F486096
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 933 | 330 | 933 | 71 |
Family's Representative Sequence
| Representative Sequence | 3300025935|Ga0207709_11235435|Ga0207709_112354351 |
| Length | 78 |
| Sequence | MRITTPSEVARQAGNKYLGVLVAAKFARYLNEFPKDQLAATGEKLTTQALQSLVEGELNYKLVRRRREKFMRMGQFLE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001228 | Switchgrass rhizosphere microbial communities from Knoxville, Tennessee, USA - 12_joined | Metagenome | Rhizosphere |
| 2 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 3 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 4 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 8 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 9 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 10 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 12 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 15 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 35 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 44 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 52 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 54 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 55 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 56 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 58 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 59 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 60 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 61 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 62 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 63 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 64 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 65 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 66 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 67 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 68 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 69 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 70 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 71 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 72 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 74 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 75 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 76 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 77 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 78 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 79 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 80 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 81 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 83 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 98 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 102 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300027424 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 163 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 164 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 165 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 166 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 167 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 168 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 169 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 170 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 171 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 172 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 173 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 174 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 175 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 176 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 177 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 178 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 179 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 180 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 181 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 182 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 183 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 184 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 185 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 186 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 187 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 188 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 189 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 190 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 191 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 192 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 193 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 194 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 195 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 196 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 197 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 198 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 199 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 200 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 201 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 202 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 203 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 204 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 205 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 206 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 207 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 208 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 209 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 210 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 211 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 212 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 213 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 214 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 215 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 216 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 217 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 218 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 219 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 220 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 221 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 222 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 223 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 224 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 225 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 226 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 227 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 228 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 229 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 230 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 231 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 232 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 233 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 234 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 235 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 244 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 245 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 246 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 247 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 248 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 249 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 250 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 251 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 252 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 253 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 254 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 255 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 256 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 257 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 258 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 259 | 3300049520 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought | Metagenome | Rhizosphere |
| 260 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 261 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 262 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 263 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 264 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 265 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 266 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 267 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 268 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 269 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 270 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 271 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 272 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 273 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 274 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 275 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 276 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 277 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 278 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 279 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 280 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 281 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 282 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 283 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 284 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 285 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 286 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 287 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 288 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 289 | 3300049672 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought | Metagenome | Rhizosphere |
| 290 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 291 | 3300049677 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control | Metagenome | Rhizosphere |
| 292 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 293 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 294 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 295 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 296 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 297 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 298 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 299 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 300 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 301 | 3300049760 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control | Metagenome | Rhizosphere |
| 302 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 303 | 3300049764 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control | Metagenome | Rhizosphere |
| 304 | 3300049768 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought | Metagenome | Rhizosphere |
| 305 | 3300049770 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control | Metagenome | Rhizosphere |
| 306 | 3300049773 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control | Metagenome | Rhizosphere |
| 307 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 308 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 309 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 310 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 311 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 312 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 313 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 314 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 315 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 316 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 317 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 318 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 319 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 320 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 321 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 322 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 323 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 324 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 325 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 326 | 3300059630 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 327 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 328 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 329 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 330 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.25 |
| Metatranscriptomes | 0.75 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 6.54 |
| Rhizosphere | 92.93 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.54 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwM_137927 | 3300001228 | Bacteria | 507 |
| 2 | Ga0058859_10961723 | 3300004798 | Bacteria | 573 |
| 3 | Ga0065712_10587870 | 3300005290 | Bacteria | 597 |
| 4 | Ga0065715_10123810 | 3300005293 | Bacteria | 2169 |
| 5 | Ga0065715_10153903 | 3300005293 | Bacteria | 1698 |
| 6 | Ga0065707_10131282 | 3300005295 | Bacteria | 1915 |
| 7 | Ga0070683_101919182 | 3300005329 | Bacteria | 569 |
| 8 | Ga0070690_100487319 | 3300005330 | Bacteria | 920 |
| 9 | Ga0068869_100639158 | 3300005334 | Unclassified | 902 |
| 10 | Ga0068869_101217913 | 3300005334 | Bacteria | 662 |
| 11 | Ga0070680_100069928 | 3300005336 | Bacteria | 2883 |
| 12 | Ga0070682_100749809 | 3300005337 | Unclassified | 788 |
| 13 | Ga0068868_102285790 | 3300005338 | Unclassified | 516 |
| 14 | Ga0070689_100535557 | 3300005340 | Bacteria | 1007 |
| 15 | Ga0070661_100662681 | 3300005344 | Unclassified | 848 |
| 16 | Ga0070661_100823006 | 3300005344 | Bacteria | 763 |
| 17 | Ga0070661_101572430 | 3300005344 | Bacteria | 556 |
| 18 | Ga0070692_10538256 | 3300005345 | Bacteria | 763 |
| 19 | Ga0070692_10559033 | 3300005345 | Bacteria | 751 |
| 20 | Ga0070668_101846966 | 3300005347 | Unclassified | 556 |
| 21 | Ga0070669_100269000 | 3300005353 | Bacteria | 1362 |
| 22 | Ga0070669_101440420 | 3300005353 | Bacteria | 598 |
| 23 | Ga0070675_100100941 | 3300005354 | Bacteria | 2430 |
| 24 | Ga0070675_100128221 | 3300005354 | Bacteria | 2160 |
| 25 | Ga0070675_100193792 | 3300005354 | Bacteria | 1762 |
| 26 | Ga0070671_100008791 | 3300005355 | Bacteria | 8100 |
| 27 | Ga0070674_100033210 | 3300005356 | Bacteria | 3433 |
| 28 | Ga0070673_100443555 | 3300005364 | Bacteria | 1167 |
| 29 | Ga0070673_100872322 | 3300005364 | Bacteria | 833 |
| 30 | Ga0070659_100105341 | 3300005366 | Bacteria | 2272 |
| 31 | Ga0070659_100803984 | 3300005366 | Unclassified | 818 |
| 32 | Ga0070659_102044092 | 3300005366 | Bacteria | 515 |
| 33 | Ga0070667_101364081 | 3300005367 | Bacteria | 665 |
| 34 | Ga0070667_101656223 | 3300005367 | Bacteria | 602 |
| 35 | Ga0070709_10304699 | 3300005434 | Unclassified | 1164 |
| 36 | Ga0070709_10395101 | 3300005434 | Bacteria | 1031 |
| 37 | Ga0070709_10416270 | 3300005434 | Unclassified | 1006 |
| 38 | Ga0070714_101767443 | 3300005435 | Bacteria | 604 |
| 39 | Ga0070710_10386282 | 3300005437 | Bacteria | 935 |
| 40 | Ga0070711_101728939 | 3300005439 | Bacteria | 548 |
| 41 | Ga0070705_100018256 | 3300005440 | Bacteria | 3675 |
| 42 | Ga0070705_100117496 | 3300005440 | Bacteria | 1711 |
| 43 | Ga0070705_100164227 | 3300005440 | Bacteria | 1488 |
| 44 | Ga0070705_100187775 | 3300005440 | Bacteria | 1406 |
| 45 | Ga0070705_100314584 | 3300005440 | Bacteria | 1128 |
| 46 | Ga0070705_100696077 | 3300005440 | Unclassified | 798 |
| 47 | Ga0070694_100015093 | 3300005444 | Bacteria | 4843 |
| 48 | Ga0070694_100087534 | 3300005444 | Bacteria | 2179 |
| 49 | Ga0070694_100093845 | 3300005444 | Bacteria | 2110 |
| 50 | Ga0070694_100186044 | 3300005444 | Bacteria | 1539 |
| 51 | Ga0070694_100755738 | 3300005444 | Unclassified | 794 |
| 52 | Ga0070694_101879420 | 3300005444 | Bacteria | 511 |
| 53 | Ga0070708_100049447 | 3300005445 | Bacteria | 3720 |
| 54 | Ga0070708_100065163 | 3300005445 | Bacteria | 3266 |
| 55 | Ga0070708_100530042 | 3300005445 | Bacteria | 1111 |
| 56 | Ga0070708_100561300 | 3300005445 | Bacteria | 1076 |
| 57 | Ga0070708_100579219 | 3300005445 | Bacteria | 1058 |
| 58 | Ga0070708_100652480 | 3300005445 | Bacteria | 991 |
| 59 | Ga0070708_100765511 | 3300005445 | Unclassified | 908 |
| 60 | Ga0070708_100780906 | 3300005445 | Bacteria | 898 |
| 61 | Ga0070708_101116976 | 3300005445 | Bacteria | 738 |
| 62 | Ga0070708_101584813 | 3300005445 | Unclassified | 610 |
| 63 | Ga0070708_102021728 | 3300005445 | Unclassified | 533 |
| 64 | Ga0070663_101162312 | 3300005455 | Unclassified | 677 |
| 65 | Ga0070663_101420644 | 3300005455 | Bacteria | 615 |
| 66 | Ga0070663_101904310 | 3300005455 | Unclassified | 534 |
| 67 | Ga0070663_102109267 | 3300005455 | Bacteria | 508 |
| 68 | Ga0070678_100473367 | 3300005456 | Bacteria | 1101 |
| 69 | Ga0070678_100709556 | 3300005456 | Unclassified | 907 |
| 70 | Ga0070662_100054765 | 3300005457 | Bacteria | 2891 |
| 71 | Ga0070662_100182576 | 3300005457 | Bacteria | 1655 |
| 72 | Ga0070662_100877038 | 3300005457 | Bacteria | 765 |
| 73 | Ga0070681_10022957 | 3300005458 | Bacteria | 6269 |
| 74 | Ga0070681_10027906 | 3300005458 | Bacteria | 5674 |
| 75 | Ga0070681_10529563 | 3300005458 | Bacteria | 1092 |
| 76 | Ga0070681_10599775 | 3300005458 | Bacteria | 1016 |
| 77 | Ga0070681_10971166 | 3300005458 | Bacteria | 769 |
| 78 | Ga0068867_100019527 | 3300005459 | Bacteria | 4829 |
| 79 | Ga0068867_100483907 | 3300005459 | Bacteria | 1061 |
| 80 | Ga0068867_100556872 | 3300005459 | Bacteria | 994 |
| 81 | Ga0068867_101832383 | 3300005459 | Bacteria | 571 |
| 82 | Ga0070685_10696834 | 3300005466 | Bacteria | 740 |
| 83 | Ga0070706_100009183 | 3300005467 | Bacteria | 9206 |
| 84 | Ga0070706_100093815 | 3300005467 | Bacteria | 2785 |
| 85 | Ga0070706_100783954 | 3300005467 | Bacteria | 883 |
| 86 | Ga0070706_101710122 | 3300005467 | Bacteria | 573 |
| 87 | Ga0070707_100002150 | 3300005468 | Bacteria | 18872 |
| 88 | Ga0070707_100029350 | 3300005468 | Bacteria | 5237 |
| 89 | Ga0070707_100096466 | 3300005468 | Bacteria | 2864 |
| 90 | Ga0070707_100187680 | 3300005468 | Bacteria | 2015 |
| 91 | Ga0070707_100327777 | 3300005468 | Bacteria | 1488 |
| 92 | Ga0070707_100357994 | 3300005468 | Bacteria | 1417 |
| 93 | Ga0070707_100450350 | 3300005468 | Bacteria | 1248 |
| 94 | Ga0070707_100507663 | 3300005468 | Bacteria | 1167 |
| 95 | Ga0070698_100003276 | 3300005471 | Bacteria | 17787 |
| 96 | Ga0070698_100007458 | 3300005471 | Bacteria | 11830 |
| 97 | Ga0070698_100015455 | 3300005471 | Bacteria | 8065 |
| 98 | Ga0070698_100270152 | 3300005471 | Bacteria | 1632 |
| 99 | Ga0070698_100353707 | 3300005471 | Bacteria | 1401 |
| 100 | Ga0070698_100488468 | 3300005471 | Unclassified | 1169 |
| 101 | Ga0070698_101719136 | 3300005471 | Bacteria | 580 |
| 102 | Ga0070699_100002133 | 3300005518 | Bacteria | 17937 |
| 103 | Ga0070699_100005989 | 3300005518 | Bacteria | 10628 |
| 104 | Ga0070699_100007511 | 3300005518 | Bacteria | 9480 |
| 105 | Ga0070699_100017837 | 3300005518 | Bacteria | 6095 |
| 106 | Ga0070699_100028112 | 3300005518 | Bacteria | 4850 |
| 107 | Ga0070699_100077326 | 3300005518 | Bacteria | 2897 |
| 108 | Ga0070699_100160149 | 3300005518 | Bacteria | 1992 |
| 109 | Ga0070699_100181645 | 3300005518 | Bacteria | 1867 |
| 110 | Ga0070699_100234006 | 3300005518 | Bacteria | 1638 |
| 111 | Ga0070699_102076596 | 3300005518 | Bacteria | 519 |
| 112 | Ga0070699_102172857 | 3300005518 | Unclassified | 506 |
| 113 | Ga0070679_100021440 | 3300005530 | Bacteria | 6308 |
| 114 | Ga0070679_100027542 | 3300005530 | Bacteria | 5594 |
| 115 | Ga0070679_101901992 | 3300005530 | Unclassified | 544 |
| 116 | Ga0070684_100317929 | 3300005535 | Bacteria | 1430 |
| 117 | Ga0070684_101094225 | 3300005535 | Bacteria | 749 |
| 118 | Ga0070697_100006203 | 3300005536 | Bacteria | 9253 |
| 119 | Ga0070697_100163462 | 3300005536 | Unclassified | 1881 |
| 120 | Ga0070697_100250111 | 3300005536 | Bacteria | 1515 |
| 121 | Ga0070697_100336674 | 3300005536 | Bacteria | 1302 |
| 122 | Ga0070697_100471476 | 3300005536 | Unclassified | 1095 |
| 123 | Ga0070697_100562967 | 3300005536 | Unclassified | 1000 |
| 124 | Ga0070697_100568784 | 3300005536 | Unclassified | 995 |
| 125 | Ga0070697_100620052 | 3300005536 | Bacteria | 951 |
| 126 | Ga0070697_100691209 | 3300005536 | Unclassified | 900 |
| 127 | Ga0070697_101647534 | 3300005536 | Unclassified | 574 |
| 128 | Ga0068853_101307303 | 3300005539 | Unclassified | 701 |
| 129 | Ga0070672_100092075 | 3300005543 | Bacteria | 2447 |
| 130 | Ga0070672_101474129 | 3300005543 | Bacteria | 609 |
| 131 | Ga0070686_100335764 | 3300005544 | Bacteria | 1131 |
| 132 | Ga0070695_100014271 | 3300005545 | Bacteria | 4789 |
| 133 | Ga0070695_100124557 | 3300005545 | Bacteria | 1768 |
| 134 | Ga0070695_100348395 | 3300005545 | Bacteria | 1109 |
| 135 | Ga0070695_100494358 | 3300005545 | Bacteria | 945 |
| 136 | Ga0070696_100000865 | 3300005546 | Bacteria | 19565 |
| 137 | Ga0070696_100005546 | 3300005546 | Bacteria | 8425 |
| 138 | Ga0070696_100052367 | 3300005546 | Bacteria | 2840 |
| 139 | Ga0070696_100081411 | 3300005546 | Bacteria | 2294 |
| 140 | Ga0070696_100100927 | 3300005546 | Bacteria | 2068 |
| 141 | Ga0070696_100128402 | 3300005546 | Bacteria | 1842 |
| 142 | Ga0070696_100322469 | 3300005546 | Bacteria | 1189 |
| 143 | Ga0070696_100354374 | 3300005546 | Bacteria | 1137 |
| 144 | Ga0070696_100812935 | 3300005546 | Bacteria | 770 |
| 145 | Ga0070696_100846174 | 3300005546 | Bacteria | 756 |
| 146 | Ga0070696_100949815 | 3300005546 | Unclassified | 716 |
| 147 | Ga0070696_101131312 | 3300005546 | Bacteria | 659 |
| 148 | Ga0070696_101314476 | 3300005546 | Bacteria | 614 |
| 149 | Ga0070693_100031072 | 3300005547 | Bacteria | 2925 |
| 150 | Ga0070693_100074516 | 3300005547 | Bacteria | 2008 |
| 151 | Ga0070693_100173961 | 3300005547 | Unclassified | 1381 |
| 152 | Ga0070665_100407848 | 3300005548 | Bacteria | 1367 |
| 153 | Ga0070665_100845184 | 3300005548 | Bacteria | 928 |
| 154 | Ga0070704_100001871 | 3300005549 | Bacteria | 11601 |
| 155 | Ga0070704_100067181 | 3300005549 | Bacteria | 2588 |
| 156 | Ga0070704_100148146 | 3300005549 | Bacteria | 1842 |
| 157 | Ga0070704_100678410 | 3300005549 | Bacteria | 912 |
| 158 | Ga0070704_101261794 | 3300005549 | Bacteria | 675 |
| 159 | Ga0070704_101418980 | 3300005549 | Bacteria | 637 |
| 160 | Ga0068855_100826175 | 3300005563 | Bacteria | 983 |
| 161 | Ga0070664_100096840 | 3300005564 | Bacteria | 2561 |
| 162 | Ga0070664_100925678 | 3300005564 | Bacteria | 818 |
| 163 | Ga0068857_101145760 | 3300005577 | Bacteria | 752 |
| 164 | Ga0068854_100638193 | 3300005578 | Bacteria | 913 |
| 165 | Ga0068854_101194771 | 3300005578 | Unclassified | 681 |
| 166 | Ga0068856_101300785 | 3300005614 | Bacteria | 742 |
| 167 | Ga0070702_100180507 | 3300005615 | Bacteria | 1381 |
| 168 | Ga0068852_100600131 | 3300005616 | Bacteria | 1105 |
| 169 | Ga0068852_101633140 | 3300005616 | Bacteria | 667 |
| 170 | Ga0068859_100053225 | 3300005617 | Unclassified | 4071 |
| 171 | Ga0068859_100109269 | 3300005617 | Bacteria | 2826 |
| 172 | Ga0068859_100188772 | 3300005617 | Bacteria | 2145 |
| 173 | Ga0068859_100663057 | 3300005617 | Unclassified | 1135 |
| 174 | Ga0068859_102668663 | 3300005617 | Bacteria | 549 |
| 175 | Ga0068864_100044368 | 3300005618 | Unclassified | 3810 |
| 176 | Ga0068864_100553708 | 3300005618 | Bacteria | 1112 |
| 177 | Ga0068864_100610233 | 3300005618 | Unclassified | 1059 |
| 178 | Ga0068864_100620167 | 3300005618 | Bacteria | 1051 |
| 179 | Ga0068864_100647103 | 3300005618 | Bacteria | 1029 |
| 180 | Ga0068864_100882891 | 3300005618 | Unclassified | 882 |
| 181 | Ga0068866_10032052 | 3300005718 | Unclassified | 2538 |
| 182 | Ga0068861_101494877 | 3300005719 | Bacteria | 662 |
| 183 | Ga0068861_102439840 | 3300005719 | Bacteria | 526 |
| 184 | Ga0068851_10455630 | 3300005834 | Bacteria | 761 |
| 185 | Ga0068870_10561569 | 3300005840 | Bacteria | 770 |
| 186 | Ga0068870_10582049 | 3300005840 | Bacteria | 758 |
| 187 | Ga0068870_10693508 | 3300005840 | Bacteria | 702 |
| 188 | Ga0068863_100011280 | 3300005841 | Bacteria | 8657 |
| 189 | Ga0068863_100960439 | 3300005841 | Bacteria | 856 |
| 190 | Ga0068863_101199778 | 3300005841 | Bacteria | 765 |
| 191 | Ga0068863_102450612 | 3300005841 | Bacteria | 531 |
| 192 | Ga0068858_100657775 | 3300005842 | Bacteria | 1018 |
| 193 | Ga0068858_101382130 | 3300005842 | Unclassified | 693 |
| 194 | Ga0068862_100220504 | 3300005844 | Bacteria | 1717 |
| 195 | Ga0068862_100518549 | 3300005844 | Unclassified | 1134 |
| 196 | Ga0068862_100903982 | 3300005844 | Bacteria | 868 |
| 197 | Ga0068862_101007983 | 3300005844 | Bacteria | 824 |
| 198 | Ga0068862_101077074 | 3300005844 | Bacteria | 798 |
| 199 | Ga0068862_101425032 | 3300005844 | Bacteria | 697 |
| 200 | Ga0081455_10080975 | 3300005937 | Unclassified | 2660 |
| 201 | Ga0081538_10046524 | 3300005981 | Bacteria | 2674 |
| 202 | Ga0070715_10098934 | 3300006163 | Bacteria | 1357 |
| 203 | Ga0070715_10479031 | 3300006163 | Bacteria | 708 |
| 204 | Ga0070716_100249063 | 3300006173 | Bacteria | 1209 |
| 205 | Ga0070716_101420647 | 3300006173 | Bacteria | 565 |
| 206 | Ga0070716_101543766 | 3300006173 | Bacteria | 544 |
| 207 | Ga0070712_100047991 | 3300006175 | Bacteria | 2958 |
| 208 | Ga0097621_100953546 | 3300006237 | Bacteria | 801 |
| 209 | Ga0068871_102264105 | 3300006358 | Unclassified | 518 |
| 210 | Ga0075428_100006932 | 3300006844 | Bacteria | 12584 |
| 211 | Ga0075428_100058586 | 3300006844 | Unclassified | 4217 |
| 212 | Ga0075428_100381825 | 3300006844 | Bacteria | 1510 |
| 213 | Ga0075428_101389275 | 3300006844 | Bacteria | 737 |
| 214 | Ga0075428_101755781 | 3300006844 | Bacteria | 647 |
| 215 | Ga0075428_101777500 | 3300006844 | Bacteria | 642 |
| 216 | Ga0075430_100092716 | 3300006846 | Bacteria | 2525 |
| 217 | Ga0075430_100354452 | 3300006846 | Unclassified | 1211 |
| 218 | Ga0075430_100637014 | 3300006846 | Bacteria | 879 |
| 219 | Ga0075430_100690207 | 3300006846 | Bacteria | 841 |
| 220 | Ga0075430_101147872 | 3300006846 | Bacteria | 640 |
| 221 | Ga0075431_100026669 | 3300006847 | Bacteria | 5927 |
| 222 | Ga0075431_100047894 | 3300006847 | Bacteria | 4408 |
| 223 | Ga0075431_100081818 | 3300006847 | Bacteria | 3334 |
| 224 | Ga0075431_100230767 | 3300006847 | Bacteria | 1886 |
| 225 | Ga0075431_100278802 | 3300006847 | Bacteria | 1693 |
| 226 | Ga0075431_100292081 | 3300006847 | Bacteria | 1649 |
| 227 | Ga0075431_100604564 | 3300006847 | Unclassified | 1080 |
| 228 | Ga0075431_100647237 | 3300006847 | Unclassified | 1038 |
| 229 | Ga0075431_102101238 | 3300006847 | Bacteria | 520 |
| 230 | Ga0075433_10006922 | 3300006852 | Bacteria | 8983 |
| 231 | Ga0075433_10076342 | 3300006852 | Unclassified | 2950 |
| 232 | Ga0075433_10170726 | 3300006852 | Bacteria | 1935 |
| 233 | Ga0075433_10241728 | 3300006852 | Bacteria | 1603 |
| 234 | Ga0075433_11068583 | 3300006852 | Bacteria | 702 |
| 235 | Ga0075433_11170367 | 3300006852 | Bacteria | 668 |
| 236 | Ga0075433_11503054 | 3300006852 | Bacteria | 582 |
| 237 | Ga0075434_100005726 | 3300006871 | Bacteria | 11341 |
| 238 | Ga0075434_100114353 | 3300006871 | Unclassified | 2711 |
| 239 | Ga0075434_100383905 | 3300006871 | Bacteria | 1425 |
| 240 | Ga0075434_100504379 | 3300006871 | Bacteria | 1231 |
| 241 | Ga0075434_100736903 | 3300006871 | Bacteria | 1003 |
| 242 | Ga0075434_101321233 | 3300006871 | Bacteria | 732 |
| 243 | Ga0075429_100000623 | 3300006880 | Bacteria | 27314 |
| 244 | Ga0075429_100318249 | 3300006880 | Unclassified | 1362 |
| 245 | Ga0075429_100593075 | 3300006880 | Bacteria | 971 |
| 246 | Ga0075429_100798229 | 3300006880 | Bacteria | 827 |
| 247 | Ga0075429_100948945 | 3300006880 | Bacteria | 752 |
| 248 | Ga0075429_101969872 | 3300006880 | Bacteria | 506 |
| 249 | Ga0075436_100043895 | 3300006914 | Bacteria | 3082 |
| 250 | Ga0075436_100176983 | 3300006914 | Bacteria | 1507 |
| 251 | Ga0075436_100184775 | 3300006914 | Bacteria | 1474 |
| 252 | Ga0075436_100231115 | 3300006914 | Bacteria | 1314 |
| 253 | Ga0097620_100053224 | 3300006931 | Unclassified | 4071 |
| 254 | Ga0097620_100109269 | 3300006931 | Bacteria | 2826 |
| 255 | Ga0097620_100188778 | 3300006931 | Bacteria | 2145 |
| 256 | Ga0097620_100663014 | 3300006931 | Unclassified | 1135 |
| 257 | Ga0097620_102669440 | 3300006931 | Bacteria | 549 |
| 258 | Ga0075435_100024954 | 3300007076 | Bacteria | 4648 |
| 259 | Ga0075435_100406113 | 3300007076 | Bacteria | 1172 |
| 260 | Ga0075435_100533266 | 3300007076 | Bacteria | 1016 |
| 261 | Ga0075435_100634926 | 3300007076 | Bacteria | 927 |
| 262 | Ga0075435_100643050 | 3300007076 | Bacteria | 920 |
| 263 | Ga0075435_100693939 | 3300007076 | Unclassified | 885 |
| 264 | Ga0075435_100959981 | 3300007076 | Bacteria | 746 |
| 265 | Ga0075435_101474367 | 3300007076 | Bacteria | 596 |
| 266 | Ga0075435_101734584 | 3300007076 | Unclassified | 548 |
| 267 | Ga0111539_10581234 | 3300009094 | Unclassified | 1305 |
| 268 | Ga0111539_10618327 | 3300009094 | Bacteria | 1262 |
| 269 | Ga0111539_10855312 | 3300009094 | Bacteria | 1058 |
| 270 | Ga0111539_11183076 | 3300009094 | Bacteria | 888 |
| 271 | Ga0114129_10000112 | 3300009147 | Bacteria | 80956 |
| 272 | Ga0114129_10086755 | 3300009147 | Bacteria | 4340 |
| 273 | Ga0114129_10129099 | 3300009147 | Bacteria | 3474 |
| 274 | Ga0114129_10293880 | 3300009147 | Unclassified | 2167 |
| 275 | Ga0114129_10433001 | 3300009147 | Bacteria | 1728 |
| 276 | Ga0114129_10515241 | 3300009147 | Bacteria | 1560 |
| 277 | Ga0114129_11512801 | 3300009147 | Bacteria | 824 |
| 278 | Ga0105243_10724450 | 3300009148 | Unclassified | 972 |
| 279 | Ga0105243_11613171 | 3300009148 | Unclassified | 676 |
| 280 | Ga0105243_12617250 | 3300009148 | Bacteria | 544 |
| 281 | Ga0105243_13077009 | 3300009148 | Unclassified | 505 |
| 282 | Ga0105241_10654456 | 3300009174 | Bacteria | 954 |
| 283 | Ga0105248_10913795 | 3300009177 | Bacteria | 991 |
| 284 | Ga0105248_11174520 | 3300009177 | Bacteria | 868 |
| 285 | Ga0105248_12657162 | 3300009177 | Bacteria | 571 |
| 286 | Ga0105237_10418652 | 3300009545 | Bacteria | 1345 |
| 287 | Ga0105238_11999119 | 3300009551 | Bacteria | 613 |
| 288 | Ga0105249_10202415 | 3300009553 | Bacteria | 1944 |
| 289 | Ga0105249_10882978 | 3300009553 | Bacteria | 961 |
| 290 | Ga0105249_10972564 | 3300009553 | Bacteria | 917 |
| 291 | Ga0105249_12950528 | 3300009553 | Bacteria | 546 |
| 292 | Ga0105239_10005218 | 3300010375 | Bacteria | 15292 |
| 293 | Ga0105239_10992321 | 3300010375 | Bacteria | 965 |
| 294 | Ga0105246_10364215 | 3300011119 | Bacteria | 1189 |
| 295 | Ga0163162_12561906 | 3300013306 | Unclassified | 587 |
| 296 | Ga0157375_11037934 | 3300013308 | Bacteria | 958 |
| 297 | Ga0163163_10005758 | 3300014325 | Bacteria | 10761 |
| 298 | Ga0163163_10246663 | 3300014325 | Bacteria | 1836 |
| 299 | Ga0163163_10893560 | 3300014325 | Bacteria | 952 |
| 300 | Ga0163163_10933766 | 3300014325 | Bacteria | 931 |
| 301 | Ga0163163_11085161 | 3300014325 | Bacteria | 863 |
| 302 | Ga0157380_12109684 | 3300014326 | Bacteria | 627 |
| 303 | Ga0157380_12526838 | 3300014326 | Bacteria | 579 |
| 304 | Ga0157380_12797457 | 3300014326 | Unclassified | 554 |
| 305 | Ga0157380_13411834 | 3300014326 | Unclassified | 508 |
| 306 | Ga0182008_10378723 | 3300014497 | Bacteria | 756 |
| 307 | Ga0182008_10600299 | 3300014497 | Bacteria | 618 |
| 308 | Ga0157379_10118199 | 3300014968 | Bacteria | 2384 |
| 309 | Ga0157379_11546043 | 3300014968 | Unclassified | 646 |
| 310 | Ga0157376_11212478 | 3300014969 | Unclassified | 783 |
| 311 | Ga0157376_11425479 | 3300014969 | Unclassified | 725 |
| 312 | Ga0163161_11150635 | 3300017792 | Bacteria | 669 |
| 313 | Ga0213876_10524693 | 3300021384 | Bacteria | 630 |
| 314 | Ga0207656_10228544 | 3300025321 | Bacteria | 906 |
| 315 | Ga0207682_10038523 | 3300025893 | Bacteria | 1940 |
| 316 | Ga0207692_10343998 | 3300025898 | Bacteria | 918 |
| 317 | Ga0207642_10866470 | 3300025899 | Bacteria | 577 |
| 318 | Ga0207688_10440822 | 3300025901 | Bacteria | 811 |
| 319 | Ga0207688_10495040 | 3300025901 | Unclassified | 765 |
| 320 | Ga0207685_10363688 | 3300025905 | Bacteria | 733 |
| 321 | Ga0207685_10388143 | 3300025905 | Bacteria | 713 |
| 322 | Ga0207699_10306992 | 3300025906 | Bacteria | 1109 |
| 323 | Ga0207699_10344016 | 3300025906 | Bacteria | 1051 |
| 324 | Ga0207699_10613428 | 3300025906 | Bacteria | 793 |
| 325 | Ga0207643_10456991 | 3300025908 | Bacteria | 813 |
| 326 | Ga0207684_10034088 | 3300025910 | Bacteria | 4327 |
| 327 | Ga0207684_10123849 | 3300025910 | Bacteria | 2217 |
| 328 | Ga0207684_10970023 | 3300025910 | Unclassified | 712 |
| 329 | Ga0207654_11414554 | 3300025911 | Bacteria | 507 |
| 330 | Ga0207707_10000702 | 3300025912 | Bacteria | 33259 |
| 331 | Ga0207707_10051069 | 3300025912 | Bacteria | 3600 |
| 332 | Ga0207707_10648027 | 3300025912 | Unclassified | 890 |
| 333 | Ga0207671_10435374 | 3300025914 | Bacteria | 1044 |
| 334 | Ga0207660_10005346 | 3300025917 | Bacteria | 8343 |
| 335 | Ga0207660_10066197 | 3300025917 | Bacteria | 2613 |
| 336 | Ga0207660_10156626 | 3300025917 | Bacteria | 1754 |
| 337 | Ga0207649_10725055 | 3300025920 | Bacteria | 772 |
| 338 | Ga0207652_10002232 | 3300025921 | Bacteria | 16521 |
| 339 | Ga0207652_10127325 | 3300025921 | Bacteria | 2269 |
| 340 | Ga0207652_10174235 | 3300025921 | Unclassified | 1931 |
| 341 | Ga0207652_11792338 | 3300025921 | Bacteria | 519 |
| 342 | Ga0207646_10022200 | 3300025922 | Bacteria | 5851 |
| 343 | Ga0207646_10039361 | 3300025922 | Bacteria | 4256 |
| 344 | Ga0207646_10080269 | 3300025922 | Bacteria | 2917 |
| 345 | Ga0207646_10711592 | 3300025922 | Unclassified | 898 |
| 346 | Ga0207646_11157793 | 3300025922 | Unclassified | 679 |
| 347 | Ga0207646_11878428 | 3300025922 | Unclassified | 511 |
| 348 | Ga0207681_10319809 | 3300025923 | Bacteria | 1234 |
| 349 | Ga0207681_10710834 | 3300025923 | Unclassified | 836 |
| 350 | Ga0207650_10510716 | 3300025925 | Bacteria | 1005 |
| 351 | Ga0207650_11843326 | 3300025925 | Bacteria | 511 |
| 352 | Ga0207659_10140505 | 3300025926 | Bacteria | 1874 |
| 353 | Ga0207659_10438377 | 3300025926 | Bacteria | 1098 |
| 354 | Ga0207659_10664298 | 3300025926 | Unclassified | 891 |
| 355 | Ga0207659_10821271 | 3300025926 | Bacteria | 799 |
| 356 | Ga0207664_11692677 | 3300025929 | Bacteria | 555 |
| 357 | Ga0207644_10004008 | 3300025931 | Bacteria | 9559 |
| 358 | Ga0207690_10432744 | 3300025932 | Unclassified | 1054 |
| 359 | Ga0207706_10088271 | 3300025933 | Unclassified | 2726 |
| 360 | Ga0207706_10089638 | 3300025933 | Bacteria | 2704 |
| 361 | Ga0207706_10806839 | 3300025933 | Bacteria | 797 |
| 362 | Ga0207706_10880555 | 3300025933 | Unclassified | 757 |
| 363 | Ga0207706_11039227 | 3300025933 | Unclassified | 687 |
| 364 | Ga0207709_11235435 | 3300025935 | Bacteria | 616 |
| 365 | Ga0207709_11582118 | 3300025935 | Unclassified | 544 |
| 366 | Ga0207670_10126412 | 3300025936 | Bacteria | 1866 |
| 367 | Ga0207669_10896170 | 3300025937 | Bacteria | 741 |
| 368 | Ga0207704_10367148 | 3300025938 | Bacteria | 1126 |
| 369 | Ga0207665_10621177 | 3300025939 | Bacteria | 845 |
| 370 | Ga0207665_10904169 | 3300025939 | Unclassified | 700 |
| 371 | Ga0207691_10016924 | 3300025940 | Bacteria | 6917 |
| 372 | Ga0207691_10200185 | 3300025940 | Bacteria | 1739 |
| 373 | Ga0207691_10853619 | 3300025940 | Bacteria | 763 |
| 374 | Ga0207691_11410739 | 3300025940 | Bacteria | 572 |
| 375 | Ga0207711_10154690 | 3300025941 | Bacteria | 2072 |
| 376 | Ga0207711_10708476 | 3300025941 | Bacteria | 939 |
| 377 | Ga0207711_10957509 | 3300025941 | Unclassified | 795 |
| 378 | Ga0207711_11765615 | 3300025941 | Bacteria | 562 |
| 379 | Ga0207689_10544173 | 3300025942 | Bacteria | 975 |
| 380 | Ga0207661_10101253 | 3300025944 | Bacteria | 2420 |
| 381 | Ga0207661_11130502 | 3300025944 | Bacteria | 721 |
| 382 | Ga0207679_10132968 | 3300025945 | Bacteria | 1999 |
| 383 | Ga0207679_10184201 | 3300025945 | Bacteria | 1730 |
| 384 | Ga0207679_10274785 | 3300025945 | Bacteria | 1442 |
| 385 | Ga0207679_10835659 | 3300025945 | Unclassified | 841 |
| 386 | Ga0207679_11249540 | 3300025945 | Bacteria | 682 |
| 387 | Ga0207651_10165925 | 3300025960 | Bacteria | 1736 |
| 388 | Ga0207651_10512051 | 3300025960 | Bacteria | 1039 |
| 389 | Ga0207712_10546134 | 3300025961 | Bacteria | 996 |
| 390 | Ga0207712_10810564 | 3300025961 | Bacteria | 823 |
| 391 | Ga0207712_12122183 | 3300025961 | Bacteria | 503 |
| 392 | Ga0207668_10015126 | 3300025972 | Bacteria | 4789 |
| 393 | Ga0207668_11301932 | 3300025972 | Bacteria | 654 |
| 394 | Ga0207668_12023245 | 3300025972 | Bacteria | 519 |
| 395 | Ga0207640_10728719 | 3300025981 | Bacteria | 853 |
| 396 | Ga0207658_10242463 | 3300025986 | Bacteria | 1528 |
| 397 | Ga0207658_11929462 | 3300025986 | Bacteria | 538 |
| 398 | Ga0207677_10886241 | 3300026023 | Bacteria | 804 |
| 399 | Ga0207677_11360798 | 3300026023 | Unclassified | 653 |
| 400 | Ga0207703_10247313 | 3300026035 | Bacteria | 1606 |
| 401 | Ga0207703_11096166 | 3300026035 | Bacteria | 765 |
| 402 | Ga0207639_11820483 | 3300026041 | Bacteria | 569 |
| 403 | Ga0207678_10248116 | 3300026067 | Bacteria | 1524 |
| 404 | Ga0207678_10478596 | 3300026067 | Bacteria | 1084 |
| 405 | Ga0207708_10079069 | 3300026075 | Bacteria | 2526 |
| 406 | Ga0207708_10838539 | 3300026075 | Bacteria | 793 |
| 407 | Ga0207702_11583342 | 3300026078 | Bacteria | 648 |
| 408 | Ga0207641_10038713 | 3300026088 | Bacteria | 3987 |
| 409 | Ga0207641_10067260 | 3300026088 | Unclassified | 3069 |
| 410 | Ga0207641_10898826 | 3300026088 | Bacteria | 879 |
| 411 | Ga0207641_12294307 | 3300026088 | Bacteria | 539 |
| 412 | Ga0207648_10093302 | 3300026089 | Bacteria | 2632 |
| 413 | Ga0207648_10114838 | 3300026089 | Bacteria | 2366 |
| 414 | Ga0207648_10645401 | 3300026089 | Bacteria | 978 |
| 415 | Ga0207676_10174486 | 3300026095 | Bacteria | 1876 |
| 416 | Ga0207676_10607718 | 3300026095 | Bacteria | 1051 |
| 417 | Ga0207676_10718672 | 3300026095 | Bacteria | 969 |
| 418 | Ga0207676_10820683 | 3300026095 | Bacteria | 908 |
| 419 | Ga0207674_10807843 | 3300026116 | Unclassified | 905 |
| 420 | Ga0207674_11555966 | 3300026116 | Bacteria | 630 |
| 421 | Ga0207675_100500015 | 3300026118 | Bacteria | 1210 |
| 422 | Ga0207675_100993439 | 3300026118 | Bacteria | 857 |
| 423 | Ga0207675_100999672 | 3300026118 | Bacteria | 855 |
| 424 | Ga0207675_101687567 | 3300026118 | Bacteria | 653 |
| 425 | Ga0207675_102592228 | 3300026118 | Unclassified | 517 |
| 426 | Ga0207683_10768000 | 3300026121 | Unclassified | 894 |
| 427 | Ga0207698_11049818 | 3300026142 | Bacteria | 826 |
| 428 | Ga0209967_1063523 | 3300027364 | Bacteria | 574 |
| 429 | Ga0209984_1050418 | 3300027424 | Bacteria | 608 |
| 430 | Ga0209982_1091304 | 3300027552 | Unclassified | 505 |
| 431 | Ga0209971_1024024 | 3300027682 | Unclassified | 1455 |
| 432 | Ga0209971_1026490 | 3300027682 | Bacteria | 1386 |
| 433 | Ga0209971_1125827 | 3300027682 | Bacteria | 631 |
| 434 | Ga0209998_10128984 | 3300027717 | Bacteria | 641 |
| 435 | Ga0209974_10010987 | 3300027876 | Bacteria | 3047 |
| 436 | Ga0209974_10059094 | 3300027876 | Bacteria | 1296 |
| 437 | Ga0268266_10370808 | 3300028379 | Bacteria | 1348 |
| 438 | Ga0268265_11032208 | 3300028380 | Bacteria | 813 |
| 439 | Ga0268265_11073493 | 3300028380 | Bacteria | 798 |
| 440 | Ga0268265_11440718 | 3300028380 | Bacteria | 691 |
| 441 | Ga0268265_11506653 | 3300028380 | Unclassified | 676 |
| 442 | Ga0268265_11969814 | 3300028380 | Bacteria | 591 |
| 443 | Ga0268264_11007904 | 3300028381 | Unclassified | 839 |
| 444 | Ga0316182_1432439 | 3300030745 | Bacteria | 697 |
| 445 | Ga0307408_100057953 | 3300031548 | Unclassified | 2814 |
| 446 | Ga0307408_100096438 | 3300031548 | Bacteria | 2244 |
| 447 | Ga0307408_100099897 | 3300031548 | Bacteria | 2209 |
| 448 | Ga0307408_100106929 | 3300031548 | Bacteria | 2141 |
| 449 | Ga0307408_100193845 | 3300031548 | Bacteria | 1639 |
| 450 | Ga0307408_100566018 | 3300031548 | Unclassified | 1005 |
| 451 | Ga0307408_100829891 | 3300031548 | Unclassified | 841 |
| 452 | Ga0307408_101270147 | 3300031548 | Unclassified | 689 |
| 453 | Ga0307408_101942394 | 3300031548 | Bacteria | 565 |
| 454 | Ga0307408_102305101 | 3300031548 | Bacteria | 521 |
| 455 | Ga0307408_102522729 | 3300031548 | Bacteria | 500 |
| 456 | Ga0316575_10014657 | 3300031665 | Bacteria | 2947 |
| 457 | Ga0316579_10051440 | 3300031691 | Bacteria | 1928 |
| 458 | Ga0316576_10493640 | 3300031727 | Unclassified | 901 |
| 459 | Ga0316578_10079698 | 3300031728 | Bacteria | 1947 |
| 460 | Ga0307405_10040038 | 3300031731 | Bacteria | 2836 |
| 461 | Ga0307405_10047774 | 3300031731 | Bacteria | 2637 |
| 462 | Ga0307405_10070175 | 3300031731 | Unclassified | 2249 |
| 463 | Ga0307405_10179436 | 3300031731 | Bacteria | 1519 |
| 464 | Ga0307405_10262034 | 3300031731 | Bacteria | 1292 |
| 465 | Ga0307405_10429726 | 3300031731 | Bacteria | 1042 |
| 466 | Ga0307405_10512706 | 3300031731 | Bacteria | 963 |
| 467 | Ga0307405_10623831 | 3300031731 | Bacteria | 883 |
| 468 | Ga0307405_10641319 | 3300031731 | Bacteria | 872 |
| 469 | Ga0316577_10203522 | 3300031733 | Unclassified | 1119 |
| 470 | Ga0307413_10006876 | 3300031824 | Bacteria | 5236 |
| 471 | Ga0307413_10074525 | 3300031824 | Bacteria | 2150 |
| 472 | Ga0307413_10095448 | 3300031824 | Bacteria | 1950 |
| 473 | Ga0307413_10112038 | 3300031824 | Bacteria | 1828 |
| 474 | Ga0307413_10307934 | 3300031824 | Bacteria | 1204 |
| 475 | Ga0307413_10332343 | 3300031824 | Bacteria | 1165 |
| 476 | Ga0307413_10415232 | 3300031824 | Unclassified | 1058 |
| 477 | Ga0307413_10453449 | 3300031824 | Bacteria | 1018 |
| 478 | Ga0307413_10470292 | 3300031824 | Unclassified | 1002 |
| 479 | Ga0307413_10648022 | 3300031824 | Bacteria | 871 |
| 480 | Ga0307413_10863720 | 3300031824 | Bacteria | 765 |
| 481 | Ga0307413_11010445 | 3300031824 | Unclassified | 713 |
| 482 | Ga0307410_10010547 | 3300031852 | Bacteria | 5242 |
| 483 | Ga0307410_10016453 | 3300031852 | Bacteria | 4412 |
| 484 | Ga0307410_10022765 | 3300031852 | Bacteria | 3880 |
| 485 | Ga0307410_10023562 | 3300031852 | Bacteria | 3830 |
| 486 | Ga0307410_10068361 | 3300031852 | Bacteria | 2453 |
| 487 | Ga0307410_10136908 | 3300031852 | Bacteria | 1806 |
| 488 | Ga0307410_10145738 | 3300031852 | Bacteria | 1757 |
| 489 | Ga0307410_10254991 | 3300031852 | Bacteria | 1365 |
| 490 | Ga0307410_10299960 | 3300031852 | Bacteria | 1267 |
| 491 | Ga0307410_10848808 | 3300031852 | Unclassified | 779 |
| 492 | Ga0307410_10896760 | 3300031852 | Bacteria | 759 |
| 493 | Ga0307410_11060957 | 3300031852 | Unclassified | 701 |
| 494 | Ga0307410_11731902 | 3300031852 | Unclassified | 554 |
| 495 | Ga0307406_10045499 | 3300031901 | Bacteria | 2756 |
| 496 | Ga0307406_10055877 | 3300031901 | Unclassified | 2525 |
| 497 | Ga0307406_10124194 | 3300031901 | Bacteria | 1800 |
| 498 | Ga0307406_10226099 | 3300031901 | Unclassified | 1394 |
| 499 | Ga0307406_10333620 | 3300031901 | Bacteria | 1178 |
| 500 | Ga0307406_10410875 | 3300031901 | Bacteria | 1075 |
| 501 | Ga0307406_11051703 | 3300031901 | Bacteria | 701 |
| 502 | Ga0307407_10048642 | 3300031903 | Unclassified | 2415 |
| 503 | Ga0307407_10063601 | 3300031903 | Bacteria | 2165 |
| 504 | Ga0307407_10072430 | 3300031903 | Bacteria | 2055 |
| 505 | Ga0307407_10213278 | 3300031903 | Bacteria | 1301 |
| 506 | Ga0307407_10361703 | 3300031903 | Unclassified | 1031 |
| 507 | Ga0307407_10586069 | 3300031903 | Unclassified | 829 |
| 508 | Ga0307407_10674182 | 3300031903 | Unclassified | 776 |
| 509 | Ga0307407_10899617 | 3300031903 | Bacteria | 679 |
| 510 | Ga0307412_10083391 | 3300031911 | Unclassified | 2216 |
| 511 | Ga0307412_10172009 | 3300031911 | Bacteria | 1620 |
| 512 | Ga0307412_10262944 | 3300031911 | Unclassified | 1346 |
| 513 | Ga0307412_10761373 | 3300031911 | Bacteria | 837 |
| 514 | Ga0307412_11724825 | 3300031911 | Bacteria | 574 |
| 515 | Ga0307409_100002373 | 3300031995 | Bacteria | 9799 |
| 516 | Ga0307409_100034623 | 3300031995 | Bacteria | 3691 |
| 517 | Ga0307409_100066713 | 3300031995 | Bacteria | 2838 |
| 518 | Ga0307409_100090409 | 3300031995 | Bacteria | 2506 |
| 519 | Ga0307409_100117330 | 3300031995 | Unclassified | 2246 |
| 520 | Ga0307409_100241673 | 3300031995 | Bacteria | 1644 |
| 521 | Ga0307409_100284397 | 3300031995 | Bacteria | 1530 |
| 522 | Ga0307409_100411102 | 3300031995 | Bacteria | 1295 |
| 523 | Ga0307409_100443292 | 3300031995 | Bacteria | 1251 |
| 524 | Ga0307409_100593627 | 3300031995 | Bacteria | 1093 |
| 525 | Ga0307409_101081854 | 3300031995 | Bacteria | 822 |
| 526 | Ga0307409_101566830 | 3300031995 | Unclassified | 687 |
| 527 | Ga0307409_102810928 | 3300031995 | Bacteria | 514 |
| 528 | Ga0307416_100002032 | 3300032002 | Bacteria | 11382 |
| 529 | Ga0307416_100002732 | 3300032002 | Bacteria | 10231 |
| 530 | Ga0307416_100019764 | 3300032002 | Bacteria | 4785 |
| 531 | Ga0307416_100025295 | 3300032002 | Bacteria | 4350 |
| 532 | Ga0307416_100039174 | 3300032002 | Bacteria | 3666 |
| 533 | Ga0307416_100091107 | 3300032002 | Bacteria | 2617 |
| 534 | Ga0307416_100135441 | 3300032002 | Bacteria | 2227 |
| 535 | Ga0307416_100191698 | 3300032002 | Bacteria | 1928 |
| 536 | Ga0307416_100371035 | 3300032002 | Bacteria | 1457 |
| 537 | Ga0307416_100788157 | 3300032002 | Unclassified | 1045 |
| 538 | Ga0307416_101324007 | 3300032002 | Bacteria | 826 |
| 539 | Ga0307416_101968567 | 3300032002 | Bacteria | 687 |
| 540 | Ga0307416_102930118 | 3300032002 | Bacteria | 571 |
| 541 | Ga0307416_103171870 | 3300032002 | Bacteria | 550 |
| 542 | Ga0307414_10044787 | 3300032004 | Bacteria | 3026 |
| 543 | Ga0307414_10062367 | 3300032004 | Bacteria | 2645 |
| 544 | Ga0307414_10078008 | 3300032004 | Bacteria | 2413 |
| 545 | Ga0307414_10087954 | 3300032004 | Bacteria | 2298 |
| 546 | Ga0307414_10404669 | 3300032004 | Bacteria | 1186 |
| 547 | Ga0307414_10456845 | 3300032004 | Bacteria | 1121 |
| 548 | Ga0307414_10746024 | 3300032004 | Unclassified | 889 |
| 549 | Ga0307414_10960695 | 3300032004 | Bacteria | 785 |
| 550 | Ga0307414_11024811 | 3300032004 | Bacteria | 760 |
| 551 | Ga0307414_11103998 | 3300032004 | Bacteria | 732 |
| 552 | Ga0307411_10020346 | 3300032005 | Bacteria | 3857 |
| 553 | Ga0307411_10035753 | 3300032005 | Bacteria | 3106 |
| 554 | Ga0307411_10052115 | 3300032005 | Bacteria | 2674 |
| 555 | Ga0307411_10081262 | 3300032005 | Unclassified | 2231 |
| 556 | Ga0307411_10135993 | 3300032005 | Bacteria | 1804 |
| 557 | Ga0307411_10136943 | 3300032005 | Bacteria | 1799 |
| 558 | Ga0307411_10340521 | 3300032005 | Bacteria | 1218 |
| 559 | Ga0307411_10688272 | 3300032005 | Unclassified | 889 |
| 560 | Ga0307411_10782029 | 3300032005 | Bacteria | 839 |
| 561 | Ga0307411_10937564 | 3300032005 | Bacteria | 771 |
| 562 | Ga0307411_10950460 | 3300032005 | Bacteria | 766 |
| 563 | Ga0307411_12261193 | 3300032005 | Unclassified | 510 |
| 564 | Ga0307411_12348394 | 3300032005 | Unclassified | 501 |
| 565 | Ga0307415_100000864 | 3300032126 | Bacteria | 13852 |
| 566 | Ga0307415_100003278 | 3300032126 | Bacteria | 8231 |
| 567 | Ga0307415_100180552 | 3300032126 | Bacteria | 1655 |
| 568 | Ga0307415_100445762 | 3300032126 | Bacteria | 1118 |
| 569 | Ga0307415_100756155 | 3300032126 | Bacteria | 883 |
| 570 | Ga0307415_101750012 | 3300032126 | Bacteria | 600 |
| 571 | Ga0307415_101827204 | 3300032126 | Bacteria | 588 |
| 572 | Ga0307415_102092772 | 3300032126 | Bacteria | 552 |
| 573 | Ga0307415_102446087 | 3300032126 | Bacteria | 514 |
| 574 | Ga0316583_10069831 | 3300032133 | Bacteria | 1229 |
| 575 | Ga0316593_10152671 | 3300032168 | Unclassified | 840 |
| 576 | Ga0373930_0032000 | 3300034816 | Unclassified | 1087 |
| 577 | Ga0373948_0095723 | 3300034817 | Bacteria | 694 |
| 578 | Ga0373958_0144029 | 3300034819 | Bacteria | 592 |
| 579 | Ga0373959_0039782 | 3300034820 | Bacteria | 982 |
| 580 | Ga0373928_0022692 | 3300035084 | Bacteria | 1333 |
| 581 | Ga0373928_0155103 | 3300035084 | Bacteria | 636 |
| 582 | Ga0373929_0097157 | 3300035085 | Bacteria | 738 |
| 583 | Ga0373940_0005472 | 3300035088 | Bacteria | 2755 |
| 584 | Ga0373940_0012634 | 3300035088 | Bacteria | 2026 |
| 585 | Ga0373952_0133576 | 3300035092 | Bacteria | 684 |
| 586 | Ga0373932_0096515 | 3300035112 | Bacteria | 956 |
| 587 | Ga0373939_0332713 | 3300035114 | Bacteria | 614 |
| 588 | Ga0373941_0123344 | 3300035115 | Unclassified | 926 |
| 589 | Ga0373941_0244230 | 3300035115 | Bacteria | 699 |
| 590 | Ga0373960_0054338 | 3300035121 | Unclassified | 1198 |
| 591 | Ga0373960_0265154 | 3300035121 | Bacteria | 628 |
| 592 | Ga0373942_0108817 | 3300035207 | Unclassified | 855 |
| 593 | Ga0373961_0091246 | 3300035241 | Bacteria | 973 |
| 594 | Ga0373961_0094213 | 3300035241 | Unclassified | 961 |
| 595 | Ga0373961_0220699 | 3300035241 | Unclassified | 676 |
| 596 | Ga0316574_0291171 | 3300035398 | Unclassified | 1039 |
| 597 | Ga0373931_0028636 | 3300035691 | Bacteria | 2854 |
| 598 | Ga0373931_0140839 | 3300035691 | Bacteria | 1397 |
| 599 | Ga0373931_0161079 | 3300035691 | Bacteria | 1315 |
| 600 | Ga0373931_0470759 | 3300035691 | Bacteria | 806 |
| 601 | Ga0373931_0687711 | 3300035691 | Unclassified | 675 |
| 602 | Ga0373933_0029773 | 3300035724 | Bacteria | 3159 |
| 603 | Ga0373937_1538255 | 3300036401 | Unclassified | 613 |
| 604 | Ga0316582_0139654 | 3300036647 | Unclassified | 1633 |
| 605 | Ga0316584_0250425 | 3300036712 | Unclassified | 1294 |
| 606 | Ga0373925_0890067 | 3300037068 | Bacteria | 734 |
| 607 | Ga0395905_0440496 | 3300037471 | Bacteria | 1200 |
| 608 | Ga0395905_0676592 | 3300037471 | Bacteria | 934 |
| 609 | Ga0395905_0790956 | 3300037471 | Unclassified | 852 |
| 610 | Ga0316581_0133477 | 3300037588 | Bacteria | 765 |
| 611 | Ga0395901_0194022 | 3300038443 | Bacteria | 2130 |
| 612 | Ga0242420_041319 | 3300038996 | Unclassified | 881 |
| 613 | Ga0436365_0532788 | 3300039437 | Bacteria | 619 |
| 614 | Ga0439436_0050161 | 3300041404 | Unclassified | 1181 |
| 615 | Ga0439439_0002520 | 3300041406 | Bacteria | 3906 |
| 616 | Ga0439439_0021942 | 3300041406 | Bacteria | 1593 |
| 617 | Ga0439461_0130005 | 3300041410 | Bacteria | 636 |
| 618 | Ga0451800_1206903 | 3300041459 | Bacteria | 1420 |
| 619 | Ga0451807_1336449 | 3300041486 | Unclassified | 888 |
| 620 | Ga0451839_0743658 | 3300041496 | Unclassified | 610 |
| 621 | Ga0451843_1171492 | 3300041509 | Bacteria | 659 |
| 622 | Ga0439431_0196026 | 3300041997 | Unclassified | 587 |
| 623 | Ga0439445_0115672 | 3300042004 | Unclassified | 768 |
| 624 | Ga0439448_0143233 | 3300042005 | Unclassified | 828 |
| 625 | Ga0439455_0043921 | 3300042012 | Unclassified | 1152 |
| 626 | Ga0439455_0051234 | 3300042012 | Bacteria | 1079 |
| 627 | Ga0439455_0099355 | 3300042012 | Bacteria | 803 |
| 628 | Ga0439457_023322 | 3300042014 | Bacteria | 1369 |
| 629 | Ga0450890_012844 | 3300042127 | Unclassified | 1089 |
| 630 | Ga0450896_073251 | 3300042133 | Bacteria | 570 |
| 631 | Ga0450898_009275 | 3300042134 | Bacteria | 1571 |
| 632 | Ga0450910_070410 | 3300042147 | Bacteria | 601 |
| 633 | Ga0439446_0007447 | 3300042156 | Bacteria | 2878 |
| 634 | Ga0439446_0051095 | 3300042156 | Bacteria | 1235 |
| 635 | Ga0439446_0056374 | 3300042156 | Bacteria | 1181 |
| 636 | Ga0439446_0097613 | 3300042156 | Unclassified | 926 |
| 637 | Ga0439446_0309813 | 3300042156 | Bacteria | 556 |
| 638 | Ga0439434_0088359 | 3300042435 | Unclassified | 989 |
| 639 | Ga0439434_0109779 | 3300042435 | Unclassified | 893 |
| 640 | Ga0439444_0052590 | 3300042437 | Unclassified | 832 |
| 641 | Ga0439444_0103733 | 3300042437 | Bacteria | 647 |
| 642 | Ga0439460_0129562 | 3300042461 | Unclassified | 831 |
| 643 | Ga0451577_0104958 | 3300042876 | Bacteria | 2525 |
| 644 | Ga0451577_0430087 | 3300042876 | Unclassified | 1198 |
| 645 | Ga0451577_0870240 | 3300042876 | Bacteria | 812 |
| 646 | Ga0451577_0894212 | 3300042876 | Bacteria | 800 |
| 647 | Ga0451577_0979478 | 3300042876 | Bacteria | 760 |
| 648 | Ga0453683_0089467 | 3300044673 | Unclassified | 1930 |
| 649 | Ga0453684_0690822 | 3300044712 | Bacteria | 1110 |
| 650 | Ga0466957_0574083 | 3300044842 | Bacteria | 788 |
| 651 | Ga0466960_0273036 | 3300044901 | Bacteria | 945 |
| 652 | Ga0466960_0741801 | 3300044901 | Unclassified | 591 |
| 653 | Ga0466960_0988309 | 3300044901 | Bacteria | 517 |
| 654 | Ga0451576_0890989 | 3300045051 | Bacteria | 934 |
| 655 | Ga0451576_1409696 | 3300045051 | Unclassified | 725 |
| 656 | Ga0466967_0327124 | 3300045976 | Bacteria | 1480 |
| 657 | Ga0466967_1675823 | 3300045976 | Bacteria | 633 |
| 658 | Ga0495603_0323636 | 3300046455 | Unclassified | 885 |
| 659 | Ga0495629_0656868 | 3300046459 | Unclassified | 698 |
| 660 | Ga0495580_0454199 | 3300046472 | Bacteria | 859 |
| 661 | Ga0495594_0288471 | 3300046499 | Bacteria | 935 |
| 662 | Ga0495594_0595211 | 3300046499 | Bacteria | 627 |
| 663 | Ga0495621_0037151 | 3300046539 | Bacteria | 1693 |
| 664 | Ga0495622_0305615 | 3300046557 | Bacteria | 693 |
| 665 | Ga0495667_0385359 | 3300046559 | Unclassified | 884 |
| 666 | Ga0495670_0407120 | 3300046691 | Unclassified | 735 |
| 667 | Ga0496100_0412803 | 3300048903 | Bacteria | 1030 |
| 668 | Ga0496100_0493441 | 3300048903 | Bacteria | 943 |
| 669 | Ga0496100_0961145 | 3300048903 | Bacteria | 672 |
| 670 | Ga0496100_1049240 | 3300048903 | Unclassified | 642 |
| 671 | Ga0496100_1460154 | 3300048903 | Bacteria | 540 |
| 672 | Ga0496100_1511805 | 3300048903 | Unclassified | 530 |
| 673 | Ga0496101_0202173 | 3300048904 | Bacteria | 1536 |
| 674 | Ga0496101_0444105 | 3300048904 | Bacteria | 1023 |
| 675 | Ga0496101_1491930 | 3300048904 | Unclassified | 526 |
| 676 | Ga0496102_0052140 | 3300048905 | Unclassified | 3726 |
| 677 | Ga0496102_0052826 | 3300048905 | Bacteria | 3704 |
| 678 | Ga0496102_0185973 | 3300048905 | Bacteria | 1958 |
| 679 | Ga0496102_0826208 | 3300048905 | Bacteria | 849 |
| 680 | Ga0496102_1502438 | 3300048905 | Bacteria | 592 |
| 681 | Ga0496102_1742552 | 3300048905 | Bacteria | 540 |
| 682 | Ga0496103_0039229 | 3300048906 | Bacteria | 2910 |
| 683 | Ga0496103_0975345 | 3300048906 | Bacteria | 529 |
| 684 | Ga0496104_0054127 | 3300048907 | Bacteria | 3793 |
| 685 | Ga0496104_0079813 | 3300048907 | Bacteria | 3119 |
| 686 | Ga0496104_0158733 | 3300048907 | Bacteria | 2170 |
| 687 | Ga0496104_0207801 | 3300048907 | Bacteria | 1870 |
| 688 | Ga0496105_0257134 | 3300048908 | Bacteria | 1413 |
| 689 | Ga0496105_0259689 | 3300048908 | Bacteria | 1405 |
| 690 | Ga0496105_0498419 | 3300048908 | Bacteria | 956 |
| 691 | Ga0496106_0048833 | 3300048909 | Unclassified | 3188 |
| 692 | Ga0496106_0347482 | 3300048909 | Bacteria | 1191 |
| 693 | Ga0496106_0381492 | 3300048909 | Bacteria | 1133 |
| 694 | Ga0496107_0119348 | 3300048910 | Bacteria | 1942 |
| 695 | Ga0496108_0051655 | 3300048911 | Bacteria | 3444 |
| 696 | Ga0496108_0070040 | 3300048911 | Bacteria | 2959 |
| 697 | Ga0496108_0131588 | 3300048911 | Bacteria | 2150 |
| 698 | Ga0496108_0886987 | 3300048911 | Bacteria | 766 |
| 699 | Ga0496108_0906256 | 3300048911 | Bacteria | 756 |
| 700 | Ga0496109_0001242 | 3300048912 | Bacteria | 21132 |
| 701 | Ga0496109_0003405 | 3300048912 | Bacteria | 13309 |
| 702 | Ga0496109_0107503 | 3300048912 | Bacteria | 2591 |
| 703 | Ga0496109_0120355 | 3300048912 | Bacteria | 2445 |
| 704 | Ga0496109_0623628 | 3300048912 | Bacteria | 1015 |
| 705 | Ga0496109_0889805 | 3300048912 | Unclassified | 828 |
| 706 | Ga0496110_0062816 | 3300048913 | Bacteria | 3281 |
| 707 | Ga0496110_0109296 | 3300048913 | Bacteria | 2483 |
| 708 | Ga0496110_0233956 | 3300048913 | Bacteria | 1671 |
| 709 | Ga0496110_0447960 | 3300048913 | Bacteria | 1177 |
| 710 | Ga0496111_0052860 | 3300048914 | Unclassified | 2934 |
| 711 | Ga0496111_0073361 | 3300048914 | Bacteria | 2492 |
| 712 | Ga0496111_0539897 | 3300048914 | Bacteria | 856 |
| 713 | Ga0496112_0006851 | 3300048915 | Bacteria | 10046 |
| 714 | Ga0496112_0078121 | 3300048915 | Bacteria | 3273 |
| 715 | Ga0496112_0314680 | 3300048915 | Bacteria | 1510 |
| 716 | Ga0496112_0723460 | 3300048915 | Bacteria | 922 |
| 717 | Ga0496113_0002551 | 3300048916 | Bacteria | 10629 |
| 718 | Ga0496113_0013682 | 3300048916 | Bacteria | 5509 |
| 719 | Ga0496113_0127845 | 3300048916 | Bacteria | 1991 |
| 720 | Ga0496113_0408360 | 3300048916 | Bacteria | 1090 |
| 721 | Ga0496114_0775170 | 3300048917 | Bacteria | 837 |
| 722 | Ga0496114_0801337 | 3300048917 | Unclassified | 821 |
| 723 | Ga0496114_1428813 | 3300048917 | Bacteria | 579 |
| 724 | Ga0496115_0072632 | 3300048918 | Bacteria | 2792 |
| 725 | Ga0496115_0073560 | 3300048918 | Bacteria | 2774 |
| 726 | Ga0501297_015215 | 3300049520 | Bacteria | 919 |
| 727 | Ga0501298_061990 | 3300049521 | Bacteria | 794 |
| 728 | Ga0501298_154911 | 3300049521 | Bacteria | 563 |
| 729 | Ga0501299_050851 | 3300049522 | Bacteria | 856 |
| 730 | Ga0501299_106168 | 3300049522 | Bacteria | 659 |
| 731 | Ga0501031_0432604 | 3300049568 | Bacteria | 850 |
| 732 | Ga0501031_0981307 | 3300049568 | Bacteria | 540 |
| 733 | Ga0501032_0269097 | 3300049569 | Bacteria | 1104 |
| 734 | Ga0501032_0712237 | 3300049569 | Bacteria | 636 |
| 735 | Ga0501033_0282461 | 3300049570 | Bacteria | 1172 |
| 736 | Ga0501034_0098585 | 3300049571 | Bacteria | 2918 |
| 737 | Ga0501034_1077037 | 3300049571 | Bacteria | 685 |
| 738 | Ga0501036_0038651 | 3300049572 | Bacteria | 4039 |
| 739 | Ga0501036_0072612 | 3300049572 | Bacteria | 2909 |
| 740 | Ga0501037_0027943 | 3300049573 | Bacteria | 4169 |
| 741 | Ga0501037_0911485 | 3300049573 | Bacteria | 576 |
| 742 | Ga0501038_0273031 | 3300049574 | Bacteria | 1333 |
| 743 | Ga0501038_0397818 | 3300049574 | Unclassified | 1066 |
| 744 | Ga0501039_0035222 | 3300049575 | Bacteria | 3863 |
| 745 | Ga0501039_0189271 | 3300049575 | Bacteria | 1619 |
| 746 | Ga0501039_0292463 | 3300049575 | Bacteria | 1281 |
| 747 | Ga0501040_0059954 | 3300049576 | Bacteria | 2615 |
| 748 | Ga0501040_0064640 | 3300049576 | Bacteria | 2519 |
| 749 | Ga0501040_0074660 | 3300049576 | Bacteria | 2343 |
| 750 | Ga0501040_0088662 | 3300049576 | Bacteria | 2149 |
| 751 | Ga0501040_0979568 | 3300049576 | Bacteria | 613 |
| 752 | Ga0501041_0091060 | 3300049577 | Bacteria | 1883 |
| 753 | Ga0501041_0154953 | 3300049577 | Bacteria | 1431 |
| 754 | Ga0501041_0211144 | 3300049577 | Bacteria | 1217 |
| 755 | Ga0501041_1041839 | 3300049577 | Bacteria | 527 |
| 756 | Ga0501042_0061501 | 3300049578 | Bacteria | 2683 |
| 757 | Ga0501042_0143165 | 3300049578 | Bacteria | 1724 |
| 758 | Ga0501043_0086142 | 3300049579 | Bacteria | 2469 |
| 759 | Ga0501043_0450759 | 3300049579 | Unclassified | 967 |
| 760 | Ga0501046_0047499 | 3300049580 | Bacteria | 3403 |
| 761 | Ga0501046_0162965 | 3300049580 | Bacteria | 1676 |
| 762 | Ga0501048_0007833 | 3300049582 | Bacteria | 8094 |
| 763 | Ga0501048_0061063 | 3300049582 | Bacteria | 2670 |
| 764 | Ga0501048_1304254 | 3300049582 | Unclassified | 522 |
| 765 | Ga0501067_0062678 | 3300049583 | Bacteria | 2058 |
| 766 | Ga0501067_0108088 | 3300049583 | Bacteria | 1546 |
| 767 | Ga0501067_0163131 | 3300049583 | Bacteria | 1241 |
| 768 | Ga0501067_0374825 | 3300049583 | Bacteria | 793 |
| 769 | Ga0501068_0031002 | 3300049584 | Bacteria | 3175 |
| 770 | Ga0501068_0203291 | 3300049584 | Bacteria | 1256 |
| 771 | Ga0501069_0026697 | 3300049585 | Bacteria | 3163 |
| 772 | Ga0501069_0099027 | 3300049585 | Bacteria | 1654 |
| 773 | Ga0501069_0175717 | 3300049585 | Bacteria | 1237 |
| 774 | Ga0501069_0246800 | 3300049585 | Bacteria | 1041 |
| 775 | Ga0501069_0329360 | 3300049585 | Unclassified | 898 |
| 776 | Ga0501069_0477757 | 3300049585 | Unclassified | 742 |
| 777 | Ga0501069_0640522 | 3300049585 | Bacteria | 639 |
| 778 | Ga0501069_0803675 | 3300049585 | Bacteria | 570 |
| 779 | Ga0501070_0049303 | 3300049586 | Bacteria | 3497 |
| 780 | Ga0501070_0200992 | 3300049586 | Bacteria | 1637 |
| 781 | Ga0501070_0228123 | 3300049586 | Bacteria | 1526 |
| 782 | Ga0501070_0259464 | 3300049586 | Bacteria | 1421 |
| 783 | Ga0501071_0034344 | 3300049587 | Bacteria | 3609 |
| 784 | Ga0501071_0109977 | 3300049587 | Bacteria | 2036 |
| 785 | Ga0501071_0354735 | 3300049587 | Bacteria | 1116 |
| 786 | Ga0501071_0504658 | 3300049587 | Bacteria | 928 |
| 787 | Ga0501071_0668705 | 3300049587 | Bacteria | 799 |
| 788 | Ga0501071_0691332 | 3300049587 | Bacteria | 785 |
| 789 | Ga0501072_0005332 | 3300049588 | Bacteria | 9784 |
| 790 | Ga0501072_1507383 | 3300049588 | Bacteria | 519 |
| 791 | Ga0501073_0874624 | 3300049589 | Bacteria | 619 |
| 792 | Ga0501074_0145818 | 3300049590 | Bacteria | 1693 |
| 793 | Ga0501074_0394104 | 3300049590 | Bacteria | 982 |
| 794 | Ga0501075_0014126 | 3300049591 | Bacteria | 5720 |
| 795 | Ga0501075_0021140 | 3300049591 | Bacteria | 4741 |
| 796 | Ga0501075_0323738 | 3300049591 | Unclassified | 1175 |
| 797 | Ga0501075_0347590 | 3300049591 | Bacteria | 1130 |
| 798 | Ga0501075_0470052 | 3300049591 | Bacteria | 959 |
| 799 | Ga0501075_0780218 | 3300049591 | Bacteria | 727 |
| 800 | Ga0501075_1098476 | 3300049591 | Unclassified | 604 |
| 801 | Ga0501075_1146780 | 3300049591 | Bacteria | 590 |
| 802 | Ga0501076_0017383 | 3300049592 | Bacteria | 5466 |
| 803 | Ga0501076_0087707 | 3300049592 | Bacteria | 2501 |
| 804 | Ga0501076_0283087 | 3300049592 | Bacteria | 1358 |
| 805 | Ga0501076_1019865 | 3300049592 | Bacteria | 682 |
| 806 | Ga0501077_0003255 | 3300049593 | Bacteria | 9786 |
| 807 | Ga0501077_0014505 | 3300049593 | Bacteria | 4952 |
| 808 | Ga0501077_0251388 | 3300049593 | Bacteria | 1124 |
| 809 | Ga0501077_0625642 | 3300049593 | Bacteria | 692 |
| 810 | Ga0501217_038778 | 3300049661 | Bacteria | 1205 |
| 811 | Ga0501217_291700 | 3300049661 | Unclassified | 536 |
| 812 | Ga0501235_086658 | 3300049669 | Unclassified | 753 |
| 813 | Ga0501239_001917 | 3300049672 | Bacteria | 1844 |
| 814 | Ga0501243_036411 | 3300049675 | Bacteria | 853 |
| 815 | Ga0501247_014660 | 3300049677 | Bacteria | 974 |
| 816 | Ga0501249_035276 | 3300049679 | Bacteria | 1124 |
| 817 | Ga0501249_131926 | 3300049679 | Bacteria | 617 |
| 818 | Ga0501257_156004 | 3300049686 | Bacteria | 632 |
| 819 | Ga0501259_033321 | 3300049688 | Bacteria | 983 |
| 820 | Ga0501221_007695 | 3300049704 | Bacteria | 1854 |
| 821 | Ga0501245_140449 | 3300049708 | Unclassified | 525 |
| 822 | Ga0501079_0016453 | 3300049741 | Bacteria | 5647 |
| 823 | Ga0501079_0020714 | 3300049741 | Bacteria | 5028 |
| 824 | Ga0501079_0229399 | 3300049741 | Bacteria | 1450 |
| 825 | Ga0501079_0434835 | 3300049741 | Bacteria | 1030 |
| 826 | Ga0501079_0693318 | 3300049741 | Bacteria | 802 |
| 827 | Ga0501079_1482999 | 3300049741 | Unclassified | 534 |
| 828 | Ga0501080_0013648 | 3300049742 | Bacteria | 7481 |
| 829 | Ga0501080_0076402 | 3300049742 | Bacteria | 3115 |
| 830 | Ga0501080_0310236 | 3300049742 | Bacteria | 1430 |
| 831 | Ga0501080_0312894 | 3300049742 | Bacteria | 1423 |
| 832 | Ga0501080_0525577 | 3300049742 | Bacteria | 1055 |
| 833 | Ga0501080_0766467 | 3300049742 | Bacteria | 848 |
| 834 | Ga0501080_1718978 | 3300049742 | Bacteria | 529 |
| 835 | Ga0501081_0004597 | 3300049743 | Bacteria | 8858 |
| 836 | Ga0501081_0009706 | 3300049743 | Bacteria | 6277 |
| 837 | Ga0501081_0086278 | 3300049743 | Bacteria | 2204 |
| 838 | Ga0501081_0168802 | 3300049743 | Bacteria | 1579 |
| 839 | Ga0501081_1285715 | 3300049743 | Bacteria | 555 |
| 840 | Ga0501081_1398547 | 3300049743 | Unclassified | 531 |
| 841 | Ga0501083_0154322 | 3300049744 | Bacteria | 1503 |
| 842 | Ga0501083_0260450 | 3300049744 | Bacteria | 1128 |
| 843 | Ga0501083_0352922 | 3300049744 | Bacteria | 956 |
| 844 | Ga0501083_0633593 | 3300049744 | Bacteria | 695 |
| 845 | Ga0501263_077837 | 3300049760 | Bacteria | 544 |
| 846 | Ga0501266_050213 | 3300049763 | Unclassified | 643 |
| 847 | Ga0501267_024643 | 3300049764 | Bacteria | 681 |
| 848 | Ga0501271_003541 | 3300049768 | Bacteria | 1445 |
| 849 | Ga0501271_015754 | 3300049768 | Bacteria | 846 |
| 850 | Ga0501273_006208 | 3300049770 | Bacteria | 1377 |
| 851 | Ga0501273_021568 | 3300049770 | Bacteria | 875 |
| 852 | Ga0501276_033015 | 3300049773 | Unclassified | 549 |
| 853 | Ga0501283_113780 | 3300049779 | Bacteria | 537 |
| 854 | Ga0501035_0063000 | 3300049822 | Bacteria | 3299 |
| 855 | Ga0501035_0385135 | 3300049822 | Bacteria | 1169 |
| 856 | Ga0501035_1201092 | 3300049822 | Bacteria | 588 |
| 857 | Ga0501045_0013479 | 3300049824 | Bacteria | 5774 |
| 858 | Ga0501045_0029004 | 3300049824 | Bacteria | 3996 |
| 859 | Ga0501045_0823598 | 3300049824 | Bacteria | 683 |
| 860 | Ga0501045_1378857 | 3300049824 | Bacteria | 512 |
| 861 | nmdc:mga05p37_215368_c1 | 3300050507 | Bacteria | 2320 |
| 862 | nmdc:mga05p37_242812_c1 | 3300050507 | Bacteria | 2164 |
| 863 | nmdc:mga05p37_280136_c1 | 3300050507 | Unclassified | 1989 |
| 864 | nmdc:mga05p37_475607_c1 | 3300050507 | Bacteria | 1440 |
| 865 | nmdc:mga05p37_6185_c1 | 3300050507 | Bacteria | 14092 |
| 866 | nmdc:mga05p37_851898_c1 | 3300050507 | Unclassified | 990 |
| 867 | nmdc:mga09592_1031811_c1 | 3300050508 | Bacteria | 686 |
| 868 | nmdc:mga09592_180745_c1 | 3300050508 | Bacteria | 1825 |
| 869 | nmdc:mga09592_358202_c1 | 3300050508 | Bacteria | 1262 |
| 870 | nmdc:mga09592_642_c1 | 3300050508 | Bacteria | 26577 |
| 871 | nmdc:mga0qj67_153335_c1 | 3300050509 | Bacteria | 1869 |
| 872 | nmdc:mga0qj67_339817_c1 | 3300050509 | Bacteria | 1214 |
| 873 | nmdc:mga0qj67_609197_c1 | 3300050509 | Unclassified | 873 |
| 874 | nmdc:mga06r32_1004102_c1 | 3300050510 | Unclassified | 787 |
| 875 | nmdc:mga06r32_1521497_c1 | 3300050510 | Bacteria | 609 |
| 876 | nmdc:mga06r32_23975_c1 | 3300050510 | Bacteria | 5655 |
| 877 | nmdc:mga06r32_325469_c1 | 3300050510 | Bacteria | 1522 |
| 878 | nmdc:mga06r32_477088_c1 | 3300050510 | Bacteria | 1225 |
| 879 | nmdc:mga06r32_65939_c1 | 3300050510 | Unclassified | 3493 |
| 880 | nmdc:mga06r32_68985_c1 | 3300050510 | Bacteria | 3416 |
| 881 | nmdc:mga08y16_459686_c1 | 3300050511 | Bacteria | 1297 |
| 882 | nmdc:mga08y16_578998_c1 | 3300050511 | Bacteria | 1133 |
| 883 | nmdc:mga0n895_1537642_c1 | 3300050512 | Bacteria | 631 |
| 884 | nmdc:mga0n895_231858_c1 | 3300050512 | Bacteria | 1874 |
| 885 | nmdc:mga0n895_26043_c1 | 3300050512 | Bacteria | 5532 |
| 886 | nmdc:mga0n895_516843_c1 | 3300050512 | Bacteria | 1202 |
| 887 | nmdc:mga0n895_606803_c1 | 3300050512 | Bacteria | 1096 |
| 888 | nmdc:mga0n895_64679_c1 | 3300050512 | Bacteria | 3618 |
| 889 | nmdc:mga0rr50_1206386_c1 | 3300050513 | Bacteria | 643 |
| 890 | nmdc:mga0rr50_126087_c1 | 3300050513 | Unclassified | 2044 |
| 891 | nmdc:mga0rr50_1391604_c1 | 3300050513 | Bacteria | 594 |
| 892 | nmdc:mga0rr50_1616007_c1 | 3300050513 | Unclassified | 547 |
| 893 | nmdc:mga0rr50_396415_c1 | 3300050513 | Bacteria | 1165 |
| 894 | nmdc:mga0rr50_404982_c1 | 3300050513 | Unclassified | 1153 |
| 895 | nmdc:mga0rr50_638951_c1 | 3300050513 | Bacteria | 908 |
| 896 | nmdc:mga0rr50_919398_c1 | 3300050513 | Bacteria | 746 |
| 897 | nmdc:mga08x19_147575_c1 | 3300050514 | Bacteria | 1591 |
| 898 | nmdc:mga08x19_149485_c1 | 3300050514 | Bacteria | 1581 |
| 899 | nmdc:mga0a205_11780_c1 | 3300050515 | Bacteria | 8069 |
| 900 | nmdc:mga0a205_227958_c1 | 3300050515 | Bacteria | 1747 |
| 901 | nmdc:mga0a205_828517_c1 | 3300050515 | Bacteria | 773 |
| 902 | nmdc:mga0a205_91158_c1 | 3300050515 | Bacteria | 2945 |
| 903 | Ga0501084_0005089 | 3300054114 | Bacteria | 10763 |
| 904 | Ga0501084_0071846 | 3300054114 | Bacteria | 2898 |
| 905 | Ga0501084_0079555 | 3300054114 | Bacteria | 2747 |
| 906 | Ga0501084_0250675 | 3300054114 | Bacteria | 1495 |
| 907 | Ga0501084_0360739 | 3300054114 | Bacteria | 1228 |
| 908 | Ga0501084_0953780 | 3300054114 | Bacteria | 721 |
| 909 | Ga0501084_1354823 | 3300054114 | Bacteria | 596 |
| 910 | Ga0501084_1446490 | 3300054114 | Bacteria | 575 |
| 911 | Ga0590071_001977 | 3300059421 | Bacteria | 5242 |
| 912 | Ga0590071_008491 | 3300059421 | Bacteria | 2415 |
| 913 | Ga0590074_007359 | 3300059423 | Bacteria | 1829 |
| 914 | Ga0590074_026919 | 3300059423 | Unclassified | 1006 |
| 915 | Ga0590075_101918 | 3300059424 | Bacteria | 748 |
| 916 | Ga0590075_161870 | 3300059424 | Bacteria | 590 |
| 917 | Ga0590077_008465 | 3300059426 | Bacteria | 2106 |
| 918 | Ga0590077_048096 | 3300059426 | Unclassified | 955 |
| 919 | Ga0587070_101906 | 3300059491 | Bacteria | 662 |
| 920 | Ga0587083_0204840 | 3300059505 | Bacteria | 565 |
| 921 | Ga0587128_138174 | 3300059630 | Bacteria | 545 |
| 922 | Ga0587079_195723 | 3300059647 | Bacteria | 549 |
| 923 | Ga0587071_040685 | 3300060344 | Bacteria | 930 |
| 924 | Ga0501082_0010764 | 3300060353 | Bacteria | 7875 |
| 925 | Ga0501082_0072769 | 3300060353 | Bacteria | 2960 |
| 926 | Ga0501082_0083641 | 3300060353 | Bacteria | 2753 |
| 927 | Ga0501082_0986011 | 3300060353 | Bacteria | 737 |
| 928 | Ga0501082_1522437 | 3300060353 | Bacteria | 584 |
| 929 | Ga0501082_1836858 | 3300060353 | Bacteria | 529 |
| 930 | Ga0530510_0083729 | 3300061734 | Bacteria | 2323 |
| 931 | Ga0530510_0431827 | 3300061734 | Unclassified | 995 |
| 932 | Ga0530510_0647416 | 3300061734 | Bacteria | 804 |
| 933 | Ga0530510_1427460 | 3300061734 | Bacteria | 531 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300031852 | Ga0307410_10068361 | Ga0307410_100683613 | 60 |
| 2 | 3300042156 | Ga0439446_0056374 | Ga0439446_0056374_977_1168 | 62 |
| 3 | 3300049592 | Ga0501076_1019865 | Ga0501076_1019865_366_560 | 64 |
| 4 | 3300060353 | Ga0501082_0986011 | Ga0501082_0986011_83_277 | 64 |
| 5 | 3300031665 | Ga0316575_10014657 | Ga0316575_100146572 | 66 |
| 6 | 3300031691 | Ga0316579_10051440 | Ga0316579_100514403 | 66 |
| 7 | 3300031727 | Ga0316576_10493640 | Ga0316576_104936402 | 66 |
| 8 | 3300031728 | Ga0316578_10079698 | Ga0316578_100796982 | 66 |
| 9 | 3300031733 | Ga0316577_10203522 | Ga0316577_102035222 | 66 |
| 10 | 3300032133 | Ga0316583_10069831 | Ga0316583_100698312 | 66 |
| 11 | 3300032168 | Ga0316593_10152671 | Ga0316593_101526712 | 66 |
| 12 | 3300035398 | Ga0316574_0291171 | Ga0316574_0291171_578_787 | 66 |
| 13 | 3300036647 | Ga0316582_0139654 | Ga0316582_0139654_889_1098 | 66 |
| 14 | 3300036712 | Ga0316584_0250425 | Ga0316584_0250425_933_1142 | 66 |
| 15 | 3300037588 | Ga0316581_0133477 | Ga0316581_0133477_543_752 | 66 |
| 16 | 3300042876 | Ga0451577_0870240 | Ga0451577_0870240_185_394 | 66 |
| 17 | 3300037471 | Ga0395905_0676592 | Ga0395905_0676592_369_578 | 67 |
| 18 | 3300044901 | Ga0466960_0988309 | Ga0466960_0988309_277_486 | 67 |
| 19 | 3300005354 | Ga0070675_100100941 | Ga0070675_1001009413 | 68 |
| 20 | 3300005354 | Ga0070675_100193792 | Ga0070675_1001937923 | 68 |
| 21 | 3300005355 | Ga0070671_100008791 | Ga0070671_1000087915 | 68 |
| 22 | 3300005356 | Ga0070674_100033210 | Ga0070674_1000332104 | 68 |
| 23 | 3300005364 | Ga0070673_100443555 | Ga0070673_1004435552 | 68 |
| 24 | 3300005364 | Ga0070673_100872322 | Ga0070673_1008723222 | 68 |
| 25 | 3300005367 | Ga0070667_101656223 | Ga0070667_1016562232 | 68 |
| 26 | 3300005455 | Ga0070663_101162312 | Ga0070663_1011623122 | 68 |
| 27 | 3300005456 | Ga0070678_100473367 | Ga0070678_1004733672 | 68 |
| 28 | 3300005456 | Ga0070678_100709556 | Ga0070678_1007095562 | 68 |
| 29 | 3300005457 | Ga0070662_100877038 | Ga0070662_1008770381 | 68 |
| 30 | 3300005459 | Ga0068867_100019527 | Ga0068867_1000195275 | 68 |
| 31 | 3300005466 | Ga0070685_10696834 | Ga0070685_106968342 | 68 |
| 32 | 3300005536 | Ga0070697_101647534 | Ga0070697_1016475342 | 68 |
| 33 | 3300005543 | Ga0070672_100092075 | Ga0070672_1000920752 | 68 |
| 34 | 3300005548 | Ga0070665_100407848 | Ga0070665_1004078482 | 68 |
| 35 | 3300005548 | Ga0070665_100845184 | Ga0070665_1008451842 | 68 |
| 36 | 3300005618 | Ga0068864_100647103 | Ga0068864_1006471032 | 68 |
| 37 | 3300005719 | Ga0068861_101494877 | Ga0068861_1014948771 | 68 |
| 38 | 3300005840 | Ga0068870_10693508 | Ga0068870_106935082 | 68 |
| 39 | 3300005841 | Ga0068863_100960439 | Ga0068863_1009604392 | 68 |
| 40 | 3300005841 | Ga0068863_101199778 | Ga0068863_1011997782 | 68 |
| 41 | 3300005844 | Ga0068862_101425032 | Ga0068862_1014250322 | 68 |
| 42 | 3300006237 | Ga0097621_100953546 | Ga0097621_1009535462 | 68 |
| 43 | 3300007076 | Ga0075435_101734584 | Ga0075435_1017345842 | 68 |
| 44 | 3300009177 | Ga0105248_11174520 | Ga0105248_111745201 | 68 |
| 45 | 3300009177 | Ga0105248_12657162 | Ga0105248_126571622 | 68 |
| 46 | 3300014325 | Ga0163163_10246663 | Ga0163163_102466632 | 68 |
| 47 | 3300014326 | Ga0157380_12109684 | Ga0157380_121096842 | 68 |
| 48 | 3300014968 | Ga0157379_11546043 | Ga0157379_115460431 | 68 |
| 49 | 3300014969 | Ga0157376_11212478 | Ga0157376_112124782 | 68 |
| 50 | 3300014969 | Ga0157376_11425479 | Ga0157376_114254792 | 68 |
| 51 | 3300017792 | Ga0163161_11150635 | Ga0163161_111506352 | 68 |
| 52 | 3300025893 | Ga0207682_10038523 | Ga0207682_100385232 | 68 |
| 53 | 3300025901 | Ga0207688_10440822 | Ga0207688_104408222 | 68 |
| 54 | 3300025923 | Ga0207681_10319809 | Ga0207681_103198092 | 68 |
| 55 | 3300025925 | Ga0207650_11843326 | Ga0207650_118433262 | 68 |
| 56 | 3300025926 | Ga0207659_10140505 | Ga0207659_101405052 | 68 |
| 57 | 3300025931 | Ga0207644_10004008 | Ga0207644_100040089 | 68 |
| 58 | 3300025933 | Ga0207706_10806839 | Ga0207706_108068392 | 68 |
| 59 | 3300025938 | Ga0207704_10367148 | Ga0207704_103671482 | 68 |
| 60 | 3300025940 | Ga0207691_10016924 | Ga0207691_100169249 | 68 |
| 61 | 3300025940 | Ga0207691_10200185 | Ga0207691_102001852 | 68 |
| 62 | 3300025941 | Ga0207711_10154690 | Ga0207711_101546902 | 68 |
| 63 | 3300025941 | Ga0207711_10708476 | Ga0207711_107084761 | 68 |
| 64 | 3300025941 | Ga0207711_11765615 | Ga0207711_117656152 | 68 |
| 65 | 3300025945 | Ga0207679_11249540 | Ga0207679_112495402 | 68 |
| 66 | 3300025960 | Ga0207651_10165925 | Ga0207651_101659252 | 68 |
| 67 | 3300025972 | Ga0207668_10015126 | Ga0207668_100151265 | 68 |
| 68 | 3300025972 | Ga0207668_11301932 | Ga0207668_113019322 | 68 |
| 69 | 3300025986 | Ga0207658_11929462 | Ga0207658_119294622 | 68 |
| 70 | 3300026075 | Ga0207708_10838539 | Ga0207708_108385391 | 68 |
| 71 | 3300026088 | Ga0207641_10898826 | Ga0207641_108988262 | 68 |
| 72 | 3300026089 | Ga0207648_10114838 | Ga0207648_101148382 | 68 |
| 73 | 3300026121 | Ga0207683_10768000 | Ga0207683_107680002 | 68 |
| 74 | 3300028379 | Ga0268266_10370808 | Ga0268266_103708082 | 68 |
| 75 | 3300028380 | Ga0268265_11440718 | Ga0268265_114407182 | 68 |
| 76 | 3300028381 | Ga0268264_11007904 | Ga0268264_110079041 | 68 |
| 77 | 3300042876 | Ga0451577_0104958 | Ga0451577_0104958_1715_1924 | 68 |
| 78 | 3300046499 | Ga0495594_0288471 | Ga0495594_0288471_423_632 | 68 |
| 79 | 3300046539 | Ga0495621_0037151 | Ga0495621_0037151_1032_1241 | 68 |
| 80 | 3300046557 | Ga0495622_0305615 | Ga0495622_0305615_160_369 | 68 |
| 81 | 3300046691 | Ga0495670_0407120 | Ga0495670_0407120_237_446 | 68 |
| 82 | 3300050513 | nmdc:mga0rr50_1616007_c1 | nmdc:mga0rr50_1616007_c1_229_441 | 68 |
| 83 | 3300049585 | Ga0501069_0329360 | Ga0501069_0329360_557_769 | 69 |
| 84 | 3300049586 | Ga0501070_0228123 | Ga0501070_0228123_419_631 | 69 |
| 85 | 3300001228 | SwM_137927 | SwM_1379271 | 70 |
| 86 | 3300004798 | Ga0058859_10961723 | Ga0058859_109617232 | 70 |
| 87 | 3300005290 | Ga0065712_10587870 | Ga0065712_105878701 | 70 |
| 88 | 3300005293 | Ga0065715_10123810 | Ga0065715_101238103 | 70 |
| 89 | 3300005293 | Ga0065715_10153903 | Ga0065715_101539032 | 70 |
| 90 | 3300005295 | Ga0065707_10131282 | Ga0065707_101312823 | 70 |
| 91 | 3300005329 | Ga0070683_101919182 | Ga0070683_1019191821 | 70 |
| 92 | 3300005330 | Ga0070690_100487319 | Ga0070690_1004873192 | 70 |
| 93 | 3300005334 | Ga0068869_100639158 | Ga0068869_1006391582 | 70 |
| 94 | 3300005334 | Ga0068869_101217913 | Ga0068869_1012179132 | 70 |
| 95 | 3300005336 | Ga0070680_100069928 | Ga0070680_1000699284 | 70 |
| 96 | 3300005337 | Ga0070682_100749809 | Ga0070682_1007498092 | 70 |
| 97 | 3300005338 | Ga0068868_102285790 | Ga0068868_1022857901 | 70 |
| 98 | 3300005340 | Ga0070689_100535557 | Ga0070689_1005355572 | 70 |
| 99 | 3300005344 | Ga0070661_100662681 | Ga0070661_1006626812 | 70 |
| 100 | 3300005344 | Ga0070661_100823006 | Ga0070661_1008230062 | 70 |
| 101 | 3300005344 | Ga0070661_101572430 | Ga0070661_1015724302 | 70 |
| 102 | 3300005345 | Ga0070692_10538256 | Ga0070692_105382562 | 70 |
| 103 | 3300005345 | Ga0070692_10559033 | Ga0070692_105590331 | 70 |
| 104 | 3300005347 | Ga0070668_101846966 | Ga0070668_1018469662 | 70 |
| 105 | 3300005353 | Ga0070669_100269000 | Ga0070669_1002690002 | 70 |
| 106 | 3300005353 | Ga0070669_101440420 | Ga0070669_1014404202 | 70 |
| 107 | 3300005354 | Ga0070675_100128221 | Ga0070675_1001282213 | 70 |
| 108 | 3300005366 | Ga0070659_100105341 | Ga0070659_1001053413 | 70 |
| 109 | 3300005366 | Ga0070659_100803984 | Ga0070659_1008039842 | 70 |
| 110 | 3300005366 | Ga0070659_102044092 | Ga0070659_1020440922 | 70 |
| 111 | 3300005367 | Ga0070667_101364081 | Ga0070667_1013640812 | 70 |
| 112 | 3300005434 | Ga0070709_10304699 | Ga0070709_103046992 | 70 |
| 113 | 3300005434 | Ga0070709_10395101 | Ga0070709_103951012 | 70 |
| 114 | 3300005434 | Ga0070709_10416270 | Ga0070709_104162701 | 70 |
| 115 | 3300005435 | Ga0070714_101767443 | Ga0070714_1017674431 | 70 |
| 116 | 3300005437 | Ga0070710_10386282 | Ga0070710_103862822 | 70 |
| 117 | 3300005439 | Ga0070711_101728939 | Ga0070711_1017289392 | 70 |
| 118 | 3300005440 | Ga0070705_100018256 | Ga0070705_1000182564 | 70 |
| 119 | 3300005440 | Ga0070705_100117496 | Ga0070705_1001174962 | 70 |
| 120 | 3300005440 | Ga0070705_100164227 | Ga0070705_1001642272 | 70 |
| 121 | 3300005440 | Ga0070705_100187775 | Ga0070705_1001877753 | 70 |
| 122 | 3300005440 | Ga0070705_100314584 | Ga0070705_1003145842 | 70 |
| 123 | 3300005440 | Ga0070705_100696077 | Ga0070705_1006960772 | 70 |
| 124 | 3300005444 | Ga0070694_100015093 | Ga0070694_1000150932 | 70 |
| 125 | 3300005444 | Ga0070694_100087534 | Ga0070694_1000875342 | 70 |
| 126 | 3300005444 | Ga0070694_100093845 | Ga0070694_1000938453 | 70 |
| 127 | 3300005444 | Ga0070694_100186044 | Ga0070694_1001860442 | 70 |
| 128 | 3300005444 | Ga0070694_100755738 | Ga0070694_1007557382 | 70 |
| 129 | 3300005444 | Ga0070694_101879420 | Ga0070694_1018794201 | 70 |
| 130 | 3300005445 | Ga0070708_100049447 | Ga0070708_1000494474 | 70 |
| 131 | 3300005445 | Ga0070708_100065163 | Ga0070708_1000651632 | 70 |
| 132 | 3300005445 | Ga0070708_100530042 | Ga0070708_1005300422 | 70 |
| 133 | 3300005445 | Ga0070708_100561300 | Ga0070708_1005613001 | 70 |
| 134 | 3300005445 | Ga0070708_100579219 | Ga0070708_1005792192 | 70 |
| 135 | 3300005445 | Ga0070708_100652480 | Ga0070708_1006524801 | 70 |
| 136 | 3300005445 | Ga0070708_100765511 | Ga0070708_1007655111 | 70 |
| 137 | 3300005445 | Ga0070708_100780906 | Ga0070708_1007809062 | 70 |
| 138 | 3300005445 | Ga0070708_101116976 | Ga0070708_1011169761 | 70 |
| 139 | 3300005445 | Ga0070708_101584813 | Ga0070708_1015848132 | 70 |
| 140 | 3300005445 | Ga0070708_102021728 | Ga0070708_1020217281 | 70 |
| 141 | 3300005455 | Ga0070663_101420644 | Ga0070663_1014206441 | 70 |
| 142 | 3300005455 | Ga0070663_101904310 | Ga0070663_1019043102 | 70 |
| 143 | 3300005455 | Ga0070663_102109267 | Ga0070663_1021092671 | 70 |
| 144 | 3300005457 | Ga0070662_100054765 | Ga0070662_1000547653 | 70 |
| 145 | 3300005457 | Ga0070662_100182576 | Ga0070662_1001825762 | 70 |
| 146 | 3300005458 | Ga0070681_10022957 | Ga0070681_100229574 | 70 |
| 147 | 3300005458 | Ga0070681_10027906 | Ga0070681_100279062 | 70 |
| 148 | 3300005458 | Ga0070681_10529563 | Ga0070681_105295632 | 70 |
| 149 | 3300005458 | Ga0070681_10599775 | Ga0070681_105997752 | 70 |
| 150 | 3300005458 | Ga0070681_10971166 | Ga0070681_109711662 | 70 |
| 151 | 3300005459 | Ga0068867_100483907 | Ga0068867_1004839072 | 70 |
| 152 | 3300005459 | Ga0068867_100556872 | Ga0068867_1005568722 | 70 |
| 153 | 3300005459 | Ga0068867_101832383 | Ga0068867_1018323832 | 70 |
| 154 | 3300005467 | Ga0070706_100009183 | Ga0070706_1000091835 | 70 |
| 155 | 3300005467 | Ga0070706_100093815 | Ga0070706_1000938152 | 70 |
| 156 | 3300005467 | Ga0070706_100783954 | Ga0070706_1007839541 | 70 |
| 157 | 3300005467 | Ga0070706_101710122 | Ga0070706_1017101221 | 70 |
| 158 | 3300005468 | Ga0070707_100002150 | Ga0070707_10000215019 | 70 |
| 159 | 3300005468 | Ga0070707_100029350 | Ga0070707_1000293502 | 70 |
| 160 | 3300005468 | Ga0070707_100096466 | Ga0070707_1000964663 | 70 |
| 161 | 3300005468 | Ga0070707_100187680 | Ga0070707_1001876803 | 70 |
| 162 | 3300005468 | Ga0070707_100327777 | Ga0070707_1003277772 | 70 |
| 163 | 3300005468 | Ga0070707_100357994 | Ga0070707_1003579942 | 70 |
| 164 | 3300005468 | Ga0070707_100450350 | Ga0070707_1004503502 | 70 |
| 165 | 3300005468 | Ga0070707_100507663 | Ga0070707_1005076632 | 70 |
| 166 | 3300005471 | Ga0070698_100003276 | Ga0070698_1000032768 | 70 |
| 167 | 3300005471 | Ga0070698_100007458 | Ga0070698_1000074586 | 70 |
| 168 | 3300005471 | Ga0070698_100015455 | Ga0070698_1000154555 | 70 |
| 169 | 3300005471 | Ga0070698_100270152 | Ga0070698_1002701521 | 70 |
| 170 | 3300005471 | Ga0070698_100353707 | Ga0070698_1003537072 | 70 |
| 171 | 3300005471 | Ga0070698_100488468 | Ga0070698_1004884682 | 70 |
| 172 | 3300005471 | Ga0070698_101719136 | Ga0070698_1017191361 | 70 |
| 173 | 3300005518 | Ga0070699_100002133 | Ga0070699_10000213310 | 70 |
| 174 | 3300005518 | Ga0070699_100005989 | Ga0070699_1000059895 | 70 |
| 175 | 3300005518 | Ga0070699_100007511 | Ga0070699_1000075114 | 70 |
| 176 | 3300005518 | Ga0070699_100017837 | Ga0070699_1000178373 | 70 |
| 177 | 3300005518 | Ga0070699_100028112 | Ga0070699_1000281123 | 70 |
| 178 | 3300005518 | Ga0070699_100077326 | Ga0070699_1000773262 | 70 |
| 179 | 3300005518 | Ga0070699_100160149 | Ga0070699_1001601492 | 70 |
| 180 | 3300005518 | Ga0070699_100181645 | Ga0070699_1001816453 | 70 |
| 181 | 3300005518 | Ga0070699_100234006 | Ga0070699_1002340063 | 70 |
| 182 | 3300005518 | Ga0070699_102076596 | Ga0070699_1020765961 | 70 |
| 183 | 3300005518 | Ga0070699_102172857 | Ga0070699_1021728571 | 70 |
| 184 | 3300005530 | Ga0070679_100021440 | Ga0070679_1000214406 | 70 |
| 185 | 3300005530 | Ga0070679_100027542 | Ga0070679_1000275422 | 70 |
| 186 | 3300005530 | Ga0070679_101901992 | Ga0070679_1019019921 | 70 |
| 187 | 3300005535 | Ga0070684_100317929 | Ga0070684_1003179292 | 70 |
| 188 | 3300005535 | Ga0070684_101094225 | Ga0070684_1010942252 | 70 |
| 189 | 3300005536 | Ga0070697_100006203 | Ga0070697_1000062033 | 70 |
| 190 | 3300005536 | Ga0070697_100163462 | Ga0070697_1001634623 | 70 |
| 191 | 3300005536 | Ga0070697_100250111 | Ga0070697_1002501111 | 70 |
| 192 | 3300005536 | Ga0070697_100336674 | Ga0070697_1003366742 | 70 |
| 193 | 3300005536 | Ga0070697_100471476 | Ga0070697_1004714762 | 70 |
| 194 | 3300005536 | Ga0070697_100562967 | Ga0070697_1005629672 | 70 |
| 195 | 3300005536 | Ga0070697_100568784 | Ga0070697_1005687842 | 70 |
| 196 | 3300005536 | Ga0070697_100620052 | Ga0070697_1006200521 | 70 |
| 197 | 3300005536 | Ga0070697_100691209 | Ga0070697_1006912092 | 70 |
| 198 | 3300005539 | Ga0068853_101307303 | Ga0068853_1013073032 | 70 |
| 199 | 3300005543 | Ga0070672_101474129 | Ga0070672_1014741292 | 70 |
| 200 | 3300005544 | Ga0070686_100335764 | Ga0070686_1003357642 | 70 |
| 201 | 3300005545 | Ga0070695_100014271 | Ga0070695_1000142711 | 70 |
| 202 | 3300005545 | Ga0070695_100124557 | Ga0070695_1001245571 | 70 |
| 203 | 3300005545 | Ga0070695_100348395 | Ga0070695_1003483952 | 70 |
| 204 | 3300005545 | Ga0070695_100494358 | Ga0070695_1004943582 | 70 |
| 205 | 3300005546 | Ga0070696_100000865 | Ga0070696_10000086510 | 70 |
| 206 | 3300005546 | Ga0070696_100005546 | Ga0070696_1000055463 | 70 |
| 207 | 3300005546 | Ga0070696_100052367 | Ga0070696_1000523673 | 70 |
| 208 | 3300005546 | Ga0070696_100081411 | Ga0070696_1000814112 | 70 |
| 209 | 3300005546 | Ga0070696_100100927 | Ga0070696_1001009272 | 70 |
| 210 | 3300005546 | Ga0070696_100128402 | Ga0070696_1001284022 | 70 |
| 211 | 3300005546 | Ga0070696_100322469 | Ga0070696_1003224692 | 70 |
| 212 | 3300005546 | Ga0070696_100354374 | Ga0070696_1003543742 | 70 |
| 213 | 3300005546 | Ga0070696_100812935 | Ga0070696_1008129352 | 70 |
| 214 | 3300005546 | Ga0070696_100846174 | Ga0070696_1008461742 | 70 |
| 215 | 3300005546 | Ga0070696_100949815 | Ga0070696_1009498152 | 70 |
| 216 | 3300005546 | Ga0070696_101131312 | Ga0070696_1011313121 | 70 |
| 217 | 3300005546 | Ga0070696_101314476 | Ga0070696_1013144762 | 70 |
| 218 | 3300005547 | Ga0070693_100031072 | Ga0070693_1000310724 | 70 |
| 219 | 3300005547 | Ga0070693_100074516 | Ga0070693_1000745162 | 70 |
| 220 | 3300005547 | Ga0070693_100173961 | Ga0070693_1001739612 | 70 |
| 221 | 3300005549 | Ga0070704_100001871 | Ga0070704_1000018712 | 70 |
| 222 | 3300005549 | Ga0070704_100067181 | Ga0070704_1000671813 | 70 |
| 223 | 3300005549 | Ga0070704_100148146 | Ga0070704_1001481462 | 70 |
| 224 | 3300005549 | Ga0070704_100678410 | Ga0070704_1006784102 | 70 |
| 225 | 3300005549 | Ga0070704_101261794 | Ga0070704_1012617942 | 70 |
| 226 | 3300005549 | Ga0070704_101418980 | Ga0070704_1014189802 | 70 |
| 227 | 3300005563 | Ga0068855_100826175 | Ga0068855_1008261752 | 70 |
| 228 | 3300005564 | Ga0070664_100096840 | Ga0070664_1000968403 | 70 |
| 229 | 3300005564 | Ga0070664_100925678 | Ga0070664_1009256782 | 70 |
| 230 | 3300005577 | Ga0068857_101145760 | Ga0068857_1011457602 | 70 |
| 231 | 3300005578 | Ga0068854_100638193 | Ga0068854_1006381932 | 70 |
| 232 | 3300005578 | Ga0068854_101194771 | Ga0068854_1011947712 | 70 |
| 233 | 3300005614 | Ga0068856_101300785 | Ga0068856_1013007852 | 70 |
| 234 | 3300005615 | Ga0070702_100180507 | Ga0070702_1001805072 | 70 |
| 235 | 3300005616 | Ga0068852_100600131 | Ga0068852_1006001312 | 70 |
| 236 | 3300005616 | Ga0068852_101633140 | Ga0068852_1016331402 | 70 |
| 237 | 3300005617 | Ga0068859_100053225 | Ga0068859_1000532252 | 70 |
| 238 | 3300005617 | Ga0068859_100109269 | Ga0068859_1001092693 | 70 |
| 239 | 3300005617 | Ga0068859_100188772 | Ga0068859_1001887722 | 70 |
| 240 | 3300005617 | Ga0068859_100663057 | Ga0068859_1006630572 | 70 |
| 241 | 3300005617 | Ga0068859_102668663 | Ga0068859_1026686632 | 70 |
| 242 | 3300005618 | Ga0068864_100044368 | Ga0068864_1000443685 | 70 |
| 243 | 3300005618 | Ga0068864_100553708 | Ga0068864_1005537082 | 70 |
| 244 | 3300005618 | Ga0068864_100610233 | Ga0068864_1006102332 | 70 |
| 245 | 3300005618 | Ga0068864_100620167 | Ga0068864_1006201672 | 70 |
| 246 | 3300005618 | Ga0068864_100882891 | Ga0068864_1008828911 | 70 |
| 247 | 3300005718 | Ga0068866_10032052 | Ga0068866_100320521 | 70 |
| 248 | 3300005719 | Ga0068861_102439840 | Ga0068861_1024398402 | 70 |
| 249 | 3300005834 | Ga0068851_10455630 | Ga0068851_104556302 | 70 |
| 250 | 3300005840 | Ga0068870_10561569 | Ga0068870_105615692 | 70 |
| 251 | 3300005840 | Ga0068870_10582049 | Ga0068870_105820492 | 70 |
| 252 | 3300005841 | Ga0068863_100011280 | Ga0068863_1000112802 | 70 |
| 253 | 3300005841 | Ga0068863_102450612 | Ga0068863_1024506122 | 70 |
| 254 | 3300005842 | Ga0068858_100657775 | Ga0068858_1006577752 | 70 |
| 255 | 3300005842 | Ga0068858_101382130 | Ga0068858_1013821302 | 70 |
| 256 | 3300005844 | Ga0068862_100220504 | Ga0068862_1002205042 | 70 |
| 257 | 3300005844 | Ga0068862_100518549 | Ga0068862_1005185492 | 70 |
| 258 | 3300005844 | Ga0068862_100903982 | Ga0068862_1009039822 | 70 |
| 259 | 3300005844 | Ga0068862_101007983 | Ga0068862_1010079832 | 70 |
| 260 | 3300005844 | Ga0068862_101077074 | Ga0068862_1010770742 | 70 |
| 261 | 3300005937 | Ga0081455_10080975 | Ga0081455_100809753 | 70 |
| 262 | 3300005981 | Ga0081538_10046524 | Ga0081538_100465242 | 70 |
| 263 | 3300006163 | Ga0070715_10098934 | Ga0070715_100989342 | 70 |
| 264 | 3300006163 | Ga0070715_10479031 | Ga0070715_104790312 | 70 |
| 265 | 3300006173 | Ga0070716_100249063 | Ga0070716_1002490632 | 70 |
| 266 | 3300006173 | Ga0070716_101420647 | Ga0070716_1014206472 | 70 |
| 267 | 3300006173 | Ga0070716_101543766 | Ga0070716_1015437662 | 70 |
| 268 | 3300006175 | Ga0070712_100047991 | Ga0070712_1000479913 | 70 |
| 269 | 3300006358 | Ga0068871_102264105 | Ga0068871_1022641051 | 70 |
| 270 | 3300006844 | Ga0075428_100006932 | Ga0075428_1000069327 | 70 |
| 271 | 3300006844 | Ga0075428_100058586 | Ga0075428_1000585862 | 70 |
| 272 | 3300006844 | Ga0075428_100381825 | Ga0075428_1003818252 | 70 |
| 273 | 3300006844 | Ga0075428_101389275 | Ga0075428_1013892752 | 70 |
| 274 | 3300006844 | Ga0075428_101755781 | Ga0075428_1017557811 | 70 |
| 275 | 3300006844 | Ga0075428_101777500 | Ga0075428_1017775002 | 70 |
| 276 | 3300006846 | Ga0075430_100092716 | Ga0075430_1000927162 | 70 |
| 277 | 3300006846 | Ga0075430_100354452 | Ga0075430_1003544522 | 70 |
| 278 | 3300006846 | Ga0075430_100637014 | Ga0075430_1006370141 | 70 |
| 279 | 3300006846 | Ga0075430_100690207 | Ga0075430_1006902072 | 70 |
| 280 | 3300006846 | Ga0075430_101147872 | Ga0075430_1011478722 | 70 |
| 281 | 3300006847 | Ga0075431_100026669 | Ga0075431_1000266692 | 70 |
| 282 | 3300006847 | Ga0075431_100047894 | Ga0075431_1000478942 | 70 |
| 283 | 3300006847 | Ga0075431_100081818 | Ga0075431_1000818183 | 70 |
| 284 | 3300006847 | Ga0075431_100230767 | Ga0075431_1002307673 | 70 |
| 285 | 3300006847 | Ga0075431_100278802 | Ga0075431_1002788022 | 70 |
| 286 | 3300006847 | Ga0075431_100292081 | Ga0075431_1002920812 | 70 |
| 287 | 3300006847 | Ga0075431_100604564 | Ga0075431_1006045642 | 70 |
| 288 | 3300006847 | Ga0075431_100647237 | Ga0075431_1006472371 | 70 |
| 289 | 3300006847 | Ga0075431_102101238 | Ga0075431_1021012382 | 70 |
| 290 | 3300006852 | Ga0075433_10006922 | Ga0075433_100069227 | 70 |
| 291 | 3300006852 | Ga0075433_10076342 | Ga0075433_100763423 | 70 |
| 292 | 3300006852 | Ga0075433_10170726 | Ga0075433_101707262 | 70 |
| 293 | 3300006852 | Ga0075433_10241728 | Ga0075433_102417283 | 70 |
| 294 | 3300006852 | Ga0075433_11068583 | Ga0075433_110685832 | 70 |
| 295 | 3300006852 | Ga0075433_11170367 | Ga0075433_111703672 | 70 |
| 296 | 3300006852 | Ga0075433_11503054 | Ga0075433_115030541 | 70 |
| 297 | 3300006871 | Ga0075434_100005726 | Ga0075434_1000057264 | 70 |
| 298 | 3300006871 | Ga0075434_100114353 | Ga0075434_1001143533 | 70 |
| 299 | 3300006871 | Ga0075434_100383905 | Ga0075434_1003839052 | 70 |
| 300 | 3300006871 | Ga0075434_100504379 | Ga0075434_1005043792 | 70 |
| 301 | 3300006871 | Ga0075434_100736903 | Ga0075434_1007369032 | 70 |
| 302 | 3300006871 | Ga0075434_101321233 | Ga0075434_1013212332 | 70 |
| 303 | 3300006880 | Ga0075429_100000623 | Ga0075429_10000062312 | 70 |
| 304 | 3300006880 | Ga0075429_100318249 | Ga0075429_1003182492 | 70 |
| 305 | 3300006880 | Ga0075429_100593075 | Ga0075429_1005930752 | 70 |
| 306 | 3300006880 | Ga0075429_100798229 | Ga0075429_1007982292 | 70 |
| 307 | 3300006880 | Ga0075429_100948945 | Ga0075429_1009489451 | 70 |
| 308 | 3300006880 | Ga0075429_101969872 | Ga0075429_1019698722 | 70 |
| 309 | 3300006914 | Ga0075436_100043895 | Ga0075436_1000438952 | 70 |
| 310 | 3300006914 | Ga0075436_100176983 | Ga0075436_1001769833 | 70 |
| 311 | 3300006914 | Ga0075436_100184775 | Ga0075436_1001847752 | 70 |
| 312 | 3300006914 | Ga0075436_100231115 | Ga0075436_1002311152 | 70 |
| 313 | 3300006931 | Ga0097620_100053224 | Ga0097620_1000532242 | 70 |
| 314 | 3300006931 | Ga0097620_100109269 | Ga0097620_1001092693 | 70 |
| 315 | 3300006931 | Ga0097620_100188778 | Ga0097620_1001887782 | 70 |
| 316 | 3300006931 | Ga0097620_100663014 | Ga0097620_1006630142 | 70 |
| 317 | 3300006931 | Ga0097620_102669440 | Ga0097620_1026694402 | 70 |
| 318 | 3300007076 | Ga0075435_100024954 | Ga0075435_1000249544 | 70 |
| 319 | 3300007076 | Ga0075435_100406113 | Ga0075435_1004061132 | 70 |
| 320 | 3300007076 | Ga0075435_100533266 | Ga0075435_1005332662 | 70 |
| 321 | 3300007076 | Ga0075435_100634926 | Ga0075435_1006349262 | 70 |
| 322 | 3300007076 | Ga0075435_100643050 | Ga0075435_1006430502 | 70 |
| 323 | 3300007076 | Ga0075435_100693939 | Ga0075435_1006939392 | 70 |
| 324 | 3300007076 | Ga0075435_100959981 | Ga0075435_1009599812 | 70 |
| 325 | 3300007076 | Ga0075435_101474367 | Ga0075435_1014743672 | 70 |
| 326 | 3300009094 | Ga0111539_10581234 | Ga0111539_105812342 | 70 |
| 327 | 3300009094 | Ga0111539_10618327 | Ga0111539_106183272 | 70 |
| 328 | 3300009094 | Ga0111539_10855312 | Ga0111539_108553123 | 70 |
| 329 | 3300009094 | Ga0111539_11183076 | Ga0111539_111830761 | 70 |
| 330 | 3300009147 | Ga0114129_10000112 | Ga0114129_1000011275 | 70 |
| 331 | 3300009147 | Ga0114129_10086755 | Ga0114129_100867553 | 70 |
| 332 | 3300009147 | Ga0114129_10129099 | Ga0114129_101290993 | 70 |
| 333 | 3300009147 | Ga0114129_10293880 | Ga0114129_102938803 | 70 |
| 334 | 3300009147 | Ga0114129_10433001 | Ga0114129_104330013 | 70 |
| 335 | 3300009147 | Ga0114129_10515241 | Ga0114129_105152412 | 70 |
| 336 | 3300009147 | Ga0114129_11512801 | Ga0114129_115128012 | 70 |
| 337 | 3300009148 | Ga0105243_10724450 | Ga0105243_107244501 | 70 |
| 338 | 3300009148 | Ga0105243_11613171 | Ga0105243_116131711 | 70 |
| 339 | 3300009148 | Ga0105243_12617250 | Ga0105243_126172502 | 70 |
| 340 | 3300009148 | Ga0105243_13077009 | Ga0105243_130770092 | 70 |
| 341 | 3300009174 | Ga0105241_10654456 | Ga0105241_106544562 | 70 |
| 342 | 3300009177 | Ga0105248_10913795 | Ga0105248_109137952 | 70 |
| 343 | 3300009545 | Ga0105237_10418652 | Ga0105237_104186522 | 70 |
| 344 | 3300009551 | Ga0105238_11999119 | Ga0105238_119991192 | 70 |
| 345 | 3300009553 | Ga0105249_10202415 | Ga0105249_102024152 | 70 |
| 346 | 3300009553 | Ga0105249_10882978 | Ga0105249_108829782 | 70 |
| 347 | 3300009553 | Ga0105249_10972564 | Ga0105249_109725642 | 70 |
| 348 | 3300009553 | Ga0105249_12950528 | Ga0105249_129505282 | 70 |
| 349 | 3300010375 | Ga0105239_10005218 | Ga0105239_1000521812 | 70 |
| 350 | 3300010375 | Ga0105239_10992321 | Ga0105239_109923212 | 70 |
| 351 | 3300011119 | Ga0105246_10364215 | Ga0105246_103642151 | 70 |
| 352 | 3300013306 | Ga0163162_12561906 | Ga0163162_125619062 | 70 |
| 353 | 3300013308 | Ga0157375_11037934 | Ga0157375_110379342 | 70 |
| 354 | 3300014325 | Ga0163163_10005758 | Ga0163163_100057584 | 70 |
| 355 | 3300014325 | Ga0163163_10893560 | Ga0163163_108935601 | 70 |
| 356 | 3300014325 | Ga0163163_10933766 | Ga0163163_109337662 | 70 |
| 357 | 3300014325 | Ga0163163_11085161 | Ga0163163_110851611 | 70 |
| 358 | 3300014326 | Ga0157380_12526838 | Ga0157380_125268382 | 70 |
| 359 | 3300014326 | Ga0157380_12797457 | Ga0157380_127974571 | 70 |
| 360 | 3300014326 | Ga0157380_13411834 | Ga0157380_134118342 | 70 |
| 361 | 3300014497 | Ga0182008_10378723 | Ga0182008_103787232 | 70 |
| 362 | 3300014497 | Ga0182008_10600299 | Ga0182008_106002992 | 70 |
| 363 | 3300014968 | Ga0157379_10118199 | Ga0157379_101181992 | 70 |
| 364 | 3300021384 | Ga0213876_10524693 | Ga0213876_105246932 | 70 |
| 365 | 3300025321 | Ga0207656_10228544 | Ga0207656_102285442 | 70 |
| 366 | 3300025898 | Ga0207692_10343998 | Ga0207692_103439982 | 70 |
| 367 | 3300025899 | Ga0207642_10866470 | Ga0207642_108664701 | 70 |
| 368 | 3300025901 | Ga0207688_10495040 | Ga0207688_104950402 | 70 |
| 369 | 3300025905 | Ga0207685_10363688 | Ga0207685_103636882 | 70 |
| 370 | 3300025905 | Ga0207685_10388143 | Ga0207685_103881432 | 70 |
| 371 | 3300025906 | Ga0207699_10306992 | Ga0207699_103069922 | 70 |
| 372 | 3300025906 | Ga0207699_10344016 | Ga0207699_103440161 | 70 |
| 373 | 3300025906 | Ga0207699_10613428 | Ga0207699_106134281 | 70 |
| 374 | 3300025908 | Ga0207643_10456991 | Ga0207643_104569912 | 70 |
| 375 | 3300025910 | Ga0207684_10034088 | Ga0207684_100340883 | 70 |
| 376 | 3300025910 | Ga0207684_10123849 | Ga0207684_101238491 | 70 |
| 377 | 3300025910 | Ga0207684_10970023 | Ga0207684_109700231 | 70 |
| 378 | 3300025911 | Ga0207654_11414554 | Ga0207654_114145542 | 70 |
| 379 | 3300025912 | Ga0207707_10000702 | Ga0207707_1000070215 | 70 |
| 380 | 3300025912 | Ga0207707_10051069 | Ga0207707_100510694 | 70 |
| 381 | 3300025912 | Ga0207707_10648027 | Ga0207707_106480272 | 70 |
| 382 | 3300025914 | Ga0207671_10435374 | Ga0207671_104353741 | 70 |
| 383 | 3300025917 | Ga0207660_10005346 | Ga0207660_100053465 | 70 |
| 384 | 3300025917 | Ga0207660_10066197 | Ga0207660_100661973 | 70 |
| 385 | 3300025917 | Ga0207660_10156626 | Ga0207660_101566262 | 70 |
| 386 | 3300025920 | Ga0207649_10725055 | Ga0207649_107250552 | 70 |
| 387 | 3300025921 | Ga0207652_10002232 | Ga0207652_1000223219 | 70 |
| 388 | 3300025921 | Ga0207652_10127325 | Ga0207652_101273252 | 70 |
| 389 | 3300025921 | Ga0207652_10174235 | Ga0207652_101742352 | 70 |
| 390 | 3300025921 | Ga0207652_11792338 | Ga0207652_117923382 | 70 |
| 391 | 3300025922 | Ga0207646_10022200 | Ga0207646_100222005 | 70 |
| 392 | 3300025922 | Ga0207646_10039361 | Ga0207646_100393614 | 70 |
| 393 | 3300025922 | Ga0207646_10080269 | Ga0207646_100802692 | 70 |
| 394 | 3300025922 | Ga0207646_10711592 | Ga0207646_107115922 | 70 |
| 395 | 3300025922 | Ga0207646_11157793 | Ga0207646_111577932 | 70 |
| 396 | 3300025922 | Ga0207646_11878428 | Ga0207646_118784282 | 70 |
| 397 | 3300025923 | Ga0207681_10710834 | Ga0207681_107108342 | 70 |
| 398 | 3300025925 | Ga0207650_10510716 | Ga0207650_105107162 | 70 |
| 399 | 3300025926 | Ga0207659_10438377 | Ga0207659_104383772 | 70 |
| 400 | 3300025926 | Ga0207659_10664298 | Ga0207659_106642982 | 70 |
| 401 | 3300025926 | Ga0207659_10821271 | Ga0207659_108212712 | 70 |
| 402 | 3300025929 | Ga0207664_11692677 | Ga0207664_116926772 | 70 |
| 403 | 3300025932 | Ga0207690_10432744 | Ga0207690_104327442 | 70 |
| 404 | 3300025933 | Ga0207706_10088271 | Ga0207706_100882713 | 70 |
| 405 | 3300025933 | Ga0207706_10089638 | Ga0207706_100896383 | 70 |
| 406 | 3300025933 | Ga0207706_10880555 | Ga0207706_108805552 | 70 |
| 407 | 3300025933 | Ga0207706_11039227 | Ga0207706_110392272 | 70 |
| 408 | 3300025935 | Ga0207709_11235435 | Ga0207709_112354351 | 70 |
| 409 | 3300025935 | Ga0207709_11582118 | Ga0207709_115821181 | 70 |
| 410 | 3300025936 | Ga0207670_10126412 | Ga0207670_101264122 | 70 |
| 411 | 3300025937 | Ga0207669_10896170 | Ga0207669_108961702 | 70 |
| 412 | 3300025939 | Ga0207665_10621177 | Ga0207665_106211772 | 70 |
| 413 | 3300025939 | Ga0207665_10904169 | Ga0207665_109041692 | 70 |
| 414 | 3300025940 | Ga0207691_10853619 | Ga0207691_108536192 | 70 |
| 415 | 3300025940 | Ga0207691_11410739 | Ga0207691_114107392 | 70 |
| 416 | 3300025941 | Ga0207711_10957509 | Ga0207711_109575092 | 70 |
| 417 | 3300025942 | Ga0207689_10544173 | Ga0207689_105441732 | 70 |
| 418 | 3300025944 | Ga0207661_10101253 | Ga0207661_101012533 | 70 |
| 419 | 3300025944 | Ga0207661_11130502 | Ga0207661_111305022 | 70 |
| 420 | 3300025945 | Ga0207679_10132968 | Ga0207679_101329683 | 70 |
| 421 | 3300025945 | Ga0207679_10184201 | Ga0207679_101842013 | 70 |
| 422 | 3300025945 | Ga0207679_10274785 | Ga0207679_102747852 | 70 |
| 423 | 3300025945 | Ga0207679_10835659 | Ga0207679_108356592 | 70 |
| 424 | 3300025960 | Ga0207651_10512051 | Ga0207651_105120512 | 70 |
| 425 | 3300025961 | Ga0207712_10546134 | Ga0207712_105461342 | 70 |
| 426 | 3300025961 | Ga0207712_10810564 | Ga0207712_108105642 | 70 |
| 427 | 3300025961 | Ga0207712_12122183 | Ga0207712_121221832 | 70 |
| 428 | 3300025972 | Ga0207668_12023245 | Ga0207668_120232452 | 70 |
| 429 | 3300025981 | Ga0207640_10728719 | Ga0207640_107287192 | 70 |
| 430 | 3300025986 | Ga0207658_10242463 | Ga0207658_102424633 | 70 |
| 431 | 3300026023 | Ga0207677_10886241 | Ga0207677_108862411 | 70 |
| 432 | 3300026023 | Ga0207677_11360798 | Ga0207677_113607981 | 70 |
| 433 | 3300026035 | Ga0207703_10247313 | Ga0207703_102473132 | 70 |
| 434 | 3300026035 | Ga0207703_11096166 | Ga0207703_110961662 | 70 |
| 435 | 3300026041 | Ga0207639_11820483 | Ga0207639_118204832 | 70 |
| 436 | 3300026067 | Ga0207678_10248116 | Ga0207678_102481162 | 70 |
| 437 | 3300026067 | Ga0207678_10478596 | Ga0207678_104785962 | 70 |
| 438 | 3300026075 | Ga0207708_10079069 | Ga0207708_100790692 | 70 |
| 439 | 3300026078 | Ga0207702_11583342 | Ga0207702_115833421 | 70 |
| 440 | 3300026088 | Ga0207641_10038713 | Ga0207641_100387134 | 70 |
| 441 | 3300026088 | Ga0207641_10067260 | Ga0207641_100672604 | 70 |
| 442 | 3300026088 | Ga0207641_12294307 | Ga0207641_122943072 | 70 |
| 443 | 3300026089 | Ga0207648_10093302 | Ga0207648_100933022 | 70 |
| 444 | 3300026089 | Ga0207648_10645401 | Ga0207648_106454012 | 70 |
| 445 | 3300026095 | Ga0207676_10174486 | Ga0207676_101744863 | 70 |
| 446 | 3300026095 | Ga0207676_10607718 | Ga0207676_106077182 | 70 |
| 447 | 3300026095 | Ga0207676_10718672 | Ga0207676_107186722 | 70 |
| 448 | 3300026095 | Ga0207676_10820683 | Ga0207676_108206832 | 70 |
| 449 | 3300026116 | Ga0207674_10807843 | Ga0207674_108078432 | 70 |
| 450 | 3300026116 | Ga0207674_11555966 | Ga0207674_115559662 | 70 |
| 451 | 3300026118 | Ga0207675_100500015 | Ga0207675_1005000152 | 70 |
| 452 | 3300026118 | Ga0207675_100993439 | Ga0207675_1009934392 | 70 |
| 453 | 3300026118 | Ga0207675_100999672 | Ga0207675_1009996722 | 70 |
| 454 | 3300026118 | Ga0207675_101687567 | Ga0207675_1016875671 | 70 |
| 455 | 3300026118 | Ga0207675_102592228 | Ga0207675_1025922281 | 70 |
| 456 | 3300026142 | Ga0207698_11049818 | Ga0207698_110498182 | 70 |
| 457 | 3300027364 | Ga0209967_1063523 | Ga0209967_10635231 | 70 |
| 458 | 3300027424 | Ga0209984_1050418 | Ga0209984_10504182 | 70 |
| 459 | 3300027552 | Ga0209982_1091304 | Ga0209982_10913041 | 70 |
| 460 | 3300027682 | Ga0209971_1024024 | Ga0209971_10240242 | 70 |
| 461 | 3300027682 | Ga0209971_1026490 | Ga0209971_10264903 | 70 |
| 462 | 3300027682 | Ga0209971_1125827 | Ga0209971_11258272 | 70 |
| 463 | 3300027717 | Ga0209998_10128984 | Ga0209998_101289841 | 70 |
| 464 | 3300027876 | Ga0209974_10010987 | Ga0209974_100109871 | 70 |
| 465 | 3300027876 | Ga0209974_10059094 | Ga0209974_100590942 | 70 |
| 466 | 3300028380 | Ga0268265_11032208 | Ga0268265_110322082 | 70 |
| 467 | 3300028380 | Ga0268265_11073493 | Ga0268265_110734932 | 70 |
| 468 | 3300028380 | Ga0268265_11506653 | Ga0268265_115066532 | 70 |
| 469 | 3300028380 | Ga0268265_11969814 | Ga0268265_119698141 | 70 |
| 470 | 3300030745 | Ga0316182_1432439 | Ga0316182_14324392 | 70 |
| 471 | 3300031548 | Ga0307408_100057953 | Ga0307408_1000579533 | 70 |
| 472 | 3300031548 | Ga0307408_100096438 | Ga0307408_1000964383 | 70 |
| 473 | 3300031548 | Ga0307408_100099897 | Ga0307408_1000998972 | 70 |
| 474 | 3300031548 | Ga0307408_100106929 | Ga0307408_1001069292 | 70 |
| 475 | 3300031548 | Ga0307408_100193845 | Ga0307408_1001938452 | 70 |
| 476 | 3300031548 | Ga0307408_100566018 | Ga0307408_1005660182 | 70 |
| 477 | 3300031548 | Ga0307408_100829891 | Ga0307408_1008298912 | 70 |
| 478 | 3300031548 | Ga0307408_101270147 | Ga0307408_1012701472 | 70 |
| 479 | 3300031548 | Ga0307408_101942394 | Ga0307408_1019423941 | 70 |
| 480 | 3300031548 | Ga0307408_102305101 | Ga0307408_1023051012 | 70 |
| 481 | 3300031548 | Ga0307408_102522729 | Ga0307408_1025227292 | 70 |
| 482 | 3300031731 | Ga0307405_10040038 | Ga0307405_100400383 | 70 |
| 483 | 3300031731 | Ga0307405_10047774 | Ga0307405_100477742 | 70 |
| 484 | 3300031731 | Ga0307405_10070175 | Ga0307405_100701751 | 70 |
| 485 | 3300031731 | Ga0307405_10179436 | Ga0307405_101794362 | 70 |
| 486 | 3300031731 | Ga0307405_10262034 | Ga0307405_102620342 | 70 |
| 487 | 3300031731 | Ga0307405_10429726 | Ga0307405_104297262 | 70 |
| 488 | 3300031731 | Ga0307405_10512706 | Ga0307405_105127062 | 70 |
| 489 | 3300031731 | Ga0307405_10623831 | Ga0307405_106238312 | 70 |
| 490 | 3300031731 | Ga0307405_10641319 | Ga0307405_106413192 | 70 |
| 491 | 3300031824 | Ga0307413_10006876 | Ga0307413_100068764 | 70 |
| 492 | 3300031824 | Ga0307413_10074525 | Ga0307413_100745252 | 70 |
| 493 | 3300031824 | Ga0307413_10095448 | Ga0307413_100954482 | 70 |
| 494 | 3300031824 | Ga0307413_10112038 | Ga0307413_101120382 | 70 |
| 495 | 3300031824 | Ga0307413_10307934 | Ga0307413_103079343 | 70 |
| 496 | 3300031824 | Ga0307413_10332343 | Ga0307413_103323432 | 70 |
| 497 | 3300031824 | Ga0307413_10415232 | Ga0307413_104152322 | 70 |
| 498 | 3300031824 | Ga0307413_10453449 | Ga0307413_104534492 | 70 |
| 499 | 3300031824 | Ga0307413_10470292 | Ga0307413_104702922 | 70 |
| 500 | 3300031824 | Ga0307413_10648022 | Ga0307413_106480222 | 70 |
| 501 | 3300031824 | Ga0307413_10863720 | Ga0307413_108637201 | 70 |
| 502 | 3300031824 | Ga0307413_11010445 | Ga0307413_110104451 | 70 |
| 503 | 3300031852 | Ga0307410_10010547 | Ga0307410_100105474 | 70 |
| 504 | 3300031852 | Ga0307410_10016453 | Ga0307410_100164534 | 70 |
| 505 | 3300031852 | Ga0307410_10022765 | Ga0307410_100227653 | 70 |
| 506 | 3300031852 | Ga0307410_10023562 | Ga0307410_100235621 | 70 |
| 507 | 3300031852 | Ga0307410_10136908 | Ga0307410_101369082 | 70 |
| 508 | 3300031852 | Ga0307410_10145738 | Ga0307410_101457383 | 70 |
| 509 | 3300031852 | Ga0307410_10254991 | Ga0307410_102549911 | 70 |
| 510 | 3300031852 | Ga0307410_10299960 | Ga0307410_102999601 | 70 |
| 511 | 3300031852 | Ga0307410_10848808 | Ga0307410_108488082 | 70 |
| 512 | 3300031852 | Ga0307410_10896760 | Ga0307410_108967602 | 70 |
| 513 | 3300031852 | Ga0307410_11060957 | Ga0307410_110609572 | 70 |
| 514 | 3300031852 | Ga0307410_11731902 | Ga0307410_117319022 | 70 |
| 515 | 3300031901 | Ga0307406_10045499 | Ga0307406_100454993 | 70 |
| 516 | 3300031901 | Ga0307406_10055877 | Ga0307406_100558772 | 70 |
| 517 | 3300031901 | Ga0307406_10124194 | Ga0307406_101241943 | 70 |
| 518 | 3300031901 | Ga0307406_10226099 | Ga0307406_102260991 | 70 |
| 519 | 3300031901 | Ga0307406_10333620 | Ga0307406_103336201 | 70 |
| 520 | 3300031901 | Ga0307406_10410875 | Ga0307406_104108751 | 70 |
| 521 | 3300031901 | Ga0307406_11051703 | Ga0307406_110517032 | 70 |
| 522 | 3300031903 | Ga0307407_10048642 | Ga0307407_100486423 | 70 |
| 523 | 3300031903 | Ga0307407_10063601 | Ga0307407_100636012 | 70 |
| 524 | 3300031903 | Ga0307407_10072430 | Ga0307407_100724302 | 70 |
| 525 | 3300031903 | Ga0307407_10213278 | Ga0307407_102132782 | 70 |
| 526 | 3300031903 | Ga0307407_10361703 | Ga0307407_103617032 | 70 |
| 527 | 3300031903 | Ga0307407_10586069 | Ga0307407_105860692 | 70 |
| 528 | 3300031903 | Ga0307407_10674182 | Ga0307407_106741822 | 70 |
| 529 | 3300031903 | Ga0307407_10899617 | Ga0307407_108996172 | 70 |
| 530 | 3300031911 | Ga0307412_10083391 | Ga0307412_100833912 | 70 |
| 531 | 3300031911 | Ga0307412_10172009 | Ga0307412_101720093 | 70 |
| 532 | 3300031911 | Ga0307412_10262944 | Ga0307412_102629442 | 70 |
| 533 | 3300031911 | Ga0307412_10761373 | Ga0307412_107613732 | 70 |
| 534 | 3300031911 | Ga0307412_11724825 | Ga0307412_117248252 | 70 |
| 535 | 3300031995 | Ga0307409_100002373 | Ga0307409_1000023732 | 70 |
| 536 | 3300031995 | Ga0307409_100034623 | Ga0307409_1000346233 | 70 |
| 537 | 3300031995 | Ga0307409_100066713 | Ga0307409_1000667132 | 70 |
| 538 | 3300031995 | Ga0307409_100090409 | Ga0307409_1000904092 | 70 |
| 539 | 3300031995 | Ga0307409_100117330 | Ga0307409_1001173302 | 70 |
| 540 | 3300031995 | Ga0307409_100241673 | Ga0307409_1002416733 | 70 |
| 541 | 3300031995 | Ga0307409_100284397 | Ga0307409_1002843971 | 70 |
| 542 | 3300031995 | Ga0307409_100411102 | Ga0307409_1004111022 | 70 |
| 543 | 3300031995 | Ga0307409_100443292 | Ga0307409_1004432922 | 70 |
| 544 | 3300031995 | Ga0307409_100593627 | Ga0307409_1005936272 | 70 |
| 545 | 3300031995 | Ga0307409_101081854 | Ga0307409_1010818542 | 70 |
| 546 | 3300031995 | Ga0307409_101566830 | Ga0307409_1015668302 | 70 |
| 547 | 3300031995 | Ga0307409_102810928 | Ga0307409_1028109282 | 70 |
| 548 | 3300032002 | Ga0307416_100002032 | Ga0307416_10000203214 | 70 |
| 549 | 3300032002 | Ga0307416_100002732 | Ga0307416_1000027329 | 70 |
| 550 | 3300032002 | Ga0307416_100019764 | Ga0307416_1000197643 | 70 |
| 551 | 3300032002 | Ga0307416_100025295 | Ga0307416_1000252952 | 70 |
| 552 | 3300032002 | Ga0307416_100039174 | Ga0307416_1000391743 | 70 |
| 553 | 3300032002 | Ga0307416_100091107 | Ga0307416_1000911073 | 70 |
| 554 | 3300032002 | Ga0307416_100135441 | Ga0307416_1001354413 | 70 |
| 555 | 3300032002 | Ga0307416_100191698 | Ga0307416_1001916983 | 70 |
| 556 | 3300032002 | Ga0307416_100371035 | Ga0307416_1003710352 | 70 |
| 557 | 3300032002 | Ga0307416_100788157 | Ga0307416_1007881572 | 70 |
| 558 | 3300032002 | Ga0307416_101324007 | Ga0307416_1013240072 | 70 |
| 559 | 3300032002 | Ga0307416_101968567 | Ga0307416_1019685671 | 70 |
| 560 | 3300032002 | Ga0307416_102930118 | Ga0307416_1029301182 | 70 |
| 561 | 3300032002 | Ga0307416_103171870 | Ga0307416_1031718701 | 70 |
| 562 | 3300032004 | Ga0307414_10044787 | Ga0307414_100447872 | 70 |
| 563 | 3300032004 | Ga0307414_10062367 | Ga0307414_100623673 | 70 |
| 564 | 3300032004 | Ga0307414_10078008 | Ga0307414_100780084 | 70 |
| 565 | 3300032004 | Ga0307414_10087954 | Ga0307414_100879543 | 70 |
| 566 | 3300032004 | Ga0307414_10404669 | Ga0307414_104046692 | 70 |
| 567 | 3300032004 | Ga0307414_10456845 | Ga0307414_104568452 | 70 |
| 568 | 3300032004 | Ga0307414_10746024 | Ga0307414_107460242 | 70 |
| 569 | 3300032004 | Ga0307414_10960695 | Ga0307414_109606951 | 70 |
| 570 | 3300032004 | Ga0307414_11024811 | Ga0307414_110248112 | 70 |
| 571 | 3300032004 | Ga0307414_11103998 | Ga0307414_111039982 | 70 |
| 572 | 3300032005 | Ga0307411_10020346 | Ga0307411_100203464 | 70 |
| 573 | 3300032005 | Ga0307411_10035753 | Ga0307411_100357533 | 70 |
| 574 | 3300032005 | Ga0307411_10052115 | Ga0307411_100521153 | 70 |
| 575 | 3300032005 | Ga0307411_10081262 | Ga0307411_100812623 | 70 |
| 576 | 3300032005 | Ga0307411_10135993 | Ga0307411_101359933 | 70 |
| 577 | 3300032005 | Ga0307411_10136943 | Ga0307411_101369433 | 70 |
| 578 | 3300032005 | Ga0307411_10340521 | Ga0307411_103405213 | 70 |
| 579 | 3300032005 | Ga0307411_10688272 | Ga0307411_106882722 | 70 |
| 580 | 3300032005 | Ga0307411_10782029 | Ga0307411_107820292 | 70 |
| 581 | 3300032005 | Ga0307411_10937564 | Ga0307411_109375641 | 70 |
| 582 | 3300032005 | Ga0307411_10950460 | Ga0307411_109504602 | 70 |
| 583 | 3300032005 | Ga0307411_12261193 | Ga0307411_122611932 | 70 |
| 584 | 3300032005 | Ga0307411_12348394 | Ga0307411_123483941 | 70 |
| 585 | 3300032126 | Ga0307415_100000864 | Ga0307415_1000008642 | 70 |
| 586 | 3300032126 | Ga0307415_100003278 | Ga0307415_1000032784 | 70 |
| 587 | 3300032126 | Ga0307415_100180552 | Ga0307415_1001805522 | 70 |
| 588 | 3300032126 | Ga0307415_100445762 | Ga0307415_1004457622 | 70 |
| 589 | 3300032126 | Ga0307415_100756155 | Ga0307415_1007561552 | 70 |
| 590 | 3300032126 | Ga0307415_101750012 | Ga0307415_1017500122 | 70 |
| 591 | 3300032126 | Ga0307415_101827204 | Ga0307415_1018272042 | 70 |
| 592 | 3300032126 | Ga0307415_102092772 | Ga0307415_1020927721 | 70 |
| 593 | 3300032126 | Ga0307415_102446087 | Ga0307415_1024460872 | 70 |
| 594 | 3300034816 | Ga0373930_0032000 | Ga0373930_0032000_622_834 | 70 |
| 595 | 3300034817 | Ga0373948_0095723 | Ga0373948_0095723_157_369 | 70 |
| 596 | 3300034819 | Ga0373958_0144029 | Ga0373958_0144029_326_538 | 70 |
| 597 | 3300034820 | Ga0373959_0039782 | Ga0373959_0039782_720_932 | 70 |
| 598 | 3300035084 | Ga0373928_0022692 | Ga0373928_0022692_22_234 | 70 |
| 599 | 3300035084 | Ga0373928_0155103 | Ga0373928_0155103_76_288 | 70 |
| 600 | 3300035085 | Ga0373929_0097157 | Ga0373929_0097157_235_447 | 70 |
| 601 | 3300035088 | Ga0373940_0005472 | Ga0373940_0005472_739_951 | 70 |
| 602 | 3300035088 | Ga0373940_0012634 | Ga0373940_0012634_1715_1927 | 70 |
| 603 | 3300035092 | Ga0373952_0133576 | Ga0373952_0133576_237_449 | 70 |
| 604 | 3300035112 | Ga0373932_0096515 | Ga0373932_0096515_271_483 | 70 |
| 605 | 3300035114 | Ga0373939_0332713 | Ga0373939_0332713_144_356 | 70 |
| 606 | 3300035115 | Ga0373941_0123344 | Ga0373941_0123344_283_495 | 70 |
| 607 | 3300035115 | Ga0373941_0244230 | Ga0373941_0244230_59_271 | 70 |
| 608 | 3300035121 | Ga0373960_0054338 | Ga0373960_0054338_887_1099 | 70 |
| 609 | 3300035121 | Ga0373960_0265154 | Ga0373960_0265154_121_333 | 70 |
| 610 | 3300035207 | Ga0373942_0108817 | Ga0373942_0108817_562_774 | 70 |
| 611 | 3300035241 | Ga0373961_0091246 | Ga0373961_0091246_59_271 | 70 |
| 612 | 3300035241 | Ga0373961_0094213 | Ga0373961_0094213_714_926 | 70 |
| 613 | 3300035241 | Ga0373961_0220699 | Ga0373961_0220699_25_237 | 70 |
| 614 | 3300035691 | Ga0373931_0028636 | Ga0373931_0028636_1415_1627 | 70 |
| 615 | 3300035691 | Ga0373931_0140839 | Ga0373931_0140839_19_231 | 70 |
| 616 | 3300035691 | Ga0373931_0161079 | Ga0373931_0161079_954_1166 | 70 |
| 617 | 3300035691 | Ga0373931_0470759 | Ga0373931_0470759_169_381 | 70 |
| 618 | 3300035691 | Ga0373931_0687711 | Ga0373931_0687711_212_424 | 70 |
| 619 | 3300035724 | Ga0373933_0029773 | Ga0373933_0029773_2093_2305 | 70 |
| 620 | 3300036401 | Ga0373937_1538255 | Ga0373937_1538255_371_583 | 70 |
| 621 | 3300037068 | Ga0373925_0890067 | Ga0373925_0890067_215_427 | 70 |
| 622 | 3300037471 | Ga0395905_0440496 | Ga0395905_0440496_712_924 | 70 |
| 623 | 3300037471 | Ga0395905_0790956 | Ga0395905_0790956_101_313 | 70 |
| 624 | 3300038443 | Ga0395901_0194022 | Ga0395901_0194022_228_440 | 70 |
| 625 | 3300038996 | Ga0242420_041319 | Ga0242420_041319_237_449 | 70 |
| 626 | 3300039437 | Ga0436365_0532788 | Ga0436365_0532788_130_342 | 70 |
| 627 | 3300041404 | Ga0439436_0050161 | Ga0439436_0050161_489_704 | 70 |
| 628 | 3300041406 | Ga0439439_0002520 | Ga0439439_0002520_632_847 | 70 |
| 629 | 3300041406 | Ga0439439_0021942 | Ga0439439_0021942_377_598 | 70 |
| 630 | 3300041410 | Ga0439461_0130005 | Ga0439461_0130005_70_282 | 70 |
| 631 | 3300041459 | Ga0451800_1206903 | Ga0451800_1206903_765_977 | 70 |
| 632 | 3300041486 | Ga0451807_1336449 | Ga0451807_1336449_461_673 | 70 |
| 633 | 3300041496 | Ga0451839_0743658 | Ga0451839_0743658_357_569 | 70 |
| 634 | 3300041509 | Ga0451843_1171492 | Ga0451843_1171492_176_388 | 70 |
| 635 | 3300041997 | Ga0439431_0196026 | Ga0439431_0196026_15_230 | 70 |
| 636 | 3300042004 | Ga0439445_0115672 | Ga0439445_0115672_371_583 | 70 |
| 637 | 3300042005 | Ga0439448_0143233 | Ga0439448_0143233_237_449 | 70 |
| 638 | 3300042012 | Ga0439455_0043921 | Ga0439455_0043921_467_679 | 70 |
| 639 | 3300042012 | Ga0439455_0051234 | Ga0439455_0051234_320_532 | 70 |
| 640 | 3300042012 | Ga0439455_0099355 | Ga0439455_0099355_191_403 | 70 |
| 641 | 3300042014 | Ga0439457_023322 | Ga0439457_023322_122_337 | 70 |
| 642 | 3300042127 | Ga0450890_012844 | Ga0450890_012844_760_972 | 70 |
| 643 | 3300042133 | Ga0450896_073251 | Ga0450896_073251_22_237 | 70 |
| 644 | 3300042134 | Ga0450898_009275 | Ga0450898_009275_305_520 | 70 |
| 645 | 3300042147 | Ga0450910_070410 | Ga0450910_070410_329_544 | 70 |
| 646 | 3300042156 | Ga0439446_0007447 | Ga0439446_0007447_2293_2508 | 70 |
| 647 | 3300042156 | Ga0439446_0051095 | Ga0439446_0051095_435_647 | 70 |
| 648 | 3300042156 | Ga0439446_0097613 | Ga0439446_0097613_674_886 | 70 |
| 649 | 3300042156 | Ga0439446_0309813 | Ga0439446_0309813_12_224 | 70 |
| 650 | 3300042435 | Ga0439434_0088359 | Ga0439434_0088359_478_690 | 70 |
| 651 | 3300042435 | Ga0439434_0109779 | Ga0439434_0109779_494_709 | 70 |
| 652 | 3300042437 | Ga0439444_0052590 | Ga0439444_0052590_32_244 | 70 |
| 653 | 3300042437 | Ga0439444_0103733 | Ga0439444_0103733_403_618 | 70 |
| 654 | 3300042461 | Ga0439460_0129562 | Ga0439460_0129562_293_505 | 70 |
| 655 | 3300042876 | Ga0451577_0430087 | Ga0451577_0430087_157_384 | 70 |
| 656 | 3300042876 | Ga0451577_0894212 | Ga0451577_0894212_128_340 | 70 |
| 657 | 3300042876 | Ga0451577_0979478 | Ga0451577_0979478_421_633 | 70 |
| 658 | 3300044673 | Ga0453683_0089467 | Ga0453683_0089467_898_1110 | 70 |
| 659 | 3300044712 | Ga0453684_0690822 | Ga0453684_0690822_477_689 | 70 |
| 660 | 3300044842 | Ga0466957_0574083 | Ga0466957_0574083_295_513 | 70 |
| 661 | 3300044901 | Ga0466960_0273036 | Ga0466960_0273036_319_531 | 70 |
| 662 | 3300044901 | Ga0466960_0741801 | Ga0466960_0741801_365_577 | 70 |
| 663 | 3300045051 | Ga0451576_0890989 | Ga0451576_0890989_474_686 | 70 |
| 664 | 3300045051 | Ga0451576_1409696 | Ga0451576_1409696_355_567 | 70 |
| 665 | 3300045976 | Ga0466967_0327124 | Ga0466967_0327124_885_1097 | 70 |
| 666 | 3300045976 | Ga0466967_1675823 | Ga0466967_1675823_405_617 | 70 |
| 667 | 3300046455 | Ga0495603_0323636 | Ga0495603_0323636_246_473 | 70 |
| 668 | 3300046459 | Ga0495629_0656868 | Ga0495629_0656868_457_684 | 70 |
| 669 | 3300046472 | Ga0495580_0454199 | Ga0495580_0454199_235_447 | 70 |
| 670 | 3300046499 | Ga0495594_0595211 | Ga0495594_0595211_157_384 | 70 |
| 671 | 3300046559 | Ga0495667_0385359 | Ga0495667_0385359_579_791 | 70 |
| 672 | 3300048903 | Ga0496100_0412803 | Ga0496100_0412803_271_483 | 70 |
| 673 | 3300048903 | Ga0496100_0493441 | Ga0496100_0493441_609_821 | 70 |
| 674 | 3300048903 | Ga0496100_0961145 | Ga0496100_0961145_300_512 | 70 |
| 675 | 3300048903 | Ga0496100_1049240 | Ga0496100_1049240_234_446 | 70 |
| 676 | 3300048903 | Ga0496100_1460154 | Ga0496100_1460154_201_413 | 70 |
| 677 | 3300048903 | Ga0496100_1511805 | Ga0496100_1511805_232_444 | 70 |
| 678 | 3300048904 | Ga0496101_0202173 | Ga0496101_0202173_301_513 | 70 |
| 679 | 3300048904 | Ga0496101_0444105 | Ga0496101_0444105_228_440 | 70 |
| 680 | 3300048904 | Ga0496101_1491930 | Ga0496101_1491930_286_498 | 70 |
| 681 | 3300048905 | Ga0496102_0052140 | Ga0496102_0052140_688_900 | 70 |
| 682 | 3300048905 | Ga0496102_0052826 | Ga0496102_0052826_3409_3621 | 70 |
| 683 | 3300048905 | Ga0496102_0185973 | Ga0496102_0185973_1434_1646 | 70 |
| 684 | 3300048905 | Ga0496102_0826208 | Ga0496102_0826208_341_553 | 70 |
| 685 | 3300048905 | Ga0496102_1502438 | Ga0496102_1502438_268_480 | 70 |
| 686 | 3300048905 | Ga0496102_1742552 | Ga0496102_1742552_151_363 | 70 |
| 687 | 3300048906 | Ga0496103_0039229 | Ga0496103_0039229_1739_1951 | 70 |
| 688 | 3300048906 | Ga0496103_0975345 | Ga0496103_0975345_148_360 | 70 |
| 689 | 3300048907 | Ga0496104_0054127 | Ga0496104_0054127_1967_2179 | 70 |
| 690 | 3300048907 | Ga0496104_0079813 | Ga0496104_0079813_1471_1683 | 70 |
| 691 | 3300048907 | Ga0496104_0158733 | Ga0496104_0158733_1888_2100 | 70 |
| 692 | 3300048907 | Ga0496104_0207801 | Ga0496104_0207801_1383_1595 | 70 |
| 693 | 3300048908 | Ga0496105_0257134 | Ga0496105_0257134_838_1050 | 70 |
| 694 | 3300048908 | Ga0496105_0259689 | Ga0496105_0259689_845_1057 | 70 |
| 695 | 3300048908 | Ga0496105_0498419 | Ga0496105_0498419_447_659 | 70 |
| 696 | 3300048909 | Ga0496106_0048833 | Ga0496106_0048833_443_655 | 70 |
| 697 | 3300048909 | Ga0496106_0347482 | Ga0496106_0347482_122_334 | 70 |
| 698 | 3300048909 | Ga0496106_0381492 | Ga0496106_0381492_526_738 | 70 |
| 699 | 3300048910 | Ga0496107_0119348 | Ga0496107_0119348_377_589 | 70 |
| 700 | 3300048911 | Ga0496108_0051655 | Ga0496108_0051655_2819_3031 | 70 |
| 701 | 3300048911 | Ga0496108_0070040 | Ga0496108_0070040_213_425 | 70 |
| 702 | 3300048911 | Ga0496108_0131588 | Ga0496108_0131588_849_1061 | 70 |
| 703 | 3300048911 | Ga0496108_0886987 | Ga0496108_0886987_263_475 | 70 |
| 704 | 3300048911 | Ga0496108_0906256 | Ga0496108_0906256_315_527 | 70 |
| 705 | 3300048912 | Ga0496109_0001242 | Ga0496109_0001242_17269_17481 | 70 |
| 706 | 3300048912 | Ga0496109_0003405 | Ga0496109_0003405_7854_8066 | 70 |
| 707 | 3300048912 | Ga0496109_0107503 | Ga0496109_0107503_1598_1810 | 70 |
| 708 | 3300048912 | Ga0496109_0120355 | Ga0496109_0120355_1963_2175 | 70 |
| 709 | 3300048912 | Ga0496109_0623628 | Ga0496109_0623628_512_724 | 70 |
| 710 | 3300048912 | Ga0496109_0889805 | Ga0496109_0889805_88_300 | 70 |
| 711 | 3300048913 | Ga0496110_0062816 | Ga0496110_0062816_1744_1956 | 70 |
| 712 | 3300048913 | Ga0496110_0109296 | Ga0496110_0109296_2078_2290 | 70 |
| 713 | 3300048913 | Ga0496110_0233956 | Ga0496110_0233956_493_705 | 70 |
| 714 | 3300048913 | Ga0496110_0447960 | Ga0496110_0447960_411_623 | 70 |
| 715 | 3300048914 | Ga0496111_0052860 | Ga0496111_0052860_1282_1494 | 70 |
| 716 | 3300048914 | Ga0496111_0073361 | Ga0496111_0073361_1129_1341 | 70 |
| 717 | 3300048914 | Ga0496111_0539897 | Ga0496111_0539897_388_600 | 70 |
| 718 | 3300048915 | Ga0496112_0006851 | Ga0496112_0006851_2161_2373 | 70 |
| 719 | 3300048915 | Ga0496112_0078121 | Ga0496112_0078121_848_1060 | 70 |
| 720 | 3300048915 | Ga0496112_0314680 | Ga0496112_0314680_513_725 | 70 |
| 721 | 3300048915 | Ga0496112_0723460 | Ga0496112_0723460_254_466 | 70 |
| 722 | 3300048916 | Ga0496113_0002551 | Ga0496113_0002551_246_458 | 70 |
| 723 | 3300048916 | Ga0496113_0013682 | Ga0496113_0013682_4660_4872 | 70 |
| 724 | 3300048916 | Ga0496113_0127845 | Ga0496113_0127845_1408_1620 | 70 |
| 725 | 3300048916 | Ga0496113_0408360 | Ga0496113_0408360_733_945 | 70 |
| 726 | 3300048917 | Ga0496114_0775170 | Ga0496114_0775170_68_280 | 70 |
| 727 | 3300048917 | Ga0496114_0801337 | Ga0496114_0801337_468_680 | 70 |
| 728 | 3300048917 | Ga0496114_1428813 | Ga0496114_1428813_231_443 | 70 |
| 729 | 3300048918 | Ga0496115_0072632 | Ga0496115_0072632_1324_1536 | 70 |
| 730 | 3300048918 | Ga0496115_0073560 | Ga0496115_0073560_869_1081 | 70 |
| 731 | 3300049520 | Ga0501297_015215 | Ga0501297_015215_62_274 | 70 |
| 732 | 3300049521 | Ga0501298_061990 | Ga0501298_061990_478_690 | 70 |
| 733 | 3300049521 | Ga0501298_154911 | Ga0501298_154911_77_289 | 70 |
| 734 | 3300049522 | Ga0501299_050851 | Ga0501299_050851_115_333 | 70 |
| 735 | 3300049522 | Ga0501299_106168 | Ga0501299_106168_271_483 | 70 |
| 736 | 3300049568 | Ga0501031_0432604 | Ga0501031_0432604_622_834 | 70 |
| 737 | 3300049568 | Ga0501031_0981307 | Ga0501031_0981307_36_248 | 70 |
| 738 | 3300049569 | Ga0501032_0269097 | Ga0501032_0269097_104_316 | 70 |
| 739 | 3300049569 | Ga0501032_0712237 | Ga0501032_0712237_171_383 | 70 |
| 740 | 3300049570 | Ga0501033_0282461 | Ga0501033_0282461_715_927 | 70 |
| 741 | 3300049571 | Ga0501034_0098585 | Ga0501034_0098585_1907_2119 | 70 |
| 742 | 3300049571 | Ga0501034_1077037 | Ga0501034_1077037_40_267 | 70 |
| 743 | 3300049572 | Ga0501036_0038651 | Ga0501036_0038651_1334_1546 | 70 |
| 744 | 3300049572 | Ga0501036_0072612 | Ga0501036_0072612_1582_1794 | 70 |
| 745 | 3300049573 | Ga0501037_0027943 | Ga0501037_0027943_1113_1325 | 70 |
| 746 | 3300049573 | Ga0501037_0911485 | Ga0501037_0911485_170_382 | 70 |
| 747 | 3300049574 | Ga0501038_0273031 | Ga0501038_0273031_667_879 | 70 |
| 748 | 3300049574 | Ga0501038_0397818 | Ga0501038_0397818_417_629 | 70 |
| 749 | 3300049575 | Ga0501039_0035222 | Ga0501039_0035222_391_603 | 70 |
| 750 | 3300049575 | Ga0501039_0189271 | Ga0501039_0189271_328_540 | 70 |
| 751 | 3300049575 | Ga0501039_0292463 | Ga0501039_0292463_411_623 | 70 |
| 752 | 3300049576 | Ga0501040_0059954 | Ga0501040_0059954_1482_1694 | 70 |
| 753 | 3300049576 | Ga0501040_0064640 | Ga0501040_0064640_350_562 | 70 |
| 754 | 3300049576 | Ga0501040_0074660 | Ga0501040_0074660_1659_1871 | 70 |
| 755 | 3300049576 | Ga0501040_0088662 | Ga0501040_0088662_1491_1703 | 70 |
| 756 | 3300049576 | Ga0501040_0979568 | Ga0501040_0979568_133_345 | 70 |
| 757 | 3300049577 | Ga0501041_0091060 | Ga0501041_0091060_98_310 | 70 |
| 758 | 3300049577 | Ga0501041_0154953 | Ga0501041_0154953_1141_1353 | 70 |
| 759 | 3300049577 | Ga0501041_0211144 | Ga0501041_0211144_441_653 | 70 |
| 760 | 3300049577 | Ga0501041_1041839 | Ga0501041_1041839_108_320 | 70 |
| 761 | 3300049578 | Ga0501042_0061501 | Ga0501042_0061501_1288_1500 | 70 |
| 762 | 3300049578 | Ga0501042_0143165 | Ga0501042_0143165_693_905 | 70 |
| 763 | 3300049579 | Ga0501043_0086142 | Ga0501043_0086142_1266_1478 | 70 |
| 764 | 3300049579 | Ga0501043_0450759 | Ga0501043_0450759_103_315 | 70 |
| 765 | 3300049580 | Ga0501046_0047499 | Ga0501046_0047499_1766_1978 | 70 |
| 766 | 3300049580 | Ga0501046_0162965 | Ga0501046_0162965_1410_1622 | 70 |
| 767 | 3300049582 | Ga0501048_0007833 | Ga0501048_0007833_1611_1823 | 70 |
| 768 | 3300049582 | Ga0501048_0061063 | Ga0501048_0061063_2111_2323 | 70 |
| 769 | 3300049582 | Ga0501048_1304254 | Ga0501048_1304254_17_244 | 70 |
| 770 | 3300049583 | Ga0501067_0062678 | Ga0501067_0062678_1593_1805 | 70 |
| 771 | 3300049583 | Ga0501067_0108088 | Ga0501067_0108088_782_994 | 70 |
| 772 | 3300049583 | Ga0501067_0163131 | Ga0501067_0163131_942_1154 | 70 |
| 773 | 3300049583 | Ga0501067_0374825 | Ga0501067_0374825_522_734 | 70 |
| 774 | 3300049584 | Ga0501068_0031002 | Ga0501068_0031002_1735_1947 | 70 |
| 775 | 3300049584 | Ga0501068_0203291 | Ga0501068_0203291_478_690 | 70 |
| 776 | 3300049585 | Ga0501069_0026697 | Ga0501069_0026697_517_729 | 70 |
| 777 | 3300049585 | Ga0501069_0099027 | Ga0501069_0099027_865_1077 | 70 |
| 778 | 3300049585 | Ga0501069_0175717 | Ga0501069_0175717_749_961 | 70 |
| 779 | 3300049585 | Ga0501069_0246800 | Ga0501069_0246800_480_692 | 70 |
| 780 | 3300049585 | Ga0501069_0477757 | Ga0501069_0477757_490_702 | 70 |
| 781 | 3300049585 | Ga0501069_0640522 | Ga0501069_0640522_214_429 | 70 |
| 782 | 3300049585 | Ga0501069_0803675 | Ga0501069_0803675_67_279 | 70 |
| 783 | 3300049586 | Ga0501070_0049303 | Ga0501070_0049303_1668_1883 | 70 |
| 784 | 3300049586 | Ga0501070_0200992 | Ga0501070_0200992_805_1020 | 70 |
| 785 | 3300049586 | Ga0501070_0259464 | Ga0501070_0259464_802_1014 | 70 |
| 786 | 3300049587 | Ga0501071_0034344 | Ga0501071_0034344_1100_1312 | 70 |
| 787 | 3300049587 | Ga0501071_0109977 | Ga0501071_0109977_871_1086 | 70 |
| 788 | 3300049587 | Ga0501071_0354735 | Ga0501071_0354735_425_637 | 70 |
| 789 | 3300049587 | Ga0501071_0504658 | Ga0501071_0504658_142_354 | 70 |
| 790 | 3300049587 | Ga0501071_0668705 | Ga0501071_0668705_408_623 | 70 |
| 791 | 3300049587 | Ga0501071_0691332 | Ga0501071_0691332_364_576 | 70 |
| 792 | 3300049588 | Ga0501072_0005332 | Ga0501072_0005332_7108_7320 | 70 |
| 793 | 3300049588 | Ga0501072_1507383 | Ga0501072_1507383_127_339 | 70 |
| 794 | 3300049589 | Ga0501073_0874624 | Ga0501073_0874624_354_566 | 70 |
| 795 | 3300049590 | Ga0501074_0145818 | Ga0501074_0145818_136_348 | 70 |
| 796 | 3300049590 | Ga0501074_0394104 | Ga0501074_0394104_433_648 | 70 |
| 797 | 3300049591 | Ga0501075_0014126 | Ga0501075_0014126_3403_3615 | 70 |
| 798 | 3300049591 | Ga0501075_0021140 | Ga0501075_0021140_3414_3626 | 70 |
| 799 | 3300049591 | Ga0501075_0323738 | Ga0501075_0323738_625_837 | 70 |
| 800 | 3300049591 | Ga0501075_0347590 | Ga0501075_0347590_660_872 | 70 |
| 801 | 3300049591 | Ga0501075_0470052 | Ga0501075_0470052_451_663 | 70 |
| 802 | 3300049591 | Ga0501075_0780218 | Ga0501075_0780218_21_233 | 70 |
| 803 | 3300049591 | Ga0501075_1098476 | Ga0501075_1098476_15_230 | 70 |
| 804 | 3300049591 | Ga0501075_1146780 | Ga0501075_1146780_33_245 | 70 |
| 805 | 3300049592 | Ga0501076_0017383 | Ga0501076_0017383_3446_3658 | 70 |
| 806 | 3300049592 | Ga0501076_0087707 | Ga0501076_0087707_970_1182 | 70 |
| 807 | 3300049592 | Ga0501076_0283087 | Ga0501076_0283087_947_1159 | 70 |
| 808 | 3300049593 | Ga0501077_0003255 | Ga0501077_0003255_6849_7061 | 70 |
| 809 | 3300049593 | Ga0501077_0014505 | Ga0501077_0014505_3657_3869 | 70 |
| 810 | 3300049593 | Ga0501077_0251388 | Ga0501077_0251388_194_406 | 70 |
| 811 | 3300049593 | Ga0501077_0625642 | Ga0501077_0625642_75_287 | 70 |
| 812 | 3300049661 | Ga0501217_038778 | Ga0501217_038778_537_755 | 70 |
| 813 | 3300049661 | Ga0501217_291700 | Ga0501217_291700_234_446 | 70 |
| 814 | 3300049669 | Ga0501235_086658 | Ga0501235_086658_333_551 | 70 |
| 815 | 3300049672 | Ga0501239_001917 | Ga0501239_001917_1397_1615 | 70 |
| 816 | 3300049675 | Ga0501243_036411 | Ga0501243_036411_284_502 | 70 |
| 817 | 3300049677 | Ga0501247_014660 | Ga0501247_014660_192_410 | 70 |
| 818 | 3300049679 | Ga0501249_035276 | Ga0501249_035276_22_240 | 70 |
| 819 | 3300049679 | Ga0501249_131926 | Ga0501249_131926_300_512 | 70 |
| 820 | 3300049686 | Ga0501257_156004 | Ga0501257_156004_335_547 | 70 |
| 821 | 3300049688 | Ga0501259_033321 | Ga0501259_033321_580_798 | 70 |
| 822 | 3300049704 | Ga0501221_007695 | Ga0501221_007695_405_623 | 70 |
| 823 | 3300049708 | Ga0501245_140449 | Ga0501245_140449_123_335 | 70 |
| 824 | 3300049741 | Ga0501079_0016453 | Ga0501079_0016453_3825_4037 | 70 |
| 825 | 3300049741 | Ga0501079_0020714 | Ga0501079_0020714_323_535 | 70 |
| 826 | 3300049741 | Ga0501079_0229399 | Ga0501079_0229399_82_294 | 70 |
| 827 | 3300049741 | Ga0501079_0434835 | Ga0501079_0434835_536_751 | 70 |
| 828 | 3300049741 | Ga0501079_0693318 | Ga0501079_0693318_506_718 | 70 |
| 829 | 3300049741 | Ga0501079_1482999 | Ga0501079_1482999_273_485 | 70 |
| 830 | 3300049742 | Ga0501080_0013648 | Ga0501080_0013648_5118_5330 | 70 |
| 831 | 3300049742 | Ga0501080_0076402 | Ga0501080_0076402_1883_2095 | 70 |
| 832 | 3300049742 | Ga0501080_0310236 | Ga0501080_0310236_113_325 | 70 |
| 833 | 3300049742 | Ga0501080_0312894 | Ga0501080_0312894_168_380 | 70 |
| 834 | 3300049742 | Ga0501080_0525577 | Ga0501080_0525577_809_1024 | 70 |
| 835 | 3300049742 | Ga0501080_0766467 | Ga0501080_0766467_424_639 | 70 |
| 836 | 3300049742 | Ga0501080_1718978 | Ga0501080_1718978_200_412 | 70 |
| 837 | 3300049743 | Ga0501081_0004597 | Ga0501081_0004597_3294_3506 | 70 |
| 838 | 3300049743 | Ga0501081_0009706 | Ga0501081_0009706_5180_5392 | 70 |
| 839 | 3300049743 | Ga0501081_0086278 | Ga0501081_0086278_584_796 | 70 |
| 840 | 3300049743 | Ga0501081_0168802 | Ga0501081_0168802_179_391 | 70 |
| 841 | 3300049743 | Ga0501081_1285715 | Ga0501081_1285715_103_315 | 70 |
| 842 | 3300049743 | Ga0501081_1398547 | Ga0501081_1398547_69_296 | 70 |
| 843 | 3300049744 | Ga0501083_0154322 | Ga0501083_0154322_1262_1474 | 70 |
| 844 | 3300049744 | Ga0501083_0260450 | Ga0501083_0260450_86_298 | 70 |
| 845 | 3300049744 | Ga0501083_0352922 | Ga0501083_0352922_412_627 | 70 |
| 846 | 3300049744 | Ga0501083_0633593 | Ga0501083_0633593_291_503 | 70 |
| 847 | 3300049760 | Ga0501263_077837 | Ga0501263_077837_53_271 | 70 |
| 848 | 3300049763 | Ga0501266_050213 | Ga0501266_050213_153_371 | 70 |
| 849 | 3300049764 | Ga0501267_024643 | Ga0501267_024643_215_433 | 70 |
| 850 | 3300049768 | Ga0501271_003541 | Ga0501271_003541_370_588 | 70 |
| 851 | 3300049768 | Ga0501271_015754 | Ga0501271_015754_237_449 | 70 |
| 852 | 3300049770 | Ga0501273_006208 | Ga0501273_006208_808_1020 | 70 |
| 853 | 3300049770 | Ga0501273_021568 | Ga0501273_021568_224_436 | 70 |
| 854 | 3300049773 | Ga0501276_033015 | Ga0501276_033015_213_425 | 70 |
| 855 | 3300049779 | Ga0501283_113780 | Ga0501283_113780_53_271 | 70 |
| 856 | 3300049822 | Ga0501035_0063000 | Ga0501035_0063000_1379_1591 | 70 |
| 857 | 3300049822 | Ga0501035_0385135 | Ga0501035_0385135_748_960 | 70 |
| 858 | 3300049822 | Ga0501035_1201092 | Ga0501035_1201092_27_239 | 70 |
| 859 | 3300049824 | Ga0501045_0013479 | Ga0501045_0013479_3471_3683 | 70 |
| 860 | 3300049824 | Ga0501045_0029004 | Ga0501045_0029004_1831_2043 | 70 |
| 861 | 3300049824 | Ga0501045_0823598 | Ga0501045_0823598_381_593 | 70 |
| 862 | 3300049824 | Ga0501045_1378857 | Ga0501045_1378857_93_305 | 70 |
| 863 | 3300050507 | nmdc:mga05p37_215368_c1 | nmdc:mga05p37_215368_c1_982_1209 | 70 |
| 864 | 3300050507 | nmdc:mga05p37_242812_c1 | nmdc:mga05p37_242812_c1_1388_1600 | 70 |
| 865 | 3300050507 | nmdc:mga05p37_280136_c1 | nmdc:mga05p37_280136_c1_1147_1374 | 70 |
| 866 | 3300050507 | nmdc:mga05p37_475607_c1 | nmdc:mga05p37_475607_c1_604_816 | 70 |
| 867 | 3300050507 | nmdc:mga05p37_6185_c1 | nmdc:mga05p37_6185_c1_12354_12566 | 70 |
| 868 | 3300050507 | nmdc:mga05p37_851898_c1 | nmdc:mga05p37_851898_c1_24_236 | 70 |
| 869 | 3300050508 | nmdc:mga09592_1031811_c1 | nmdc:mga09592_1031811_c1_335_562 | 70 |
| 870 | 3300050508 | nmdc:mga09592_180745_c1 | nmdc:mga09592_180745_c1_46_273 | 70 |
| 871 | 3300050508 | nmdc:mga09592_358202_c1 | nmdc:mga09592_358202_c1_221_448 | 70 |
| 872 | 3300050508 | nmdc:mga09592_642_c1 | nmdc:mga09592_642_c1_19577_19804 | 70 |
| 873 | 3300050509 | nmdc:mga0qj67_153335_c1 | nmdc:mga0qj67_153335_c1_1463_1675 | 70 |
| 874 | 3300050509 | nmdc:mga0qj67_339817_c1 | nmdc:mga0qj67_339817_c1_277_489 | 70 |
| 875 | 3300050509 | nmdc:mga0qj67_609197_c1 | nmdc:mga0qj67_609197_c1_311_523 | 70 |
| 876 | 3300050510 | nmdc:mga06r32_1004102_c1 | nmdc:mga06r32_1004102_c1_334_561 | 70 |
| 877 | 3300050510 | nmdc:mga06r32_1521497_c1 | nmdc:mga06r32_1521497_c1_281_493 | 70 |
| 878 | 3300050510 | nmdc:mga06r32_23975_c1 | nmdc:mga06r32_23975_c1_372_584 | 70 |
| 879 | 3300050510 | nmdc:mga06r32_325469_c1 | nmdc:mga06r32_325469_c1_694_906 | 70 |
| 880 | 3300050510 | nmdc:mga06r32_477088_c1 | nmdc:mga06r32_477088_c1_745_972 | 70 |
| 881 | 3300050510 | nmdc:mga06r32_65939_c1 | nmdc:mga06r32_65939_c1_2220_2447 | 70 |
| 882 | 3300050510 | nmdc:mga06r32_68985_c1 | nmdc:mga06r32_68985_c1_1158_1370 | 70 |
| 883 | 3300050511 | nmdc:mga08y16_459686_c1 | nmdc:mga08y16_459686_c1_17_229 | 70 |
| 884 | 3300050511 | nmdc:mga08y16_578998_c1 | nmdc:mga08y16_578998_c1_692_904 | 70 |
| 885 | 3300050512 | nmdc:mga0n895_1537642_c1 | nmdc:mga0n895_1537642_c1_256_468 | 70 |
| 886 | 3300050512 | nmdc:mga0n895_231858_c1 | nmdc:mga0n895_231858_c1_1607_1819 | 70 |
| 887 | 3300050512 | nmdc:mga0n895_26043_c1 | nmdc:mga0n895_26043_c1_1549_1761 | 70 |
| 888 | 3300050512 | nmdc:mga0n895_516843_c1 | nmdc:mga0n895_516843_c1_805_1032 | 70 |
| 889 | 3300050512 | nmdc:mga0n895_606803_c1 | nmdc:mga0n895_606803_c1_345_557 | 70 |
| 890 | 3300050512 | nmdc:mga0n895_64679_c1 | nmdc:mga0n895_64679_c1_677_889 | 70 |
| 891 | 3300050513 | nmdc:mga0rr50_1206386_c1 | nmdc:mga0rr50_1206386_c1_123_335 | 70 |
| 892 | 3300050513 | nmdc:mga0rr50_126087_c1 | nmdc:mga0rr50_126087_c1_162_374 | 70 |
| 893 | 3300050513 | nmdc:mga0rr50_1391604_c1 | nmdc:mga0rr50_1391604_c1_360_572 | 70 |
| 894 | 3300050513 | nmdc:mga0rr50_396415_c1 | nmdc:mga0rr50_396415_c1_708_920 | 70 |
| 895 | 3300050513 | nmdc:mga0rr50_404982_c1 | nmdc:mga0rr50_404982_c1_185_397 | 70 |
| 896 | 3300050513 | nmdc:mga0rr50_638951_c1 | nmdc:mga0rr50_638951_c1_621_833 | 70 |
| 897 | 3300050513 | nmdc:mga0rr50_919398_c1 | nmdc:mga0rr50_919398_c1_289_516 | 70 |
| 898 | 3300050514 | nmdc:mga08x19_147575_c1 | nmdc:mga08x19_147575_c1_922_1140 | 70 |
| 899 | 3300050514 | nmdc:mga08x19_149485_c1 | nmdc:mga08x19_149485_c1_260_472 | 70 |
| 900 | 3300050515 | nmdc:mga0a205_11780_c1 | nmdc:mga0a205_11780_c1_2058_2270 | 70 |
| 901 | 3300050515 | nmdc:mga0a205_227958_c1 | nmdc:mga0a205_227958_c1_541_753 | 70 |
| 902 | 3300050515 | nmdc:mga0a205_828517_c1 | nmdc:mga0a205_828517_c1_110_322 | 70 |
| 903 | 3300050515 | nmdc:mga0a205_91158_c1 | nmdc:mga0a205_91158_c1_1139_1351 | 70 |
| 904 | 3300054114 | Ga0501084_0005089 | Ga0501084_0005089_3452_3664 | 70 |
| 905 | 3300054114 | Ga0501084_0071846 | Ga0501084_0071846_1714_1926 | 70 |
| 906 | 3300054114 | Ga0501084_0079555 | Ga0501084_0079555_1655_1867 | 70 |
| 907 | 3300054114 | Ga0501084_0250675 | Ga0501084_0250675_1076_1303 | 70 |
| 908 | 3300054114 | Ga0501084_0360739 | Ga0501084_0360739_78_305 | 70 |
| 909 | 3300054114 | Ga0501084_0953780 | Ga0501084_0953780_158_385 | 70 |
| 910 | 3300054114 | Ga0501084_1354823 | Ga0501084_1354823_73_285 | 70 |
| 911 | 3300054114 | Ga0501084_1446490 | Ga0501084_1446490_212_427 | 70 |
| 912 | 3300059421 | Ga0590071_001977 | Ga0590071_001977_1679_1891 | 70 |
| 913 | 3300059421 | Ga0590071_008491 | Ga0590071_008491_463_675 | 70 |
| 914 | 3300059423 | Ga0590074_007359 | Ga0590074_007359_1106_1318 | 70 |
| 915 | 3300059423 | Ga0590074_026919 | Ga0590074_026919_606_818 | 70 |
| 916 | 3300059424 | Ga0590075_101918 | Ga0590075_101918_66_278 | 70 |
| 917 | 3300059424 | Ga0590075_161870 | Ga0590075_161870_170_382 | 70 |
| 918 | 3300059426 | Ga0590077_008465 | Ga0590077_008465_1308_1520 | 70 |
| 919 | 3300059426 | Ga0590077_048096 | Ga0590077_048096_541_753 | 70 |
| 920 | 3300059491 | Ga0587070_101906 | Ga0587070_101906_157_369 | 70 |
| 921 | 3300059505 | Ga0587083_0204840 | Ga0587083_0204840_281_493 | 70 |
| 922 | 3300059630 | Ga0587128_138174 | Ga0587128_138174_260_472 | 70 |
| 923 | 3300059647 | Ga0587079_195723 | Ga0587079_195723_219_431 | 70 |
| 924 | 3300060344 | Ga0587071_040685 | Ga0587071_040685_596_808 | 70 |
| 925 | 3300060353 | Ga0501082_0010764 | Ga0501082_0010764_3095_3307 | 70 |
| 926 | 3300060353 | Ga0501082_0072769 | Ga0501082_0072769_1193_1405 | 70 |
| 927 | 3300060353 | Ga0501082_0083641 | Ga0501082_0083641_1211_1423 | 70 |
| 928 | 3300060353 | Ga0501082_1522437 | Ga0501082_1522437_156_368 | 70 |
| 929 | 3300060353 | Ga0501082_1836858 | Ga0501082_1836858_269_481 | 70 |
| 930 | 3300061734 | Ga0530510_0083729 | Ga0530510_0083729_247_459 | 70 |
| 931 | 3300061734 | Ga0530510_0431827 | Ga0530510_0431827_455_682 | 70 |
| 932 | 3300061734 | Ga0530510_0647416 | Ga0530510_0647416_539_751 | 70 |
| 933 | 3300061734 | Ga0530510_1427460 | Ga0530510_1427460_232_444 | 70 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar