F486096

General Info

Members Datasets Scaffolds Average Seq Length
933 330 933 71

Family's Representative Sequence

Representative Sequence 3300025935|Ga0207709_11235435|Ga0207709_112354351
Length 78
Sequence MRITTPSEVARQAGNKYLGVLVAAKFARYLNEFPKDQLAATGEKLTTQALQSLVEGELNYKLVRRRREKFMRMGQFLE

Samples

Sample ID Description Type Environment
1 3300001228 Switchgrass rhizosphere microbial communities from Knoxville, Tennessee, USA - 12_joined Metagenome Rhizosphere
2 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
46 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
47 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
48 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
61 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
62 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
63 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
67 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
68 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
69 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
70 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
71 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
72 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
74 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
75 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
76 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
77 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
78 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
79 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
80 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
81 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
83 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
86 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
87 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
88 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
89 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
90 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
91 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
92 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
93 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
94 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
95 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
96 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
97 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
98 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
99 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
100 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
101 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
102 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
155 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
163 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
164 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
165 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
166 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
167 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
168 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
169 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
170 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
171 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
172 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
173 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
174 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
175 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
176 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
177 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
178 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
179 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
180 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
181 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
182 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
183 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
184 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
185 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
186 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
187 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
188 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
189 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
190 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
191 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
192 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
193 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
194 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
195 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
196 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
197 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
198 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
199 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
200 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
201 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
202 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
203 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
204 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
205 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
206 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
207 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
208 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
209 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
210 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
211 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
212 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
213 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
214 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
215 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
216 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
217 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
218 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
219 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
220 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
221 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
222 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
223 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
224 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
225 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
226 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
227 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
228 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
229 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
230 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
231 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
232 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
233 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
234 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
235 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
236 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
237 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
238 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
239 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
240 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
241 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
242 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
243 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
244 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
245 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
246 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
247 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
248 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
249 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
250 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
251 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
252 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
253 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
254 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
255 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
256 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
257 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
258 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
259 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
260 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
261 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
262 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
263 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
264 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
265 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
266 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
267 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
268 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
269 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
270 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
271 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
272 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
273 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
274 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
275 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
276 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
277 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
278 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
279 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
280 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
281 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
282 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
283 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
284 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
285 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
286 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
287 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
288 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
289 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
290 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
291 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
292 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
293 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
294 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
295 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
296 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
297 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
298 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
299 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
300 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
301 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
302 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
303 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
304 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
305 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
306 3300049773 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control Metagenome Rhizosphere
307 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
308 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
309 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
310 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
311 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
312 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
313 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
314 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
315 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
316 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
317 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
318 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
319 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
320 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
321 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
322 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
323 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
324 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
325 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
326 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
327 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
328 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
329 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
330 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.25
Metatranscriptomes 0.75
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 6.54
Rhizosphere 92.93
Stem 0
Stem Tuber 0
Unclassified 0.54

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwM_137927 3300001228 Bacteria 507
2 Ga0058859_10961723 3300004798 Bacteria 573
3 Ga0065712_10587870 3300005290 Bacteria 597
4 Ga0065715_10123810 3300005293 Bacteria 2169
5 Ga0065715_10153903 3300005293 Bacteria 1698
6 Ga0065707_10131282 3300005295 Bacteria 1915
7 Ga0070683_101919182 3300005329 Bacteria 569
8 Ga0070690_100487319 3300005330 Bacteria 920
9 Ga0068869_100639158 3300005334 Unclassified 902
10 Ga0068869_101217913 3300005334 Bacteria 662
11 Ga0070680_100069928 3300005336 Bacteria 2883
12 Ga0070682_100749809 3300005337 Unclassified 788
13 Ga0068868_102285790 3300005338 Unclassified 516
14 Ga0070689_100535557 3300005340 Bacteria 1007
15 Ga0070661_100662681 3300005344 Unclassified 848
16 Ga0070661_100823006 3300005344 Bacteria 763
17 Ga0070661_101572430 3300005344 Bacteria 556
18 Ga0070692_10538256 3300005345 Bacteria 763
19 Ga0070692_10559033 3300005345 Bacteria 751
20 Ga0070668_101846966 3300005347 Unclassified 556
21 Ga0070669_100269000 3300005353 Bacteria 1362
22 Ga0070669_101440420 3300005353 Bacteria 598
23 Ga0070675_100100941 3300005354 Bacteria 2430
24 Ga0070675_100128221 3300005354 Bacteria 2160
25 Ga0070675_100193792 3300005354 Bacteria 1762
26 Ga0070671_100008791 3300005355 Bacteria 8100
27 Ga0070674_100033210 3300005356 Bacteria 3433
28 Ga0070673_100443555 3300005364 Bacteria 1167
29 Ga0070673_100872322 3300005364 Bacteria 833
30 Ga0070659_100105341 3300005366 Bacteria 2272
31 Ga0070659_100803984 3300005366 Unclassified 818
32 Ga0070659_102044092 3300005366 Bacteria 515
33 Ga0070667_101364081 3300005367 Bacteria 665
34 Ga0070667_101656223 3300005367 Bacteria 602
35 Ga0070709_10304699 3300005434 Unclassified 1164
36 Ga0070709_10395101 3300005434 Bacteria 1031
37 Ga0070709_10416270 3300005434 Unclassified 1006
38 Ga0070714_101767443 3300005435 Bacteria 604
39 Ga0070710_10386282 3300005437 Bacteria 935
40 Ga0070711_101728939 3300005439 Bacteria 548
41 Ga0070705_100018256 3300005440 Bacteria 3675
42 Ga0070705_100117496 3300005440 Bacteria 1711
43 Ga0070705_100164227 3300005440 Bacteria 1488
44 Ga0070705_100187775 3300005440 Bacteria 1406
45 Ga0070705_100314584 3300005440 Bacteria 1128
46 Ga0070705_100696077 3300005440 Unclassified 798
47 Ga0070694_100015093 3300005444 Bacteria 4843
48 Ga0070694_100087534 3300005444 Bacteria 2179
49 Ga0070694_100093845 3300005444 Bacteria 2110
50 Ga0070694_100186044 3300005444 Bacteria 1539
51 Ga0070694_100755738 3300005444 Unclassified 794
52 Ga0070694_101879420 3300005444 Bacteria 511
53 Ga0070708_100049447 3300005445 Bacteria 3720
54 Ga0070708_100065163 3300005445 Bacteria 3266
55 Ga0070708_100530042 3300005445 Bacteria 1111
56 Ga0070708_100561300 3300005445 Bacteria 1076
57 Ga0070708_100579219 3300005445 Bacteria 1058
58 Ga0070708_100652480 3300005445 Bacteria 991
59 Ga0070708_100765511 3300005445 Unclassified 908
60 Ga0070708_100780906 3300005445 Bacteria 898
61 Ga0070708_101116976 3300005445 Bacteria 738
62 Ga0070708_101584813 3300005445 Unclassified 610
63 Ga0070708_102021728 3300005445 Unclassified 533
64 Ga0070663_101162312 3300005455 Unclassified 677
65 Ga0070663_101420644 3300005455 Bacteria 615
66 Ga0070663_101904310 3300005455 Unclassified 534
67 Ga0070663_102109267 3300005455 Bacteria 508
68 Ga0070678_100473367 3300005456 Bacteria 1101
69 Ga0070678_100709556 3300005456 Unclassified 907
70 Ga0070662_100054765 3300005457 Bacteria 2891
71 Ga0070662_100182576 3300005457 Bacteria 1655
72 Ga0070662_100877038 3300005457 Bacteria 765
73 Ga0070681_10022957 3300005458 Bacteria 6269
74 Ga0070681_10027906 3300005458 Bacteria 5674
75 Ga0070681_10529563 3300005458 Bacteria 1092
76 Ga0070681_10599775 3300005458 Bacteria 1016
77 Ga0070681_10971166 3300005458 Bacteria 769
78 Ga0068867_100019527 3300005459 Bacteria 4829
79 Ga0068867_100483907 3300005459 Bacteria 1061
80 Ga0068867_100556872 3300005459 Bacteria 994
81 Ga0068867_101832383 3300005459 Bacteria 571
82 Ga0070685_10696834 3300005466 Bacteria 740
83 Ga0070706_100009183 3300005467 Bacteria 9206
84 Ga0070706_100093815 3300005467 Bacteria 2785
85 Ga0070706_100783954 3300005467 Bacteria 883
86 Ga0070706_101710122 3300005467 Bacteria 573
87 Ga0070707_100002150 3300005468 Bacteria 18872
88 Ga0070707_100029350 3300005468 Bacteria 5237
89 Ga0070707_100096466 3300005468 Bacteria 2864
90 Ga0070707_100187680 3300005468 Bacteria 2015
91 Ga0070707_100327777 3300005468 Bacteria 1488
92 Ga0070707_100357994 3300005468 Bacteria 1417
93 Ga0070707_100450350 3300005468 Bacteria 1248
94 Ga0070707_100507663 3300005468 Bacteria 1167
95 Ga0070698_100003276 3300005471 Bacteria 17787
96 Ga0070698_100007458 3300005471 Bacteria 11830
97 Ga0070698_100015455 3300005471 Bacteria 8065
98 Ga0070698_100270152 3300005471 Bacteria 1632
99 Ga0070698_100353707 3300005471 Bacteria 1401
100 Ga0070698_100488468 3300005471 Unclassified 1169
101 Ga0070698_101719136 3300005471 Bacteria 580
102 Ga0070699_100002133 3300005518 Bacteria 17937
103 Ga0070699_100005989 3300005518 Bacteria 10628
104 Ga0070699_100007511 3300005518 Bacteria 9480
105 Ga0070699_100017837 3300005518 Bacteria 6095
106 Ga0070699_100028112 3300005518 Bacteria 4850
107 Ga0070699_100077326 3300005518 Bacteria 2897
108 Ga0070699_100160149 3300005518 Bacteria 1992
109 Ga0070699_100181645 3300005518 Bacteria 1867
110 Ga0070699_100234006 3300005518 Bacteria 1638
111 Ga0070699_102076596 3300005518 Bacteria 519
112 Ga0070699_102172857 3300005518 Unclassified 506
113 Ga0070679_100021440 3300005530 Bacteria 6308
114 Ga0070679_100027542 3300005530 Bacteria 5594
115 Ga0070679_101901992 3300005530 Unclassified 544
116 Ga0070684_100317929 3300005535 Bacteria 1430
117 Ga0070684_101094225 3300005535 Bacteria 749
118 Ga0070697_100006203 3300005536 Bacteria 9253
119 Ga0070697_100163462 3300005536 Unclassified 1881
120 Ga0070697_100250111 3300005536 Bacteria 1515
121 Ga0070697_100336674 3300005536 Bacteria 1302
122 Ga0070697_100471476 3300005536 Unclassified 1095
123 Ga0070697_100562967 3300005536 Unclassified 1000
124 Ga0070697_100568784 3300005536 Unclassified 995
125 Ga0070697_100620052 3300005536 Bacteria 951
126 Ga0070697_100691209 3300005536 Unclassified 900
127 Ga0070697_101647534 3300005536 Unclassified 574
128 Ga0068853_101307303 3300005539 Unclassified 701
129 Ga0070672_100092075 3300005543 Bacteria 2447
130 Ga0070672_101474129 3300005543 Bacteria 609
131 Ga0070686_100335764 3300005544 Bacteria 1131
132 Ga0070695_100014271 3300005545 Bacteria 4789
133 Ga0070695_100124557 3300005545 Bacteria 1768
134 Ga0070695_100348395 3300005545 Bacteria 1109
135 Ga0070695_100494358 3300005545 Bacteria 945
136 Ga0070696_100000865 3300005546 Bacteria 19565
137 Ga0070696_100005546 3300005546 Bacteria 8425
138 Ga0070696_100052367 3300005546 Bacteria 2840
139 Ga0070696_100081411 3300005546 Bacteria 2294
140 Ga0070696_100100927 3300005546 Bacteria 2068
141 Ga0070696_100128402 3300005546 Bacteria 1842
142 Ga0070696_100322469 3300005546 Bacteria 1189
143 Ga0070696_100354374 3300005546 Bacteria 1137
144 Ga0070696_100812935 3300005546 Bacteria 770
145 Ga0070696_100846174 3300005546 Bacteria 756
146 Ga0070696_100949815 3300005546 Unclassified 716
147 Ga0070696_101131312 3300005546 Bacteria 659
148 Ga0070696_101314476 3300005546 Bacteria 614
149 Ga0070693_100031072 3300005547 Bacteria 2925
150 Ga0070693_100074516 3300005547 Bacteria 2008
151 Ga0070693_100173961 3300005547 Unclassified 1381
152 Ga0070665_100407848 3300005548 Bacteria 1367
153 Ga0070665_100845184 3300005548 Bacteria 928
154 Ga0070704_100001871 3300005549 Bacteria 11601
155 Ga0070704_100067181 3300005549 Bacteria 2588
156 Ga0070704_100148146 3300005549 Bacteria 1842
157 Ga0070704_100678410 3300005549 Bacteria 912
158 Ga0070704_101261794 3300005549 Bacteria 675
159 Ga0070704_101418980 3300005549 Bacteria 637
160 Ga0068855_100826175 3300005563 Bacteria 983
161 Ga0070664_100096840 3300005564 Bacteria 2561
162 Ga0070664_100925678 3300005564 Bacteria 818
163 Ga0068857_101145760 3300005577 Bacteria 752
164 Ga0068854_100638193 3300005578 Bacteria 913
165 Ga0068854_101194771 3300005578 Unclassified 681
166 Ga0068856_101300785 3300005614 Bacteria 742
167 Ga0070702_100180507 3300005615 Bacteria 1381
168 Ga0068852_100600131 3300005616 Bacteria 1105
169 Ga0068852_101633140 3300005616 Bacteria 667
170 Ga0068859_100053225 3300005617 Unclassified 4071
171 Ga0068859_100109269 3300005617 Bacteria 2826
172 Ga0068859_100188772 3300005617 Bacteria 2145
173 Ga0068859_100663057 3300005617 Unclassified 1135
174 Ga0068859_102668663 3300005617 Bacteria 549
175 Ga0068864_100044368 3300005618 Unclassified 3810
176 Ga0068864_100553708 3300005618 Bacteria 1112
177 Ga0068864_100610233 3300005618 Unclassified 1059
178 Ga0068864_100620167 3300005618 Bacteria 1051
179 Ga0068864_100647103 3300005618 Bacteria 1029
180 Ga0068864_100882891 3300005618 Unclassified 882
181 Ga0068866_10032052 3300005718 Unclassified 2538
182 Ga0068861_101494877 3300005719 Bacteria 662
183 Ga0068861_102439840 3300005719 Bacteria 526
184 Ga0068851_10455630 3300005834 Bacteria 761
185 Ga0068870_10561569 3300005840 Bacteria 770
186 Ga0068870_10582049 3300005840 Bacteria 758
187 Ga0068870_10693508 3300005840 Bacteria 702
188 Ga0068863_100011280 3300005841 Bacteria 8657
189 Ga0068863_100960439 3300005841 Bacteria 856
190 Ga0068863_101199778 3300005841 Bacteria 765
191 Ga0068863_102450612 3300005841 Bacteria 531
192 Ga0068858_100657775 3300005842 Bacteria 1018
193 Ga0068858_101382130 3300005842 Unclassified 693
194 Ga0068862_100220504 3300005844 Bacteria 1717
195 Ga0068862_100518549 3300005844 Unclassified 1134
196 Ga0068862_100903982 3300005844 Bacteria 868
197 Ga0068862_101007983 3300005844 Bacteria 824
198 Ga0068862_101077074 3300005844 Bacteria 798
199 Ga0068862_101425032 3300005844 Bacteria 697
200 Ga0081455_10080975 3300005937 Unclassified 2660
201 Ga0081538_10046524 3300005981 Bacteria 2674
202 Ga0070715_10098934 3300006163 Bacteria 1357
203 Ga0070715_10479031 3300006163 Bacteria 708
204 Ga0070716_100249063 3300006173 Bacteria 1209
205 Ga0070716_101420647 3300006173 Bacteria 565
206 Ga0070716_101543766 3300006173 Bacteria 544
207 Ga0070712_100047991 3300006175 Bacteria 2958
208 Ga0097621_100953546 3300006237 Bacteria 801
209 Ga0068871_102264105 3300006358 Unclassified 518
210 Ga0075428_100006932 3300006844 Bacteria 12584
211 Ga0075428_100058586 3300006844 Unclassified 4217
212 Ga0075428_100381825 3300006844 Bacteria 1510
213 Ga0075428_101389275 3300006844 Bacteria 737
214 Ga0075428_101755781 3300006844 Bacteria 647
215 Ga0075428_101777500 3300006844 Bacteria 642
216 Ga0075430_100092716 3300006846 Bacteria 2525
217 Ga0075430_100354452 3300006846 Unclassified 1211
218 Ga0075430_100637014 3300006846 Bacteria 879
219 Ga0075430_100690207 3300006846 Bacteria 841
220 Ga0075430_101147872 3300006846 Bacteria 640
221 Ga0075431_100026669 3300006847 Bacteria 5927
222 Ga0075431_100047894 3300006847 Bacteria 4408
223 Ga0075431_100081818 3300006847 Bacteria 3334
224 Ga0075431_100230767 3300006847 Bacteria 1886
225 Ga0075431_100278802 3300006847 Bacteria 1693
226 Ga0075431_100292081 3300006847 Bacteria 1649
227 Ga0075431_100604564 3300006847 Unclassified 1080
228 Ga0075431_100647237 3300006847 Unclassified 1038
229 Ga0075431_102101238 3300006847 Bacteria 520
230 Ga0075433_10006922 3300006852 Bacteria 8983
231 Ga0075433_10076342 3300006852 Unclassified 2950
232 Ga0075433_10170726 3300006852 Bacteria 1935
233 Ga0075433_10241728 3300006852 Bacteria 1603
234 Ga0075433_11068583 3300006852 Bacteria 702
235 Ga0075433_11170367 3300006852 Bacteria 668
236 Ga0075433_11503054 3300006852 Bacteria 582
237 Ga0075434_100005726 3300006871 Bacteria 11341
238 Ga0075434_100114353 3300006871 Unclassified 2711
239 Ga0075434_100383905 3300006871 Bacteria 1425
240 Ga0075434_100504379 3300006871 Bacteria 1231
241 Ga0075434_100736903 3300006871 Bacteria 1003
242 Ga0075434_101321233 3300006871 Bacteria 732
243 Ga0075429_100000623 3300006880 Bacteria 27314
244 Ga0075429_100318249 3300006880 Unclassified 1362
245 Ga0075429_100593075 3300006880 Bacteria 971
246 Ga0075429_100798229 3300006880 Bacteria 827
247 Ga0075429_100948945 3300006880 Bacteria 752
248 Ga0075429_101969872 3300006880 Bacteria 506
249 Ga0075436_100043895 3300006914 Bacteria 3082
250 Ga0075436_100176983 3300006914 Bacteria 1507
251 Ga0075436_100184775 3300006914 Bacteria 1474
252 Ga0075436_100231115 3300006914 Bacteria 1314
253 Ga0097620_100053224 3300006931 Unclassified 4071
254 Ga0097620_100109269 3300006931 Bacteria 2826
255 Ga0097620_100188778 3300006931 Bacteria 2145
256 Ga0097620_100663014 3300006931 Unclassified 1135
257 Ga0097620_102669440 3300006931 Bacteria 549
258 Ga0075435_100024954 3300007076 Bacteria 4648
259 Ga0075435_100406113 3300007076 Bacteria 1172
260 Ga0075435_100533266 3300007076 Bacteria 1016
261 Ga0075435_100634926 3300007076 Bacteria 927
262 Ga0075435_100643050 3300007076 Bacteria 920
263 Ga0075435_100693939 3300007076 Unclassified 885
264 Ga0075435_100959981 3300007076 Bacteria 746
265 Ga0075435_101474367 3300007076 Bacteria 596
266 Ga0075435_101734584 3300007076 Unclassified 548
267 Ga0111539_10581234 3300009094 Unclassified 1305
268 Ga0111539_10618327 3300009094 Bacteria 1262
269 Ga0111539_10855312 3300009094 Bacteria 1058
270 Ga0111539_11183076 3300009094 Bacteria 888
271 Ga0114129_10000112 3300009147 Bacteria 80956
272 Ga0114129_10086755 3300009147 Bacteria 4340
273 Ga0114129_10129099 3300009147 Bacteria 3474
274 Ga0114129_10293880 3300009147 Unclassified 2167
275 Ga0114129_10433001 3300009147 Bacteria 1728
276 Ga0114129_10515241 3300009147 Bacteria 1560
277 Ga0114129_11512801 3300009147 Bacteria 824
278 Ga0105243_10724450 3300009148 Unclassified 972
279 Ga0105243_11613171 3300009148 Unclassified 676
280 Ga0105243_12617250 3300009148 Bacteria 544
281 Ga0105243_13077009 3300009148 Unclassified 505
282 Ga0105241_10654456 3300009174 Bacteria 954
283 Ga0105248_10913795 3300009177 Bacteria 991
284 Ga0105248_11174520 3300009177 Bacteria 868
285 Ga0105248_12657162 3300009177 Bacteria 571
286 Ga0105237_10418652 3300009545 Bacteria 1345
287 Ga0105238_11999119 3300009551 Bacteria 613
288 Ga0105249_10202415 3300009553 Bacteria 1944
289 Ga0105249_10882978 3300009553 Bacteria 961
290 Ga0105249_10972564 3300009553 Bacteria 917
291 Ga0105249_12950528 3300009553 Bacteria 546
292 Ga0105239_10005218 3300010375 Bacteria 15292
293 Ga0105239_10992321 3300010375 Bacteria 965
294 Ga0105246_10364215 3300011119 Bacteria 1189
295 Ga0163162_12561906 3300013306 Unclassified 587
296 Ga0157375_11037934 3300013308 Bacteria 958
297 Ga0163163_10005758 3300014325 Bacteria 10761
298 Ga0163163_10246663 3300014325 Bacteria 1836
299 Ga0163163_10893560 3300014325 Bacteria 952
300 Ga0163163_10933766 3300014325 Bacteria 931
301 Ga0163163_11085161 3300014325 Bacteria 863
302 Ga0157380_12109684 3300014326 Bacteria 627
303 Ga0157380_12526838 3300014326 Bacteria 579
304 Ga0157380_12797457 3300014326 Unclassified 554
305 Ga0157380_13411834 3300014326 Unclassified 508
306 Ga0182008_10378723 3300014497 Bacteria 756
307 Ga0182008_10600299 3300014497 Bacteria 618
308 Ga0157379_10118199 3300014968 Bacteria 2384
309 Ga0157379_11546043 3300014968 Unclassified 646
310 Ga0157376_11212478 3300014969 Unclassified 783
311 Ga0157376_11425479 3300014969 Unclassified 725
312 Ga0163161_11150635 3300017792 Bacteria 669
313 Ga0213876_10524693 3300021384 Bacteria 630
314 Ga0207656_10228544 3300025321 Bacteria 906
315 Ga0207682_10038523 3300025893 Bacteria 1940
316 Ga0207692_10343998 3300025898 Bacteria 918
317 Ga0207642_10866470 3300025899 Bacteria 577
318 Ga0207688_10440822 3300025901 Bacteria 811
319 Ga0207688_10495040 3300025901 Unclassified 765
320 Ga0207685_10363688 3300025905 Bacteria 733
321 Ga0207685_10388143 3300025905 Bacteria 713
322 Ga0207699_10306992 3300025906 Bacteria 1109
323 Ga0207699_10344016 3300025906 Bacteria 1051
324 Ga0207699_10613428 3300025906 Bacteria 793
325 Ga0207643_10456991 3300025908 Bacteria 813
326 Ga0207684_10034088 3300025910 Bacteria 4327
327 Ga0207684_10123849 3300025910 Bacteria 2217
328 Ga0207684_10970023 3300025910 Unclassified 712
329 Ga0207654_11414554 3300025911 Bacteria 507
330 Ga0207707_10000702 3300025912 Bacteria 33259
331 Ga0207707_10051069 3300025912 Bacteria 3600
332 Ga0207707_10648027 3300025912 Unclassified 890
333 Ga0207671_10435374 3300025914 Bacteria 1044
334 Ga0207660_10005346 3300025917 Bacteria 8343
335 Ga0207660_10066197 3300025917 Bacteria 2613
336 Ga0207660_10156626 3300025917 Bacteria 1754
337 Ga0207649_10725055 3300025920 Bacteria 772
338 Ga0207652_10002232 3300025921 Bacteria 16521
339 Ga0207652_10127325 3300025921 Bacteria 2269
340 Ga0207652_10174235 3300025921 Unclassified 1931
341 Ga0207652_11792338 3300025921 Bacteria 519
342 Ga0207646_10022200 3300025922 Bacteria 5851
343 Ga0207646_10039361 3300025922 Bacteria 4256
344 Ga0207646_10080269 3300025922 Bacteria 2917
345 Ga0207646_10711592 3300025922 Unclassified 898
346 Ga0207646_11157793 3300025922 Unclassified 679
347 Ga0207646_11878428 3300025922 Unclassified 511
348 Ga0207681_10319809 3300025923 Bacteria 1234
349 Ga0207681_10710834 3300025923 Unclassified 836
350 Ga0207650_10510716 3300025925 Bacteria 1005
351 Ga0207650_11843326 3300025925 Bacteria 511
352 Ga0207659_10140505 3300025926 Bacteria 1874
353 Ga0207659_10438377 3300025926 Bacteria 1098
354 Ga0207659_10664298 3300025926 Unclassified 891
355 Ga0207659_10821271 3300025926 Bacteria 799
356 Ga0207664_11692677 3300025929 Bacteria 555
357 Ga0207644_10004008 3300025931 Bacteria 9559
358 Ga0207690_10432744 3300025932 Unclassified 1054
359 Ga0207706_10088271 3300025933 Unclassified 2726
360 Ga0207706_10089638 3300025933 Bacteria 2704
361 Ga0207706_10806839 3300025933 Bacteria 797
362 Ga0207706_10880555 3300025933 Unclassified 757
363 Ga0207706_11039227 3300025933 Unclassified 687
364 Ga0207709_11235435 3300025935 Bacteria 616
365 Ga0207709_11582118 3300025935 Unclassified 544
366 Ga0207670_10126412 3300025936 Bacteria 1866
367 Ga0207669_10896170 3300025937 Bacteria 741
368 Ga0207704_10367148 3300025938 Bacteria 1126
369 Ga0207665_10621177 3300025939 Bacteria 845
370 Ga0207665_10904169 3300025939 Unclassified 700
371 Ga0207691_10016924 3300025940 Bacteria 6917
372 Ga0207691_10200185 3300025940 Bacteria 1739
373 Ga0207691_10853619 3300025940 Bacteria 763
374 Ga0207691_11410739 3300025940 Bacteria 572
375 Ga0207711_10154690 3300025941 Bacteria 2072
376 Ga0207711_10708476 3300025941 Bacteria 939
377 Ga0207711_10957509 3300025941 Unclassified 795
378 Ga0207711_11765615 3300025941 Bacteria 562
379 Ga0207689_10544173 3300025942 Bacteria 975
380 Ga0207661_10101253 3300025944 Bacteria 2420
381 Ga0207661_11130502 3300025944 Bacteria 721
382 Ga0207679_10132968 3300025945 Bacteria 1999
383 Ga0207679_10184201 3300025945 Bacteria 1730
384 Ga0207679_10274785 3300025945 Bacteria 1442
385 Ga0207679_10835659 3300025945 Unclassified 841
386 Ga0207679_11249540 3300025945 Bacteria 682
387 Ga0207651_10165925 3300025960 Bacteria 1736
388 Ga0207651_10512051 3300025960 Bacteria 1039
389 Ga0207712_10546134 3300025961 Bacteria 996
390 Ga0207712_10810564 3300025961 Bacteria 823
391 Ga0207712_12122183 3300025961 Bacteria 503
392 Ga0207668_10015126 3300025972 Bacteria 4789
393 Ga0207668_11301932 3300025972 Bacteria 654
394 Ga0207668_12023245 3300025972 Bacteria 519
395 Ga0207640_10728719 3300025981 Bacteria 853
396 Ga0207658_10242463 3300025986 Bacteria 1528
397 Ga0207658_11929462 3300025986 Bacteria 538
398 Ga0207677_10886241 3300026023 Bacteria 804
399 Ga0207677_11360798 3300026023 Unclassified 653
400 Ga0207703_10247313 3300026035 Bacteria 1606
401 Ga0207703_11096166 3300026035 Bacteria 765
402 Ga0207639_11820483 3300026041 Bacteria 569
403 Ga0207678_10248116 3300026067 Bacteria 1524
404 Ga0207678_10478596 3300026067 Bacteria 1084
405 Ga0207708_10079069 3300026075 Bacteria 2526
406 Ga0207708_10838539 3300026075 Bacteria 793
407 Ga0207702_11583342 3300026078 Bacteria 648
408 Ga0207641_10038713 3300026088 Bacteria 3987
409 Ga0207641_10067260 3300026088 Unclassified 3069
410 Ga0207641_10898826 3300026088 Bacteria 879
411 Ga0207641_12294307 3300026088 Bacteria 539
412 Ga0207648_10093302 3300026089 Bacteria 2632
413 Ga0207648_10114838 3300026089 Bacteria 2366
414 Ga0207648_10645401 3300026089 Bacteria 978
415 Ga0207676_10174486 3300026095 Bacteria 1876
416 Ga0207676_10607718 3300026095 Bacteria 1051
417 Ga0207676_10718672 3300026095 Bacteria 969
418 Ga0207676_10820683 3300026095 Bacteria 908
419 Ga0207674_10807843 3300026116 Unclassified 905
420 Ga0207674_11555966 3300026116 Bacteria 630
421 Ga0207675_100500015 3300026118 Bacteria 1210
422 Ga0207675_100993439 3300026118 Bacteria 857
423 Ga0207675_100999672 3300026118 Bacteria 855
424 Ga0207675_101687567 3300026118 Bacteria 653
425 Ga0207675_102592228 3300026118 Unclassified 517
426 Ga0207683_10768000 3300026121 Unclassified 894
427 Ga0207698_11049818 3300026142 Bacteria 826
428 Ga0209967_1063523 3300027364 Bacteria 574
429 Ga0209984_1050418 3300027424 Bacteria 608
430 Ga0209982_1091304 3300027552 Unclassified 505
431 Ga0209971_1024024 3300027682 Unclassified 1455
432 Ga0209971_1026490 3300027682 Bacteria 1386
433 Ga0209971_1125827 3300027682 Bacteria 631
434 Ga0209998_10128984 3300027717 Bacteria 641
435 Ga0209974_10010987 3300027876 Bacteria 3047
436 Ga0209974_10059094 3300027876 Bacteria 1296
437 Ga0268266_10370808 3300028379 Bacteria 1348
438 Ga0268265_11032208 3300028380 Bacteria 813
439 Ga0268265_11073493 3300028380 Bacteria 798
440 Ga0268265_11440718 3300028380 Bacteria 691
441 Ga0268265_11506653 3300028380 Unclassified 676
442 Ga0268265_11969814 3300028380 Bacteria 591
443 Ga0268264_11007904 3300028381 Unclassified 839
444 Ga0316182_1432439 3300030745 Bacteria 697
445 Ga0307408_100057953 3300031548 Unclassified 2814
446 Ga0307408_100096438 3300031548 Bacteria 2244
447 Ga0307408_100099897 3300031548 Bacteria 2209
448 Ga0307408_100106929 3300031548 Bacteria 2141
449 Ga0307408_100193845 3300031548 Bacteria 1639
450 Ga0307408_100566018 3300031548 Unclassified 1005
451 Ga0307408_100829891 3300031548 Unclassified 841
452 Ga0307408_101270147 3300031548 Unclassified 689
453 Ga0307408_101942394 3300031548 Bacteria 565
454 Ga0307408_102305101 3300031548 Bacteria 521
455 Ga0307408_102522729 3300031548 Bacteria 500
456 Ga0316575_10014657 3300031665 Bacteria 2947
457 Ga0316579_10051440 3300031691 Bacteria 1928
458 Ga0316576_10493640 3300031727 Unclassified 901
459 Ga0316578_10079698 3300031728 Bacteria 1947
460 Ga0307405_10040038 3300031731 Bacteria 2836
461 Ga0307405_10047774 3300031731 Bacteria 2637
462 Ga0307405_10070175 3300031731 Unclassified 2249
463 Ga0307405_10179436 3300031731 Bacteria 1519
464 Ga0307405_10262034 3300031731 Bacteria 1292
465 Ga0307405_10429726 3300031731 Bacteria 1042
466 Ga0307405_10512706 3300031731 Bacteria 963
467 Ga0307405_10623831 3300031731 Bacteria 883
468 Ga0307405_10641319 3300031731 Bacteria 872
469 Ga0316577_10203522 3300031733 Unclassified 1119
470 Ga0307413_10006876 3300031824 Bacteria 5236
471 Ga0307413_10074525 3300031824 Bacteria 2150
472 Ga0307413_10095448 3300031824 Bacteria 1950
473 Ga0307413_10112038 3300031824 Bacteria 1828
474 Ga0307413_10307934 3300031824 Bacteria 1204
475 Ga0307413_10332343 3300031824 Bacteria 1165
476 Ga0307413_10415232 3300031824 Unclassified 1058
477 Ga0307413_10453449 3300031824 Bacteria 1018
478 Ga0307413_10470292 3300031824 Unclassified 1002
479 Ga0307413_10648022 3300031824 Bacteria 871
480 Ga0307413_10863720 3300031824 Bacteria 765
481 Ga0307413_11010445 3300031824 Unclassified 713
482 Ga0307410_10010547 3300031852 Bacteria 5242
483 Ga0307410_10016453 3300031852 Bacteria 4412
484 Ga0307410_10022765 3300031852 Bacteria 3880
485 Ga0307410_10023562 3300031852 Bacteria 3830
486 Ga0307410_10068361 3300031852 Bacteria 2453
487 Ga0307410_10136908 3300031852 Bacteria 1806
488 Ga0307410_10145738 3300031852 Bacteria 1757
489 Ga0307410_10254991 3300031852 Bacteria 1365
490 Ga0307410_10299960 3300031852 Bacteria 1267
491 Ga0307410_10848808 3300031852 Unclassified 779
492 Ga0307410_10896760 3300031852 Bacteria 759
493 Ga0307410_11060957 3300031852 Unclassified 701
494 Ga0307410_11731902 3300031852 Unclassified 554
495 Ga0307406_10045499 3300031901 Bacteria 2756
496 Ga0307406_10055877 3300031901 Unclassified 2525
497 Ga0307406_10124194 3300031901 Bacteria 1800
498 Ga0307406_10226099 3300031901 Unclassified 1394
499 Ga0307406_10333620 3300031901 Bacteria 1178
500 Ga0307406_10410875 3300031901 Bacteria 1075
501 Ga0307406_11051703 3300031901 Bacteria 701
502 Ga0307407_10048642 3300031903 Unclassified 2415
503 Ga0307407_10063601 3300031903 Bacteria 2165
504 Ga0307407_10072430 3300031903 Bacteria 2055
505 Ga0307407_10213278 3300031903 Bacteria 1301
506 Ga0307407_10361703 3300031903 Unclassified 1031
507 Ga0307407_10586069 3300031903 Unclassified 829
508 Ga0307407_10674182 3300031903 Unclassified 776
509 Ga0307407_10899617 3300031903 Bacteria 679
510 Ga0307412_10083391 3300031911 Unclassified 2216
511 Ga0307412_10172009 3300031911 Bacteria 1620
512 Ga0307412_10262944 3300031911 Unclassified 1346
513 Ga0307412_10761373 3300031911 Bacteria 837
514 Ga0307412_11724825 3300031911 Bacteria 574
515 Ga0307409_100002373 3300031995 Bacteria 9799
516 Ga0307409_100034623 3300031995 Bacteria 3691
517 Ga0307409_100066713 3300031995 Bacteria 2838
518 Ga0307409_100090409 3300031995 Bacteria 2506
519 Ga0307409_100117330 3300031995 Unclassified 2246
520 Ga0307409_100241673 3300031995 Bacteria 1644
521 Ga0307409_100284397 3300031995 Bacteria 1530
522 Ga0307409_100411102 3300031995 Bacteria 1295
523 Ga0307409_100443292 3300031995 Bacteria 1251
524 Ga0307409_100593627 3300031995 Bacteria 1093
525 Ga0307409_101081854 3300031995 Bacteria 822
526 Ga0307409_101566830 3300031995 Unclassified 687
527 Ga0307409_102810928 3300031995 Bacteria 514
528 Ga0307416_100002032 3300032002 Bacteria 11382
529 Ga0307416_100002732 3300032002 Bacteria 10231
530 Ga0307416_100019764 3300032002 Bacteria 4785
531 Ga0307416_100025295 3300032002 Bacteria 4350
532 Ga0307416_100039174 3300032002 Bacteria 3666
533 Ga0307416_100091107 3300032002 Bacteria 2617
534 Ga0307416_100135441 3300032002 Bacteria 2227
535 Ga0307416_100191698 3300032002 Bacteria 1928
536 Ga0307416_100371035 3300032002 Bacteria 1457
537 Ga0307416_100788157 3300032002 Unclassified 1045
538 Ga0307416_101324007 3300032002 Bacteria 826
539 Ga0307416_101968567 3300032002 Bacteria 687
540 Ga0307416_102930118 3300032002 Bacteria 571
541 Ga0307416_103171870 3300032002 Bacteria 550
542 Ga0307414_10044787 3300032004 Bacteria 3026
543 Ga0307414_10062367 3300032004 Bacteria 2645
544 Ga0307414_10078008 3300032004 Bacteria 2413
545 Ga0307414_10087954 3300032004 Bacteria 2298
546 Ga0307414_10404669 3300032004 Bacteria 1186
547 Ga0307414_10456845 3300032004 Bacteria 1121
548 Ga0307414_10746024 3300032004 Unclassified 889
549 Ga0307414_10960695 3300032004 Bacteria 785
550 Ga0307414_11024811 3300032004 Bacteria 760
551 Ga0307414_11103998 3300032004 Bacteria 732
552 Ga0307411_10020346 3300032005 Bacteria 3857
553 Ga0307411_10035753 3300032005 Bacteria 3106
554 Ga0307411_10052115 3300032005 Bacteria 2674
555 Ga0307411_10081262 3300032005 Unclassified 2231
556 Ga0307411_10135993 3300032005 Bacteria 1804
557 Ga0307411_10136943 3300032005 Bacteria 1799
558 Ga0307411_10340521 3300032005 Bacteria 1218
559 Ga0307411_10688272 3300032005 Unclassified 889
560 Ga0307411_10782029 3300032005 Bacteria 839
561 Ga0307411_10937564 3300032005 Bacteria 771
562 Ga0307411_10950460 3300032005 Bacteria 766
563 Ga0307411_12261193 3300032005 Unclassified 510
564 Ga0307411_12348394 3300032005 Unclassified 501
565 Ga0307415_100000864 3300032126 Bacteria 13852
566 Ga0307415_100003278 3300032126 Bacteria 8231
567 Ga0307415_100180552 3300032126 Bacteria 1655
568 Ga0307415_100445762 3300032126 Bacteria 1118
569 Ga0307415_100756155 3300032126 Bacteria 883
570 Ga0307415_101750012 3300032126 Bacteria 600
571 Ga0307415_101827204 3300032126 Bacteria 588
572 Ga0307415_102092772 3300032126 Bacteria 552
573 Ga0307415_102446087 3300032126 Bacteria 514
574 Ga0316583_10069831 3300032133 Bacteria 1229
575 Ga0316593_10152671 3300032168 Unclassified 840
576 Ga0373930_0032000 3300034816 Unclassified 1087
577 Ga0373948_0095723 3300034817 Bacteria 694
578 Ga0373958_0144029 3300034819 Bacteria 592
579 Ga0373959_0039782 3300034820 Bacteria 982
580 Ga0373928_0022692 3300035084 Bacteria 1333
581 Ga0373928_0155103 3300035084 Bacteria 636
582 Ga0373929_0097157 3300035085 Bacteria 738
583 Ga0373940_0005472 3300035088 Bacteria 2755
584 Ga0373940_0012634 3300035088 Bacteria 2026
585 Ga0373952_0133576 3300035092 Bacteria 684
586 Ga0373932_0096515 3300035112 Bacteria 956
587 Ga0373939_0332713 3300035114 Bacteria 614
588 Ga0373941_0123344 3300035115 Unclassified 926
589 Ga0373941_0244230 3300035115 Bacteria 699
590 Ga0373960_0054338 3300035121 Unclassified 1198
591 Ga0373960_0265154 3300035121 Bacteria 628
592 Ga0373942_0108817 3300035207 Unclassified 855
593 Ga0373961_0091246 3300035241 Bacteria 973
594 Ga0373961_0094213 3300035241 Unclassified 961
595 Ga0373961_0220699 3300035241 Unclassified 676
596 Ga0316574_0291171 3300035398 Unclassified 1039
597 Ga0373931_0028636 3300035691 Bacteria 2854
598 Ga0373931_0140839 3300035691 Bacteria 1397
599 Ga0373931_0161079 3300035691 Bacteria 1315
600 Ga0373931_0470759 3300035691 Bacteria 806
601 Ga0373931_0687711 3300035691 Unclassified 675
602 Ga0373933_0029773 3300035724 Bacteria 3159
603 Ga0373937_1538255 3300036401 Unclassified 613
604 Ga0316582_0139654 3300036647 Unclassified 1633
605 Ga0316584_0250425 3300036712 Unclassified 1294
606 Ga0373925_0890067 3300037068 Bacteria 734
607 Ga0395905_0440496 3300037471 Bacteria 1200
608 Ga0395905_0676592 3300037471 Bacteria 934
609 Ga0395905_0790956 3300037471 Unclassified 852
610 Ga0316581_0133477 3300037588 Bacteria 765
611 Ga0395901_0194022 3300038443 Bacteria 2130
612 Ga0242420_041319 3300038996 Unclassified 881
613 Ga0436365_0532788 3300039437 Bacteria 619
614 Ga0439436_0050161 3300041404 Unclassified 1181
615 Ga0439439_0002520 3300041406 Bacteria 3906
616 Ga0439439_0021942 3300041406 Bacteria 1593
617 Ga0439461_0130005 3300041410 Bacteria 636
618 Ga0451800_1206903 3300041459 Bacteria 1420
619 Ga0451807_1336449 3300041486 Unclassified 888
620 Ga0451839_0743658 3300041496 Unclassified 610
621 Ga0451843_1171492 3300041509 Bacteria 659
622 Ga0439431_0196026 3300041997 Unclassified 587
623 Ga0439445_0115672 3300042004 Unclassified 768
624 Ga0439448_0143233 3300042005 Unclassified 828
625 Ga0439455_0043921 3300042012 Unclassified 1152
626 Ga0439455_0051234 3300042012 Bacteria 1079
627 Ga0439455_0099355 3300042012 Bacteria 803
628 Ga0439457_023322 3300042014 Bacteria 1369
629 Ga0450890_012844 3300042127 Unclassified 1089
630 Ga0450896_073251 3300042133 Bacteria 570
631 Ga0450898_009275 3300042134 Bacteria 1571
632 Ga0450910_070410 3300042147 Bacteria 601
633 Ga0439446_0007447 3300042156 Bacteria 2878
634 Ga0439446_0051095 3300042156 Bacteria 1235
635 Ga0439446_0056374 3300042156 Bacteria 1181
636 Ga0439446_0097613 3300042156 Unclassified 926
637 Ga0439446_0309813 3300042156 Bacteria 556
638 Ga0439434_0088359 3300042435 Unclassified 989
639 Ga0439434_0109779 3300042435 Unclassified 893
640 Ga0439444_0052590 3300042437 Unclassified 832
641 Ga0439444_0103733 3300042437 Bacteria 647
642 Ga0439460_0129562 3300042461 Unclassified 831
643 Ga0451577_0104958 3300042876 Bacteria 2525
644 Ga0451577_0430087 3300042876 Unclassified 1198
645 Ga0451577_0870240 3300042876 Bacteria 812
646 Ga0451577_0894212 3300042876 Bacteria 800
647 Ga0451577_0979478 3300042876 Bacteria 760
648 Ga0453683_0089467 3300044673 Unclassified 1930
649 Ga0453684_0690822 3300044712 Bacteria 1110
650 Ga0466957_0574083 3300044842 Bacteria 788
651 Ga0466960_0273036 3300044901 Bacteria 945
652 Ga0466960_0741801 3300044901 Unclassified 591
653 Ga0466960_0988309 3300044901 Bacteria 517
654 Ga0451576_0890989 3300045051 Bacteria 934
655 Ga0451576_1409696 3300045051 Unclassified 725
656 Ga0466967_0327124 3300045976 Bacteria 1480
657 Ga0466967_1675823 3300045976 Bacteria 633
658 Ga0495603_0323636 3300046455 Unclassified 885
659 Ga0495629_0656868 3300046459 Unclassified 698
660 Ga0495580_0454199 3300046472 Bacteria 859
661 Ga0495594_0288471 3300046499 Bacteria 935
662 Ga0495594_0595211 3300046499 Bacteria 627
663 Ga0495621_0037151 3300046539 Bacteria 1693
664 Ga0495622_0305615 3300046557 Bacteria 693
665 Ga0495667_0385359 3300046559 Unclassified 884
666 Ga0495670_0407120 3300046691 Unclassified 735
667 Ga0496100_0412803 3300048903 Bacteria 1030
668 Ga0496100_0493441 3300048903 Bacteria 943
669 Ga0496100_0961145 3300048903 Bacteria 672
670 Ga0496100_1049240 3300048903 Unclassified 642
671 Ga0496100_1460154 3300048903 Bacteria 540
672 Ga0496100_1511805 3300048903 Unclassified 530
673 Ga0496101_0202173 3300048904 Bacteria 1536
674 Ga0496101_0444105 3300048904 Bacteria 1023
675 Ga0496101_1491930 3300048904 Unclassified 526
676 Ga0496102_0052140 3300048905 Unclassified 3726
677 Ga0496102_0052826 3300048905 Bacteria 3704
678 Ga0496102_0185973 3300048905 Bacteria 1958
679 Ga0496102_0826208 3300048905 Bacteria 849
680 Ga0496102_1502438 3300048905 Bacteria 592
681 Ga0496102_1742552 3300048905 Bacteria 540
682 Ga0496103_0039229 3300048906 Bacteria 2910
683 Ga0496103_0975345 3300048906 Bacteria 529
684 Ga0496104_0054127 3300048907 Bacteria 3793
685 Ga0496104_0079813 3300048907 Bacteria 3119
686 Ga0496104_0158733 3300048907 Bacteria 2170
687 Ga0496104_0207801 3300048907 Bacteria 1870
688 Ga0496105_0257134 3300048908 Bacteria 1413
689 Ga0496105_0259689 3300048908 Bacteria 1405
690 Ga0496105_0498419 3300048908 Bacteria 956
691 Ga0496106_0048833 3300048909 Unclassified 3188
692 Ga0496106_0347482 3300048909 Bacteria 1191
693 Ga0496106_0381492 3300048909 Bacteria 1133
694 Ga0496107_0119348 3300048910 Bacteria 1942
695 Ga0496108_0051655 3300048911 Bacteria 3444
696 Ga0496108_0070040 3300048911 Bacteria 2959
697 Ga0496108_0131588 3300048911 Bacteria 2150
698 Ga0496108_0886987 3300048911 Bacteria 766
699 Ga0496108_0906256 3300048911 Bacteria 756
700 Ga0496109_0001242 3300048912 Bacteria 21132
701 Ga0496109_0003405 3300048912 Bacteria 13309
702 Ga0496109_0107503 3300048912 Bacteria 2591
703 Ga0496109_0120355 3300048912 Bacteria 2445
704 Ga0496109_0623628 3300048912 Bacteria 1015
705 Ga0496109_0889805 3300048912 Unclassified 828
706 Ga0496110_0062816 3300048913 Bacteria 3281
707 Ga0496110_0109296 3300048913 Bacteria 2483
708 Ga0496110_0233956 3300048913 Bacteria 1671
709 Ga0496110_0447960 3300048913 Bacteria 1177
710 Ga0496111_0052860 3300048914 Unclassified 2934
711 Ga0496111_0073361 3300048914 Bacteria 2492
712 Ga0496111_0539897 3300048914 Bacteria 856
713 Ga0496112_0006851 3300048915 Bacteria 10046
714 Ga0496112_0078121 3300048915 Bacteria 3273
715 Ga0496112_0314680 3300048915 Bacteria 1510
716 Ga0496112_0723460 3300048915 Bacteria 922
717 Ga0496113_0002551 3300048916 Bacteria 10629
718 Ga0496113_0013682 3300048916 Bacteria 5509
719 Ga0496113_0127845 3300048916 Bacteria 1991
720 Ga0496113_0408360 3300048916 Bacteria 1090
721 Ga0496114_0775170 3300048917 Bacteria 837
722 Ga0496114_0801337 3300048917 Unclassified 821
723 Ga0496114_1428813 3300048917 Bacteria 579
724 Ga0496115_0072632 3300048918 Bacteria 2792
725 Ga0496115_0073560 3300048918 Bacteria 2774
726 Ga0501297_015215 3300049520 Bacteria 919
727 Ga0501298_061990 3300049521 Bacteria 794
728 Ga0501298_154911 3300049521 Bacteria 563
729 Ga0501299_050851 3300049522 Bacteria 856
730 Ga0501299_106168 3300049522 Bacteria 659
731 Ga0501031_0432604 3300049568 Bacteria 850
732 Ga0501031_0981307 3300049568 Bacteria 540
733 Ga0501032_0269097 3300049569 Bacteria 1104
734 Ga0501032_0712237 3300049569 Bacteria 636
735 Ga0501033_0282461 3300049570 Bacteria 1172
736 Ga0501034_0098585 3300049571 Bacteria 2918
737 Ga0501034_1077037 3300049571 Bacteria 685
738 Ga0501036_0038651 3300049572 Bacteria 4039
739 Ga0501036_0072612 3300049572 Bacteria 2909
740 Ga0501037_0027943 3300049573 Bacteria 4169
741 Ga0501037_0911485 3300049573 Bacteria 576
742 Ga0501038_0273031 3300049574 Bacteria 1333
743 Ga0501038_0397818 3300049574 Unclassified 1066
744 Ga0501039_0035222 3300049575 Bacteria 3863
745 Ga0501039_0189271 3300049575 Bacteria 1619
746 Ga0501039_0292463 3300049575 Bacteria 1281
747 Ga0501040_0059954 3300049576 Bacteria 2615
748 Ga0501040_0064640 3300049576 Bacteria 2519
749 Ga0501040_0074660 3300049576 Bacteria 2343
750 Ga0501040_0088662 3300049576 Bacteria 2149
751 Ga0501040_0979568 3300049576 Bacteria 613
752 Ga0501041_0091060 3300049577 Bacteria 1883
753 Ga0501041_0154953 3300049577 Bacteria 1431
754 Ga0501041_0211144 3300049577 Bacteria 1217
755 Ga0501041_1041839 3300049577 Bacteria 527
756 Ga0501042_0061501 3300049578 Bacteria 2683
757 Ga0501042_0143165 3300049578 Bacteria 1724
758 Ga0501043_0086142 3300049579 Bacteria 2469
759 Ga0501043_0450759 3300049579 Unclassified 967
760 Ga0501046_0047499 3300049580 Bacteria 3403
761 Ga0501046_0162965 3300049580 Bacteria 1676
762 Ga0501048_0007833 3300049582 Bacteria 8094
763 Ga0501048_0061063 3300049582 Bacteria 2670
764 Ga0501048_1304254 3300049582 Unclassified 522
765 Ga0501067_0062678 3300049583 Bacteria 2058
766 Ga0501067_0108088 3300049583 Bacteria 1546
767 Ga0501067_0163131 3300049583 Bacteria 1241
768 Ga0501067_0374825 3300049583 Bacteria 793
769 Ga0501068_0031002 3300049584 Bacteria 3175
770 Ga0501068_0203291 3300049584 Bacteria 1256
771 Ga0501069_0026697 3300049585 Bacteria 3163
772 Ga0501069_0099027 3300049585 Bacteria 1654
773 Ga0501069_0175717 3300049585 Bacteria 1237
774 Ga0501069_0246800 3300049585 Bacteria 1041
775 Ga0501069_0329360 3300049585 Unclassified 898
776 Ga0501069_0477757 3300049585 Unclassified 742
777 Ga0501069_0640522 3300049585 Bacteria 639
778 Ga0501069_0803675 3300049585 Bacteria 570
779 Ga0501070_0049303 3300049586 Bacteria 3497
780 Ga0501070_0200992 3300049586 Bacteria 1637
781 Ga0501070_0228123 3300049586 Bacteria 1526
782 Ga0501070_0259464 3300049586 Bacteria 1421
783 Ga0501071_0034344 3300049587 Bacteria 3609
784 Ga0501071_0109977 3300049587 Bacteria 2036
785 Ga0501071_0354735 3300049587 Bacteria 1116
786 Ga0501071_0504658 3300049587 Bacteria 928
787 Ga0501071_0668705 3300049587 Bacteria 799
788 Ga0501071_0691332 3300049587 Bacteria 785
789 Ga0501072_0005332 3300049588 Bacteria 9784
790 Ga0501072_1507383 3300049588 Bacteria 519
791 Ga0501073_0874624 3300049589 Bacteria 619
792 Ga0501074_0145818 3300049590 Bacteria 1693
793 Ga0501074_0394104 3300049590 Bacteria 982
794 Ga0501075_0014126 3300049591 Bacteria 5720
795 Ga0501075_0021140 3300049591 Bacteria 4741
796 Ga0501075_0323738 3300049591 Unclassified 1175
797 Ga0501075_0347590 3300049591 Bacteria 1130
798 Ga0501075_0470052 3300049591 Bacteria 959
799 Ga0501075_0780218 3300049591 Bacteria 727
800 Ga0501075_1098476 3300049591 Unclassified 604
801 Ga0501075_1146780 3300049591 Bacteria 590
802 Ga0501076_0017383 3300049592 Bacteria 5466
803 Ga0501076_0087707 3300049592 Bacteria 2501
804 Ga0501076_0283087 3300049592 Bacteria 1358
805 Ga0501076_1019865 3300049592 Bacteria 682
806 Ga0501077_0003255 3300049593 Bacteria 9786
807 Ga0501077_0014505 3300049593 Bacteria 4952
808 Ga0501077_0251388 3300049593 Bacteria 1124
809 Ga0501077_0625642 3300049593 Bacteria 692
810 Ga0501217_038778 3300049661 Bacteria 1205
811 Ga0501217_291700 3300049661 Unclassified 536
812 Ga0501235_086658 3300049669 Unclassified 753
813 Ga0501239_001917 3300049672 Bacteria 1844
814 Ga0501243_036411 3300049675 Bacteria 853
815 Ga0501247_014660 3300049677 Bacteria 974
816 Ga0501249_035276 3300049679 Bacteria 1124
817 Ga0501249_131926 3300049679 Bacteria 617
818 Ga0501257_156004 3300049686 Bacteria 632
819 Ga0501259_033321 3300049688 Bacteria 983
820 Ga0501221_007695 3300049704 Bacteria 1854
821 Ga0501245_140449 3300049708 Unclassified 525
822 Ga0501079_0016453 3300049741 Bacteria 5647
823 Ga0501079_0020714 3300049741 Bacteria 5028
824 Ga0501079_0229399 3300049741 Bacteria 1450
825 Ga0501079_0434835 3300049741 Bacteria 1030
826 Ga0501079_0693318 3300049741 Bacteria 802
827 Ga0501079_1482999 3300049741 Unclassified 534
828 Ga0501080_0013648 3300049742 Bacteria 7481
829 Ga0501080_0076402 3300049742 Bacteria 3115
830 Ga0501080_0310236 3300049742 Bacteria 1430
831 Ga0501080_0312894 3300049742 Bacteria 1423
832 Ga0501080_0525577 3300049742 Bacteria 1055
833 Ga0501080_0766467 3300049742 Bacteria 848
834 Ga0501080_1718978 3300049742 Bacteria 529
835 Ga0501081_0004597 3300049743 Bacteria 8858
836 Ga0501081_0009706 3300049743 Bacteria 6277
837 Ga0501081_0086278 3300049743 Bacteria 2204
838 Ga0501081_0168802 3300049743 Bacteria 1579
839 Ga0501081_1285715 3300049743 Bacteria 555
840 Ga0501081_1398547 3300049743 Unclassified 531
841 Ga0501083_0154322 3300049744 Bacteria 1503
842 Ga0501083_0260450 3300049744 Bacteria 1128
843 Ga0501083_0352922 3300049744 Bacteria 956
844 Ga0501083_0633593 3300049744 Bacteria 695
845 Ga0501263_077837 3300049760 Bacteria 544
846 Ga0501266_050213 3300049763 Unclassified 643
847 Ga0501267_024643 3300049764 Bacteria 681
848 Ga0501271_003541 3300049768 Bacteria 1445
849 Ga0501271_015754 3300049768 Bacteria 846
850 Ga0501273_006208 3300049770 Bacteria 1377
851 Ga0501273_021568 3300049770 Bacteria 875
852 Ga0501276_033015 3300049773 Unclassified 549
853 Ga0501283_113780 3300049779 Bacteria 537
854 Ga0501035_0063000 3300049822 Bacteria 3299
855 Ga0501035_0385135 3300049822 Bacteria 1169
856 Ga0501035_1201092 3300049822 Bacteria 588
857 Ga0501045_0013479 3300049824 Bacteria 5774
858 Ga0501045_0029004 3300049824 Bacteria 3996
859 Ga0501045_0823598 3300049824 Bacteria 683
860 Ga0501045_1378857 3300049824 Bacteria 512
861 nmdc:mga05p37_215368_c1 3300050507 Bacteria 2320
862 nmdc:mga05p37_242812_c1 3300050507 Bacteria 2164
863 nmdc:mga05p37_280136_c1 3300050507 Unclassified 1989
864 nmdc:mga05p37_475607_c1 3300050507 Bacteria 1440
865 nmdc:mga05p37_6185_c1 3300050507 Bacteria 14092
866 nmdc:mga05p37_851898_c1 3300050507 Unclassified 990
867 nmdc:mga09592_1031811_c1 3300050508 Bacteria 686
868 nmdc:mga09592_180745_c1 3300050508 Bacteria 1825
869 nmdc:mga09592_358202_c1 3300050508 Bacteria 1262
870 nmdc:mga09592_642_c1 3300050508 Bacteria 26577
871 nmdc:mga0qj67_153335_c1 3300050509 Bacteria 1869
872 nmdc:mga0qj67_339817_c1 3300050509 Bacteria 1214
873 nmdc:mga0qj67_609197_c1 3300050509 Unclassified 873
874 nmdc:mga06r32_1004102_c1 3300050510 Unclassified 787
875 nmdc:mga06r32_1521497_c1 3300050510 Bacteria 609
876 nmdc:mga06r32_23975_c1 3300050510 Bacteria 5655
877 nmdc:mga06r32_325469_c1 3300050510 Bacteria 1522
878 nmdc:mga06r32_477088_c1 3300050510 Bacteria 1225
879 nmdc:mga06r32_65939_c1 3300050510 Unclassified 3493
880 nmdc:mga06r32_68985_c1 3300050510 Bacteria 3416
881 nmdc:mga08y16_459686_c1 3300050511 Bacteria 1297
882 nmdc:mga08y16_578998_c1 3300050511 Bacteria 1133
883 nmdc:mga0n895_1537642_c1 3300050512 Bacteria 631
884 nmdc:mga0n895_231858_c1 3300050512 Bacteria 1874
885 nmdc:mga0n895_26043_c1 3300050512 Bacteria 5532
886 nmdc:mga0n895_516843_c1 3300050512 Bacteria 1202
887 nmdc:mga0n895_606803_c1 3300050512 Bacteria 1096
888 nmdc:mga0n895_64679_c1 3300050512 Bacteria 3618
889 nmdc:mga0rr50_1206386_c1 3300050513 Bacteria 643
890 nmdc:mga0rr50_126087_c1 3300050513 Unclassified 2044
891 nmdc:mga0rr50_1391604_c1 3300050513 Bacteria 594
892 nmdc:mga0rr50_1616007_c1 3300050513 Unclassified 547
893 nmdc:mga0rr50_396415_c1 3300050513 Bacteria 1165
894 nmdc:mga0rr50_404982_c1 3300050513 Unclassified 1153
895 nmdc:mga0rr50_638951_c1 3300050513 Bacteria 908
896 nmdc:mga0rr50_919398_c1 3300050513 Bacteria 746
897 nmdc:mga08x19_147575_c1 3300050514 Bacteria 1591
898 nmdc:mga08x19_149485_c1 3300050514 Bacteria 1581
899 nmdc:mga0a205_11780_c1 3300050515 Bacteria 8069
900 nmdc:mga0a205_227958_c1 3300050515 Bacteria 1747
901 nmdc:mga0a205_828517_c1 3300050515 Bacteria 773
902 nmdc:mga0a205_91158_c1 3300050515 Bacteria 2945
903 Ga0501084_0005089 3300054114 Bacteria 10763
904 Ga0501084_0071846 3300054114 Bacteria 2898
905 Ga0501084_0079555 3300054114 Bacteria 2747
906 Ga0501084_0250675 3300054114 Bacteria 1495
907 Ga0501084_0360739 3300054114 Bacteria 1228
908 Ga0501084_0953780 3300054114 Bacteria 721
909 Ga0501084_1354823 3300054114 Bacteria 596
910 Ga0501084_1446490 3300054114 Bacteria 575
911 Ga0590071_001977 3300059421 Bacteria 5242
912 Ga0590071_008491 3300059421 Bacteria 2415
913 Ga0590074_007359 3300059423 Bacteria 1829
914 Ga0590074_026919 3300059423 Unclassified 1006
915 Ga0590075_101918 3300059424 Bacteria 748
916 Ga0590075_161870 3300059424 Bacteria 590
917 Ga0590077_008465 3300059426 Bacteria 2106
918 Ga0590077_048096 3300059426 Unclassified 955
919 Ga0587070_101906 3300059491 Bacteria 662
920 Ga0587083_0204840 3300059505 Bacteria 565
921 Ga0587128_138174 3300059630 Bacteria 545
922 Ga0587079_195723 3300059647 Bacteria 549
923 Ga0587071_040685 3300060344 Bacteria 930
924 Ga0501082_0010764 3300060353 Bacteria 7875
925 Ga0501082_0072769 3300060353 Bacteria 2960
926 Ga0501082_0083641 3300060353 Bacteria 2753
927 Ga0501082_0986011 3300060353 Bacteria 737
928 Ga0501082_1522437 3300060353 Bacteria 584
929 Ga0501082_1836858 3300060353 Bacteria 529
930 Ga0530510_0083729 3300061734 Bacteria 2323
931 Ga0530510_0431827 3300061734 Unclassified 995
932 Ga0530510_0647416 3300061734 Bacteria 804
933 Ga0530510_1427460 3300061734 Bacteria 531

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031852 Ga0307410_10068361 Ga0307410_100683613 60
2 3300042156 Ga0439446_0056374 Ga0439446_0056374_977_1168 62
3 3300049592 Ga0501076_1019865 Ga0501076_1019865_366_560 64
4 3300060353 Ga0501082_0986011 Ga0501082_0986011_83_277 64
5 3300031665 Ga0316575_10014657 Ga0316575_100146572 66
6 3300031691 Ga0316579_10051440 Ga0316579_100514403 66
7 3300031727 Ga0316576_10493640 Ga0316576_104936402 66
8 3300031728 Ga0316578_10079698 Ga0316578_100796982 66
9 3300031733 Ga0316577_10203522 Ga0316577_102035222 66
10 3300032133 Ga0316583_10069831 Ga0316583_100698312 66
11 3300032168 Ga0316593_10152671 Ga0316593_101526712 66
12 3300035398 Ga0316574_0291171 Ga0316574_0291171_578_787 66
13 3300036647 Ga0316582_0139654 Ga0316582_0139654_889_1098 66
14 3300036712 Ga0316584_0250425 Ga0316584_0250425_933_1142 66
15 3300037588 Ga0316581_0133477 Ga0316581_0133477_543_752 66
16 3300042876 Ga0451577_0870240 Ga0451577_0870240_185_394 66
17 3300037471 Ga0395905_0676592 Ga0395905_0676592_369_578 67
18 3300044901 Ga0466960_0988309 Ga0466960_0988309_277_486 67
19 3300005354 Ga0070675_100100941 Ga0070675_1001009413 68
20 3300005354 Ga0070675_100193792 Ga0070675_1001937923 68
21 3300005355 Ga0070671_100008791 Ga0070671_1000087915 68
22 3300005356 Ga0070674_100033210 Ga0070674_1000332104 68
23 3300005364 Ga0070673_100443555 Ga0070673_1004435552 68
24 3300005364 Ga0070673_100872322 Ga0070673_1008723222 68
25 3300005367 Ga0070667_101656223 Ga0070667_1016562232 68
26 3300005455 Ga0070663_101162312 Ga0070663_1011623122 68
27 3300005456 Ga0070678_100473367 Ga0070678_1004733672 68
28 3300005456 Ga0070678_100709556 Ga0070678_1007095562 68
29 3300005457 Ga0070662_100877038 Ga0070662_1008770381 68
30 3300005459 Ga0068867_100019527 Ga0068867_1000195275 68
31 3300005466 Ga0070685_10696834 Ga0070685_106968342 68
32 3300005536 Ga0070697_101647534 Ga0070697_1016475342 68
33 3300005543 Ga0070672_100092075 Ga0070672_1000920752 68
34 3300005548 Ga0070665_100407848 Ga0070665_1004078482 68
35 3300005548 Ga0070665_100845184 Ga0070665_1008451842 68
36 3300005618 Ga0068864_100647103 Ga0068864_1006471032 68
37 3300005719 Ga0068861_101494877 Ga0068861_1014948771 68
38 3300005840 Ga0068870_10693508 Ga0068870_106935082 68
39 3300005841 Ga0068863_100960439 Ga0068863_1009604392 68
40 3300005841 Ga0068863_101199778 Ga0068863_1011997782 68
41 3300005844 Ga0068862_101425032 Ga0068862_1014250322 68
42 3300006237 Ga0097621_100953546 Ga0097621_1009535462 68
43 3300007076 Ga0075435_101734584 Ga0075435_1017345842 68
44 3300009177 Ga0105248_11174520 Ga0105248_111745201 68
45 3300009177 Ga0105248_12657162 Ga0105248_126571622 68
46 3300014325 Ga0163163_10246663 Ga0163163_102466632 68
47 3300014326 Ga0157380_12109684 Ga0157380_121096842 68
48 3300014968 Ga0157379_11546043 Ga0157379_115460431 68
49 3300014969 Ga0157376_11212478 Ga0157376_112124782 68
50 3300014969 Ga0157376_11425479 Ga0157376_114254792 68
51 3300017792 Ga0163161_11150635 Ga0163161_111506352 68
52 3300025893 Ga0207682_10038523 Ga0207682_100385232 68
53 3300025901 Ga0207688_10440822 Ga0207688_104408222 68
54 3300025923 Ga0207681_10319809 Ga0207681_103198092 68
55 3300025925 Ga0207650_11843326 Ga0207650_118433262 68
56 3300025926 Ga0207659_10140505 Ga0207659_101405052 68
57 3300025931 Ga0207644_10004008 Ga0207644_100040089 68
58 3300025933 Ga0207706_10806839 Ga0207706_108068392 68
59 3300025938 Ga0207704_10367148 Ga0207704_103671482 68
60 3300025940 Ga0207691_10016924 Ga0207691_100169249 68
61 3300025940 Ga0207691_10200185 Ga0207691_102001852 68
62 3300025941 Ga0207711_10154690 Ga0207711_101546902 68
63 3300025941 Ga0207711_10708476 Ga0207711_107084761 68
64 3300025941 Ga0207711_11765615 Ga0207711_117656152 68
65 3300025945 Ga0207679_11249540 Ga0207679_112495402 68
66 3300025960 Ga0207651_10165925 Ga0207651_101659252 68
67 3300025972 Ga0207668_10015126 Ga0207668_100151265 68
68 3300025972 Ga0207668_11301932 Ga0207668_113019322 68
69 3300025986 Ga0207658_11929462 Ga0207658_119294622 68
70 3300026075 Ga0207708_10838539 Ga0207708_108385391 68
71 3300026088 Ga0207641_10898826 Ga0207641_108988262 68
72 3300026089 Ga0207648_10114838 Ga0207648_101148382 68
73 3300026121 Ga0207683_10768000 Ga0207683_107680002 68
74 3300028379 Ga0268266_10370808 Ga0268266_103708082 68
75 3300028380 Ga0268265_11440718 Ga0268265_114407182 68
76 3300028381 Ga0268264_11007904 Ga0268264_110079041 68
77 3300042876 Ga0451577_0104958 Ga0451577_0104958_1715_1924 68
78 3300046499 Ga0495594_0288471 Ga0495594_0288471_423_632 68
79 3300046539 Ga0495621_0037151 Ga0495621_0037151_1032_1241 68
80 3300046557 Ga0495622_0305615 Ga0495622_0305615_160_369 68
81 3300046691 Ga0495670_0407120 Ga0495670_0407120_237_446 68
82 3300050513 nmdc:mga0rr50_1616007_c1 nmdc:mga0rr50_1616007_c1_229_441 68
83 3300049585 Ga0501069_0329360 Ga0501069_0329360_557_769 69
84 3300049586 Ga0501070_0228123 Ga0501070_0228123_419_631 69
85 3300001228 SwM_137927 SwM_1379271 70
86 3300004798 Ga0058859_10961723 Ga0058859_109617232 70
87 3300005290 Ga0065712_10587870 Ga0065712_105878701 70
88 3300005293 Ga0065715_10123810 Ga0065715_101238103 70
89 3300005293 Ga0065715_10153903 Ga0065715_101539032 70
90 3300005295 Ga0065707_10131282 Ga0065707_101312823 70
91 3300005329 Ga0070683_101919182 Ga0070683_1019191821 70
92 3300005330 Ga0070690_100487319 Ga0070690_1004873192 70
93 3300005334 Ga0068869_100639158 Ga0068869_1006391582 70
94 3300005334 Ga0068869_101217913 Ga0068869_1012179132 70
95 3300005336 Ga0070680_100069928 Ga0070680_1000699284 70
96 3300005337 Ga0070682_100749809 Ga0070682_1007498092 70
97 3300005338 Ga0068868_102285790 Ga0068868_1022857901 70
98 3300005340 Ga0070689_100535557 Ga0070689_1005355572 70
99 3300005344 Ga0070661_100662681 Ga0070661_1006626812 70
100 3300005344 Ga0070661_100823006 Ga0070661_1008230062 70
101 3300005344 Ga0070661_101572430 Ga0070661_1015724302 70
102 3300005345 Ga0070692_10538256 Ga0070692_105382562 70
103 3300005345 Ga0070692_10559033 Ga0070692_105590331 70
104 3300005347 Ga0070668_101846966 Ga0070668_1018469662 70
105 3300005353 Ga0070669_100269000 Ga0070669_1002690002 70
106 3300005353 Ga0070669_101440420 Ga0070669_1014404202 70
107 3300005354 Ga0070675_100128221 Ga0070675_1001282213 70
108 3300005366 Ga0070659_100105341 Ga0070659_1001053413 70
109 3300005366 Ga0070659_100803984 Ga0070659_1008039842 70
110 3300005366 Ga0070659_102044092 Ga0070659_1020440922 70
111 3300005367 Ga0070667_101364081 Ga0070667_1013640812 70
112 3300005434 Ga0070709_10304699 Ga0070709_103046992 70
113 3300005434 Ga0070709_10395101 Ga0070709_103951012 70
114 3300005434 Ga0070709_10416270 Ga0070709_104162701 70
115 3300005435 Ga0070714_101767443 Ga0070714_1017674431 70
116 3300005437 Ga0070710_10386282 Ga0070710_103862822 70
117 3300005439 Ga0070711_101728939 Ga0070711_1017289392 70
118 3300005440 Ga0070705_100018256 Ga0070705_1000182564 70
119 3300005440 Ga0070705_100117496 Ga0070705_1001174962 70
120 3300005440 Ga0070705_100164227 Ga0070705_1001642272 70
121 3300005440 Ga0070705_100187775 Ga0070705_1001877753 70
122 3300005440 Ga0070705_100314584 Ga0070705_1003145842 70
123 3300005440 Ga0070705_100696077 Ga0070705_1006960772 70
124 3300005444 Ga0070694_100015093 Ga0070694_1000150932 70
125 3300005444 Ga0070694_100087534 Ga0070694_1000875342 70
126 3300005444 Ga0070694_100093845 Ga0070694_1000938453 70
127 3300005444 Ga0070694_100186044 Ga0070694_1001860442 70
128 3300005444 Ga0070694_100755738 Ga0070694_1007557382 70
129 3300005444 Ga0070694_101879420 Ga0070694_1018794201 70
130 3300005445 Ga0070708_100049447 Ga0070708_1000494474 70
131 3300005445 Ga0070708_100065163 Ga0070708_1000651632 70
132 3300005445 Ga0070708_100530042 Ga0070708_1005300422 70
133 3300005445 Ga0070708_100561300 Ga0070708_1005613001 70
134 3300005445 Ga0070708_100579219 Ga0070708_1005792192 70
135 3300005445 Ga0070708_100652480 Ga0070708_1006524801 70
136 3300005445 Ga0070708_100765511 Ga0070708_1007655111 70
137 3300005445 Ga0070708_100780906 Ga0070708_1007809062 70
138 3300005445 Ga0070708_101116976 Ga0070708_1011169761 70
139 3300005445 Ga0070708_101584813 Ga0070708_1015848132 70
140 3300005445 Ga0070708_102021728 Ga0070708_1020217281 70
141 3300005455 Ga0070663_101420644 Ga0070663_1014206441 70
142 3300005455 Ga0070663_101904310 Ga0070663_1019043102 70
143 3300005455 Ga0070663_102109267 Ga0070663_1021092671 70
144 3300005457 Ga0070662_100054765 Ga0070662_1000547653 70
145 3300005457 Ga0070662_100182576 Ga0070662_1001825762 70
146 3300005458 Ga0070681_10022957 Ga0070681_100229574 70
147 3300005458 Ga0070681_10027906 Ga0070681_100279062 70
148 3300005458 Ga0070681_10529563 Ga0070681_105295632 70
149 3300005458 Ga0070681_10599775 Ga0070681_105997752 70
150 3300005458 Ga0070681_10971166 Ga0070681_109711662 70
151 3300005459 Ga0068867_100483907 Ga0068867_1004839072 70
152 3300005459 Ga0068867_100556872 Ga0068867_1005568722 70
153 3300005459 Ga0068867_101832383 Ga0068867_1018323832 70
154 3300005467 Ga0070706_100009183 Ga0070706_1000091835 70
155 3300005467 Ga0070706_100093815 Ga0070706_1000938152 70
156 3300005467 Ga0070706_100783954 Ga0070706_1007839541 70
157 3300005467 Ga0070706_101710122 Ga0070706_1017101221 70
158 3300005468 Ga0070707_100002150 Ga0070707_10000215019 70
159 3300005468 Ga0070707_100029350 Ga0070707_1000293502 70
160 3300005468 Ga0070707_100096466 Ga0070707_1000964663 70
161 3300005468 Ga0070707_100187680 Ga0070707_1001876803 70
162 3300005468 Ga0070707_100327777 Ga0070707_1003277772 70
163 3300005468 Ga0070707_100357994 Ga0070707_1003579942 70
164 3300005468 Ga0070707_100450350 Ga0070707_1004503502 70
165 3300005468 Ga0070707_100507663 Ga0070707_1005076632 70
166 3300005471 Ga0070698_100003276 Ga0070698_1000032768 70
167 3300005471 Ga0070698_100007458 Ga0070698_1000074586 70
168 3300005471 Ga0070698_100015455 Ga0070698_1000154555 70
169 3300005471 Ga0070698_100270152 Ga0070698_1002701521 70
170 3300005471 Ga0070698_100353707 Ga0070698_1003537072 70
171 3300005471 Ga0070698_100488468 Ga0070698_1004884682 70
172 3300005471 Ga0070698_101719136 Ga0070698_1017191361 70
173 3300005518 Ga0070699_100002133 Ga0070699_10000213310 70
174 3300005518 Ga0070699_100005989 Ga0070699_1000059895 70
175 3300005518 Ga0070699_100007511 Ga0070699_1000075114 70
176 3300005518 Ga0070699_100017837 Ga0070699_1000178373 70
177 3300005518 Ga0070699_100028112 Ga0070699_1000281123 70
178 3300005518 Ga0070699_100077326 Ga0070699_1000773262 70
179 3300005518 Ga0070699_100160149 Ga0070699_1001601492 70
180 3300005518 Ga0070699_100181645 Ga0070699_1001816453 70
181 3300005518 Ga0070699_100234006 Ga0070699_1002340063 70
182 3300005518 Ga0070699_102076596 Ga0070699_1020765961 70
183 3300005518 Ga0070699_102172857 Ga0070699_1021728571 70
184 3300005530 Ga0070679_100021440 Ga0070679_1000214406 70
185 3300005530 Ga0070679_100027542 Ga0070679_1000275422 70
186 3300005530 Ga0070679_101901992 Ga0070679_1019019921 70
187 3300005535 Ga0070684_100317929 Ga0070684_1003179292 70
188 3300005535 Ga0070684_101094225 Ga0070684_1010942252 70
189 3300005536 Ga0070697_100006203 Ga0070697_1000062033 70
190 3300005536 Ga0070697_100163462 Ga0070697_1001634623 70
191 3300005536 Ga0070697_100250111 Ga0070697_1002501111 70
192 3300005536 Ga0070697_100336674 Ga0070697_1003366742 70
193 3300005536 Ga0070697_100471476 Ga0070697_1004714762 70
194 3300005536 Ga0070697_100562967 Ga0070697_1005629672 70
195 3300005536 Ga0070697_100568784 Ga0070697_1005687842 70
196 3300005536 Ga0070697_100620052 Ga0070697_1006200521 70
197 3300005536 Ga0070697_100691209 Ga0070697_1006912092 70
198 3300005539 Ga0068853_101307303 Ga0068853_1013073032 70
199 3300005543 Ga0070672_101474129 Ga0070672_1014741292 70
200 3300005544 Ga0070686_100335764 Ga0070686_1003357642 70
201 3300005545 Ga0070695_100014271 Ga0070695_1000142711 70
202 3300005545 Ga0070695_100124557 Ga0070695_1001245571 70
203 3300005545 Ga0070695_100348395 Ga0070695_1003483952 70
204 3300005545 Ga0070695_100494358 Ga0070695_1004943582 70
205 3300005546 Ga0070696_100000865 Ga0070696_10000086510 70
206 3300005546 Ga0070696_100005546 Ga0070696_1000055463 70
207 3300005546 Ga0070696_100052367 Ga0070696_1000523673 70
208 3300005546 Ga0070696_100081411 Ga0070696_1000814112 70
209 3300005546 Ga0070696_100100927 Ga0070696_1001009272 70
210 3300005546 Ga0070696_100128402 Ga0070696_1001284022 70
211 3300005546 Ga0070696_100322469 Ga0070696_1003224692 70
212 3300005546 Ga0070696_100354374 Ga0070696_1003543742 70
213 3300005546 Ga0070696_100812935 Ga0070696_1008129352 70
214 3300005546 Ga0070696_100846174 Ga0070696_1008461742 70
215 3300005546 Ga0070696_100949815 Ga0070696_1009498152 70
216 3300005546 Ga0070696_101131312 Ga0070696_1011313121 70
217 3300005546 Ga0070696_101314476 Ga0070696_1013144762 70
218 3300005547 Ga0070693_100031072 Ga0070693_1000310724 70
219 3300005547 Ga0070693_100074516 Ga0070693_1000745162 70
220 3300005547 Ga0070693_100173961 Ga0070693_1001739612 70
221 3300005549 Ga0070704_100001871 Ga0070704_1000018712 70
222 3300005549 Ga0070704_100067181 Ga0070704_1000671813 70
223 3300005549 Ga0070704_100148146 Ga0070704_1001481462 70
224 3300005549 Ga0070704_100678410 Ga0070704_1006784102 70
225 3300005549 Ga0070704_101261794 Ga0070704_1012617942 70
226 3300005549 Ga0070704_101418980 Ga0070704_1014189802 70
227 3300005563 Ga0068855_100826175 Ga0068855_1008261752 70
228 3300005564 Ga0070664_100096840 Ga0070664_1000968403 70
229 3300005564 Ga0070664_100925678 Ga0070664_1009256782 70
230 3300005577 Ga0068857_101145760 Ga0068857_1011457602 70
231 3300005578 Ga0068854_100638193 Ga0068854_1006381932 70
232 3300005578 Ga0068854_101194771 Ga0068854_1011947712 70
233 3300005614 Ga0068856_101300785 Ga0068856_1013007852 70
234 3300005615 Ga0070702_100180507 Ga0070702_1001805072 70
235 3300005616 Ga0068852_100600131 Ga0068852_1006001312 70
236 3300005616 Ga0068852_101633140 Ga0068852_1016331402 70
237 3300005617 Ga0068859_100053225 Ga0068859_1000532252 70
238 3300005617 Ga0068859_100109269 Ga0068859_1001092693 70
239 3300005617 Ga0068859_100188772 Ga0068859_1001887722 70
240 3300005617 Ga0068859_100663057 Ga0068859_1006630572 70
241 3300005617 Ga0068859_102668663 Ga0068859_1026686632 70
242 3300005618 Ga0068864_100044368 Ga0068864_1000443685 70
243 3300005618 Ga0068864_100553708 Ga0068864_1005537082 70
244 3300005618 Ga0068864_100610233 Ga0068864_1006102332 70
245 3300005618 Ga0068864_100620167 Ga0068864_1006201672 70
246 3300005618 Ga0068864_100882891 Ga0068864_1008828911 70
247 3300005718 Ga0068866_10032052 Ga0068866_100320521 70
248 3300005719 Ga0068861_102439840 Ga0068861_1024398402 70
249 3300005834 Ga0068851_10455630 Ga0068851_104556302 70
250 3300005840 Ga0068870_10561569 Ga0068870_105615692 70
251 3300005840 Ga0068870_10582049 Ga0068870_105820492 70
252 3300005841 Ga0068863_100011280 Ga0068863_1000112802 70
253 3300005841 Ga0068863_102450612 Ga0068863_1024506122 70
254 3300005842 Ga0068858_100657775 Ga0068858_1006577752 70
255 3300005842 Ga0068858_101382130 Ga0068858_1013821302 70
256 3300005844 Ga0068862_100220504 Ga0068862_1002205042 70
257 3300005844 Ga0068862_100518549 Ga0068862_1005185492 70
258 3300005844 Ga0068862_100903982 Ga0068862_1009039822 70
259 3300005844 Ga0068862_101007983 Ga0068862_1010079832 70
260 3300005844 Ga0068862_101077074 Ga0068862_1010770742 70
261 3300005937 Ga0081455_10080975 Ga0081455_100809753 70
262 3300005981 Ga0081538_10046524 Ga0081538_100465242 70
263 3300006163 Ga0070715_10098934 Ga0070715_100989342 70
264 3300006163 Ga0070715_10479031 Ga0070715_104790312 70
265 3300006173 Ga0070716_100249063 Ga0070716_1002490632 70
266 3300006173 Ga0070716_101420647 Ga0070716_1014206472 70
267 3300006173 Ga0070716_101543766 Ga0070716_1015437662 70
268 3300006175 Ga0070712_100047991 Ga0070712_1000479913 70
269 3300006358 Ga0068871_102264105 Ga0068871_1022641051 70
270 3300006844 Ga0075428_100006932 Ga0075428_1000069327 70
271 3300006844 Ga0075428_100058586 Ga0075428_1000585862 70
272 3300006844 Ga0075428_100381825 Ga0075428_1003818252 70
273 3300006844 Ga0075428_101389275 Ga0075428_1013892752 70
274 3300006844 Ga0075428_101755781 Ga0075428_1017557811 70
275 3300006844 Ga0075428_101777500 Ga0075428_1017775002 70
276 3300006846 Ga0075430_100092716 Ga0075430_1000927162 70
277 3300006846 Ga0075430_100354452 Ga0075430_1003544522 70
278 3300006846 Ga0075430_100637014 Ga0075430_1006370141 70
279 3300006846 Ga0075430_100690207 Ga0075430_1006902072 70
280 3300006846 Ga0075430_101147872 Ga0075430_1011478722 70
281 3300006847 Ga0075431_100026669 Ga0075431_1000266692 70
282 3300006847 Ga0075431_100047894 Ga0075431_1000478942 70
283 3300006847 Ga0075431_100081818 Ga0075431_1000818183 70
284 3300006847 Ga0075431_100230767 Ga0075431_1002307673 70
285 3300006847 Ga0075431_100278802 Ga0075431_1002788022 70
286 3300006847 Ga0075431_100292081 Ga0075431_1002920812 70
287 3300006847 Ga0075431_100604564 Ga0075431_1006045642 70
288 3300006847 Ga0075431_100647237 Ga0075431_1006472371 70
289 3300006847 Ga0075431_102101238 Ga0075431_1021012382 70
290 3300006852 Ga0075433_10006922 Ga0075433_100069227 70
291 3300006852 Ga0075433_10076342 Ga0075433_100763423 70
292 3300006852 Ga0075433_10170726 Ga0075433_101707262 70
293 3300006852 Ga0075433_10241728 Ga0075433_102417283 70
294 3300006852 Ga0075433_11068583 Ga0075433_110685832 70
295 3300006852 Ga0075433_11170367 Ga0075433_111703672 70
296 3300006852 Ga0075433_11503054 Ga0075433_115030541 70
297 3300006871 Ga0075434_100005726 Ga0075434_1000057264 70
298 3300006871 Ga0075434_100114353 Ga0075434_1001143533 70
299 3300006871 Ga0075434_100383905 Ga0075434_1003839052 70
300 3300006871 Ga0075434_100504379 Ga0075434_1005043792 70
301 3300006871 Ga0075434_100736903 Ga0075434_1007369032 70
302 3300006871 Ga0075434_101321233 Ga0075434_1013212332 70
303 3300006880 Ga0075429_100000623 Ga0075429_10000062312 70
304 3300006880 Ga0075429_100318249 Ga0075429_1003182492 70
305 3300006880 Ga0075429_100593075 Ga0075429_1005930752 70
306 3300006880 Ga0075429_100798229 Ga0075429_1007982292 70
307 3300006880 Ga0075429_100948945 Ga0075429_1009489451 70
308 3300006880 Ga0075429_101969872 Ga0075429_1019698722 70
309 3300006914 Ga0075436_100043895 Ga0075436_1000438952 70
310 3300006914 Ga0075436_100176983 Ga0075436_1001769833 70
311 3300006914 Ga0075436_100184775 Ga0075436_1001847752 70
312 3300006914 Ga0075436_100231115 Ga0075436_1002311152 70
313 3300006931 Ga0097620_100053224 Ga0097620_1000532242 70
314 3300006931 Ga0097620_100109269 Ga0097620_1001092693 70
315 3300006931 Ga0097620_100188778 Ga0097620_1001887782 70
316 3300006931 Ga0097620_100663014 Ga0097620_1006630142 70
317 3300006931 Ga0097620_102669440 Ga0097620_1026694402 70
318 3300007076 Ga0075435_100024954 Ga0075435_1000249544 70
319 3300007076 Ga0075435_100406113 Ga0075435_1004061132 70
320 3300007076 Ga0075435_100533266 Ga0075435_1005332662 70
321 3300007076 Ga0075435_100634926 Ga0075435_1006349262 70
322 3300007076 Ga0075435_100643050 Ga0075435_1006430502 70
323 3300007076 Ga0075435_100693939 Ga0075435_1006939392 70
324 3300007076 Ga0075435_100959981 Ga0075435_1009599812 70
325 3300007076 Ga0075435_101474367 Ga0075435_1014743672 70
326 3300009094 Ga0111539_10581234 Ga0111539_105812342 70
327 3300009094 Ga0111539_10618327 Ga0111539_106183272 70
328 3300009094 Ga0111539_10855312 Ga0111539_108553123 70
329 3300009094 Ga0111539_11183076 Ga0111539_111830761 70
330 3300009147 Ga0114129_10000112 Ga0114129_1000011275 70
331 3300009147 Ga0114129_10086755 Ga0114129_100867553 70
332 3300009147 Ga0114129_10129099 Ga0114129_101290993 70
333 3300009147 Ga0114129_10293880 Ga0114129_102938803 70
334 3300009147 Ga0114129_10433001 Ga0114129_104330013 70
335 3300009147 Ga0114129_10515241 Ga0114129_105152412 70
336 3300009147 Ga0114129_11512801 Ga0114129_115128012 70
337 3300009148 Ga0105243_10724450 Ga0105243_107244501 70
338 3300009148 Ga0105243_11613171 Ga0105243_116131711 70
339 3300009148 Ga0105243_12617250 Ga0105243_126172502 70
340 3300009148 Ga0105243_13077009 Ga0105243_130770092 70
341 3300009174 Ga0105241_10654456 Ga0105241_106544562 70
342 3300009177 Ga0105248_10913795 Ga0105248_109137952 70
343 3300009545 Ga0105237_10418652 Ga0105237_104186522 70
344 3300009551 Ga0105238_11999119 Ga0105238_119991192 70
345 3300009553 Ga0105249_10202415 Ga0105249_102024152 70
346 3300009553 Ga0105249_10882978 Ga0105249_108829782 70
347 3300009553 Ga0105249_10972564 Ga0105249_109725642 70
348 3300009553 Ga0105249_12950528 Ga0105249_129505282 70
349 3300010375 Ga0105239_10005218 Ga0105239_1000521812 70
350 3300010375 Ga0105239_10992321 Ga0105239_109923212 70
351 3300011119 Ga0105246_10364215 Ga0105246_103642151 70
352 3300013306 Ga0163162_12561906 Ga0163162_125619062 70
353 3300013308 Ga0157375_11037934 Ga0157375_110379342 70
354 3300014325 Ga0163163_10005758 Ga0163163_100057584 70
355 3300014325 Ga0163163_10893560 Ga0163163_108935601 70
356 3300014325 Ga0163163_10933766 Ga0163163_109337662 70
357 3300014325 Ga0163163_11085161 Ga0163163_110851611 70
358 3300014326 Ga0157380_12526838 Ga0157380_125268382 70
359 3300014326 Ga0157380_12797457 Ga0157380_127974571 70
360 3300014326 Ga0157380_13411834 Ga0157380_134118342 70
361 3300014497 Ga0182008_10378723 Ga0182008_103787232 70
362 3300014497 Ga0182008_10600299 Ga0182008_106002992 70
363 3300014968 Ga0157379_10118199 Ga0157379_101181992 70
364 3300021384 Ga0213876_10524693 Ga0213876_105246932 70
365 3300025321 Ga0207656_10228544 Ga0207656_102285442 70
366 3300025898 Ga0207692_10343998 Ga0207692_103439982 70
367 3300025899 Ga0207642_10866470 Ga0207642_108664701 70
368 3300025901 Ga0207688_10495040 Ga0207688_104950402 70
369 3300025905 Ga0207685_10363688 Ga0207685_103636882 70
370 3300025905 Ga0207685_10388143 Ga0207685_103881432 70
371 3300025906 Ga0207699_10306992 Ga0207699_103069922 70
372 3300025906 Ga0207699_10344016 Ga0207699_103440161 70
373 3300025906 Ga0207699_10613428 Ga0207699_106134281 70
374 3300025908 Ga0207643_10456991 Ga0207643_104569912 70
375 3300025910 Ga0207684_10034088 Ga0207684_100340883 70
376 3300025910 Ga0207684_10123849 Ga0207684_101238491 70
377 3300025910 Ga0207684_10970023 Ga0207684_109700231 70
378 3300025911 Ga0207654_11414554 Ga0207654_114145542 70
379 3300025912 Ga0207707_10000702 Ga0207707_1000070215 70
380 3300025912 Ga0207707_10051069 Ga0207707_100510694 70
381 3300025912 Ga0207707_10648027 Ga0207707_106480272 70
382 3300025914 Ga0207671_10435374 Ga0207671_104353741 70
383 3300025917 Ga0207660_10005346 Ga0207660_100053465 70
384 3300025917 Ga0207660_10066197 Ga0207660_100661973 70
385 3300025917 Ga0207660_10156626 Ga0207660_101566262 70
386 3300025920 Ga0207649_10725055 Ga0207649_107250552 70
387 3300025921 Ga0207652_10002232 Ga0207652_1000223219 70
388 3300025921 Ga0207652_10127325 Ga0207652_101273252 70
389 3300025921 Ga0207652_10174235 Ga0207652_101742352 70
390 3300025921 Ga0207652_11792338 Ga0207652_117923382 70
391 3300025922 Ga0207646_10022200 Ga0207646_100222005 70
392 3300025922 Ga0207646_10039361 Ga0207646_100393614 70
393 3300025922 Ga0207646_10080269 Ga0207646_100802692 70
394 3300025922 Ga0207646_10711592 Ga0207646_107115922 70
395 3300025922 Ga0207646_11157793 Ga0207646_111577932 70
396 3300025922 Ga0207646_11878428 Ga0207646_118784282 70
397 3300025923 Ga0207681_10710834 Ga0207681_107108342 70
398 3300025925 Ga0207650_10510716 Ga0207650_105107162 70
399 3300025926 Ga0207659_10438377 Ga0207659_104383772 70
400 3300025926 Ga0207659_10664298 Ga0207659_106642982 70
401 3300025926 Ga0207659_10821271 Ga0207659_108212712 70
402 3300025929 Ga0207664_11692677 Ga0207664_116926772 70
403 3300025932 Ga0207690_10432744 Ga0207690_104327442 70
404 3300025933 Ga0207706_10088271 Ga0207706_100882713 70
405 3300025933 Ga0207706_10089638 Ga0207706_100896383 70
406 3300025933 Ga0207706_10880555 Ga0207706_108805552 70
407 3300025933 Ga0207706_11039227 Ga0207706_110392272 70
408 3300025935 Ga0207709_11235435 Ga0207709_112354351 70
409 3300025935 Ga0207709_11582118 Ga0207709_115821181 70
410 3300025936 Ga0207670_10126412 Ga0207670_101264122 70
411 3300025937 Ga0207669_10896170 Ga0207669_108961702 70
412 3300025939 Ga0207665_10621177 Ga0207665_106211772 70
413 3300025939 Ga0207665_10904169 Ga0207665_109041692 70
414 3300025940 Ga0207691_10853619 Ga0207691_108536192 70
415 3300025940 Ga0207691_11410739 Ga0207691_114107392 70
416 3300025941 Ga0207711_10957509 Ga0207711_109575092 70
417 3300025942 Ga0207689_10544173 Ga0207689_105441732 70
418 3300025944 Ga0207661_10101253 Ga0207661_101012533 70
419 3300025944 Ga0207661_11130502 Ga0207661_111305022 70
420 3300025945 Ga0207679_10132968 Ga0207679_101329683 70
421 3300025945 Ga0207679_10184201 Ga0207679_101842013 70
422 3300025945 Ga0207679_10274785 Ga0207679_102747852 70
423 3300025945 Ga0207679_10835659 Ga0207679_108356592 70
424 3300025960 Ga0207651_10512051 Ga0207651_105120512 70
425 3300025961 Ga0207712_10546134 Ga0207712_105461342 70
426 3300025961 Ga0207712_10810564 Ga0207712_108105642 70
427 3300025961 Ga0207712_12122183 Ga0207712_121221832 70
428 3300025972 Ga0207668_12023245 Ga0207668_120232452 70
429 3300025981 Ga0207640_10728719 Ga0207640_107287192 70
430 3300025986 Ga0207658_10242463 Ga0207658_102424633 70
431 3300026023 Ga0207677_10886241 Ga0207677_108862411 70
432 3300026023 Ga0207677_11360798 Ga0207677_113607981 70
433 3300026035 Ga0207703_10247313 Ga0207703_102473132 70
434 3300026035 Ga0207703_11096166 Ga0207703_110961662 70
435 3300026041 Ga0207639_11820483 Ga0207639_118204832 70
436 3300026067 Ga0207678_10248116 Ga0207678_102481162 70
437 3300026067 Ga0207678_10478596 Ga0207678_104785962 70
438 3300026075 Ga0207708_10079069 Ga0207708_100790692 70
439 3300026078 Ga0207702_11583342 Ga0207702_115833421 70
440 3300026088 Ga0207641_10038713 Ga0207641_100387134 70
441 3300026088 Ga0207641_10067260 Ga0207641_100672604 70
442 3300026088 Ga0207641_12294307 Ga0207641_122943072 70
443 3300026089 Ga0207648_10093302 Ga0207648_100933022 70
444 3300026089 Ga0207648_10645401 Ga0207648_106454012 70
445 3300026095 Ga0207676_10174486 Ga0207676_101744863 70
446 3300026095 Ga0207676_10607718 Ga0207676_106077182 70
447 3300026095 Ga0207676_10718672 Ga0207676_107186722 70
448 3300026095 Ga0207676_10820683 Ga0207676_108206832 70
449 3300026116 Ga0207674_10807843 Ga0207674_108078432 70
450 3300026116 Ga0207674_11555966 Ga0207674_115559662 70
451 3300026118 Ga0207675_100500015 Ga0207675_1005000152 70
452 3300026118 Ga0207675_100993439 Ga0207675_1009934392 70
453 3300026118 Ga0207675_100999672 Ga0207675_1009996722 70
454 3300026118 Ga0207675_101687567 Ga0207675_1016875671 70
455 3300026118 Ga0207675_102592228 Ga0207675_1025922281 70
456 3300026142 Ga0207698_11049818 Ga0207698_110498182 70
457 3300027364 Ga0209967_1063523 Ga0209967_10635231 70
458 3300027424 Ga0209984_1050418 Ga0209984_10504182 70
459 3300027552 Ga0209982_1091304 Ga0209982_10913041 70
460 3300027682 Ga0209971_1024024 Ga0209971_10240242 70
461 3300027682 Ga0209971_1026490 Ga0209971_10264903 70
462 3300027682 Ga0209971_1125827 Ga0209971_11258272 70
463 3300027717 Ga0209998_10128984 Ga0209998_101289841 70
464 3300027876 Ga0209974_10010987 Ga0209974_100109871 70
465 3300027876 Ga0209974_10059094 Ga0209974_100590942 70
466 3300028380 Ga0268265_11032208 Ga0268265_110322082 70
467 3300028380 Ga0268265_11073493 Ga0268265_110734932 70
468 3300028380 Ga0268265_11506653 Ga0268265_115066532 70
469 3300028380 Ga0268265_11969814 Ga0268265_119698141 70
470 3300030745 Ga0316182_1432439 Ga0316182_14324392 70
471 3300031548 Ga0307408_100057953 Ga0307408_1000579533 70
472 3300031548 Ga0307408_100096438 Ga0307408_1000964383 70
473 3300031548 Ga0307408_100099897 Ga0307408_1000998972 70
474 3300031548 Ga0307408_100106929 Ga0307408_1001069292 70
475 3300031548 Ga0307408_100193845 Ga0307408_1001938452 70
476 3300031548 Ga0307408_100566018 Ga0307408_1005660182 70
477 3300031548 Ga0307408_100829891 Ga0307408_1008298912 70
478 3300031548 Ga0307408_101270147 Ga0307408_1012701472 70
479 3300031548 Ga0307408_101942394 Ga0307408_1019423941 70
480 3300031548 Ga0307408_102305101 Ga0307408_1023051012 70
481 3300031548 Ga0307408_102522729 Ga0307408_1025227292 70
482 3300031731 Ga0307405_10040038 Ga0307405_100400383 70
483 3300031731 Ga0307405_10047774 Ga0307405_100477742 70
484 3300031731 Ga0307405_10070175 Ga0307405_100701751 70
485 3300031731 Ga0307405_10179436 Ga0307405_101794362 70
486 3300031731 Ga0307405_10262034 Ga0307405_102620342 70
487 3300031731 Ga0307405_10429726 Ga0307405_104297262 70
488 3300031731 Ga0307405_10512706 Ga0307405_105127062 70
489 3300031731 Ga0307405_10623831 Ga0307405_106238312 70
490 3300031731 Ga0307405_10641319 Ga0307405_106413192 70
491 3300031824 Ga0307413_10006876 Ga0307413_100068764 70
492 3300031824 Ga0307413_10074525 Ga0307413_100745252 70
493 3300031824 Ga0307413_10095448 Ga0307413_100954482 70
494 3300031824 Ga0307413_10112038 Ga0307413_101120382 70
495 3300031824 Ga0307413_10307934 Ga0307413_103079343 70
496 3300031824 Ga0307413_10332343 Ga0307413_103323432 70
497 3300031824 Ga0307413_10415232 Ga0307413_104152322 70
498 3300031824 Ga0307413_10453449 Ga0307413_104534492 70
499 3300031824 Ga0307413_10470292 Ga0307413_104702922 70
500 3300031824 Ga0307413_10648022 Ga0307413_106480222 70
501 3300031824 Ga0307413_10863720 Ga0307413_108637201 70
502 3300031824 Ga0307413_11010445 Ga0307413_110104451 70
503 3300031852 Ga0307410_10010547 Ga0307410_100105474 70
504 3300031852 Ga0307410_10016453 Ga0307410_100164534 70
505 3300031852 Ga0307410_10022765 Ga0307410_100227653 70
506 3300031852 Ga0307410_10023562 Ga0307410_100235621 70
507 3300031852 Ga0307410_10136908 Ga0307410_101369082 70
508 3300031852 Ga0307410_10145738 Ga0307410_101457383 70
509 3300031852 Ga0307410_10254991 Ga0307410_102549911 70
510 3300031852 Ga0307410_10299960 Ga0307410_102999601 70
511 3300031852 Ga0307410_10848808 Ga0307410_108488082 70
512 3300031852 Ga0307410_10896760 Ga0307410_108967602 70
513 3300031852 Ga0307410_11060957 Ga0307410_110609572 70
514 3300031852 Ga0307410_11731902 Ga0307410_117319022 70
515 3300031901 Ga0307406_10045499 Ga0307406_100454993 70
516 3300031901 Ga0307406_10055877 Ga0307406_100558772 70
517 3300031901 Ga0307406_10124194 Ga0307406_101241943 70
518 3300031901 Ga0307406_10226099 Ga0307406_102260991 70
519 3300031901 Ga0307406_10333620 Ga0307406_103336201 70
520 3300031901 Ga0307406_10410875 Ga0307406_104108751 70
521 3300031901 Ga0307406_11051703 Ga0307406_110517032 70
522 3300031903 Ga0307407_10048642 Ga0307407_100486423 70
523 3300031903 Ga0307407_10063601 Ga0307407_100636012 70
524 3300031903 Ga0307407_10072430 Ga0307407_100724302 70
525 3300031903 Ga0307407_10213278 Ga0307407_102132782 70
526 3300031903 Ga0307407_10361703 Ga0307407_103617032 70
527 3300031903 Ga0307407_10586069 Ga0307407_105860692 70
528 3300031903 Ga0307407_10674182 Ga0307407_106741822 70
529 3300031903 Ga0307407_10899617 Ga0307407_108996172 70
530 3300031911 Ga0307412_10083391 Ga0307412_100833912 70
531 3300031911 Ga0307412_10172009 Ga0307412_101720093 70
532 3300031911 Ga0307412_10262944 Ga0307412_102629442 70
533 3300031911 Ga0307412_10761373 Ga0307412_107613732 70
534 3300031911 Ga0307412_11724825 Ga0307412_117248252 70
535 3300031995 Ga0307409_100002373 Ga0307409_1000023732 70
536 3300031995 Ga0307409_100034623 Ga0307409_1000346233 70
537 3300031995 Ga0307409_100066713 Ga0307409_1000667132 70
538 3300031995 Ga0307409_100090409 Ga0307409_1000904092 70
539 3300031995 Ga0307409_100117330 Ga0307409_1001173302 70
540 3300031995 Ga0307409_100241673 Ga0307409_1002416733 70
541 3300031995 Ga0307409_100284397 Ga0307409_1002843971 70
542 3300031995 Ga0307409_100411102 Ga0307409_1004111022 70
543 3300031995 Ga0307409_100443292 Ga0307409_1004432922 70
544 3300031995 Ga0307409_100593627 Ga0307409_1005936272 70
545 3300031995 Ga0307409_101081854 Ga0307409_1010818542 70
546 3300031995 Ga0307409_101566830 Ga0307409_1015668302 70
547 3300031995 Ga0307409_102810928 Ga0307409_1028109282 70
548 3300032002 Ga0307416_100002032 Ga0307416_10000203214 70
549 3300032002 Ga0307416_100002732 Ga0307416_1000027329 70
550 3300032002 Ga0307416_100019764 Ga0307416_1000197643 70
551 3300032002 Ga0307416_100025295 Ga0307416_1000252952 70
552 3300032002 Ga0307416_100039174 Ga0307416_1000391743 70
553 3300032002 Ga0307416_100091107 Ga0307416_1000911073 70
554 3300032002 Ga0307416_100135441 Ga0307416_1001354413 70
555 3300032002 Ga0307416_100191698 Ga0307416_1001916983 70
556 3300032002 Ga0307416_100371035 Ga0307416_1003710352 70
557 3300032002 Ga0307416_100788157 Ga0307416_1007881572 70
558 3300032002 Ga0307416_101324007 Ga0307416_1013240072 70
559 3300032002 Ga0307416_101968567 Ga0307416_1019685671 70
560 3300032002 Ga0307416_102930118 Ga0307416_1029301182 70
561 3300032002 Ga0307416_103171870 Ga0307416_1031718701 70
562 3300032004 Ga0307414_10044787 Ga0307414_100447872 70
563 3300032004 Ga0307414_10062367 Ga0307414_100623673 70
564 3300032004 Ga0307414_10078008 Ga0307414_100780084 70
565 3300032004 Ga0307414_10087954 Ga0307414_100879543 70
566 3300032004 Ga0307414_10404669 Ga0307414_104046692 70
567 3300032004 Ga0307414_10456845 Ga0307414_104568452 70
568 3300032004 Ga0307414_10746024 Ga0307414_107460242 70
569 3300032004 Ga0307414_10960695 Ga0307414_109606951 70
570 3300032004 Ga0307414_11024811 Ga0307414_110248112 70
571 3300032004 Ga0307414_11103998 Ga0307414_111039982 70
572 3300032005 Ga0307411_10020346 Ga0307411_100203464 70
573 3300032005 Ga0307411_10035753 Ga0307411_100357533 70
574 3300032005 Ga0307411_10052115 Ga0307411_100521153 70
575 3300032005 Ga0307411_10081262 Ga0307411_100812623 70
576 3300032005 Ga0307411_10135993 Ga0307411_101359933 70
577 3300032005 Ga0307411_10136943 Ga0307411_101369433 70
578 3300032005 Ga0307411_10340521 Ga0307411_103405213 70
579 3300032005 Ga0307411_10688272 Ga0307411_106882722 70
580 3300032005 Ga0307411_10782029 Ga0307411_107820292 70
581 3300032005 Ga0307411_10937564 Ga0307411_109375641 70
582 3300032005 Ga0307411_10950460 Ga0307411_109504602 70
583 3300032005 Ga0307411_12261193 Ga0307411_122611932 70
584 3300032005 Ga0307411_12348394 Ga0307411_123483941 70
585 3300032126 Ga0307415_100000864 Ga0307415_1000008642 70
586 3300032126 Ga0307415_100003278 Ga0307415_1000032784 70
587 3300032126 Ga0307415_100180552 Ga0307415_1001805522 70
588 3300032126 Ga0307415_100445762 Ga0307415_1004457622 70
589 3300032126 Ga0307415_100756155 Ga0307415_1007561552 70
590 3300032126 Ga0307415_101750012 Ga0307415_1017500122 70
591 3300032126 Ga0307415_101827204 Ga0307415_1018272042 70
592 3300032126 Ga0307415_102092772 Ga0307415_1020927721 70
593 3300032126 Ga0307415_102446087 Ga0307415_1024460872 70
594 3300034816 Ga0373930_0032000 Ga0373930_0032000_622_834 70
595 3300034817 Ga0373948_0095723 Ga0373948_0095723_157_369 70
596 3300034819 Ga0373958_0144029 Ga0373958_0144029_326_538 70
597 3300034820 Ga0373959_0039782 Ga0373959_0039782_720_932 70
598 3300035084 Ga0373928_0022692 Ga0373928_0022692_22_234 70
599 3300035084 Ga0373928_0155103 Ga0373928_0155103_76_288 70
600 3300035085 Ga0373929_0097157 Ga0373929_0097157_235_447 70
601 3300035088 Ga0373940_0005472 Ga0373940_0005472_739_951 70
602 3300035088 Ga0373940_0012634 Ga0373940_0012634_1715_1927 70
603 3300035092 Ga0373952_0133576 Ga0373952_0133576_237_449 70
604 3300035112 Ga0373932_0096515 Ga0373932_0096515_271_483 70
605 3300035114 Ga0373939_0332713 Ga0373939_0332713_144_356 70
606 3300035115 Ga0373941_0123344 Ga0373941_0123344_283_495 70
607 3300035115 Ga0373941_0244230 Ga0373941_0244230_59_271 70
608 3300035121 Ga0373960_0054338 Ga0373960_0054338_887_1099 70
609 3300035121 Ga0373960_0265154 Ga0373960_0265154_121_333 70
610 3300035207 Ga0373942_0108817 Ga0373942_0108817_562_774 70
611 3300035241 Ga0373961_0091246 Ga0373961_0091246_59_271 70
612 3300035241 Ga0373961_0094213 Ga0373961_0094213_714_926 70
613 3300035241 Ga0373961_0220699 Ga0373961_0220699_25_237 70
614 3300035691 Ga0373931_0028636 Ga0373931_0028636_1415_1627 70
615 3300035691 Ga0373931_0140839 Ga0373931_0140839_19_231 70
616 3300035691 Ga0373931_0161079 Ga0373931_0161079_954_1166 70
617 3300035691 Ga0373931_0470759 Ga0373931_0470759_169_381 70
618 3300035691 Ga0373931_0687711 Ga0373931_0687711_212_424 70
619 3300035724 Ga0373933_0029773 Ga0373933_0029773_2093_2305 70
620 3300036401 Ga0373937_1538255 Ga0373937_1538255_371_583 70
621 3300037068 Ga0373925_0890067 Ga0373925_0890067_215_427 70
622 3300037471 Ga0395905_0440496 Ga0395905_0440496_712_924 70
623 3300037471 Ga0395905_0790956 Ga0395905_0790956_101_313 70
624 3300038443 Ga0395901_0194022 Ga0395901_0194022_228_440 70
625 3300038996 Ga0242420_041319 Ga0242420_041319_237_449 70
626 3300039437 Ga0436365_0532788 Ga0436365_0532788_130_342 70
627 3300041404 Ga0439436_0050161 Ga0439436_0050161_489_704 70
628 3300041406 Ga0439439_0002520 Ga0439439_0002520_632_847 70
629 3300041406 Ga0439439_0021942 Ga0439439_0021942_377_598 70
630 3300041410 Ga0439461_0130005 Ga0439461_0130005_70_282 70
631 3300041459 Ga0451800_1206903 Ga0451800_1206903_765_977 70
632 3300041486 Ga0451807_1336449 Ga0451807_1336449_461_673 70
633 3300041496 Ga0451839_0743658 Ga0451839_0743658_357_569 70
634 3300041509 Ga0451843_1171492 Ga0451843_1171492_176_388 70
635 3300041997 Ga0439431_0196026 Ga0439431_0196026_15_230 70
636 3300042004 Ga0439445_0115672 Ga0439445_0115672_371_583 70
637 3300042005 Ga0439448_0143233 Ga0439448_0143233_237_449 70
638 3300042012 Ga0439455_0043921 Ga0439455_0043921_467_679 70
639 3300042012 Ga0439455_0051234 Ga0439455_0051234_320_532 70
640 3300042012 Ga0439455_0099355 Ga0439455_0099355_191_403 70
641 3300042014 Ga0439457_023322 Ga0439457_023322_122_337 70
642 3300042127 Ga0450890_012844 Ga0450890_012844_760_972 70
643 3300042133 Ga0450896_073251 Ga0450896_073251_22_237 70
644 3300042134 Ga0450898_009275 Ga0450898_009275_305_520 70
645 3300042147 Ga0450910_070410 Ga0450910_070410_329_544 70
646 3300042156 Ga0439446_0007447 Ga0439446_0007447_2293_2508 70
647 3300042156 Ga0439446_0051095 Ga0439446_0051095_435_647 70
648 3300042156 Ga0439446_0097613 Ga0439446_0097613_674_886 70
649 3300042156 Ga0439446_0309813 Ga0439446_0309813_12_224 70
650 3300042435 Ga0439434_0088359 Ga0439434_0088359_478_690 70
651 3300042435 Ga0439434_0109779 Ga0439434_0109779_494_709 70
652 3300042437 Ga0439444_0052590 Ga0439444_0052590_32_244 70
653 3300042437 Ga0439444_0103733 Ga0439444_0103733_403_618 70
654 3300042461 Ga0439460_0129562 Ga0439460_0129562_293_505 70
655 3300042876 Ga0451577_0430087 Ga0451577_0430087_157_384 70
656 3300042876 Ga0451577_0894212 Ga0451577_0894212_128_340 70
657 3300042876 Ga0451577_0979478 Ga0451577_0979478_421_633 70
658 3300044673 Ga0453683_0089467 Ga0453683_0089467_898_1110 70
659 3300044712 Ga0453684_0690822 Ga0453684_0690822_477_689 70
660 3300044842 Ga0466957_0574083 Ga0466957_0574083_295_513 70
661 3300044901 Ga0466960_0273036 Ga0466960_0273036_319_531 70
662 3300044901 Ga0466960_0741801 Ga0466960_0741801_365_577 70
663 3300045051 Ga0451576_0890989 Ga0451576_0890989_474_686 70
664 3300045051 Ga0451576_1409696 Ga0451576_1409696_355_567 70
665 3300045976 Ga0466967_0327124 Ga0466967_0327124_885_1097 70
666 3300045976 Ga0466967_1675823 Ga0466967_1675823_405_617 70
667 3300046455 Ga0495603_0323636 Ga0495603_0323636_246_473 70
668 3300046459 Ga0495629_0656868 Ga0495629_0656868_457_684 70
669 3300046472 Ga0495580_0454199 Ga0495580_0454199_235_447 70
670 3300046499 Ga0495594_0595211 Ga0495594_0595211_157_384 70
671 3300046559 Ga0495667_0385359 Ga0495667_0385359_579_791 70
672 3300048903 Ga0496100_0412803 Ga0496100_0412803_271_483 70
673 3300048903 Ga0496100_0493441 Ga0496100_0493441_609_821 70
674 3300048903 Ga0496100_0961145 Ga0496100_0961145_300_512 70
675 3300048903 Ga0496100_1049240 Ga0496100_1049240_234_446 70
676 3300048903 Ga0496100_1460154 Ga0496100_1460154_201_413 70
677 3300048903 Ga0496100_1511805 Ga0496100_1511805_232_444 70
678 3300048904 Ga0496101_0202173 Ga0496101_0202173_301_513 70
679 3300048904 Ga0496101_0444105 Ga0496101_0444105_228_440 70
680 3300048904 Ga0496101_1491930 Ga0496101_1491930_286_498 70
681 3300048905 Ga0496102_0052140 Ga0496102_0052140_688_900 70
682 3300048905 Ga0496102_0052826 Ga0496102_0052826_3409_3621 70
683 3300048905 Ga0496102_0185973 Ga0496102_0185973_1434_1646 70
684 3300048905 Ga0496102_0826208 Ga0496102_0826208_341_553 70
685 3300048905 Ga0496102_1502438 Ga0496102_1502438_268_480 70
686 3300048905 Ga0496102_1742552 Ga0496102_1742552_151_363 70
687 3300048906 Ga0496103_0039229 Ga0496103_0039229_1739_1951 70
688 3300048906 Ga0496103_0975345 Ga0496103_0975345_148_360 70
689 3300048907 Ga0496104_0054127 Ga0496104_0054127_1967_2179 70
690 3300048907 Ga0496104_0079813 Ga0496104_0079813_1471_1683 70
691 3300048907 Ga0496104_0158733 Ga0496104_0158733_1888_2100 70
692 3300048907 Ga0496104_0207801 Ga0496104_0207801_1383_1595 70
693 3300048908 Ga0496105_0257134 Ga0496105_0257134_838_1050 70
694 3300048908 Ga0496105_0259689 Ga0496105_0259689_845_1057 70
695 3300048908 Ga0496105_0498419 Ga0496105_0498419_447_659 70
696 3300048909 Ga0496106_0048833 Ga0496106_0048833_443_655 70
697 3300048909 Ga0496106_0347482 Ga0496106_0347482_122_334 70
698 3300048909 Ga0496106_0381492 Ga0496106_0381492_526_738 70
699 3300048910 Ga0496107_0119348 Ga0496107_0119348_377_589 70
700 3300048911 Ga0496108_0051655 Ga0496108_0051655_2819_3031 70
701 3300048911 Ga0496108_0070040 Ga0496108_0070040_213_425 70
702 3300048911 Ga0496108_0131588 Ga0496108_0131588_849_1061 70
703 3300048911 Ga0496108_0886987 Ga0496108_0886987_263_475 70
704 3300048911 Ga0496108_0906256 Ga0496108_0906256_315_527 70
705 3300048912 Ga0496109_0001242 Ga0496109_0001242_17269_17481 70
706 3300048912 Ga0496109_0003405 Ga0496109_0003405_7854_8066 70
707 3300048912 Ga0496109_0107503 Ga0496109_0107503_1598_1810 70
708 3300048912 Ga0496109_0120355 Ga0496109_0120355_1963_2175 70
709 3300048912 Ga0496109_0623628 Ga0496109_0623628_512_724 70
710 3300048912 Ga0496109_0889805 Ga0496109_0889805_88_300 70
711 3300048913 Ga0496110_0062816 Ga0496110_0062816_1744_1956 70
712 3300048913 Ga0496110_0109296 Ga0496110_0109296_2078_2290 70
713 3300048913 Ga0496110_0233956 Ga0496110_0233956_493_705 70
714 3300048913 Ga0496110_0447960 Ga0496110_0447960_411_623 70
715 3300048914 Ga0496111_0052860 Ga0496111_0052860_1282_1494 70
716 3300048914 Ga0496111_0073361 Ga0496111_0073361_1129_1341 70
717 3300048914 Ga0496111_0539897 Ga0496111_0539897_388_600 70
718 3300048915 Ga0496112_0006851 Ga0496112_0006851_2161_2373 70
719 3300048915 Ga0496112_0078121 Ga0496112_0078121_848_1060 70
720 3300048915 Ga0496112_0314680 Ga0496112_0314680_513_725 70
721 3300048915 Ga0496112_0723460 Ga0496112_0723460_254_466 70
722 3300048916 Ga0496113_0002551 Ga0496113_0002551_246_458 70
723 3300048916 Ga0496113_0013682 Ga0496113_0013682_4660_4872 70
724 3300048916 Ga0496113_0127845 Ga0496113_0127845_1408_1620 70
725 3300048916 Ga0496113_0408360 Ga0496113_0408360_733_945 70
726 3300048917 Ga0496114_0775170 Ga0496114_0775170_68_280 70
727 3300048917 Ga0496114_0801337 Ga0496114_0801337_468_680 70
728 3300048917 Ga0496114_1428813 Ga0496114_1428813_231_443 70
729 3300048918 Ga0496115_0072632 Ga0496115_0072632_1324_1536 70
730 3300048918 Ga0496115_0073560 Ga0496115_0073560_869_1081 70
731 3300049520 Ga0501297_015215 Ga0501297_015215_62_274 70
732 3300049521 Ga0501298_061990 Ga0501298_061990_478_690 70
733 3300049521 Ga0501298_154911 Ga0501298_154911_77_289 70
734 3300049522 Ga0501299_050851 Ga0501299_050851_115_333 70
735 3300049522 Ga0501299_106168 Ga0501299_106168_271_483 70
736 3300049568 Ga0501031_0432604 Ga0501031_0432604_622_834 70
737 3300049568 Ga0501031_0981307 Ga0501031_0981307_36_248 70
738 3300049569 Ga0501032_0269097 Ga0501032_0269097_104_316 70
739 3300049569 Ga0501032_0712237 Ga0501032_0712237_171_383 70
740 3300049570 Ga0501033_0282461 Ga0501033_0282461_715_927 70
741 3300049571 Ga0501034_0098585 Ga0501034_0098585_1907_2119 70
742 3300049571 Ga0501034_1077037 Ga0501034_1077037_40_267 70
743 3300049572 Ga0501036_0038651 Ga0501036_0038651_1334_1546 70
744 3300049572 Ga0501036_0072612 Ga0501036_0072612_1582_1794 70
745 3300049573 Ga0501037_0027943 Ga0501037_0027943_1113_1325 70
746 3300049573 Ga0501037_0911485 Ga0501037_0911485_170_382 70
747 3300049574 Ga0501038_0273031 Ga0501038_0273031_667_879 70
748 3300049574 Ga0501038_0397818 Ga0501038_0397818_417_629 70
749 3300049575 Ga0501039_0035222 Ga0501039_0035222_391_603 70
750 3300049575 Ga0501039_0189271 Ga0501039_0189271_328_540 70
751 3300049575 Ga0501039_0292463 Ga0501039_0292463_411_623 70
752 3300049576 Ga0501040_0059954 Ga0501040_0059954_1482_1694 70
753 3300049576 Ga0501040_0064640 Ga0501040_0064640_350_562 70
754 3300049576 Ga0501040_0074660 Ga0501040_0074660_1659_1871 70
755 3300049576 Ga0501040_0088662 Ga0501040_0088662_1491_1703 70
756 3300049576 Ga0501040_0979568 Ga0501040_0979568_133_345 70
757 3300049577 Ga0501041_0091060 Ga0501041_0091060_98_310 70
758 3300049577 Ga0501041_0154953 Ga0501041_0154953_1141_1353 70
759 3300049577 Ga0501041_0211144 Ga0501041_0211144_441_653 70
760 3300049577 Ga0501041_1041839 Ga0501041_1041839_108_320 70
761 3300049578 Ga0501042_0061501 Ga0501042_0061501_1288_1500 70
762 3300049578 Ga0501042_0143165 Ga0501042_0143165_693_905 70
763 3300049579 Ga0501043_0086142 Ga0501043_0086142_1266_1478 70
764 3300049579 Ga0501043_0450759 Ga0501043_0450759_103_315 70
765 3300049580 Ga0501046_0047499 Ga0501046_0047499_1766_1978 70
766 3300049580 Ga0501046_0162965 Ga0501046_0162965_1410_1622 70
767 3300049582 Ga0501048_0007833 Ga0501048_0007833_1611_1823 70
768 3300049582 Ga0501048_0061063 Ga0501048_0061063_2111_2323 70
769 3300049582 Ga0501048_1304254 Ga0501048_1304254_17_244 70
770 3300049583 Ga0501067_0062678 Ga0501067_0062678_1593_1805 70
771 3300049583 Ga0501067_0108088 Ga0501067_0108088_782_994 70
772 3300049583 Ga0501067_0163131 Ga0501067_0163131_942_1154 70
773 3300049583 Ga0501067_0374825 Ga0501067_0374825_522_734 70
774 3300049584 Ga0501068_0031002 Ga0501068_0031002_1735_1947 70
775 3300049584 Ga0501068_0203291 Ga0501068_0203291_478_690 70
776 3300049585 Ga0501069_0026697 Ga0501069_0026697_517_729 70
777 3300049585 Ga0501069_0099027 Ga0501069_0099027_865_1077 70
778 3300049585 Ga0501069_0175717 Ga0501069_0175717_749_961 70
779 3300049585 Ga0501069_0246800 Ga0501069_0246800_480_692 70
780 3300049585 Ga0501069_0477757 Ga0501069_0477757_490_702 70
781 3300049585 Ga0501069_0640522 Ga0501069_0640522_214_429 70
782 3300049585 Ga0501069_0803675 Ga0501069_0803675_67_279 70
783 3300049586 Ga0501070_0049303 Ga0501070_0049303_1668_1883 70
784 3300049586 Ga0501070_0200992 Ga0501070_0200992_805_1020 70
785 3300049586 Ga0501070_0259464 Ga0501070_0259464_802_1014 70
786 3300049587 Ga0501071_0034344 Ga0501071_0034344_1100_1312 70
787 3300049587 Ga0501071_0109977 Ga0501071_0109977_871_1086 70
788 3300049587 Ga0501071_0354735 Ga0501071_0354735_425_637 70
789 3300049587 Ga0501071_0504658 Ga0501071_0504658_142_354 70
790 3300049587 Ga0501071_0668705 Ga0501071_0668705_408_623 70
791 3300049587 Ga0501071_0691332 Ga0501071_0691332_364_576 70
792 3300049588 Ga0501072_0005332 Ga0501072_0005332_7108_7320 70
793 3300049588 Ga0501072_1507383 Ga0501072_1507383_127_339 70
794 3300049589 Ga0501073_0874624 Ga0501073_0874624_354_566 70
795 3300049590 Ga0501074_0145818 Ga0501074_0145818_136_348 70
796 3300049590 Ga0501074_0394104 Ga0501074_0394104_433_648 70
797 3300049591 Ga0501075_0014126 Ga0501075_0014126_3403_3615 70
798 3300049591 Ga0501075_0021140 Ga0501075_0021140_3414_3626 70
799 3300049591 Ga0501075_0323738 Ga0501075_0323738_625_837 70
800 3300049591 Ga0501075_0347590 Ga0501075_0347590_660_872 70
801 3300049591 Ga0501075_0470052 Ga0501075_0470052_451_663 70
802 3300049591 Ga0501075_0780218 Ga0501075_0780218_21_233 70
803 3300049591 Ga0501075_1098476 Ga0501075_1098476_15_230 70
804 3300049591 Ga0501075_1146780 Ga0501075_1146780_33_245 70
805 3300049592 Ga0501076_0017383 Ga0501076_0017383_3446_3658 70
806 3300049592 Ga0501076_0087707 Ga0501076_0087707_970_1182 70
807 3300049592 Ga0501076_0283087 Ga0501076_0283087_947_1159 70
808 3300049593 Ga0501077_0003255 Ga0501077_0003255_6849_7061 70
809 3300049593 Ga0501077_0014505 Ga0501077_0014505_3657_3869 70
810 3300049593 Ga0501077_0251388 Ga0501077_0251388_194_406 70
811 3300049593 Ga0501077_0625642 Ga0501077_0625642_75_287 70
812 3300049661 Ga0501217_038778 Ga0501217_038778_537_755 70
813 3300049661 Ga0501217_291700 Ga0501217_291700_234_446 70
814 3300049669 Ga0501235_086658 Ga0501235_086658_333_551 70
815 3300049672 Ga0501239_001917 Ga0501239_001917_1397_1615 70
816 3300049675 Ga0501243_036411 Ga0501243_036411_284_502 70
817 3300049677 Ga0501247_014660 Ga0501247_014660_192_410 70
818 3300049679 Ga0501249_035276 Ga0501249_035276_22_240 70
819 3300049679 Ga0501249_131926 Ga0501249_131926_300_512 70
820 3300049686 Ga0501257_156004 Ga0501257_156004_335_547 70
821 3300049688 Ga0501259_033321 Ga0501259_033321_580_798 70
822 3300049704 Ga0501221_007695 Ga0501221_007695_405_623 70
823 3300049708 Ga0501245_140449 Ga0501245_140449_123_335 70
824 3300049741 Ga0501079_0016453 Ga0501079_0016453_3825_4037 70
825 3300049741 Ga0501079_0020714 Ga0501079_0020714_323_535 70
826 3300049741 Ga0501079_0229399 Ga0501079_0229399_82_294 70
827 3300049741 Ga0501079_0434835 Ga0501079_0434835_536_751 70
828 3300049741 Ga0501079_0693318 Ga0501079_0693318_506_718 70
829 3300049741 Ga0501079_1482999 Ga0501079_1482999_273_485 70
830 3300049742 Ga0501080_0013648 Ga0501080_0013648_5118_5330 70
831 3300049742 Ga0501080_0076402 Ga0501080_0076402_1883_2095 70
832 3300049742 Ga0501080_0310236 Ga0501080_0310236_113_325 70
833 3300049742 Ga0501080_0312894 Ga0501080_0312894_168_380 70
834 3300049742 Ga0501080_0525577 Ga0501080_0525577_809_1024 70
835 3300049742 Ga0501080_0766467 Ga0501080_0766467_424_639 70
836 3300049742 Ga0501080_1718978 Ga0501080_1718978_200_412 70
837 3300049743 Ga0501081_0004597 Ga0501081_0004597_3294_3506 70
838 3300049743 Ga0501081_0009706 Ga0501081_0009706_5180_5392 70
839 3300049743 Ga0501081_0086278 Ga0501081_0086278_584_796 70
840 3300049743 Ga0501081_0168802 Ga0501081_0168802_179_391 70
841 3300049743 Ga0501081_1285715 Ga0501081_1285715_103_315 70
842 3300049743 Ga0501081_1398547 Ga0501081_1398547_69_296 70
843 3300049744 Ga0501083_0154322 Ga0501083_0154322_1262_1474 70
844 3300049744 Ga0501083_0260450 Ga0501083_0260450_86_298 70
845 3300049744 Ga0501083_0352922 Ga0501083_0352922_412_627 70
846 3300049744 Ga0501083_0633593 Ga0501083_0633593_291_503 70
847 3300049760 Ga0501263_077837 Ga0501263_077837_53_271 70
848 3300049763 Ga0501266_050213 Ga0501266_050213_153_371 70
849 3300049764 Ga0501267_024643 Ga0501267_024643_215_433 70
850 3300049768 Ga0501271_003541 Ga0501271_003541_370_588 70
851 3300049768 Ga0501271_015754 Ga0501271_015754_237_449 70
852 3300049770 Ga0501273_006208 Ga0501273_006208_808_1020 70
853 3300049770 Ga0501273_021568 Ga0501273_021568_224_436 70
854 3300049773 Ga0501276_033015 Ga0501276_033015_213_425 70
855 3300049779 Ga0501283_113780 Ga0501283_113780_53_271 70
856 3300049822 Ga0501035_0063000 Ga0501035_0063000_1379_1591 70
857 3300049822 Ga0501035_0385135 Ga0501035_0385135_748_960 70
858 3300049822 Ga0501035_1201092 Ga0501035_1201092_27_239 70
859 3300049824 Ga0501045_0013479 Ga0501045_0013479_3471_3683 70
860 3300049824 Ga0501045_0029004 Ga0501045_0029004_1831_2043 70
861 3300049824 Ga0501045_0823598 Ga0501045_0823598_381_593 70
862 3300049824 Ga0501045_1378857 Ga0501045_1378857_93_305 70
863 3300050507 nmdc:mga05p37_215368_c1 nmdc:mga05p37_215368_c1_982_1209 70
864 3300050507 nmdc:mga05p37_242812_c1 nmdc:mga05p37_242812_c1_1388_1600 70
865 3300050507 nmdc:mga05p37_280136_c1 nmdc:mga05p37_280136_c1_1147_1374 70
866 3300050507 nmdc:mga05p37_475607_c1 nmdc:mga05p37_475607_c1_604_816 70
867 3300050507 nmdc:mga05p37_6185_c1 nmdc:mga05p37_6185_c1_12354_12566 70
868 3300050507 nmdc:mga05p37_851898_c1 nmdc:mga05p37_851898_c1_24_236 70
869 3300050508 nmdc:mga09592_1031811_c1 nmdc:mga09592_1031811_c1_335_562 70
870 3300050508 nmdc:mga09592_180745_c1 nmdc:mga09592_180745_c1_46_273 70
871 3300050508 nmdc:mga09592_358202_c1 nmdc:mga09592_358202_c1_221_448 70
872 3300050508 nmdc:mga09592_642_c1 nmdc:mga09592_642_c1_19577_19804 70
873 3300050509 nmdc:mga0qj67_153335_c1 nmdc:mga0qj67_153335_c1_1463_1675 70
874 3300050509 nmdc:mga0qj67_339817_c1 nmdc:mga0qj67_339817_c1_277_489 70
875 3300050509 nmdc:mga0qj67_609197_c1 nmdc:mga0qj67_609197_c1_311_523 70
876 3300050510 nmdc:mga06r32_1004102_c1 nmdc:mga06r32_1004102_c1_334_561 70
877 3300050510 nmdc:mga06r32_1521497_c1 nmdc:mga06r32_1521497_c1_281_493 70
878 3300050510 nmdc:mga06r32_23975_c1 nmdc:mga06r32_23975_c1_372_584 70
879 3300050510 nmdc:mga06r32_325469_c1 nmdc:mga06r32_325469_c1_694_906 70
880 3300050510 nmdc:mga06r32_477088_c1 nmdc:mga06r32_477088_c1_745_972 70
881 3300050510 nmdc:mga06r32_65939_c1 nmdc:mga06r32_65939_c1_2220_2447 70
882 3300050510 nmdc:mga06r32_68985_c1 nmdc:mga06r32_68985_c1_1158_1370 70
883 3300050511 nmdc:mga08y16_459686_c1 nmdc:mga08y16_459686_c1_17_229 70
884 3300050511 nmdc:mga08y16_578998_c1 nmdc:mga08y16_578998_c1_692_904 70
885 3300050512 nmdc:mga0n895_1537642_c1 nmdc:mga0n895_1537642_c1_256_468 70
886 3300050512 nmdc:mga0n895_231858_c1 nmdc:mga0n895_231858_c1_1607_1819 70
887 3300050512 nmdc:mga0n895_26043_c1 nmdc:mga0n895_26043_c1_1549_1761 70
888 3300050512 nmdc:mga0n895_516843_c1 nmdc:mga0n895_516843_c1_805_1032 70
889 3300050512 nmdc:mga0n895_606803_c1 nmdc:mga0n895_606803_c1_345_557 70
890 3300050512 nmdc:mga0n895_64679_c1 nmdc:mga0n895_64679_c1_677_889 70
891 3300050513 nmdc:mga0rr50_1206386_c1 nmdc:mga0rr50_1206386_c1_123_335 70
892 3300050513 nmdc:mga0rr50_126087_c1 nmdc:mga0rr50_126087_c1_162_374 70
893 3300050513 nmdc:mga0rr50_1391604_c1 nmdc:mga0rr50_1391604_c1_360_572 70
894 3300050513 nmdc:mga0rr50_396415_c1 nmdc:mga0rr50_396415_c1_708_920 70
895 3300050513 nmdc:mga0rr50_404982_c1 nmdc:mga0rr50_404982_c1_185_397 70
896 3300050513 nmdc:mga0rr50_638951_c1 nmdc:mga0rr50_638951_c1_621_833 70
897 3300050513 nmdc:mga0rr50_919398_c1 nmdc:mga0rr50_919398_c1_289_516 70
898 3300050514 nmdc:mga08x19_147575_c1 nmdc:mga08x19_147575_c1_922_1140 70
899 3300050514 nmdc:mga08x19_149485_c1 nmdc:mga08x19_149485_c1_260_472 70
900 3300050515 nmdc:mga0a205_11780_c1 nmdc:mga0a205_11780_c1_2058_2270 70
901 3300050515 nmdc:mga0a205_227958_c1 nmdc:mga0a205_227958_c1_541_753 70
902 3300050515 nmdc:mga0a205_828517_c1 nmdc:mga0a205_828517_c1_110_322 70
903 3300050515 nmdc:mga0a205_91158_c1 nmdc:mga0a205_91158_c1_1139_1351 70
904 3300054114 Ga0501084_0005089 Ga0501084_0005089_3452_3664 70
905 3300054114 Ga0501084_0071846 Ga0501084_0071846_1714_1926 70
906 3300054114 Ga0501084_0079555 Ga0501084_0079555_1655_1867 70
907 3300054114 Ga0501084_0250675 Ga0501084_0250675_1076_1303 70
908 3300054114 Ga0501084_0360739 Ga0501084_0360739_78_305 70
909 3300054114 Ga0501084_0953780 Ga0501084_0953780_158_385 70
910 3300054114 Ga0501084_1354823 Ga0501084_1354823_73_285 70
911 3300054114 Ga0501084_1446490 Ga0501084_1446490_212_427 70
912 3300059421 Ga0590071_001977 Ga0590071_001977_1679_1891 70
913 3300059421 Ga0590071_008491 Ga0590071_008491_463_675 70
914 3300059423 Ga0590074_007359 Ga0590074_007359_1106_1318 70
915 3300059423 Ga0590074_026919 Ga0590074_026919_606_818 70
916 3300059424 Ga0590075_101918 Ga0590075_101918_66_278 70
917 3300059424 Ga0590075_161870 Ga0590075_161870_170_382 70
918 3300059426 Ga0590077_008465 Ga0590077_008465_1308_1520 70
919 3300059426 Ga0590077_048096 Ga0590077_048096_541_753 70
920 3300059491 Ga0587070_101906 Ga0587070_101906_157_369 70
921 3300059505 Ga0587083_0204840 Ga0587083_0204840_281_493 70
922 3300059630 Ga0587128_138174 Ga0587128_138174_260_472 70
923 3300059647 Ga0587079_195723 Ga0587079_195723_219_431 70
924 3300060344 Ga0587071_040685 Ga0587071_040685_596_808 70
925 3300060353 Ga0501082_0010764 Ga0501082_0010764_3095_3307 70
926 3300060353 Ga0501082_0072769 Ga0501082_0072769_1193_1405 70
927 3300060353 Ga0501082_0083641 Ga0501082_0083641_1211_1423 70
928 3300060353 Ga0501082_1522437 Ga0501082_1522437_156_368 70
929 3300060353 Ga0501082_1836858 Ga0501082_1836858_269_481 70
930 3300061734 Ga0530510_0083729 Ga0530510_0083729_247_459 70
931 3300061734 Ga0530510_0431827 Ga0530510_0431827_455_682 70
932 3300061734 Ga0530510_0647416 Ga0530510_0647416_539_751 70
933 3300061734 Ga0530510_1427460 Ga0530510_1427460_232_444 70

Feature Viewer

pLDDT pTM Quality
71.01 0.36 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map