405 Ga0070686_1009714052 97
200 3300005545 Ga0070695_100318783 Ga0070695_1003187832 97
201 3300005545 Ga0070695_100327524 Ga0070695_1003275242 97
202 3300005545 Ga0070695_100520785 Ga0070695_1005207852 97
203 3300005545 Ga0070695_101534646 Ga0070695_1015346462 97
204 3300005545 Ga0070695_101637135 Ga0070695_1016371351 97
205 3300005546 Ga0070696_100113732 Ga0070696_1001137322 97
206 3300005546 Ga0070696_100122741 Ga0070696_1001227412 97
207 3300005547 Ga0070693_100012610 Ga0070693_1000126103 97
208 3300005547 Ga0070693_100797629 Ga0070693_1007976292 97
209 3300005549 Ga0070704_100003924 Ga0070704_1000039244 97
210 3300005549 Ga0070704_101408657 Ga0070704_1014086571 97
211 3300005563 Ga0068855_100004465 Ga0068855_10000446513 97
212 3300005563 Ga0068855_100334991 Ga0068855_1003349911 97
213 3300005564 Ga0070664_100046540 Ga0070664_1000465403 97
214 3300005564 Ga0070664_100071150 Ga0070664_1000711502 97
215 3300005564 Ga0070664_100377929 Ga0070664_1003779292 97
216 3300005564 Ga0070664_100402657 Ga0070664_1004026573 97
217 3300005564 Ga0070664_100428124 Ga0070664_1004281242 97
218 3300005564 Ga0070664_100492270 Ga0070664_1004922702 97
219 3300005564 Ga0070664_101350123 Ga0070664_1013501231 97
220 3300005564 Ga0070664_101799579 Ga0070664_1017995792 97
221 3300005577 Ga0068857_100036956 Ga0068857_1000369562 97
222 3300005577 Ga0068857_100091619 Ga0068857_1000916194 97
223 3300005577 Ga0068857_100672225 Ga0068857_1006722252 97
224 3300005578 Ga0068854_100029527 Ga0068854_1000295272 97
225 3300005578 Ga0068854_100395260 Ga0068854_1003952602 97
226 3300005614 Ga0068856_100348838 Ga0068856_1003488382 97
227 3300005614 Ga0068856_100398126 Ga0068856_1003981262 97
228 3300005615 Ga0070702_100973644 Ga0070702_1009736442 97
229 3300005616 Ga0068852_100228011 Ga0068852_1002280112 97
230 3300005616 Ga0068852_100249695 Ga0068852_1002496953 97
231 3300005616 Ga0068852_100345930 Ga0068852_1003459303 97
232 3300005616 Ga0068852_100803720 Ga0068852_1008037202 97
233 3300005617 Ga0068859_100020486 Ga0068859_1000204862 97
234 3300005617 Ga0068859_102185738 Ga0068859_1021857382 97
235 3300005618 Ga0068864_100048790 Ga0068864_1000487904 97
236 3300005718 Ga0068866_11271712 Ga0068866_112717122 97
237 3300005719 Ga0068861_100248109 Ga0068861_1002481092 97
238 3300005719 Ga0068861_100265826 Ga0068861_1002658263 97
239 3300005719 Ga0068861_101091389 Ga0068861_1010913892 97
240 3300005834 Ga0068851_10233002 Ga0068851_102330022 97
241 3300005834 Ga0068851_10310274 Ga0068851_103102742 97
242 3300005840 Ga0068870_10001350 Ga0068870_100013504 97
243 3300005841 Ga0068863_100345344 Ga0068863_1003453442 97
244 3300005841 Ga0068863_101500322 Ga0068863_1015003222 97
245 3300005842 Ga0068858_100086515 Ga0068858_1000865152 97
246 3300005842 Ga0068858_102211906 Ga0068858_1022119062 97
247 3300005843 Ga0068860_100038331 Ga0068860_1000383315 97
248 3300005844 Ga0068862_100088865 Ga0068862_1000888652 97
249 3300005844 Ga0068862_100607312 Ga0068862_1006073122 97
250 3300005985 Ga0081539_10000103 Ga0081539_10000103109 97
251 3300006028 Ga0070717_10058340 Ga0070717_100583402 97
252 3300006028 Ga0070717_10471490 Ga0070717_104714903 97
253 3300006028 Ga0070717_10724409 Ga0070717_107244092 97
254 3300006175 Ga0070712_100003656 Ga0070712_10000365611 97
255 3300006175 Ga0070712_100211655 Ga0070712_1002116552 97
256 3300006175 Ga0070712_100257583 Ga0070712_1002575833 97
257 3300006186 Ga0075369_10019451 Ga0075369_100194512 97
258 3300006195 Ga0075366_10027909 Ga0075366_100279095 97
259 3300006353 Ga0075370_10050067 Ga0075370_100500674 97
260 3300006358 Ga0068871_100288671 Ga0068871_1002886712 97
261 3300006846 Ga0075430_100191765 Ga0075430_1001917652 97
262 3300006846 Ga0075430_100655505 Ga0075430_1006555052 97
263 3300006846 Ga0075430_101006359 Ga0075430_1010063592 97
264 3300006847 Ga0075431_100075350 Ga0075431_1000753503 97
265 3300006847 Ga0075431_100204773 Ga0075431_1002047733 97
266 3300006847 Ga0075431_101245805 Ga0075431_1012458052 97
267 3300006852 Ga0075433_10339054 Ga0075433_103390543 97
268 3300006880 Ga0075429_101055457 Ga0075429_1010554572 97
269 3300006880 Ga0075429_101408755 Ga0075429_1014087552 97
270 3300006881 Ga0068865_100236802 Ga0068865_1002368023 97
271 3300006914 Ga0075436_100100836 Ga0075436_1001008363 97
272 3300006914 Ga0075436_100560910 Ga0075436_1005609102 97
273 3300006931 Ga0097620_100020486 Ga0097620_1000204862 97
274 3300006931 Ga0097620_102185929 Ga0097620_1021859292 97
275 3300006946 Ga0079104_1016283 Ga0079104_10162832 97
276 3300007076 Ga0075435_100004837 Ga0075435_1000048372 97
277 3300007076 Ga0075435_100483296 Ga0075435_1004832961 97
278 3300007265 Ga0099794_10023946 Ga0099794_100239462 97
279 3300007788 Ga0099795_10003070 Ga0099795_100030704 97
280 3300007788 Ga0099795_10280020 Ga0099795_102800201 97
281 3300009011 Ga0105251_10350811 Ga0105251_103508112 97
282 3300009093 Ga0105240_10013785 Ga0105240_100137857 97
283 3300009093 Ga0105240_10302459 Ga0105240_103024592 97
284 3300009093 Ga0105240_12381192 Ga0105240_123811922 97
285 3300009094 Ga0111539_10458223 Ga0111539_104582232 97
286 3300009098 Ga0105245_12011763 Ga0105245_120117631 97
287 3300009101 Ga0105247_11298443 Ga0105247_112984432 97
288 3300009147 Ga0114129_11524445 Ga0114129_115244452 97
289 3300009147 Ga0114129_12938087 Ga0114129_129380872 97
290 3300009148 Ga0105243_10046635 Ga0105243_100466355 97
291 3300009176 Ga0105242_12427266 Ga0105242_124272662 97
292 3300009177 Ga0105248_10187820 Ga0105248_101878202 97
293 3300009177 Ga0105248_11247886 Ga0105248_112478862 97
294 3300009545 Ga0105237_10039956 Ga0105237_100399563 97
295 3300009551 Ga0105238_10061680 Ga0105238_100616803 97
296 3300009551 Ga0105238_10434183 Ga0105238_104341832 97
297 3300009551 Ga0105238_10797331 Ga0105238_107973312 97
298 3300009551 Ga0105238_11095629 Ga0105238_110956292 97
299 3300009553 Ga0105249_10948572 Ga0105249_109485722 97
300 3300009553 Ga0105249_11055526 Ga0105249_110555262 97
301 3300009553 Ga0105249_13487615 Ga0105249_134876151 97
302 3300010159 Ga0099796_10458075 Ga0099796_104580752 97
303 3300010375 Ga0105239_10025227 Ga0105239_100252272 97
304 3300010375 Ga0105239_11405377 Ga0105239_114053772 97
305 3300011119 Ga0105246_10411305 Ga0105246_104113052 97
306 3300011119 Ga0105246_10852407 Ga0105246_108524072 97
307 3300011119 Ga0105246_11041459 Ga0105246_110414592 97
308 3300012502 Ga0157347_1020377 Ga0157347_10203772 97
309 3300013100 Ga0157373_10348239 Ga0157373_103482392 97
310 3300013100 Ga0157373_10572287 Ga0157373_105722872 97
311 3300013102 Ga0157371_10111548 Ga0157371_101115482 97
312 3300013102 Ga0157371_10385107 Ga0157371_103851072 97
313 3300013102 Ga0157371_11164409 Ga0157371_111644092 97
314 3300013104 Ga0157370_10027470 Ga0157370_100274705 97
315 3300013104 Ga0157370_10044296 Ga0157370_100442963 97
316 3300013104 Ga0157370_10286338 Ga0157370_102863383 97
317 3300013104 Ga0157370_11789799 Ga0157370_117897992 97
318 3300013105 Ga0157369_10155261 Ga0157369_101552612 97
319 3300013105 Ga0157369_10646827 Ga0157369_106468273 97
320 3300013105 Ga0157369_11329576 Ga0157369_113295762 97
321 3300013105 Ga0157369_12252195 Ga0157369_122521952 97
322 3300013296 Ga0157374_11279188 Ga0157374_112791882 97
323 3300013296 Ga0157374_12313574 Ga0157374_123135742 97
324 3300013297 Ga0157378_10506210 Ga0157378_105062102 97
325 3300013297 Ga0157378_10920836 Ga0157378_109208362 97
326 3300013297 Ga0157378_11115765 Ga0157378_111157652 97
327 3300013297 Ga0157378_11387265 Ga0157378_113872652 97
328 3300013306 Ga0163162_10460780 Ga0163162_104607802 97
329 3300013306 Ga0163162_10555845 Ga0163162_105558452 97
330 3300013306 Ga0163162_10670238 Ga0163162_106702382 97
331 3300013306 Ga0163162_11735111 Ga0163162_117351111 97
332 3300013306 Ga0163162_12903158 Ga0163162_129031582 97
333 3300013307 Ga0157372_10051984 Ga0157372_100519842 97
334 3300013307 Ga0157372_10463378 Ga0157372_104633782 97
335 3300013308 Ga0157375_10141341 Ga0157375_101413412 97
336 3300013308 Ga0157375_10709640 Ga0157375_107096402 97
337 3300013308 Ga0157375_11113680 Ga0157375_111136802 97
338 3300014325 Ga0163163_10352776 Ga0163163_103527762 97
339 3300014325 Ga0163163_11550547 Ga0163163_115505472 97
340 3300014325 Ga0163163_12860585 Ga0163163_128605852 97
341 3300014326 Ga0157380_10396090 Ga0157380_103960902 97
342 3300014326 Ga0157380_12000636 Ga0157380_120006362 97
343 3300014497 Ga0182008_10002555 Ga0182008_100025554 97
344 3300014497 Ga0182008_10013374 Ga0182008_100133744 97
345 3300014497 Ga0182008_10273328 Ga0182008_102733282 97
346 3300014745 Ga0157377_10364316 Ga0157377_103643162 97
347 3300014745 Ga0157377_10657886 Ga0157377_106578862 97
348 3300014745 Ga0157377_11365740 Ga0157377_113657402 97
349 3300014968 Ga0157379_10648618 Ga0157379_106486182 97
350 3300014969 Ga0157376_10605332 Ga0157376_106053321 97
351 3300014969 Ga0157376_10894730 Ga0157376_108947302 97
352 3300014969 Ga0157376_11892112 Ga0157376_118921122 97
353 3300014969 Ga0157376_13009303 Ga0157376_130093031 97
354 3300015261 Ga0182006_1000465 Ga0182006_100046527 97
355 3300015262 Ga0182007_10007704 Ga0182007_100077042 97
356 3300015262 Ga0182007_10282251 Ga0182007_102822511 97
357 3300015265 Ga0182005_1000078 Ga0182005_100007888 97
358 3300025224 Ga0209784_100002 Ga0209784_1000021160 97
359 3300025225 Ga0209566_100003 Ga0209566_1000031160 97
360 3300025226 Ga0209674_100003 Ga0209674_1000031918 97
361 3300025226 Ga0209674_100004 Ga0209674_1000041160 97
362 3300025230 Ga0209563_100006 Ga0209563_1000061160 97
363 3300025230 Ga0209563_100017 Ga0209563_10001752 97
364 3300025253 Ga0209677_100003 Ga0209677_1000031160 97
365 3300025253 Ga0209677_100467 Ga0209677_10046720 97
366 3300025303 Ga0209051_1011278 Ga0209051_10112783 97
367 3300025304 Ga0209257_1000032 Ga0209257_1000032243 97
368 3300025315 Ga0207697_10117564 Ga0207697_101175642 97
369 3300025321 Ga0207656_10131262 Ga0207656_101312622 97
370 3300025321 Ga0207656_10303200 Ga0207656_103032002 97
371 3300025321 Ga0207656_10485358 Ga0207656_104853581 97
372 3300025321 Ga0207656_10497700 Ga0207656_104977002 97
373 3300025893 Ga0207682_10301251 Ga0207682_103012512 97
374 3300025893 Ga0207682_10495084 Ga0207682_104950842 97
375 3300025898 Ga0207692_10081066 Ga0207692_100810662 97
376 3300025898 Ga0207692_10283405 Ga0207692_102834051 97
377 3300025899 Ga0207642_10198671 Ga0207642_101986713 97
378 3300025904 Ga0207647_10068185 Ga0207647_100681852 97
379 3300025905 Ga0207685_10219732 Ga0207685_102197322 97
380 3300025906 Ga0207699_10010032 Ga0207699_100100322 97
381 3300025906 Ga0207699_10019110 Ga0207699_100191104 97
382 3300025906 Ga0207699_10074048 Ga0207699_100740482 97
383 3300025906 Ga0207699_10391367 Ga0207699_103913672 97
384 3300025907 Ga0207645_10117231 Ga0207645_101172313 97
385 3300025907 Ga0207645_10128707 Ga0207645_101287072 97
386 3300025907 Ga0207645_10196254 Ga0207645_101962542 97
387 3300025908 Ga0207643_10008540 Ga0207643_100085401 97
388 3300025909 Ga0207705_10020296 Ga0207705_100202962 97
389 3300025909 Ga0207705_10066042 Ga0207705_100660422 97
390 3300025909 Ga0207705_10083344 Ga0207705_100833442 97
391 3300025909 Ga0207705_10480128 Ga0207705_104801282 97
392 3300025909 Ga0207705_10480231 Ga0207705_104802312 97
393 3300025909 Ga0207705_10563023 Ga0207705_105630232 97
394 3300025912 Ga0207707_10008443 Ga0207707_100084431 97
395 3300025912 Ga0207707_10188488 Ga0207707_101884883 97
396 3300025912 Ga0207707_10681211 Ga0207707_106812112 97
397 3300025912 Ga0207707_11121705 Ga0207707_111217052 97
398 3300025913 Ga0207695_10001853 Ga0207695_100018533 97
399 3300025913 Ga0207695_10003759 Ga0207695_1000375914 97
400 3300025913 Ga0207695_10037174 Ga0207695_100371743 97
401 3300025914 Ga0207671_10013287 Ga0207671_100132872 97
402 3300025915 Ga0207693_10003536 Ga0207693_1000353614 97
403 3300025915 Ga0207693_10113785 Ga0207693_101137853 97
404 3300025915 Ga0207693_10122685 Ga0207693_101226852 97
405 3300025916 Ga0207663_10004765 Ga0207663_100047657 97
406 3300025916 Ga0207663_10088813 Ga0207663_100888134 97
407 3300025917 Ga0207660_10000108 Ga0207660_1000010838 97
408 3300025917 Ga0207660_10184576 Ga0207660_101845762 97
409 3300025917 Ga0207660_10187336 Ga0207660_101873362 97
410 3300025917 Ga0207660_11189932 Ga0207660_111899322 97
411 3300025917 Ga0207660_11726346 Ga0207660_117263461 97
412 3300025918 Ga0207662_10040598 Ga0207662_100405984 97
413 3300025918 Ga0207662_10823619 Ga0207662_108236192 97
414 3300025919 Ga0207657_10134465 Ga0207657_101344653 97
415 3300025919 Ga0207657_10192341 Ga0207657_101923412 97
416 3300025919 Ga0207657_10624397 Ga0207657_106243972 97
417 3300025920 Ga0207649_10059611 Ga0207649_100596112 97
418 3300025920 Ga0207649_10284652 Ga0207649_102846522 97
419 3300025920 Ga0207649_10448539 Ga0207649_104485392 97
420 3300025921 Ga0207652_10461974 Ga0207652_104619743 97
421 3300025921 Ga0207652_11793562 Ga0207652_117935621 97
422 3300025922 Ga0207646_11875752 Ga0207646_118757521 97
423 3300025923 Ga0207681_10037004 Ga0207681_100370045 97
424 3300025924 Ga0207694_10037025 Ga0207694_100370253 97
425 3300025925 Ga0207650_10039405 Ga0207650_100394052 97
426 3300025925 Ga0207650_10163241 Ga0207650_101632412 97
427 3300025925 Ga0207650_10172409 Ga0207650_101724092 97
428 3300025925 Ga0207650_11455561 Ga0207650_114555612 97
429 3300025926 Ga0207659_10037462 Ga0207659_100374622 97
430 3300025926 Ga0207659_10216485 Ga0207659_102164853 97
431 3300025926 Ga0207659_10574573 Ga0207659_105745732 97
432 3300025926 Ga0207659_11323980 Ga0207659_113239802 97
433 3300025927 Ga0207687_11615204 Ga0207687_116152042 97
434 3300025927 Ga0207687_11800710 Ga0207687_118007101 97
435 3300025928 Ga0207700_10026068 Ga0207700_100260683 97
436 3300025928 Ga0207700_10143131 Ga0207700_101431312 97
437 3300025928 Ga0207700_10153827 Ga0207700_101538272 97
438 3300025928 Ga0207700_10694998 Ga0207700_106949982 97
439 3300025929 Ga0207664_10026276 Ga0207664_100262762 97
440 3300025929 Ga0207664_10040338 Ga0207664_100403384 97
441 3300025931 Ga0207644_10607647 Ga0207644_106076472 97
442 3300025932 Ga0207690_10181149 Ga0207690_101811494 97
443 3300025932 Ga0207690_10213555 Ga0207690_102135552 97
444 3300025932 Ga0207690_11402236 Ga0207690_114022361 97
445 3300025933 Ga0207706_10120698 Ga0207706_101206982 97
446 3300025933 Ga0207706_10249799 Ga0207706_102497992 97
447 3300025933 Ga0207706_10427236 Ga0207706_104272362 97
448 3300025933 Ga0207706_10612496 Ga0207706_106124962 97
449 3300025934 Ga0207686_10211190 Ga0207686_102111902 97
450 3300025935 Ga0207709_10834611 Ga0207709_108346111 97
451 3300025935 Ga0207709_11242391 Ga0207709_112423912 97
452 3300025935 Ga0207709_11347797 Ga0207709_113477972 97
453 3300025936 Ga0207670_10015446 Ga0207670_100154463 97
454 3300025936 Ga0207670_11220513 Ga0207670_112205132 97
455 3300025937 Ga0207669_10330718 Ga0207669_103307181 97
456 3300025937 Ga0207669_10509609 Ga0207669_105096091 97
457 3300025938 Ga0207704_10061975 Ga0207704_100619754 97
458 3300025938 Ga0207704_10432381 Ga0207704_104323812 97
459 3300025939 Ga0207665_10844310 Ga0207665_108443102 97
460 3300025939 Ga0207665_11212508 Ga0207665_112125082 97
461 3300025940 Ga0207691_10003241 Ga0207691_100032417 97
462 3300025940 Ga0207691_10034050 Ga0207691_100340505 97
463 3300025940 Ga0207691_10159600 Ga0207691_101596002 97
464 3300025940 Ga0207691_10464926 Ga0207691_104649263 97
465 3300025940 Ga0207691_10541450 Ga0207691_105414502 97
466 3300025940 Ga0207691_11410422 Ga0207691_114104222 97
467 3300025941 Ga0207711_10116293 Ga0207711_101162934 97
468 3300025941 Ga0207711_10148571 Ga0207711_101485712 97
469 3300025941 Ga0207711_10263813 Ga0207711_102638133 97
470 3300025942 Ga0207689_10060980 Ga0207689_100609804 97
471 3300025944 Ga0207661_10046637 Ga0207661_100466375 97
472 3300025944 Ga0207661_10148680 Ga0207661_101486802 97
473 3300025944 Ga0207661_10440636 Ga0207661_104406363 97
474 3300025944 Ga0207661_10453473 Ga0207661_104534732 97
475 3300025944 Ga0207661_10538442 Ga0207661_105384422 97
476 3300025945 Ga0207679_10094142 Ga0207679_100941422 97
477 3300025945 Ga0207679_10115434 Ga0207679_101154342 97
478 3300025945 Ga0207679_10275936 Ga0207679_102759362 97
479 3300025945 Ga0207679_10369007 Ga0207679_103690072 97
480 3300025945 Ga0207679_10469775 Ga0207679_104697751 97
481 3300025945 Ga0207679_11832344 Ga0207679_118323442 97
482 3300025949 Ga0207667_10000438 Ga0207667_1000043843 97
483 3300025949 Ga0207667_10080431 Ga0207667_100804315 97
484 3300025949 Ga0207667_10120706 Ga0207667_101207064 97
485 3300025949 Ga0207667_10532629 Ga0207667_105326292 97
486 3300025949 Ga0207667_11078949 Ga0207667_110789492 97
487 3300025949 Ga0207667_11779875 Ga0207667_117798752 97
488 3300025960 Ga0207651_10044954 Ga0207651_100449542 97
489 3300025960 Ga0207651_10049833 Ga0207651_100498332 97
490 3300025960 Ga0207651_10592134 Ga0207651_105921342 97
491 3300025960 Ga0207651_11912507 Ga0207651_119125072 97
492 3300025961 Ga0207712_11111599 Ga0207712_111115992 97
493 3300025961 Ga0207712_11180360 Ga0207712_111803602 97
494 3300025961 Ga0207712_11858715 Ga0207712_118587152 97
495 3300025972 Ga0207668_10170685 Ga0207668_101706851 97
496 3300025972 Ga0207668_10813330 Ga0207668_108133302 97
497 3300025972 Ga0207668_11650884 Ga0207668_116508842 97
498 3300025981 Ga0207640_10164010 Ga0207640_101640102 97
499 3300025986 Ga0207658_10207146 Ga0207658_102071462 97
500 3300025986 Ga0207658_10334431 Ga0207658_103344311 97
501 3300025986 Ga0207658_10553881 Ga0207658_105538812 97
502 3300026023 Ga0207677_10558543 Ga0207677_105585432 97
503 3300026023 Ga0207677_10874560 Ga0207677_108745602 97
504 3300026023 Ga0207677_11010063 Ga0207677_110100632 97
505 3300026035 Ga0207703_10320070 Ga0207703_103200702 97
506 3300026041 Ga0207639_10335709 Ga0207639_103357092 97
507 3300026067 Ga0207678_10228246 Ga0207678_102282462 97
508 3300026067 Ga0207678_10286314 Ga0207678_102863142 97
509 3300026067 Ga0207678_11119896 Ga0207678_111198962 97
510 3300026067 Ga0207678_11339925 Ga0207678_113399252 97
511 3300026075 Ga0207708_10567734 Ga0207708_105677342 97
512 3300026075 Ga0207708_11487935 Ga0207708_114879352 97
513 3300026075 Ga0207708_11562456 Ga0207708_115624562 97
514 3300026078 Ga0207702_10100428 Ga0207702_101004282 97
515 3300026078 Ga0207702_10714697 Ga0207702_107146972 97
516 3300026078 Ga0207702_12128198 Ga0207702_121281982 97
517 3300026088 Ga0207641_10234602 Ga0207641_102346023 97
518 3300026088 Ga0207641_10605511 Ga0207641_106055112 97
519 3300026089 Ga0207648_10009384 Ga0207648_100093844 97
520 3300026089 Ga0207648_11342871 Ga0207648_113428711 97
521 3300026095 Ga0207676_10528943 Ga0207676_105289432 97
522 3300026116 Ga0207674_10019328 Ga0207674_100193286 97
523 3300026116 Ga0207674_10030258 Ga0207674_100302584 97
524 3300026116 Ga0207674_10471185 Ga0207674_104711851 97
525 3300026116 Ga0207674_11842393 Ga0207674_118423932 97
526 3300026118 Ga0207675_100281049 Ga0207675_1002810493 97
527 3300026118 Ga0207675_100560854 Ga0207675_1005608542 97
528 3300026118 Ga0207675_100702801 Ga0207675_1007028012 97
529 3300026118 Ga0207675_100762188 Ga0207675_1007621882 97
530 3300026121 Ga0207683_10188565 Ga0207683_101885652 97
531 3300026121 Ga0207683_10227218 Ga0207683_102272182 97
532 3300026121 Ga0207683_10406459 Ga0207683_104064592 97
533 3300026142 Ga0207698_10203459 Ga0207698_102034592 97
534 3300026142 Ga0207698_10212653 Ga0207698_102126532 97
535 3300026142 Ga0207698_10577776 Ga0207698_105777761 97
536 3300026142 Ga0207698_11302213 Ga0207698_113022132 97
537 3300027111 Ga0209281_1015504 Ga0209281_10155042 97
538 3300027360 Ga0209969_1006876 Ga0209969_10068762 97
539 3300027360 Ga0209969_1064622 Ga0209969_10646222 97
540 3300027364 Ga0209967_1002057 Ga0209967_10020571 97
541 3300027395 Ga0209996_1012602 Ga0209996_10126022 97
542 3300027462 Ga0210000_1000359 Ga0210000_10003594 97
543 3300027462 Ga0210000_1021166 Ga0210000_10211662 97
544 3300027512 Ga0209179_1076816 Ga0209179_10768161 97
545 3300027526 Ga0209968_1057529 Ga0209968_10575292 97
546 3300027526 Ga0209968_1076531 Ga0209968_10765312 97
547 3300027543 Ga0209999_1000555 Ga0209999_10005553 97
548 3300027665 Ga0209983_1046924 Ga0209983_10469242 97
549 3300027666 Ga0209282_1125663 Ga0209282_11256632 97
550 3300027671 Ga0209588_1035122 Ga0209588_10351222 97
551 3300027682 Ga0209971_1006039 Ga0209971_10060392 97
552 3300027876 Ga0209974_10006308 Ga0209974_100063083 97
553 3300027876 Ga0209974_10016099 Ga0209974_100160992 97
554 3300028036 Ga0265355_1020574 Ga0265355_10205742 97
555 3300028380 Ga0268265_10974493 Ga0268265_109744932 97
556 3300028380 Ga0268265_11266507 Ga0268265_112665072 97
557 3300028381 Ga0268264_10359998 Ga0268264_103599982 97
558 3300028800 Ga0265338_10460300 Ga0265338_104603002 97
559 3300030745 Ga0316182_1388674 Ga0316182_13886744 97
560 3300031548 Ga0307408_100542836 Ga0307408_1005428362 97
561 3300031548 Ga0307408_101042820 Ga0307408_1010428202 97
562 3300031548 Ga0307408_101318191 Ga0307408_1013181912 97
563 3300031665 Ga0316575_10000032 Ga0316575_1000003225 97
564 3300031665 Ga0316575_10007166 Ga0316575_100071663 97
565 3300031665 Ga0316575_10208096 Ga0316575_102080961 97
566 3300031691 Ga0316579_10000922 Ga0316579_100009224 97
567 3300031691 Ga0316579_10003486 Ga0316579_100034863 97
568 3300031727 Ga0316576_10505678 Ga0316576_105056781 97
569 3300031728 Ga0316578_10019379 Ga0316578_100193795 97
570 3300031728 Ga0316578_10038835 Ga0316578_100388354 97
571 3300031731 Ga0307405_10302791 Ga0307405_103027912 97
572 3300031731 Ga0307405_11720673 Ga0307405_117206732 97
573 3300031824 Ga0307413_10775714 Ga0307413_107757142 97
574 3300031852 Ga0307410_10137989 Ga0307410_101379894 97
575 3300031852 Ga0307410_10643308 Ga0307410_106433082 97
576 3300031901 Ga0307406_10053066 Ga0307406_100530662 97
577 3300031901 Ga0307406_10124064 Ga0307406_101240642 97
578 3300031901 Ga0307406_10333259 Ga0307406_103332593 97
579 3300031901 Ga0307406_11680663 Ga0307406_116806632 97
580 3300031911 Ga0307412_10388759 Ga0307412_103887592 97
581 3300031911 Ga0307412_11207745 Ga0307412_112077452 97
582 3300031995 Ga0307409_100321415 Ga0307409_1003214153 97
583 3300031995 Ga0307409_100725525 Ga0307409_1007255253 97
584 3300031995 Ga0307409_100959655 Ga0307409_1009596552 97
585 3300031995 Ga0307409_101849815 Ga0307409_1018498152 97
586 3300031995 Ga0307409_102158352 Ga0307409_1021583521 97
587 3300032002 Ga0307416_100071671 Ga0307416_1000716712 97
588 3300032002 Ga0307416_100094290 Ga0307416_1000942902 97
589 3300032002 Ga0307416_100995760 Ga0307416_1009957602 97
590 3300032002 Ga0307416_101643754 Ga0307416_1016437542 97
591 3300032002 Ga0307416_101978192 Ga0307416_1019781922 97
592 3300032002 Ga0307416_102411812 Ga0307416_1024118122 97
593 3300032002 Ga0307416_102631432 Ga0307416_1026314322 97
594 3300032004 Ga0307414_10201808 Ga0307414_102018082 97
595 3300032004 Ga0307414_11979702 Ga0307414_119797022 97
596 3300032004 Ga0307414_12178846 Ga0307414_121788461 97
597 3300032005 Ga0307411_10189389 Ga0307411_101893892 97
598 3300032005 Ga0307411_10244153 Ga0307411_102441533 97
599 3300032005 Ga0307411_10288180 Ga0307411_102881801 97
600 3300032126 Ga0307415_100523335 Ga0307415_1005233352 97
601 3300032126 Ga0307415_100606156 Ga0307415_1006061562 97
602 3300032126 Ga0307415_100911094 Ga0307415_1009110942 97
603 3300032126 Ga0307415_101085684 Ga0307415_1010856842 97
604 3300032133 Ga0316583_10003578 Ga0316583_100035781 97
605 3300032133 Ga0316583_10012848 Ga0316583_100128482 97
606 3300032133 Ga0316583_10110681 Ga0316583_101106812 97
607 3300032168 Ga0316593_10236263 Ga0316593_102362632 97
608 3300035083 Ga0373926_0012427 Ga0373926_0012427_1513_1806 97
609 3300035083 Ga0373926_0081631 Ga0373926_0081631_357_650 97
610 3300035086 Ga0373934_0000613 Ga0373934_0000613_1547_1840 97
611 3300035089 Ga0373944_0043393 Ga0373944_0043393_507_800 97
612 3300035111 Ga0373923_0021276 Ga0373923_0021276_1021_1314 97
613 3300035116 Ga0373945_0096315 Ga0373945_0096315_606_899 97
614 3300035119 Ga0373956_0097835 Ga0373956_0097835_714_1007 97
615 3300035120 Ga0373957_0011425 Ga0373957_0011425_1726_2019 97
616 3300035121 Ga0373960_0038491 Ga0373960_0038491_509_817 97
617 3300035170 Ga0373943_0967145 Ga0373943_0967145_165_458 97
618 3300035171 Ga0373946_0066655 Ga0373946_0066655_981_1274 97
619 3300035172 Ga0373955_0000555 Ga0373955_0000555_15020_15313 97
620 3300035207 Ga0373942_0160572 Ga0373942_0160572_333_635 97
621 3300035398 Ga0316574_0311636 Ga0316574_0311636_265_576 97
622 3300035410 Ga0373924_0031046 Ga0373924_0031046_1723_2016 97
623 3300035692 Ga0373935_0015507 Ga0373935_0015507_2892_3185 97
624 3300035692 Ga0373935_0518439 Ga0373935_0518439_122_439 97
625 3300035692 Ga0373935_0568069 Ga0373935_0568069_393_686 97
626 3300035692 Ga0373935_1182297 Ga0373935_1182297_249_542 97
627 3300035695 Ga0373927_0027933 Ga0373927_0027933_1159_1452 97
628 3300035695 Ga0373927_0104013 Ga0373927_0104013_1181_1474 97
629 3300035695 Ga0373927_0164642 Ga0373927_0164642_474_767 97
630 3300035724 Ga0373933_0000055 Ga0373933_0000055_11593_11886 97
631 3300035725 Ga0373947_0037687 Ga0373947_0037687_2514_2807 97
632 3300035725 Ga0373947_0043390 Ga0373947_0043390_762_1055 97
633 3300036401 Ga0373937_0000450 Ga0373937_0000450_30172_30465 97
634 3300036401 Ga0373937_0386729 Ga0373937_0386729_582_875 97
635 3300036647 Ga0316582_0000229 Ga0316582_0000229_4501_4806 97
636 3300036647 Ga0316582_0010275 Ga0316582_0010275_3275_3586 97
637 3300036647 Ga0316582_0131791 Ga0316582_0131791_917_1219 97
638 3300036712 Ga0316584_0062296 Ga0316584_0062296_2455_2760 97
639 3300036712 Ga0316584_0124699 Ga0316584_0124699_1499_1801 97
640 3300037068 Ga0373925_0533729 Ga0373925_0533729_285_578 97
641 3300037068 Ga0373925_0743704 Ga0373925_0743704_261_554 97
642 3300037068 Ga0373925_1281198 Ga0373925_1281198_193_501 97
643 3300037588 Ga0316581_0016222 Ga0316581_0016222_693_1004 97
644 3300037588 Ga0316581_0018143 Ga0316581_0018143_1044_1349 97
645 3300037853 Ga0436364_0497955 Ga0436364_0497955_21_338 97
646 3300038443 Ga0395901_0933184 Ga0395901_0933184_208_501 97
647 3300038443 Ga0395901_1686137 Ga0395901_1686137_264_557 97
648 3300039437 Ga0436365_0350682 Ga0436365_0350682_134_427 97
649 3300039437 Ga0436365_1200738 Ga0436365_1200738_107_400 97
650 3300039437 Ga0436365_1592469 Ga0436365_1592469_18_323 97
651 3300039447 Ga0436361_0730207 Ga0436361_0730207_1680_1985 97
652 3300039447 Ga0436361_1079523 Ga0436361_1079523_1630_1938 97
653 3300041404 Ga0439436_0140609 Ga0439436_0140609_221_526 97
654 3300041406 Ga0439439_0249705 Ga0439439_0249705_162_467 97
655 3300041410 Ga0439461_0062686 Ga0439461_0062686_344_664 97
656 3300041498 Ga0451841_0300790 Ga0451841_0300790_224_541 97
657 3300041501 Ga0451845_0910423 Ga0451845_0910423_69_389 97
658 3300041503 Ga0451847_0780003 Ga0451847_0780003_89_409 97
659 3300041512 Ga0451853_3739149 Ga0451853_3739149_470_790 97
660 3300042004 Ga0439445_0190724 Ga0439445_0190724_134_439 97
661 3300042004 Ga0439445_0224983 Ga0439445_0224983_135_455 97
662 3300042007 Ga0439449_0046339 Ga0439449_0046339_366_671 97
663 3300042010 Ga0439452_034928 Ga0439452_034928_437_742 97
664 3300042012 Ga0439455_0033113 Ga0439455_0033113_35_355 97
665 3300042014 Ga0439457_100883 Ga0439457_100883_214_519 97
666 3300042116 Ga0450912_004316 Ga0450912_004316_162_482 97
667 3300042120 Ga0450917_003459 Ga0450917_003459_554_874 97
668 3300042125 Ga0450923_116922 Ga0450923_116922_182_487 97
669 3300042126 Ga0450888_002272 Ga0450888_002272_756_1076 97
670 3300042127 Ga0450890_009447 Ga0450890_009447_30_350 97
671 3300042129 Ga0450891_000222 Ga0450891_000222_936_1256 97
672 3300042130 Ga0450892_001107 Ga0450892_001107_799_1119 97
673 3300042138 Ga0450903_020990 Ga0450903_020990_494_814 97
674 3300042435 Ga0439434_0095027 Ga0439434_0095027_362_664 97
675 3300042437 Ga0439444_0002332 Ga0439444_0002332_225_533 97
676 3300042438 Ga0439459_0017764 Ga0439459_0017764_388_708 97
677 3300042532 Ga0450893_0000472 Ga0450893_0000472_3766_4086 97
678 3300042876 Ga0451577_0804129 Ga0451577_0804129_102_407 97
679 3300042993 Ga0439440_0114816 Ga0439440_0114816_332_652 97
680 3300042993 Ga0439440_0140568 Ga0439440_0140568_55_348 97
681 3300044673 Ga0453683_0074998 Ga0453683_0074998_1069_1380 97
682 3300044673 Ga0453683_0518135 Ga0453683_0518135_68_364 97
683 3300044712 Ga0453684_0743783 Ga0453684_0743783_271_576 97
684 3300044712 Ga0453684_0872633 Ga0453684_0872633_23_328 97
685 3300045051 Ga0451576_0072908 Ga0451576_0072908_3026_3337 97
686 3300045051 Ga0451576_1661229 Ga0451576_1661229_275_589 97
687 3300045976 Ga0466967_1666302 Ga0466967_1666302_19_312 97
688 3300046454 Ga0495592_0002705 Ga0495592_0002705_4447_4740 97
689 3300046454 Ga0495592_0825445 Ga0495592_0825445_63_356 97
690 3300046459 Ga0495629_0011314 Ga0495629_0011314_4529_4822 97
691 3300046459 Ga0495629_0064592 Ga0495629_0064592_1650_1943 97
692 3300046459 Ga0495629_0142153 Ga0495629_0142153_593_886 97
693 3300046462 Ga0495651_0000996 Ga0495651_0000996_16847_17140 97
694 3300046463 Ga0495653_0000195 Ga0495653_0000195_28064_28357 97
695 3300046471 Ga0495650_0012788 Ga0495650_0012788_1327_1644 97
696 3300046472 Ga0495580_0008769 Ga0495580_0008769_372_665 97
697 3300046472 Ga0495580_0048643 Ga0495580_0048643_2157_2450 97
698 3300046472 Ga0495580_0068932 Ga0495580_0068932_1919_2212 97
699 3300046473 Ga0495582_0041545 Ga0495582_0041545_789_1082 97
700 3300046473 Ga0495582_0215716 Ga0495582_0215716_737_1030 97
701 3300046473 Ga0495582_0538044 Ga0495582_0538044_368_661 97
702 3300046473 Ga0495582_0725799 Ga0495582_0725799_107_400 97
703 3300046475 Ga0495639_0008494 Ga0495639_0008494_494_787 97
704 3300046475 Ga0495639_0089033 Ga0495639_0089033_986_1279 97
705 3300046475 Ga0495639_0120029 Ga0495639_0120029_823_1116 97
706 3300046477 Ga0495664_0054273 Ga0495664_0054273_1574_1867 97
707 3300046499 Ga0495594_0036114 Ga0495594_0036114_592_885 97
708 3300046499 Ga0495594_0274194 Ga0495594_0274194_353_646 97
709 3300046499 Ga0495594_0695554 Ga0495594_0695554_233_526 97
710 3300046500 Ga0495596_0103789 Ga0495596_0103789_160_453 97
711 3300046500 Ga0495596_0334621 Ga0495596_0334621_132_425 97
712 3300046506 Ga0495583_0008785 Ga0495583_0008785_4979_5296 97
713 3300046507 Ga0495606_0006532 Ga0495606_0006532_9431_9748 97
714 3300046511 Ga0495608_0000085 Ga0495608_0000085_61195_61488 97
715 3300046511 Ga0495608_0662561 Ga0495608_0662561_203_496 97
716 3300046516 Ga0495628_0034222 Ga0495628_0034222_2948_3241 97
717 3300046517 Ga0495630_0011652 Ga0495630_0011652_718_1011 97
718 3300046517 Ga0495630_0022736 Ga0495630_0022736_473_766 97
719 3300046517 Ga0495630_0155017 Ga0495630_0155017_113_406 97
720 3300046517 Ga0495630_1355860 Ga0495630_1355860_149_442 97
721 3300046525 Ga0495663_0062093 Ga0495663_0062093_656_949 97
722 3300046525 Ga0495663_0082676 Ga0495663_0082676_165_479 97
723 3300046525 Ga0495663_0213062 Ga0495663_0213062_149_442 97
724 3300046526 Ga0495666_0184231 Ga0495666_0184231_437_730 97
725 3300046528 Ga0495642_0053050 Ga0495642_0053050_383_691 97
726 3300046529 Ga0495652_0008685 Ga0495652_0008685_7804_8097 97
727 3300046530 Ga0495654_0368700 Ga0495654_0368700_12_317 97
728 3300046531 Ga0495665_0005306 Ga0495665_0005306_3228_3521 97
729 3300046531 Ga0495665_0103981 Ga0495665_0103981_639_932 97
730 3300046531 Ga0495665_0106728 Ga0495665_0106728_31_324 97
731 3300046531 Ga0495665_0652993 Ga0495665_0652993_175_468 97
732 3300046533 Ga0495640_0304947 Ga0495640_0304947_572_865 97
733 3300046536 Ga0495587_0000114 Ga0495587_0000114_9257_9550 97
734 3300046537 Ga0495598_0189898 Ga0495598_0189898_303_596 97
735 3300046539 Ga0495621_0006211 Ga0495621_0006211_997_1290 97
736 3300046539 Ga0495621_0204629 Ga0495621_0204629_382_702 97
737 3300046539 Ga0495621_0254339 Ga0495621_0254339_219_512 97
738 3300046543 Ga0495645_0000144 Ga0495645_0000144_28146_28439 97
739 3300046543 Ga0495645_0629896 Ga0495645_0629896_325_618 97
740 3300046559 Ga0495667_0000241 Ga0495667_0000241_9072_9365 97
741 3300046559 Ga0495667_0082166 Ga0495667_0082166_247_540 97
742 3300046559 Ga0495667_0459167 Ga0495667_0459167_433_726 97
743 3300046616 Ga0495668_0107838 Ga0495668_0107838_336_653 97
744 3300046642 Ga0495634_0261307 Ga0495634_0261307_383_676 97
745 3300046660 Ga0495625_0152379 Ga0495625_0152379_866_1183 97
746 3300046660 Ga0495625_0534897 Ga0495625_0534897_28_333 97
747 3300046663 Ga0495635_0000253 Ga0495635_0000253_13206_13499 97
748 3300046663 Ga0495635_0336897 Ga0495635_0336897_502_795 97
749 3300046663 Ga0495635_0889632 Ga0495635_0889632_147_440 97
750 3300046664 Ga0495659_0241169 Ga0495659_0241169_83_391 97
751 3300046664 Ga0495659_0302271 Ga0495659_0302271_336_629 97
752 3300046674 Ga0495588_0066857 Ga0495588_0066857_813_1106 97
753 3300046674 Ga0495588_0126015 Ga0495588_0126015_710_1003 97
754 3300046674 Ga0495588_0298141 Ga0495588_0298141_260_553 97
755 3300046674 Ga0495588_0439476 Ga0495588_0439476_173_466 97
756 3300046675 Ga0495657_0000210 Ga0495657_0000210_28783_29076 97
757 3300046675 Ga0495657_0254549 Ga0495657_0254549_399_692 97
758 3300046678 Ga0495599_0000436 Ga0495599_0000436_491_784 97
759 3300046679 Ga0495623_0000305 Ga0495623_0000305_22477_22770 97
760 3300046680 Ga0495646_0011487 Ga0495646_0011487_3022_3315 97
761 3300046683 Ga0495658_0001556 Ga0495658_0001556_9224_9517 97
762 3300046683 Ga0495658_0489290 Ga0495658_0489290_128_421 97
763 3300046684 Ga0495669_0003327 Ga0495669_0003327_5335_5643 97
764 3300046684 Ga0495669_0162795 Ga0495669_0162795_81_374 97
765 3300046684 Ga0495669_0366748 Ga0495669_0366748_315_608 97
766 3300046684 Ga0495669_0560199 Ga0495669_0560199_79_387 97
767 3300046689 Ga0495613_0065654 Ga0495613_0065654_720_1013 97
768 3300046689 Ga0495613_0068004 Ga0495613_0068004_1938_2231 97
769 3300046689 Ga0495613_0694257 Ga0495613_0694257_81_374 97
770 3300046694 Ga0495649_0012212 Ga0495649_0012212_3869_4186 97
771 3300046794 Ga0495589_0045800 Ga0495589_0045800_482_799 97
772 3300046809 Ga0495600_0000023 Ga0495600_0000023_57657_57950 97
773 3300047315 Ga0495581_0009338 Ga0495581_0009338_4011_4304 97
774 3300047317 Ga0495604_0000251 Ga0495604_0000251_24372_24665 97
775 3300047317 Ga0495604_0245664 Ga0495604_0245664_187_480 97
776 3300047317 Ga0495604_0567091 Ga0495604_0567091_259_552 97
777 3300047318 Ga0495636_0077133 Ga0495636_0077133_1039_1332 97
778 3300047319 Ga0495674_0040004 Ga0495674_0040004_3333_3626 97
779 3300047319 Ga0495674_0461643 Ga0495674_0461643_677_970 97
780 3300047320 Ga0495672_0003697 Ga0495672_0003697_8636_8929 97
781 3300047320 Ga0495672_0167004 Ga0495672_0167004_805_1110 97
782 3300047322 Ga0495680_0006224 Ga0495680_0006224_5388_5681 97
783 3300047444 Ga0495675_0005468 Ga0495675_0005468_4854_5147 97
784 3300047444 Ga0495675_0416813 Ga0495675_0416813_239_532 97
785 3300047447 Ga0495685_054585 Ga0495685_054585_453_746 97
786 3300047471 Ga0495684_0000037 Ga0495684_0000037_73178_73471 97
787 3300047472 Ga0495686_0009043 Ga0495686_0009043_1333_1650 97
788 3300047673 Ga0495593_0153212 Ga0495593_0153212_55_348 97
789 3300047673 Ga0495593_0172241 Ga0495593_0172241_360_653 97
790 3300047673 Ga0495593_0659117 Ga0495593_0659117_214_507 97
791 3300048088 Ga0495602_0002980 Ga0495602_0002980_12100_12393 97
792 3300048088 Ga0495602_0523073 Ga0495602_0523073_465_758 97
793 3300048088 Ga0495602_0661447 Ga0495602_0661447_83_376 97
794 3300048089 Ga0495614_0003629 Ga0495614_0003629_1631_1924 97
795 3300048090 Ga0495615_0030918 Ga0495615_0030918_717_1010 97
796 3300048903 Ga0496100_0338633 Ga0496100_0338633_458_775 97
797 3300048903 Ga0496100_0706097 Ga0496100_0706097_305_610 97
798 3300048904 Ga0496101_1373097 Ga0496101_1373097_63_356 97
799 3300048907 Ga0496104_0115322 Ga0496104_0115322_232_537 97
800 3300048907 Ga0496104_0405684 Ga0496104_0405684_291_608 97
801 3300048907 Ga0496104_0433022 Ga0496104_0433022_207_500 97
802 3300048907 Ga0496104_0708472 Ga0496104_0708472_593_886 97
803 3300048908 Ga0496105_0008533 Ga0496105_0008533_5138_5443 97
804 3300048908 Ga0496105_0179939 Ga0496105_0179939_822_1139 97
805 3300048909 Ga0496106_0076551 Ga0496106_0076551_1937_2230 97
806 3300048909 Ga0496106_1420676 Ga0496106_1420676_171_488 97
807 3300048910 Ga0496107_0170082 Ga0496107_0170082_930_1235 97
808 3300048911 Ga0496108_0270466 Ga0496108_0270466_603_896 97
809 3300048912 Ga0496109_0186466 Ga0496109_0186466_397_690 97
810 3300048912 Ga0496109_0706940 Ga0496109_0706940_464_784 97
811 3300048913 Ga0496110_0385554 Ga0496110_0385554_910_1203 97
812 3300048914 Ga0496111_0659780 Ga0496111_0659780_133_450 97
813 3300048914 Ga0496111_1077685 Ga0496111_1077685_234_527 97
814 3300048915 Ga0496112_0016641 Ga0496112_0016641_1848_2141 97
815 3300048916 Ga0496113_0301778 Ga0496113_0301778_369_662 97
816 3300048917 Ga0496114_0110142 Ga0496114_0110142_1227_1532 97
817 3300048917 Ga0496114_0451355 Ga0496114_0451355_812_1105 97
818 3300048918 Ga0496115_0218617 Ga0496115_0218617_751_1056 97
819 3300048918 Ga0496115_0385705 Ga0496115_0385705_59_352 97
820 3300048918 Ga0496115_0640522 Ga0496115_0640522_255_548 97
821 3300048918 Ga0496115_0669474 Ga0496115_0669474_402_719 97
822 3300048920 Ga0496117_0000278 Ga0496117_0000278_25087_25392 97
823 3300048927 Ga0496124_0875548 Ga0496124_0875548_15_320 97
824 3300048928 Ga0496125_0113300 Ga0496125_0113300_1553_1858 97
825 3300049127 Ga0501306_053080 Ga0501306_053080_255_563 97
826 3300049128 Ga0501308_005184 Ga0501308_005184_440_769 97
827 3300049129 Ga0501309_000129 Ga0501309_000129_3515_3844 97
828 3300049130 Ga0501310_000219 Ga0501310_000219_4309_4638 97
829 3300049160 Ga0501304_001129 Ga0501304_001129_1180_1509 97
830 3300049161 Ga0501305_000428 Ga0501305_000428_2740_3069 97
831 3300049162 Ga0501307_005139 Ga0501307_005139_879_1208 97
832 3300049515 Ga0501292_053519 Ga0501292_053519_206_511 97
833 3300049517 Ga0501294_024649 Ga0501294_024649_134_463 97
834 3300049522 Ga0501299_050248 Ga0501299_050248_208_501 97
835 3300049522 Ga0501299_215354 Ga0501299_215354_138_431 97
836 3300049523 Ga0501300_000306 Ga0501300_000306_4688_5017 97
837 3300049527 Ga0501311_000655 Ga0501311_000655_726_1055 97
838 3300049527 Ga0501311_038849 Ga0501311_038849_334_642 97
839 3300049528 Ga0501312_001901 Ga0501312_001901_39_368 97
840 3300049529 Ga0501313_005114 Ga0501313_005114_191_520 97
841 3300049530 Ga0501314_000050 Ga0501314_000050_754_1083 97
842 3300049531 Ga0501315_001210 Ga0501315_001210_174_503 97
843 3300049531 Ga0501315_027922 Ga0501315_027922_438_758 97
844 3300049532 Ga0501316_030814 Ga0501316_030814_224_553 97
845 3300049533 Ga0501317_002747 Ga0501317_002747_1214_1543 97
846 3300049534 Ga0501318_012445 Ga0501318_012445_538_867 97
847 3300049537 Ga0501321_027411 Ga0501321_027411_165_494 97
848 3300049541 Ga0501325_017376 Ga0501325_017376_386_694 97
849 3300049570 Ga0501033_0040060 Ga0501033_0040060_2090_2395 97
850 3300049570 Ga0501033_0932162 Ga0501033_0932162_99_404 97
851 3300049571 Ga0501034_0126349 Ga0501034_0126349_2090_2395 97
852 3300049571 Ga0501034_0252901 Ga0501034_0252901_1009_1317 97
853 3300049572 Ga0501036_0058733 Ga0501036_0058733_2585_2890 97
854 3300049572 Ga0501036_0310142 Ga0501036_0310142_604_918 97
855 3300049572 Ga0501036_0956207 Ga0501036_0956207_330_644 97
856 3300049573 Ga0501037_0033043 Ga0501037_0033043_3084_3389 97
857 3300049573 Ga0501037_0474293 Ga0501037_0474293_141_452 97
858 3300049574 Ga0501038_0030062 Ga0501038_0030062_1194_1499 97
859 3300049575 Ga0501039_0129507 Ga0501039_0129507_1263_1568 97
860 3300049575 Ga0501039_0138074 Ga0501039_0138074_182_493 97
861 3300049575 Ga0501039_0558671 Ga0501039_0558671_451_765 97
862 3300049577 Ga0501041_0461416 Ga0501041_0461416_261_572 97
863 3300049578 Ga0501042_0759586 Ga0501042_0759586_12_317 97
864 3300049579 Ga0501043_0007959 Ga0501043_0007959_3277_3582 97
865 3300049579 Ga0501043_0445092 Ga0501043_0445092_294_590 97
866 3300049580 Ga0501046_0195899 Ga0501046_0195899_461_766 97
867 3300049581 Ga0501047_0034967 Ga0501047_0034967_1798_2103 97
868 3300049581 Ga0501047_0694399 Ga0501047_0694399_16_321 97
869 3300049582 Ga0501048_0282626 Ga0501048_0282626_114_425 97
870 3300049582 Ga0501048_1094189 Ga0501048_1094189_258_563 97
871 3300049584 Ga0501068_0126379 Ga0501068_0126379_520_825 97
872 3300049585 Ga0501069_0278331 Ga0501069_0278331_255_560 97
873 3300049586 Ga0501070_0712859 Ga0501070_0712859_457_765 97
874 3300049587 Ga0501071_0119317 Ga0501071_0119317_472_783 97
875 3300049587 Ga0501071_0233595 Ga0501071_0233595_346_657 97
876 3300049587 Ga0501071_1007948 Ga0501071_1007948_216_521 97
877 3300049588 Ga0501072_0275302 Ga0501072_0275302_240_551 97
878 3300049589 Ga0501073_0009894 Ga0501073_0009894_5898_6203 97
879 3300049589 Ga0501073_0238113 Ga0501073_0238113_730_1041 97
880 3300049590 Ga0501074_0016929 Ga0501074_0016929_2172_2477 97
881 3300049590 Ga0501074_0470645 Ga0501074_0470645_174_506 97
882 3300049591 Ga0501075_0712888 Ga0501075_0712888_384_677 97
883 3300049591 Ga0501075_1055326 Ga0501075_1055326_45_338 97
884 3300049592 Ga0501076_0361483 Ga0501076_0361483_68_379 97
885 3300049592 Ga0501076_0620888 Ga0501076_0620888_83_376 97
886 3300049593 Ga0501077_0325612 Ga0501077_0325612_287_604 97
887 3300049593 Ga0501077_1040063 Ga0501077_1040063_72_392 97
888 3300049649 Ga0501198_128946 Ga0501198_128946_198_491 97
889 3300049653 Ga0501206_014163 Ga0501206_014163_388_717 97
890 3300049657 Ga0501210_001725 Ga0501210_001725_827_1156 97
891 3300049658 Ga0501211_004106 Ga0501211_004106_770_1099 97
892 3300049660 Ga0501216_109924 Ga0501216_109924_235_528 97
893 3300049662 Ga0501222_020639 Ga0501222_020639_121_450 97
894 3300049663 Ga0501223_024425 Ga0501223_024425_359_688 97
895 3300049663 Ga0501223_046172 Ga0501223_046172_155_448 97
896 3300049663 Ga0501223_135690 Ga0501223_135690_142_435 97
897 3300049665 Ga0501227_004174 Ga0501227_004174_368_688 97
898 3300049668 Ga0501233_003475 Ga0501233_003475_1698_2027 97
899 3300049669 Ga0501235_003946 Ga0501235_003946_1839_2168 97
900 3300049672 Ga0501239_039619 Ga0501239_039619_181_474 97
901 3300049675 Ga0501243_109855 Ga0501243_109855_107_406 97
902 3300049675 Ga0501243_137035 Ga0501243_137035_157_450 97
903 3300049679 Ga0501249_008085 Ga0501249_008085_1036_1365 97
904 3300049683 Ga0501253_063853 Ga0501253_063853_75_404 97
905 3300049684 Ga0501255_016054 Ga0501255_016054_471_800 97
906 3300049687 Ga0501258_002063 Ga0501258_002063_913_1242 97
907 3300049704 Ga0501221_003510 Ga0501221_003510_135_464 97
908 3300049705 Ga0501225_0003592 Ga0501225_0003592_817_1146 97
909 3300049706 Ga0501229_038397 Ga0501229_038397_47_355 97
910 3300049707 Ga0501234_077211 Ga0501234_077211_164_493 97
911 3300049741 Ga0501079_0264274 Ga0501079_0264274_796_1107 97
912 3300049741 Ga0501079_1522117 Ga0501079_1522117_183_503 97
913 3300049742 Ga0501080_0008652 Ga0501080_0008652_1086_1397 97
914 3300049742 Ga0501080_0057515 Ga0501080_0057515_3085_3390 97
915 3300049743 Ga0501081_0119454 Ga0501081_0119454_1126_1437 97
916 3300049744 Ga0501083_0035946 Ga0501083_0035946_2719_3024 97
917 3300049759 Ga0501262_004570 Ga0501262_004570_1023_1343 97
918 3300049764 Ga0501267_000175 Ga0501267_000175_2982_3311 97
919 3300049768 Ga0501271_006347 Ga0501271_006347_450_779 97
920 3300049769 Ga0501272_032672 Ga0501272_032672_224_553 97
921 3300049772 Ga0501275_076951 Ga0501275_076951_13_327 97
922 3300049779 Ga0501283_048226 Ga0501283_048226_154_483 97
923 3300049822 Ga0501035_0268059 Ga0501035_0268059_969_1274 97
924 3300049822 Ga0501035_0674645 Ga0501035_0674645_244_555 97
925 3300049823 Ga0501044_0015304 Ga0501044_0015304_1371_1676 97
926 3300049823 Ga0501044_0525921 Ga0501044_0525921_598_903 97
927 3300050489 nmdc:mga03683_622358_c1 nmdc:mga03683_622358_c1_188_517 97
928 3300050493 nmdc:mga0k408_25245_c2 nmdc:mga0k408_25245_c2_794_1111 97
929 3300050496 nmdc:mga07m45_7457_c1 nmdc:mga07m45_7457_c1_4884_5201 97
930 3300050508 nmdc:mga09592_852973_c1 nmdc:mga09592_852973_c1_295_588 97
931 3300050509 nmdc:mga0qj67_60894_c1 nmdc:mga0qj67_60894_c1_1243_1551 97
932 3300050509 nmdc:mga0qj67_638307_c1 nmdc:mga0qj67_638307_c1_350_658 97
933 3300050509 nmdc:mga0qj67_643432_c1 nmdc:mga0qj67_643432_c1_393_686 97
934 3300050510 nmdc:mga06r32_441888_c1 nmdc:mga06r32_441888_c1_328_639 97
935 3300050510 nmdc:mga06r32_687524_c1 nmdc:mga06r32_687524_c1_320_628 97
936 3300050511 nmdc:mga08y16_107923_c1 nmdc:mga08y16_107923_c1_1983_2276 97
937 3300050512 nmdc:mga0n895_2003095_c1 nmdc:mga0n895_2003095_c1_188_481 97
938 3300050512 nmdc:mga0n895_766365_c1 nmdc:mga0n895_766365_c1_460_753 97
939 3300050513 nmdc:mga0rr50_1745688_c1 nmdc:mga0rr50_1745688_c1_101_394 97
940 3300050513 nmdc:mga0rr50_385862_c1 nmdc:mga0rr50_385862_c1_12_314 97
941 3300050514 nmdc:mga08x19_192665_c1 nmdc:mga08x19_192665_c1_219_512 97
942 3300050514 nmdc:mga08x19_312301_c1 nmdc:mga08x19_312301_c1_44_364 97
943 3300050515 nmdc:mga0a205_238225_c1 nmdc:mga0a205_238225_c1_888_1190 97
944 3300053077 Ga0495601_0002235 Ga0495601_0002235_7093_7386 97
945 3300053077 Ga0495601_0590726 Ga0495601_0590726_227_520 97
946 3300053078 Ga0495612_0000577 Ga0495612_0000577_10080_10373 97
947 3300053078 Ga0495612_0478171 Ga0495612_0478171_114_407 97
948 3300053083 Ga0495655_0297108 Ga0495655_0297108_21_320 97
949 3300053084 Ga0495595_0011132 Ga0495595_0011132_1419_1712 97
950 3300053085 Ga0495619_0006426 Ga0495619_0006426_6307_6600 97
951 3300053093 Ga0500651_0700854 Ga0500651_0700854_208_513 97
952 3300053122 Ga0500608_199548 Ga0500608_199548_332_649 97
953 3300053139 Ga0500568_0168736 Ga0500568_0168736_121_426 97
954 3300053151 Ga0500604_0064906 Ga0500604_0064906_361_666 97
955 3300053158 Ga0500627_0292841 Ga0500627_0292841_109_414 97
956 3300053160 Ga0500633_0277547 Ga0500633_0277547_214_519 97
957 3300053177 Ga0500636_0105745 Ga0500636_0105745_366_683 97
958 3300053177 Ga0500636_0495408 Ga0500636_0495408_15_338 97
959 3300054114 Ga0501084_0547311 Ga0501084_0547311_316_621 97
960 3300059421 Ga0590071_032829 Ga0590071_032829_174_479 97
961 3300059423 Ga0590074_029865 Ga0590074_029865_163_477 97
962 3300059424 Ga0590075_170084 Ga0590075_170084_152_445 97
963 3300059645 Ga0587076_016241 Ga0587076_016241_97_414 97
964 3300060353 Ga0501082_0653376 Ga0501082_0653376_603_908 97
965 3300060353 Ga0501082_0717548 Ga0501082_0717548_442_753 97
966 iso_pu_bacteria 2643221585 2643935861 97
967 iso_pu_bacteria 2643221639 2644221322 97
968 iso_pu_bacteria 2643221646 2644257920 97
969 iso_pu_bacteria 2643221656 2644317644 97

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00420

Oxidored_q2

NADH-ubiquinone/plastoquinone oxidoreductase chain 4L

16

109

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
6nci-assembly1.cif.gz_B crystal structure of cdp-chase: vector data collection 0.9268 8 41
6nch-assembly1.cif.gz_B crystal structure of cdp-chase: raster data collection 0.9251 8 41
4hfq-assembly1.cif.gz_B crystal structure of udp-x diphosphatase 0.9062 2 46
6inr-assembly1.cif.gz_A the crystal structure of phytoplasmal effector causing phyllody symptoms 1 (phyl1) 0.8833 2 49
4k2p-assembly2.cif.gz_B the structure of a quintuple mutant of the tiam1 ph-cc-ex domain 0.8722 2 44
ID Description Score Start End Superfamily
3q4iA01 Special;Helix non-globular;Single alpha-helices involved in coiled-coils or other helix-helix interfaces; 0.9747 8 39 6.10.250.1120
3q1pA01 Special;Helix non-globular;Single alpha-helices involved in coiled-coils or other helix-helix interfaces; 0.9714 8 39 6.10.250.1120
6nciA01 Special;Helix non-globular;Single alpha-helices involved in coiled-coils or other helix-helix interfaces; 0.9607 8 39 6.10.250.1120
af_Q2FX96_176_237_1.20.5.1930 Mainly Alpha;Up-down Bundle;Single alpha-helices involved in coiled-coils or other helix-helix interfaces; 0.9438 6 46 1.20.5.1930
6nciB01 Special;Helix non-globular;Single alpha-helices involved in coiled-coils or other helix-helix interfaces; 0.938 8 39 6.10.250.1120
ID Description Score Start End GO Terms
AF-A0A3R6Z6P1-F1-model_v4 ER membrane protein complex subunit 6 0.8855 2 49 GO:0016020
AF-A0A7J4NUR5-F1-model_v4 NADH-quinone oxidoreductase subunit NuoK (EC 1.6.5.11) 0.8737 1 59 GO:0016020
GO:0016491
AF-A0A3A9AE88-F1-model_v4 DUF2508 family protein 0.871 1 50
AF-A0A534KFM0-F1-model_v4 NADH-quinone oxidoreductase subunit NuoK (EC 1.6.5.11) 0.8363 1 61 GO:0016651
GO:0030964
GO:0042773
AF-A0A7J4NUR5-F1-model_v4 NADH-quinone oxidoreductase subunit NuoK (EC 1.6.5.11) 0.8078 1 59 GO:0016020
GO:0016491

Feature Viewer

pLDDT pTM Quality
89.66 0.69 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map