F485828
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 923 | 444 | 914 | 152 |
Family's Representative Sequence
| Representative Sequence | 3300025911|Ga0207654_10002810|Ga0207654_1000281010 |
| Length | 144 |
| Sequence | MDPLHLGRTSELPSSPEAATLDYVPNPRPGRLYLVRFAAPEFTSLCPVTGQPDFAHLVIDYAIVESKSLKLFLGSYRNHAAFHEDCTLGIAERLVEEMEPRWLRIGGYWYPRGGIPIDVFWQSGPPPEGLWLPDQGVAPYRGRG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221733 | Bosea sp. Root381 | Isolate | Unclassified |
| 2 | 2643221734 | Bosea sp. Root670 | Isolate | Unclassified |
| 3 | 2818991467 | Bosea vestrisii 3192 | Isolate | Unclassified |
| 4 | 2841911363 | Bosea caraganae RCAM04685 | Isolate | Nodule |
| 5 | 2841917233 | Bosea caraganae RCAM04680 | Isolate | Nodule |
| 6 | 2885429604 | Sphingomonas sp. WZY 27 | Isolate | Rhizosphere |
| 7 | 2917699015 | Bosea sp. F3-2 | Isolate | Rhizosphere |
| 8 | 2990265787 | Sphingomonas sp. SORGH_AS802 | Isolate | Aerial Root |
| 9 | 2993693658 | Sphingomonas sp. SORGH_AS438 | Isolate | Aerial Root |
| 10 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 11 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 12 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 13 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 14 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 15 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 16 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 17 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 18 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 19 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 20 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 21 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 22 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 23 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 24 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 25 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 26 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 27 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 28 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 32 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 35 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 46 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 61 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 62 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 63 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 64 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 66 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 67 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 68 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 69 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 71 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 72 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 76 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 77 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 79 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 80 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 81 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 83 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 84 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 85 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 86 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 87 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 88 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 89 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 90 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 91 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 92 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 93 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 94 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 95 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 96 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 97 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 98 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 99 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 100 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 101 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 102 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 103 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 105 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 106 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 107 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 108 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 109 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 110 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 111 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 112 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 113 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 115 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300013250 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 | Metagenome | Rhizosphere |
| 135 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 145 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 146 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 147 | 3300025223 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 149 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 150 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 151 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 152 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 153 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 154 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 212 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 216 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 217 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 218 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 219 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 220 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 221 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 222 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 223 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 224 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 225 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 226 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 227 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 228 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 229 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 230 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 231 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 232 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 233 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 234 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 235 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 236 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 237 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 238 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 239 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 240 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 241 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 242 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 243 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 244 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 245 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 246 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 247 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 248 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 249 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 250 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 251 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 252 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 253 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 254 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 255 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 256 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 257 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 258 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 259 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 260 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 261 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 262 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 263 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 264 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 265 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 266 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 267 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 268 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 269 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 270 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 271 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 272 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 273 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 274 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 275 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 276 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 277 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 278 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 279 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 280 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 281 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 282 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 283 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 284 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 285 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 286 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 287 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 288 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 289 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 290 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 291 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 292 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 293 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 294 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 295 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 296 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 297 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 298 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 299 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 339 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 340 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 341 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 342 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 343 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 344 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 345 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 346 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 347 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 348 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 349 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 350 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 351 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 352 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 353 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 354 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 355 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 356 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 357 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 358 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 359 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 360 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 361 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 362 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 363 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 364 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 365 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 366 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 367 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 368 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 369 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 370 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 371 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 372 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 373 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 374 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 375 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 376 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 377 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 378 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 379 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 380 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 381 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 382 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 383 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 384 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 385 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 386 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 387 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 388 | 3300049768 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought | Metagenome | Rhizosphere |
| 389 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 390 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 391 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 392 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 393 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 394 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 395 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 396 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 397 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 398 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 399 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 400 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 401 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 402 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 403 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 404 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 405 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 406 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 407 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 409 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 412 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 413 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 414 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 415 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 416 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 417 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 418 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 419 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 420 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 421 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 422 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 423 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 424 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 425 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 426 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 427 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 428 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 429 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 430 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 431 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 432 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 433 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 434 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 435 | 3300053728 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 endosphere | Metagenome | Endosphere |
| 436 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 437 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 438 | 3300053732 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere | Metagenome | Endosphere |
| 439 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 440 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 441 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 442 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 443 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 444 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.92 |
| Metatranscriptomes | 0.11 |
| Isolates | 0.98 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.22 |
| Bulb | 0 |
| Endosphere | 9.43 |
| Nodule | 0.22 |
| Rhizoplane | 4.33 |
| Rhizosphere | 81.04 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.77 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24736J21556_1000034 | 3300001904 | Bacteria | 23064 |
| 2 | JGI24741J21665_1031856 | 3300001915 | Bacteria | 788 |
| 3 | JGI24752J21851_1000458 | 3300001976 | Bacteria | 5505 |
| 4 | JGI24739J22299_10002575 | 3300001989 | Bacteria | 6989 |
| 5 | JGI24739J22299_10031232 | 3300001989 | Bacteria | 1841 |
| 6 | JGI24737J22298_10065785 | 3300001990 | Bacteria | 1086 |
| 7 | JGI24735J21928_10016828 | 3300002067 | Bacteria | 2264 |
| 8 | JGI24735J21928_10098894 | 3300002067 | Bacteria | 838 |
| 9 | JGI24748J21848_1000034 | 3300002074 | Bacteria | 74812 |
| 10 | JGI24738J21930_10000114 | 3300002075 | Bacteria | 18967 |
| 11 | JGI24738J21930_10034486 | 3300002075 | Bacteria | 1031 |
| 12 | JGI24034J26672_10000018 | 3300002239 | Bacteria | 130180 |
| 13 | JGI24742J22300_10046678 | 3300002244 | Bacteria | 779 |
| 14 | JGI24751J29686_10030297 | 3300002459 | Bacteria | 1122 |
| 15 | JGI25164J39214_1013956 | 3300002772 | Bacteria | 747 |
| 16 | JGI25151J46595_10000038 | 3300003187 | Bacteria | 180430 |
| 17 | Ga0055526_1000500 | 3300003771 | Bacteria | 31211 |
| 18 | Ga0055526_1031178 | 3300003771 | Bacteria | 1535 |
| 19 | Ga0055524_1000091 | 3300003775 | Bacteria | 113761 |
| 20 | Ga0055524_1014261 | 3300003775 | Bacteria | 2955 |
| 21 | Ga0055536_1001520 | 3300003781 | Bacteria | 13913 |
| 22 | Ga0055528_1044668 | 3300003790 | Bacteria | 951 |
| 23 | Ga0070690_100000008 | 3300005330 | Bacteria | 118441 |
| 24 | Ga0070690_100038551 | 3300005330 | Bacteria | 3016 |
| 25 | Ga0070670_100000042 | 3300005331 | Bacteria | 143266 |
| 26 | Ga0070670_100005780 | 3300005331 | Bacteria | 10453 |
| 27 | Ga0070670_100096794 | 3300005331 | Bacteria | 2539 |
| 28 | Ga0070670_100096842 | 3300005331 | Bacteria | 2538 |
| 29 | Ga0070677_10034874 | 3300005333 | Bacteria | 1946 |
| 30 | Ga0070666_10000032 | 3300005335 | Bacteria | 129142 |
| 31 | Ga0070666_10180284 | 3300005335 | Bacteria | 1481 |
| 32 | Ga0070666_10211537 | 3300005335 | Bacteria | 1366 |
| 33 | Ga0070680_100049496 | 3300005336 | Bacteria | 3426 |
| 34 | Ga0070680_100128513 | 3300005336 | Bacteria | 2118 |
| 35 | Ga0070680_100328182 | 3300005336 | Bacteria | 1299 |
| 36 | Ga0070680_100588819 | 3300005336 | Bacteria | 954 |
| 37 | Ga0070680_101053298 | 3300005336 | Bacteria | 703 |
| 38 | Ga0070680_101520445 | 3300005336 | Bacteria | 580 |
| 39 | Ga0070682_100044349 | 3300005337 | Bacteria | 2753 |
| 40 | Ga0070660_100039885 | 3300005339 | Bacteria | 3570 |
| 41 | Ga0070660_100122873 | 3300005339 | Bacteria | 2072 |
| 42 | Ga0070689_100003709 | 3300005340 | Bacteria | 10213 |
| 43 | Ga0070689_100021089 | 3300005340 | Bacteria | 4844 |
| 44 | Ga0070691_10003404 | 3300005341 | Bacteria | 7154 |
| 45 | Ga0070687_100018525 | 3300005343 | Bacteria | 3223 |
| 46 | Ga0070687_100148008 | 3300005343 | Bacteria | 1375 |
| 47 | Ga0070661_100090408 | 3300005344 | Bacteria | 2267 |
| 48 | Ga0070661_100168477 | 3300005344 | Bacteria | 1662 |
| 49 | Ga0070692_10182334 | 3300005345 | Bacteria | 1218 |
| 50 | Ga0070668_100000274 | 3300005347 | Bacteria | 34084 |
| 51 | Ga0070668_100000576 | 3300005347 | Bacteria | 24618 |
| 52 | Ga0070668_100025796 | 3300005347 | Bacteria | 4458 |
| 53 | Ga0070668_100054490 | 3300005347 | Bacteria | 3084 |
| 54 | Ga0070668_100073534 | 3300005347 | Bacteria | 2665 |
| 55 | Ga0070668_100087645 | 3300005347 | Bacteria | 2449 |
| 56 | Ga0070668_100412195 | 3300005347 | Bacteria | 1155 |
| 57 | Ga0070669_100000211 | 3300005353 | Bacteria | 48717 |
| 58 | Ga0070669_100003446 | 3300005353 | Bacteria | 11398 |
| 59 | Ga0070669_100861126 | 3300005353 | Bacteria | 773 |
| 60 | Ga0070669_100926427 | 3300005353 | Bacteria | 745 |
| 61 | Ga0070675_100000318 | 3300005354 | Bacteria | 32359 |
| 62 | Ga0070671_100220342 | 3300005355 | Bacteria | 1610 |
| 63 | Ga0070671_100658785 | 3300005355 | Bacteria | 907 |
| 64 | Ga0070674_100007694 | 3300005356 | Bacteria | 6365 |
| 65 | Ga0070674_100329627 | 3300005356 | Bacteria | 1226 |
| 66 | Ga0070673_100056396 | 3300005364 | Bacteria | 3100 |
| 67 | Ga0070688_100000278 | 3300005365 | Bacteria | 26547 |
| 68 | Ga0070688_100078692 | 3300005365 | Bacteria | 2127 |
| 69 | Ga0070659_100178217 | 3300005366 | Bacteria | 1743 |
| 70 | Ga0070659_100529669 | 3300005366 | Bacteria | 1007 |
| 71 | Ga0070667_100000152 | 3300005367 | Bacteria | 86556 |
| 72 | Ga0070667_100009964 | 3300005367 | Bacteria | 7876 |
| 73 | Ga0070667_100052643 | 3300005367 | Bacteria | 3436 |
| 74 | Ga0070667_100818656 | 3300005367 | Bacteria | 865 |
| 75 | Ga0070667_101973677 | 3300005367 | Bacteria | 550 |
| 76 | Ga0070703_10434170 | 3300005406 | Bacteria | 578 |
| 77 | Ga0070714_100104092 | 3300005435 | Bacteria | 2504 |
| 78 | Ga0070714_100384567 | 3300005435 | Bacteria | 1324 |
| 79 | Ga0070714_100856549 | 3300005435 | Bacteria | 881 |
| 80 | Ga0070713_101633643 | 3300005436 | Bacteria | 625 |
| 81 | Ga0070710_10567670 | 3300005437 | Bacteria | 786 |
| 82 | Ga0070711_100061252 | 3300005439 | Bacteria | 2619 |
| 83 | Ga0070711_100356676 | 3300005439 | Bacteria | 1177 |
| 84 | Ga0070705_100036828 | 3300005440 | Bacteria | 2754 |
| 85 | Ga0070705_100045966 | 3300005440 | Bacteria | 2515 |
| 86 | Ga0070705_100214254 | 3300005440 | Bacteria | 1330 |
| 87 | Ga0070700_100005755 | 3300005441 | Bacteria | 6578 |
| 88 | Ga0070694_100227163 | 3300005444 | Bacteria | 1403 |
| 89 | Ga0070708_102210372 | 3300005445 | Bacteria | 508 |
| 90 | Ga0070663_100407695 | 3300005455 | Bacteria | 1112 |
| 91 | Ga0070678_100123226 | 3300005456 | Bacteria | 2047 |
| 92 | Ga0070662_100005437 | 3300005457 | Bacteria | 8135 |
| 93 | Ga0070662_100066497 | 3300005457 | Bacteria | 2644 |
| 94 | Ga0070662_100151577 | 3300005457 | Bacteria | 1805 |
| 95 | Ga0070662_100154225 | 3300005457 | Bacteria | 1791 |
| 96 | Ga0070662_100506176 | 3300005457 | Bacteria | 1008 |
| 97 | Ga0070681_10014076 | 3300005458 | Bacteria | 7961 |
| 98 | Ga0070681_10030742 | 3300005458 | Bacteria | 5389 |
| 99 | Ga0070681_10041636 | 3300005458 | Bacteria | 4604 |
| 100 | Ga0070681_10229958 | 3300005458 | Bacteria | 1769 |
| 101 | Ga0070681_10487511 | 3300005458 | Bacteria | 1145 |
| 102 | Ga0068867_100007408 | 3300005459 | Bacteria | 7760 |
| 103 | Ga0070685_10000046 | 3300005466 | Bacteria | 73999 |
| 104 | Ga0070706_100078812 | 3300005467 | Bacteria | 3050 |
| 105 | Ga0070699_101395048 | 3300005518 | Bacteria | 643 |
| 106 | Ga0070679_100026774 | 3300005530 | Bacteria | 5671 |
| 107 | Ga0070679_100281383 | 3300005530 | Bacteria | 1616 |
| 108 | Ga0070679_100537191 | 3300005530 | Bacteria | 1113 |
| 109 | Ga0070679_100606486 | 3300005530 | Bacteria | 1038 |
| 110 | Ga0070684_100016494 | 3300005535 | Bacteria | 6038 |
| 111 | Ga0070684_100988247 | 3300005535 | Bacteria | 790 |
| 112 | Ga0070697_100284636 | 3300005536 | Bacteria | 1419 |
| 113 | Ga0068853_100163578 | 3300005539 | Bacteria | 2009 |
| 114 | Ga0068853_100410391 | 3300005539 | Bacteria | 1269 |
| 115 | Ga0068853_100458931 | 3300005539 | Bacteria | 1199 |
| 116 | Ga0068853_100565972 | 3300005539 | Bacteria | 1077 |
| 117 | Ga0068853_101193898 | 3300005539 | Bacteria | 734 |
| 118 | Ga0070672_100092685 | 3300005543 | Bacteria | 2439 |
| 119 | Ga0070672_101008875 | 3300005543 | Bacteria | 738 |
| 120 | Ga0070686_100000030 | 3300005544 | Bacteria | 118308 |
| 121 | Ga0070695_100011453 | 3300005545 | Bacteria | 5304 |
| 122 | Ga0070695_100083595 | 3300005545 | Bacteria | 2115 |
| 123 | Ga0070695_100961278 | 3300005545 | Bacteria | 693 |
| 124 | Ga0070696_100514055 | 3300005546 | Bacteria | 955 |
| 125 | Ga0070696_100553811 | 3300005546 | Bacteria | 922 |
| 126 | Ga0070696_100804731 | 3300005546 | Bacteria | 774 |
| 127 | Ga0070696_101194723 | 3300005546 | Bacteria | 642 |
| 128 | Ga0070693_100011046 | 3300005547 | Bacteria | 4542 |
| 129 | Ga0070693_100452526 | 3300005547 | Bacteria | 901 |
| 130 | Ga0070665_100000056 | 3300005548 | Bacteria | 242622 |
| 131 | Ga0070665_100003473 | 3300005548 | Bacteria | 16785 |
| 132 | Ga0070704_100209537 | 3300005549 | Bacteria | 1578 |
| 133 | Ga0070704_101749865 | 3300005549 | Bacteria | 575 |
| 134 | Ga0068855_100037376 | 3300005563 | Bacteria | 5774 |
| 135 | Ga0068855_100043532 | 3300005563 | Bacteria | 5318 |
| 136 | Ga0068855_100184107 | 3300005563 | Bacteria | 2360 |
| 137 | Ga0068855_100351476 | 3300005563 | Bacteria | 1624 |
| 138 | Ga0068855_100408913 | 3300005563 | Bacteria | 1486 |
| 139 | Ga0070664_100034473 | 3300005564 | Bacteria | 4246 |
| 140 | Ga0070664_100432852 | 3300005564 | Bacteria | 1206 |
| 141 | Ga0068857_100008220 | 3300005577 | Bacteria | 9019 |
| 142 | Ga0068857_100010280 | 3300005577 | Bacteria | 8132 |
| 143 | Ga0068857_100241386 | 3300005577 | Bacteria | 1654 |
| 144 | Ga0068857_100280925 | 3300005577 | Bacteria | 1531 |
| 145 | Ga0068857_100563182 | 3300005577 | Bacteria | 1074 |
| 146 | Ga0068854_100077681 | 3300005578 | Bacteria | 2444 |
| 147 | Ga0068854_100360305 | 3300005578 | Bacteria | 1193 |
| 148 | Ga0068856_100097628 | 3300005614 | Bacteria | 2927 |
| 149 | Ga0068856_100202593 | 3300005614 | Bacteria | 1999 |
| 150 | Ga0068856_101153245 | 3300005614 | Bacteria | 792 |
| 151 | Ga0068856_101973726 | 3300005614 | Bacteria | 594 |
| 152 | Ga0070702_100167066 | 3300005615 | Bacteria | 1428 |
| 153 | Ga0068852_100079878 | 3300005616 | Bacteria | 2898 |
| 154 | Ga0068852_100268440 | 3300005616 | Bacteria | 1641 |
| 155 | Ga0068852_100949643 | 3300005616 | Bacteria | 878 |
| 156 | Ga0068859_100002159 | 3300005617 | Bacteria | 19984 |
| 157 | Ga0068859_100003975 | 3300005617 | Bacteria | 15087 |
| 158 | Ga0068859_100020980 | 3300005617 | Bacteria | 6558 |
| 159 | Ga0068859_100161616 | 3300005617 | Bacteria | 2319 |
| 160 | Ga0068864_100000245 | 3300005618 | Bacteria | 48553 |
| 161 | Ga0068864_100001636 | 3300005618 | Bacteria | 18474 |
| 162 | Ga0068864_100043422 | 3300005618 | Bacteria | 3849 |
| 163 | Ga0068864_100058115 | 3300005618 | Bacteria | 3342 |
| 164 | Ga0068864_100222676 | 3300005618 | Bacteria | 1741 |
| 165 | Ga0068864_101647623 | 3300005618 | Bacteria | 646 |
| 166 | Ga0068866_10037881 | 3300005718 | Bacteria | 2371 |
| 167 | Ga0068861_100006545 | 3300005719 | Bacteria | 7948 |
| 168 | Ga0068861_100450585 | 3300005719 | Bacteria | 1153 |
| 169 | Ga0068861_100650806 | 3300005719 | Bacteria | 973 |
| 170 | Ga0068851_10060087 | 3300005834 | Bacteria | 1945 |
| 171 | Ga0068870_10308889 | 3300005840 | Bacteria | 1001 |
| 172 | Ga0068863_100000065 | 3300005841 | Bacteria | 117925 |
| 173 | Ga0068863_100000516 | 3300005841 | Bacteria | 39335 |
| 174 | Ga0068863_100003234 | 3300005841 | Bacteria | 16132 |
| 175 | Ga0068858_100000821 | 3300005842 | Bacteria | 32408 |
| 176 | Ga0068858_100005370 | 3300005842 | Bacteria | 12561 |
| 177 | Ga0068858_100035804 | 3300005842 | Bacteria | 4604 |
| 178 | Ga0068858_100038866 | 3300005842 | Bacteria | 4414 |
| 179 | Ga0068860_100000032 | 3300005843 | Bacteria | 251624 |
| 180 | Ga0068860_100000132 | 3300005843 | Bacteria | 120657 |
| 181 | Ga0068860_100000653 | 3300005843 | Bacteria | 40425 |
| 182 | Ga0068860_100009274 | 3300005843 | Bacteria | 9782 |
| 183 | Ga0068862_100000356 | 3300005844 | Bacteria | 49670 |
| 184 | Ga0068862_100000638 | 3300005844 | Bacteria | 36283 |
| 185 | Ga0068862_100005614 | 3300005844 | Bacteria | 10484 |
| 186 | Ga0068862_100026325 | 3300005844 | Bacteria | 4889 |
| 187 | Ga0068862_100070950 | 3300005844 | Bacteria | 3008 |
| 188 | Ga0068862_100159574 | 3300005844 | Bacteria | 2012 |
| 189 | Ga0068862_100197499 | 3300005844 | Bacteria | 1812 |
| 190 | Ga0068862_100456420 | 3300005844 | Bacteria | 1205 |
| 191 | Ga0068862_100565487 | 3300005844 | Bacteria | 1087 |
| 192 | Ga0068862_100600347 | 3300005844 | Bacteria | 1057 |
| 193 | Ga0068862_101121240 | 3300005844 | Bacteria | 782 |
| 194 | Ga0081538_10177576 | 3300005981 | Bacteria | 917 |
| 195 | Ga0081540_1055329 | 3300005983 | Bacteria | 1933 |
| 196 | Ga0070717_10006289 | 3300006028 | Bacteria | 8722 |
| 197 | Ga0070717_10533754 | 3300006028 | Bacteria | 1062 |
| 198 | Ga0075368_10079600 | 3300006042 | Bacteria | 1332 |
| 199 | Ga0075364_10003424 | 3300006051 | Bacteria | 9017 |
| 200 | Ga0070716_100932721 | 3300006173 | Bacteria | 682 |
| 201 | Ga0070712_100263270 | 3300006175 | Bacteria | 1382 |
| 202 | Ga0075367_10011760 | 3300006178 | Bacteria | 4645 |
| 203 | Ga0075367_10063393 | 3300006178 | Bacteria | 2209 |
| 204 | Ga0075369_10494375 | 3300006186 | Bacteria | 581 |
| 205 | Ga0075366_10114155 | 3300006195 | Bacteria | 1626 |
| 206 | Ga0075366_10118768 | 3300006195 | Bacteria | 1593 |
| 207 | Ga0097621_100441456 | 3300006237 | Bacteria | 1171 |
| 208 | Ga0075370_10020138 | 3300006353 | Bacteria | 3643 |
| 209 | Ga0075370_10061778 | 3300006353 | Bacteria | 2134 |
| 210 | Ga0075370_10173999 | 3300006353 | Bacteria | 1266 |
| 211 | Ga0075370_10574283 | 3300006353 | Bacteria | 682 |
| 212 | Ga0068871_100088100 | 3300006358 | Bacteria | 2582 |
| 213 | Ga0068871_100889370 | 3300006358 | Bacteria | 825 |
| 214 | Ga0075428_100066407 | 3300006844 | Bacteria | 3949 |
| 215 | Ga0075428_100102914 | 3300006844 | Bacteria | 3114 |
| 216 | Ga0075428_100282668 | 3300006844 | Bacteria | 1785 |
| 217 | Ga0075428_100335721 | 3300006844 | Bacteria | 1623 |
| 218 | Ga0075428_100644051 | 3300006844 | Bacteria | 1130 |
| 219 | Ga0075430_100008579 | 3300006846 | Bacteria | 8623 |
| 220 | Ga0075430_100008751 | 3300006846 | Bacteria | 8542 |
| 221 | Ga0075430_100034569 | 3300006846 | Bacteria | 4290 |
| 222 | Ga0075430_100174590 | 3300006846 | Bacteria | 1788 |
| 223 | Ga0075431_100055566 | 3300006847 | Bacteria | 4084 |
| 224 | Ga0075431_100084807 | 3300006847 | Bacteria | 3270 |
| 225 | Ga0075431_100124950 | 3300006847 | Bacteria | 2655 |
| 226 | Ga0075431_100287958 | 3300006847 | Bacteria | 1662 |
| 227 | Ga0075431_100655631 | 3300006847 | Bacteria | 1030 |
| 228 | Ga0075431_102034268 | 3300006847 | Bacteria | 529 |
| 229 | Ga0075433_10458406 | 3300006852 | Bacteria | 1123 |
| 230 | Ga0075434_100214345 | 3300006871 | Bacteria | 1945 |
| 231 | Ga0075434_101808012 | 3300006871 | Bacteria | 618 |
| 232 | Ga0075429_100052398 | 3300006880 | Bacteria | 3550 |
| 233 | Ga0075429_100424513 | 3300006880 | Bacteria | 1164 |
| 234 | Ga0075429_101134592 | 3300006880 | Bacteria | 683 |
| 235 | Ga0068865_100283651 | 3300006881 | Bacteria | 1319 |
| 236 | Ga0097620_100002159 | 3300006931 | Bacteria | 19984 |
| 237 | Ga0097620_100003975 | 3300006931 | Bacteria | 15087 |
| 238 | Ga0097620_100020981 | 3300006931 | Bacteria | 6558 |
| 239 | Ga0097620_100161615 | 3300006931 | Bacteria | 2319 |
| 240 | Ga0097620_100676952 | 3300006931 | Bacteria | 1123 |
| 241 | Ga0075435_100188539 | 3300007076 | Bacteria | 1745 |
| 242 | Ga0075435_101505653 | 3300007076 | Bacteria | 590 |
| 243 | Ga0105244_10252797 | 3300009036 | Bacteria | 821 |
| 244 | Ga0105250_10097612 | 3300009092 | Bacteria | 1198 |
| 245 | Ga0105240_10000671 | 3300009093 | Bacteria | 62794 |
| 246 | Ga0105240_10018243 | 3300009093 | Bacteria | 9431 |
| 247 | Ga0105240_10381121 | 3300009093 | Bacteria | 1593 |
| 248 | Ga0105240_11121365 | 3300009093 | Bacteria | 836 |
| 249 | Ga0111539_10589405 | 3300009094 | Bacteria | 1295 |
| 250 | Ga0111539_10766970 | 3300009094 | Bacteria | 1122 |
| 251 | Ga0111539_10837644 | 3300009094 | Bacteria | 1070 |
| 252 | Ga0111539_10938887 | 3300009094 | Bacteria | 1006 |
| 253 | Ga0111539_11004405 | 3300009094 | Bacteria | 970 |
| 254 | Ga0111539_11617824 | 3300009094 | Bacteria | 751 |
| 255 | Ga0105245_10076531 | 3300009098 | Bacteria | 3049 |
| 256 | Ga0105245_10543610 | 3300009098 | Bacteria | 1183 |
| 257 | Ga0105245_11464734 | 3300009098 | Bacteria | 733 |
| 258 | Ga0105245_12329724 | 3300009098 | Bacteria | 589 |
| 259 | Ga0105247_10035094 | 3300009101 | Bacteria | 3056 |
| 260 | Ga0105247_10098873 | 3300009101 | Bacteria | 1863 |
| 261 | Ga0105247_10652288 | 3300009101 | Bacteria | 786 |
| 262 | Ga0114129_10000745 | 3300009147 | Bacteria | 41347 |
| 263 | Ga0114129_10216471 | 3300009147 | Bacteria | 2586 |
| 264 | Ga0114129_10375634 | 3300009147 | Bacteria | 1878 |
| 265 | Ga0114129_10532586 | 3300009147 | Bacteria | 1530 |
| 266 | Ga0114129_10793836 | 3300009147 | Bacteria | 1208 |
| 267 | Ga0114129_10808146 | 3300009147 | Bacteria | 1196 |
| 268 | Ga0105243_10391776 | 3300009148 | Bacteria | 1288 |
| 269 | Ga0105243_10805468 | 3300009148 | Bacteria | 926 |
| 270 | Ga0105241_10086169 | 3300009174 | Bacteria | 2470 |
| 271 | Ga0105241_11644588 | 3300009174 | Bacteria | 622 |
| 272 | Ga0105242_10194425 | 3300009176 | Bacteria | 1798 |
| 273 | Ga0105242_10594840 | 3300009176 | Bacteria | 1068 |
| 274 | Ga0105242_11101440 | 3300009176 | Bacteria | 808 |
| 275 | Ga0105248_10003063 | 3300009177 | Bacteria | 18537 |
| 276 | Ga0105248_10168892 | 3300009177 | Bacteria | 2465 |
| 277 | Ga0105248_10218333 | 3300009177 | Bacteria | 2147 |
| 278 | Ga0105248_10326716 | 3300009177 | Bacteria | 1728 |
| 279 | Ga0105248_10629335 | 3300009177 | Bacteria | 1211 |
| 280 | Ga0105248_12200769 | 3300009177 | Bacteria | 627 |
| 281 | Ga0105237_10041422 | 3300009545 | Bacteria | 4644 |
| 282 | Ga0105237_10072029 | 3300009545 | Bacteria | 3450 |
| 283 | Ga0105237_11257466 | 3300009545 | Bacteria | 747 |
| 284 | Ga0105238_10019049 | 3300009551 | Bacteria | 6992 |
| 285 | Ga0105238_10022500 | 3300009551 | Bacteria | 6424 |
| 286 | Ga0105238_10100629 | 3300009551 | Bacteria | 2873 |
| 287 | Ga0105238_10168351 | 3300009551 | Bacteria | 2167 |
| 288 | Ga0105238_10491129 | 3300009551 | Bacteria | 1228 |
| 289 | Ga0105249_10000109 | 3300009553 | Bacteria | 112308 |
| 290 | Ga0105249_10006288 | 3300009553 | Bacteria | 10316 |
| 291 | Ga0105249_10040669 | 3300009553 | Bacteria | 4223 |
| 292 | Ga0105249_10044880 | 3300009553 | Bacteria | 4019 |
| 293 | Ga0105249_10768915 | 3300009553 | Bacteria | 1026 |
| 294 | Ga0105249_11726440 | 3300009553 | Bacteria | 698 |
| 295 | Ga0105239_10204065 | 3300010375 | Bacteria | 2215 |
| 296 | Ga0105239_10529788 | 3300010375 | Bacteria | 1341 |
| 297 | Ga0105239_10708147 | 3300010375 | Bacteria | 1151 |
| 298 | Ga0105239_10724445 | 3300010375 | Bacteria | 1138 |
| 299 | Ga0105239_12793220 | 3300010375 | Bacteria | 570 |
| 300 | Ga0105246_10066374 | 3300011119 | Bacteria | 2526 |
| 301 | Ga0105246_11071271 | 3300011119 | Bacteria | 734 |
| 302 | Ga0157373_10136481 | 3300013100 | Bacteria | 1725 |
| 303 | Ga0157373_10140232 | 3300013100 | Bacteria | 1700 |
| 304 | Ga0157370_10087756 | 3300013104 | Bacteria | 2922 |
| 305 | Ga0157370_10494797 | 3300013104 | Bacteria | 1123 |
| 306 | Ga0157369_10402814 | 3300013105 | Bacteria | 1419 |
| 307 | Ga0157369_10677775 | 3300013105 | Bacteria | 1062 |
| 308 | Ga0171462_1033 | 3300013250 | Bacteria | 90238 |
| 309 | Ga0157374_11980524 | 3300013296 | Bacteria | 609 |
| 310 | Ga0163162_10077860 | 3300013306 | Bacteria | 3380 |
| 311 | Ga0163162_10106902 | 3300013306 | Bacteria | 2893 |
| 312 | Ga0163162_10170855 | 3300013306 | Bacteria | 2299 |
| 313 | Ga0163162_10781695 | 3300013306 | Bacteria | 1073 |
| 314 | Ga0163162_11298004 | 3300013306 | Bacteria | 827 |
| 315 | Ga0157372_10104618 | 3300013307 | Bacteria | 3236 |
| 316 | Ga0157372_10271507 | 3300013307 | Bacteria | 1971 |
| 317 | Ga0157372_12649118 | 3300013307 | Bacteria | 575 |
| 318 | Ga0157375_10007541 | 3300013308 | Bacteria | 9512 |
| 319 | Ga0157375_10308033 | 3300013308 | Bacteria | 1748 |
| 320 | Ga0163163_10000744 | 3300014325 | Bacteria | 27738 |
| 321 | Ga0163163_10056749 | 3300014325 | Bacteria | 3870 |
| 322 | Ga0163163_10371393 | 3300014325 | Bacteria | 1487 |
| 323 | Ga0163163_11222863 | 3300014325 | Bacteria | 814 |
| 324 | Ga0157380_10000599 | 3300014326 | Bacteria | 22227 |
| 325 | Ga0157380_10403480 | 3300014326 | Bacteria | 1298 |
| 326 | Ga0157380_10726379 | 3300014326 | Bacteria | 1001 |
| 327 | Ga0157380_10726849 | 3300014326 | Bacteria | 1001 |
| 328 | Ga0157377_10014975 | 3300014745 | Bacteria | 3954 |
| 329 | Ga0157379_10005894 | 3300014968 | Bacteria | 10546 |
| 330 | Ga0157379_10022792 | 3300014968 | Bacteria | 5549 |
| 331 | Ga0157379_10713845 | 3300014968 | Bacteria | 942 |
| 332 | Ga0157379_10893049 | 3300014968 | Bacteria | 843 |
| 333 | Ga0163161_10000084 | 3300017792 | Bacteria | 93742 |
| 334 | Ga0213873_10093913 | 3300021358 | Bacteria | 855 |
| 335 | Ga0213872_10010483 | 3300021361 | Bacteria | 4409 |
| 336 | Ga0213872_10037050 | 3300021361 | Bacteria | 2227 |
| 337 | Ga0213875_10107095 | 3300021388 | Bacteria | 1305 |
| 338 | Ga0213875_10176951 | 3300021388 | Bacteria | 1002 |
| 339 | Ga0207672_1000296 | 3300025223 | Bacteria | 6734 |
| 340 | Ga0209673_1016862 | 3300025273 | Bacteria | 2715 |
| 341 | Ga0209676_1000343 | 3300025292 | Bacteria | 88398 |
| 342 | Ga0209025_1000014 | 3300025294 | Bacteria | 865448 |
| 343 | Ga0209025_1028265 | 3300025294 | Bacteria | 2755 |
| 344 | Ga0209564_1000017 | 3300025295 | Bacteria | 594063 |
| 345 | Ga0209564_1000150 | 3300025295 | Bacteria | 170318 |
| 346 | Ga0209256_1000108 | 3300025299 | Bacteria | 185884 |
| 347 | Ga0209256_1000338 | 3300025299 | Bacteria | 78064 |
| 348 | Ga0209257_1124285 | 3300025304 | Bacteria | 599 |
| 349 | Ga0207656_10074562 | 3300025321 | Bacteria | 1514 |
| 350 | Ga0207692_10126826 | 3300025898 | Bacteria | 1436 |
| 351 | Ga0207642_10004579 | 3300025899 | Bacteria | 4466 |
| 352 | Ga0207642_10512501 | 3300025899 | Bacteria | 736 |
| 353 | Ga0207710_10051986 | 3300025900 | Bacteria | 1842 |
| 354 | Ga0207710_10327655 | 3300025900 | Bacteria | 777 |
| 355 | Ga0207710_10552090 | 3300025900 | Bacteria | 600 |
| 356 | Ga0207688_10010554 | 3300025901 | Bacteria | 5024 |
| 357 | Ga0207680_10000009 | 3300025903 | Bacteria | 464571 |
| 358 | Ga0207647_10000766 | 3300025904 | Bacteria | 25085 |
| 359 | Ga0207647_10106875 | 3300025904 | Bacteria | 1656 |
| 360 | Ga0207645_10568816 | 3300025907 | Bacteria | 769 |
| 361 | Ga0207643_10093320 | 3300025908 | Bacteria | 1757 |
| 362 | Ga0207705_10004861 | 3300025909 | Bacteria | 10087 |
| 363 | Ga0207705_10105946 | 3300025909 | Bacteria | 2073 |
| 364 | Ga0207705_10762507 | 3300025909 | Bacteria | 751 |
| 365 | Ga0207684_10147688 | 3300025910 | Bacteria | 2022 |
| 366 | Ga0207654_10000868 | 3300025911 | Bacteria | 16743 |
| 367 | Ga0207654_10002810 | 3300025911 | Bacteria | 8833 |
| 368 | Ga0207654_10184888 | 3300025911 | Bacteria | 1362 |
| 369 | Ga0207654_10522774 | 3300025911 | Bacteria | 840 |
| 370 | Ga0207707_10068274 | 3300025912 | Bacteria | 3097 |
| 371 | Ga0207707_10114316 | 3300025912 | Bacteria | 2359 |
| 372 | Ga0207707_10156135 | 3300025912 | Bacteria | 1996 |
| 373 | Ga0207707_10222486 | 3300025912 | Bacteria | 1643 |
| 374 | Ga0207707_10260687 | 3300025912 | Bacteria | 1504 |
| 375 | Ga0207695_10000876 | 3300025913 | Bacteria | 54758 |
| 376 | Ga0207695_10002095 | 3300025913 | Bacteria | 30360 |
| 377 | Ga0207695_10003070 | 3300025913 | Bacteria | 23930 |
| 378 | Ga0207695_10004968 | 3300025913 | Bacteria | 17901 |
| 379 | Ga0207695_10146550 | 3300025913 | Bacteria | 2304 |
| 380 | Ga0207695_10201215 | 3300025913 | Bacteria | 1906 |
| 381 | Ga0207671_10006894 | 3300025914 | Bacteria | 10023 |
| 382 | Ga0207671_10070299 | 3300025914 | Bacteria | 2609 |
| 383 | Ga0207693_10011477 | 3300025915 | Bacteria | 7166 |
| 384 | Ga0207693_10238743 | 3300025915 | Bacteria | 1427 |
| 385 | Ga0207663_10076004 | 3300025916 | Bacteria | 2181 |
| 386 | Ga0207663_10307577 | 3300025916 | Bacteria | 1187 |
| 387 | Ga0207660_10059463 | 3300025917 | Bacteria | 2744 |
| 388 | Ga0207660_10147324 | 3300025917 | Bacteria | 1805 |
| 389 | Ga0207660_10196094 | 3300025917 | Bacteria | 1575 |
| 390 | Ga0207660_11365648 | 3300025917 | Bacteria | 575 |
| 391 | Ga0207662_10502415 | 3300025918 | Bacteria | 835 |
| 392 | Ga0207657_10007686 | 3300025919 | Bacteria | 11017 |
| 393 | Ga0207657_10040691 | 3300025919 | Bacteria | 4116 |
| 394 | Ga0207657_10240877 | 3300025919 | Bacteria | 1444 |
| 395 | Ga0207657_10612786 | 3300025919 | Bacteria | 849 |
| 396 | Ga0207649_10157546 | 3300025920 | Bacteria | 1570 |
| 397 | Ga0207652_10396289 | 3300025921 | Bacteria | 1246 |
| 398 | Ga0207652_11190684 | 3300025921 | Bacteria | 663 |
| 399 | Ga0207681_10000965 | 3300025923 | Bacteria | 18765 |
| 400 | Ga0207681_10763842 | 3300025923 | Bacteria | 806 |
| 401 | Ga0207694_10090258 | 3300025924 | Bacteria | 2417 |
| 402 | Ga0207694_10125317 | 3300025924 | Bacteria | 2054 |
| 403 | Ga0207694_10303669 | 3300025924 | Bacteria | 1314 |
| 404 | Ga0207694_10559462 | 3300025924 | Bacteria | 960 |
| 405 | Ga0207694_11323055 | 3300025924 | Bacteria | 609 |
| 406 | Ga0207650_10000378 | 3300025925 | Bacteria | 41832 |
| 407 | Ga0207650_10122997 | 3300025925 | Bacteria | 2022 |
| 408 | Ga0207650_10186042 | 3300025925 | Bacteria | 1657 |
| 409 | Ga0207650_10611152 | 3300025925 | Bacteria | 917 |
| 410 | Ga0207659_10004912 | 3300025926 | Bacteria | 8098 |
| 411 | Ga0207659_10182710 | 3300025926 | Bacteria | 1663 |
| 412 | Ga0207687_10533384 | 3300025927 | Bacteria | 983 |
| 413 | Ga0207687_10997577 | 3300025927 | Bacteria | 718 |
| 414 | Ga0207700_10546791 | 3300025928 | Bacteria | 1028 |
| 415 | Ga0207664_10151107 | 3300025929 | Bacteria | 1973 |
| 416 | Ga0207644_10003709 | 3300025931 | Bacteria | 9897 |
| 417 | Ga0207644_10103058 | 3300025931 | Bacteria | 2147 |
| 418 | Ga0207644_10117953 | 3300025931 | Bacteria | 2016 |
| 419 | Ga0207690_10137604 | 3300025932 | Bacteria | 1795 |
| 420 | Ga0207690_10596165 | 3300025932 | Bacteria | 901 |
| 421 | Ga0207706_10020148 | 3300025933 | Bacteria | 5993 |
| 422 | Ga0207706_10040317 | 3300025933 | Bacteria | 4139 |
| 423 | Ga0207706_10051223 | 3300025933 | Bacteria | 3646 |
| 424 | Ga0207706_10501732 | 3300025933 | Bacteria | 1047 |
| 425 | Ga0207706_10501733 | 3300025933 | Bacteria | 1047 |
| 426 | Ga0207686_11170379 | 3300025934 | Bacteria | 629 |
| 427 | Ga0207709_10525045 | 3300025935 | Bacteria | 927 |
| 428 | Ga0207670_10022376 | 3300025936 | Bacteria | 3917 |
| 429 | Ga0207670_10054735 | 3300025936 | Bacteria | 2693 |
| 430 | Ga0207669_10301972 | 3300025937 | Bacteria | 1217 |
| 431 | Ga0207691_10018446 | 3300025940 | Bacteria | 6612 |
| 432 | Ga0207711_10004477 | 3300025941 | Bacteria | 11910 |
| 433 | Ga0207711_10005259 | 3300025941 | Bacteria | 10973 |
| 434 | Ga0207711_10043340 | 3300025941 | Bacteria | 3837 |
| 435 | Ga0207711_10079035 | 3300025941 | Bacteria | 2870 |
| 436 | Ga0207711_10106037 | 3300025941 | Bacteria | 2493 |
| 437 | Ga0207711_10545579 | 3300025941 | Bacteria | 1081 |
| 438 | Ga0207661_10904371 | 3300025944 | Bacteria | 813 |
| 439 | Ga0207679_10013683 | 3300025945 | Bacteria | 5320 |
| 440 | Ga0207679_10700207 | 3300025945 | Bacteria | 919 |
| 441 | Ga0207667_10013251 | 3300025949 | Bacteria | 9450 |
| 442 | Ga0207667_10041103 | 3300025949 | Bacteria | 4919 |
| 443 | Ga0207667_10067709 | 3300025949 | Bacteria | 3719 |
| 444 | Ga0207667_10202140 | 3300025949 | Bacteria | 2038 |
| 445 | Ga0207667_10361064 | 3300025949 | Bacteria | 1481 |
| 446 | Ga0207651_10028339 | 3300025960 | Bacteria | 3531 |
| 447 | Ga0207712_10000046 | 3300025961 | Bacteria | 162468 |
| 448 | Ga0207712_10014037 | 3300025961 | Bacteria | 5142 |
| 449 | Ga0207668_10001618 | 3300025972 | Bacteria | 13153 |
| 450 | Ga0207668_10011845 | 3300025972 | Bacteria | 5316 |
| 451 | Ga0207668_10020444 | 3300025972 | Bacteria | 4206 |
| 452 | Ga0207668_10021901 | 3300025972 | Bacteria | 4082 |
| 453 | Ga0207668_10172515 | 3300025972 | Bacteria | 1697 |
| 454 | Ga0207668_10440739 | 3300025972 | Bacteria | 1109 |
| 455 | Ga0207668_10473346 | 3300025972 | Bacteria | 1073 |
| 456 | Ga0207668_11144001 | 3300025972 | Bacteria | 698 |
| 457 | Ga0207668_11219305 | 3300025972 | Bacteria | 676 |
| 458 | Ga0207640_10101558 | 3300025981 | Bacteria | 2018 |
| 459 | Ga0207658_10000189 | 3300025986 | Bacteria | 65788 |
| 460 | Ga0207658_10000784 | 3300025986 | Bacteria | 27123 |
| 461 | Ga0207658_10007593 | 3300025986 | Bacteria | 7388 |
| 462 | Ga0207703_10000278 | 3300026035 | Bacteria | 56746 |
| 463 | Ga0207703_10005251 | 3300026035 | Bacteria | 10446 |
| 464 | Ga0207703_10023484 | 3300026035 | Bacteria | 4844 |
| 465 | Ga0207703_11280694 | 3300026035 | Bacteria | 705 |
| 466 | Ga0207639_10008983 | 3300026041 | Bacteria | 6881 |
| 467 | Ga0207639_10321776 | 3300026041 | Bacteria | 1373 |
| 468 | Ga0207639_10551073 | 3300026041 | Bacteria | 1059 |
| 469 | Ga0207678_10014887 | 3300026067 | Bacteria | 6841 |
| 470 | Ga0207678_10286350 | 3300026067 | Bacteria | 1415 |
| 471 | Ga0207678_10476904 | 3300026067 | Bacteria | 1086 |
| 472 | Ga0207708_10168093 | 3300026075 | Bacteria | 1735 |
| 473 | Ga0207702_10001550 | 3300026078 | Bacteria | 22735 |
| 474 | Ga0207702_10029757 | 3300026078 | Bacteria | 4545 |
| 475 | Ga0207702_10452033 | 3300026078 | Bacteria | 1246 |
| 476 | Ga0207641_10000063 | 3300026088 | Bacteria | 159283 |
| 477 | Ga0207641_10000260 | 3300026088 | Bacteria | 66830 |
| 478 | Ga0207641_10006925 | 3300026088 | Bacteria | 9488 |
| 479 | Ga0207676_10000233 | 3300026095 | Bacteria | 48533 |
| 480 | Ga0207676_10003249 | 3300026095 | Bacteria | 11573 |
| 481 | Ga0207676_10048314 | 3300026095 | Bacteria | 3303 |
| 482 | Ga0207676_10067629 | 3300026095 | Bacteria | 2854 |
| 483 | Ga0207676_10104251 | 3300026095 | Bacteria | 2358 |
| 484 | Ga0207676_10171124 | 3300026095 | Bacteria | 1893 |
| 485 | Ga0207676_10253368 | 3300026095 | Bacteria | 1586 |
| 486 | Ga0207674_10000811 | 3300026116 | Bacteria | 40585 |
| 487 | Ga0207674_10005308 | 3300026116 | Bacteria | 15329 |
| 488 | Ga0207674_10063883 | 3300026116 | Bacteria | 3714 |
| 489 | Ga0207674_10329138 | 3300026116 | Bacteria | 1477 |
| 490 | Ga0207674_10640391 | 3300026116 | Bacteria | 1026 |
| 491 | Ga0207675_100000167 | 3300026118 | Bacteria | 58637 |
| 492 | Ga0207675_100047567 | 3300026118 | Bacteria | 4005 |
| 493 | Ga0207675_100667485 | 3300026118 | Bacteria | 1046 |
| 494 | Ga0207675_100884716 | 3300026118 | Bacteria | 909 |
| 495 | Ga0207683_10036937 | 3300026121 | Bacteria | 4254 |
| 496 | Ga0207698_10018372 | 3300026142 | Bacteria | 4762 |
| 497 | Ga0207698_10689508 | 3300026142 | Bacteria | 1015 |
| 498 | Ga0207698_11296025 | 3300026142 | Bacteria | 743 |
| 499 | Ga0207428_10128038 | 3300027907 | Bacteria | 1944 |
| 500 | Ga0207428_10266497 | 3300027907 | Bacteria | 1275 |
| 501 | Ga0268266_10000066 | 3300028379 | Bacteria | 242637 |
| 502 | Ga0268266_10000805 | 3300028379 | Bacteria | 41604 |
| 503 | Ga0268266_10209637 | 3300028379 | Bacteria | 1786 |
| 504 | Ga0268266_10399807 | 3300028379 | Bacteria | 1299 |
| 505 | Ga0268265_10000129 | 3300028380 | Bacteria | 96060 |
| 506 | Ga0268265_10000445 | 3300028380 | Bacteria | 43689 |
| 507 | Ga0268265_10003546 | 3300028380 | Bacteria | 11161 |
| 508 | Ga0268265_10004220 | 3300028380 | Bacteria | 10038 |
| 509 | Ga0268265_10004653 | 3300028380 | Bacteria | 9475 |
| 510 | Ga0268265_10058315 | 3300028380 | Bacteria | 2947 |
| 511 | Ga0268265_10169989 | 3300028380 | Bacteria | 1862 |
| 512 | Ga0268265_10248731 | 3300028380 | Bacteria | 1573 |
| 513 | Ga0268265_10544775 | 3300028380 | Bacteria | 1100 |
| 514 | Ga0268264_10000045 | 3300028381 | Bacteria | 364764 |
| 515 | Ga0268264_10000130 | 3300028381 | Bacteria | 181732 |
| 516 | Ga0268264_10000248 | 3300028381 | Bacteria | 101501 |
| 517 | Ga0268264_10007926 | 3300028381 | Bacteria | 8837 |
| 518 | Ga0268264_10042602 | 3300028381 | Bacteria | 3758 |
| 519 | Ga0268264_11105894 | 3300028381 | Bacteria | 801 |
| 520 | Ga0265334_10006729 | 3300028573 | Bacteria | 4937 |
| 521 | Ga0265318_10019261 | 3300028577 | Bacteria | 2770 |
| 522 | Ga0307517_10374994 | 3300028786 | Bacteria | 763 |
| 523 | Ga0265338_10022804 | 3300028800 | Bacteria | 6463 |
| 524 | Ga0265338_10026178 | 3300028800 | Bacteria | 5894 |
| 525 | Ga0265338_10026523 | 3300028800 | Bacteria | 5841 |
| 526 | Ga0265338_10094210 | 3300028800 | Bacteria | 2464 |
| 527 | Ga0265338_10119775 | 3300028800 | Bacteria | 2101 |
| 528 | Ga0265338_10335903 | 3300028800 | Bacteria | 1090 |
| 529 | Ga0307511_10005612 | 3300030521 | Bacteria | 12736 |
| 530 | Ga0265760_10018652 | 3300031090 | Bacteria | 1998 |
| 531 | Ga0265328_10004612 | 3300031239 | Bacteria | 5967 |
| 532 | Ga0265320_10000765 | 3300031240 | Bacteria | 24662 |
| 533 | Ga0265325_10058885 | 3300031241 | Bacteria | 1955 |
| 534 | Ga0265340_10140923 | 3300031247 | Bacteria | 1103 |
| 535 | Ga0265339_10376476 | 3300031249 | Bacteria | 666 |
| 536 | Ga0265331_10000019 | 3300031250 | Bacteria | 258837 |
| 537 | Ga0265327_10000928 | 3300031251 | Bacteria | 42902 |
| 538 | Ga0265327_10488398 | 3300031251 | Bacteria | 531 |
| 539 | Ga0307513_10075345 | 3300031456 | Bacteria | 3504 |
| 540 | Ga0307408_100050214 | 3300031548 | Bacteria | 2999 |
| 541 | Ga0307408_100102895 | 3300031548 | Bacteria | 2179 |
| 542 | Ga0307408_100511061 | 3300031548 | Bacteria | 1053 |
| 543 | Ga0307408_101094255 | 3300031548 | Bacteria | 739 |
| 544 | Ga0265313_10000644 | 3300031595 | Bacteria | 35985 |
| 545 | Ga0265313_10004334 | 3300031595 | Bacteria | 10976 |
| 546 | Ga0307508_10742356 | 3300031616 | Bacteria | 594 |
| 547 | Ga0316579_10006754 | 3300031691 | Bacteria | 4699 |
| 548 | Ga0265314_10143936 | 3300031711 | Bacteria | 1470 |
| 549 | Ga0265314_10159320 | 3300031711 | Bacteria | 1375 |
| 550 | Ga0316576_10048037 | 3300031727 | Bacteria | 3093 |
| 551 | Ga0316578_10002183 | 3300031728 | Bacteria | 8451 |
| 552 | Ga0307516_10000002 | 3300031730 | Bacteria | 467851 |
| 553 | Ga0307405_10152973 | 3300031731 | Bacteria | 1624 |
| 554 | Ga0316577_10056675 | 3300031733 | Bacteria | 2187 |
| 555 | Ga0307413_10108930 | 3300031824 | Bacteria | 1850 |
| 556 | Ga0307406_10202447 | 3300031901 | Bacteria | 1462 |
| 557 | Ga0307406_10333774 | 3300031901 | Bacteria | 1178 |
| 558 | Ga0307406_10907461 | 3300031901 | Bacteria | 750 |
| 559 | Ga0307406_11179754 | 3300031901 | Bacteria | 664 |
| 560 | Ga0307412_10059815 | 3300031911 | Bacteria | 2555 |
| 561 | Ga0307409_100044588 | 3300031995 | Bacteria | 3342 |
| 562 | Ga0307416_100213800 | 3300032002 | Bacteria | 1842 |
| 563 | Ga0307414_10051626 | 3300032004 | Bacteria | 2856 |
| 564 | Ga0307414_10263254 | 3300032004 | Bacteria | 1440 |
| 565 | Ga0307414_10562100 | 3300032004 | Bacteria | 1018 |
| 566 | Ga0307414_11338820 | 3300032004 | Bacteria | 665 |
| 567 | Ga0307411_10733024 | 3300032005 | Bacteria | 864 |
| 568 | Ga0307411_10741506 | 3300032005 | Bacteria | 860 |
| 569 | Ga0316585_10033052 | 3300032137 | Bacteria | 1631 |
| 570 | Ga0316580_10021695 | 3300032139 | Bacteria | 1980 |
| 571 | Ga0307510_10163086 | 3300033180 | Bacteria | 1822 |
| 572 | Ga0373958_0027320 | 3300034819 | Bacteria | 1098 |
| 573 | Ga0373938_0122792 | 3300034957 | Bacteria | 671 |
| 574 | Ga0373928_0286993 | 3300035084 | Bacteria | 500 |
| 575 | Ga0373940_0029440 | 3300035088 | Bacteria | 1455 |
| 576 | Ga0373932_0324789 | 3300035112 | Bacteria | 580 |
| 577 | Ga0373939_0017187 | 3300035114 | Bacteria | 1919 |
| 578 | Ga0373941_0064254 | 3300035115 | Bacteria | 1202 |
| 579 | Ga0373941_0086296 | 3300035115 | Bacteria | 1069 |
| 580 | Ga0373953_0041532 | 3300035117 | Bacteria | 1830 |
| 581 | Ga0373953_0195470 | 3300035117 | Bacteria | 874 |
| 582 | Ga0373954_0004243 | 3300035118 | Bacteria | 6158 |
| 583 | Ga0373956_0058473 | 3300035119 | Bacteria | 1743 |
| 584 | Ga0373960_0067528 | 3300035121 | Bacteria | 1098 |
| 585 | Ga0373942_0080996 | 3300035207 | Bacteria | 964 |
| 586 | Ga0373942_0262969 | 3300035207 | Bacteria | 590 |
| 587 | Ga0373962_0009228 | 3300035242 | Bacteria | 2439 |
| 588 | Ga0316574_0010852 | 3300035398 | Bacteria | 5161 |
| 589 | Ga0373924_0033263 | 3300035410 | Bacteria | 2081 |
| 590 | Ga0373931_0058733 | 3300035691 | Bacteria | 2067 |
| 591 | Ga0373931_0269096 | 3300035691 | Bacteria | 1042 |
| 592 | Ga0373931_0524428 | 3300035691 | Bacteria | 767 |
| 593 | Ga0373927_0077921 | 3300035695 | Bacteria | 2147 |
| 594 | Ga0373933_0007330 | 3300035724 | Bacteria | 6018 |
| 595 | Ga0373947_0539777 | 3300035725 | Bacteria | 793 |
| 596 | Ga0373937_0312383 | 3300036401 | Bacteria | 1487 |
| 597 | Ga0373937_1079723 | 3300036401 | Bacteria | 751 |
| 598 | Ga0316582_0035297 | 3300036647 | Bacteria | 3086 |
| 599 | Ga0316584_0066758 | 3300036712 | Bacteria | 2695 |
| 600 | Ga0373925_0421645 | 3300037068 | Bacteria | 1090 |
| 601 | Ga0395899_0000178 | 3300037312 | Bacteria | 93671 |
| 602 | Ga0395899_0096936 | 3300037312 | Bacteria | 2132 |
| 603 | Ga0395900_0001522 | 3300037418 | Bacteria | 27543 |
| 604 | Ga0395900_0013620 | 3300037418 | Bacteria | 8304 |
| 605 | Ga0395900_0060994 | 3300037418 | Bacteria | 3879 |
| 606 | Ga0395900_0283939 | 3300037418 | Bacteria | 1646 |
| 607 | Ga0395900_1138488 | 3300037418 | Bacteria | 697 |
| 608 | Ga0395898_0006429 | 3300037466 | Bacteria | 12549 |
| 609 | Ga0395898_0086977 | 3300037466 | Bacteria | 3011 |
| 610 | Ga0395898_0123742 | 3300037466 | Bacteria | 2478 |
| 611 | Ga0395905_0010228 | 3300037471 | Bacteria | 9143 |
| 612 | Ga0395905_0313980 | 3300037471 | Bacteria | 1456 |
| 613 | Ga0395905_0352779 | 3300037471 | Bacteria | 1363 |
| 614 | Ga0395905_0757071 | 3300037471 | Bacteria | 874 |
| 615 | Ga0395905_0829320 | 3300037471 | Bacteria | 827 |
| 616 | Ga0436364_0252525 | 3300037853 | Bacteria | 644 |
| 617 | Ga0436364_0740827 | 3300037853 | Bacteria | 1564 |
| 618 | Ga0436364_0828364 | 3300037853 | Bacteria | 1404 |
| 619 | Ga0395901_0000001 | 3300038443 | Bacteria | 800383 |
| 620 | Ga0395901_0101972 | 3300038443 | Bacteria | 3011 |
| 621 | Ga0395901_0879661 | 3300038443 | Bacteria | 879 |
| 622 | Ga0395901_0909059 | 3300038443 | Bacteria | 862 |
| 623 | Ga0242420_069071 | 3300038996 | Bacteria | 716 |
| 624 | Ga0400483_062723 | 3300039062 | Bacteria | 13444 |
| 625 | Ga0436365_0223789 | 3300039437 | Bacteria | 888 |
| 626 | Ga0436365_1441610 | 3300039437 | Bacteria | 827 |
| 627 | Ga0436365_1846196 | 3300039437 | Bacteria | 4881 |
| 628 | Ga0436360_0091052 | 3300039438 | Bacteria | 514 |
| 629 | Ga0436360_0343564 | 3300039438 | Bacteria | 632 |
| 630 | Ga0436360_0735785 | 3300039438 | Bacteria | 1054 |
| 631 | Ga0436361_0016812 | 3300039447 | Bacteria | 2234 |
| 632 | Ga0436361_0205614 | 3300039447 | Bacteria | 1512 |
| 633 | Ga0436361_0215284 | 3300039447 | Bacteria | 11054 |
| 634 | Ga0436361_0540899 | 3300039447 | Bacteria | 1843 |
| 635 | Ga0436361_0641214 | 3300039447 | Bacteria | 2667 |
| 636 | Ga0436361_1001866 | 3300039447 | Bacteria | 37490 |
| 637 | Ga0436363_0057851 | 3300039450 | Bacteria | 2194 |
| 638 | Ga0436363_1627005 | 3300039450 | Bacteria | 917 |
| 639 | Ga0436363_1685778 | 3300039450 | Bacteria | 2894 |
| 640 | Ga0436362_1235293 | 3300039453 | Bacteria | 1270 |
| 641 | Ga0436362_1289189 | 3300039453 | Bacteria | 592 |
| 642 | Ga0451797_0790261 | 3300041453 | Bacteria | 697 |
| 643 | Ga0451841_0404297 | 3300041498 | Bacteria | 504 |
| 644 | Ga0439448_0088266 | 3300042005 | Bacteria | 1046 |
| 645 | Ga0439454_018205 | 3300042011 | Bacteria | 1011 |
| 646 | Ga0450896_019627 | 3300042133 | Bacteria | 985 |
| 647 | Ga0439446_0065351 | 3300042156 | Bacteria | 1105 |
| 648 | Ga0451577_0002876 | 3300042876 | Bacteria | 19794 |
| 649 | Ga0451577_0029071 | 3300042876 | Bacteria | 4997 |
| 650 | Ga0451577_0031237 | 3300042876 | Bacteria | 4807 |
| 651 | Ga0451577_0121174 | 3300042876 | Bacteria | 2343 |
| 652 | Ga0451577_0595897 | 3300042876 | Bacteria | 1003 |
| 653 | Ga0453683_0029861 | 3300044673 | Bacteria | 3445 |
| 654 | Ga0453684_0023503 | 3300044712 | Bacteria | 9071 |
| 655 | Ga0453684_0102090 | 3300044712 | Bacteria | 3507 |
| 656 | Ga0453684_0215293 | 3300044712 | Bacteria | 2229 |
| 657 | Ga0453684_0242739 | 3300044712 | Bacteria | 2073 |
| 658 | Ga0453684_0280256 | 3300044712 | Bacteria | 1901 |
| 659 | Ga0453684_0576712 | 3300044712 | Bacteria | 1236 |
| 660 | Ga0466970_0803340 | 3300044765 | Bacteria | 551 |
| 661 | Ga0466957_0027436 | 3300044842 | Bacteria | 3384 |
| 662 | Ga0466957_0784845 | 3300044842 | Bacteria | 676 |
| 663 | Ga0466959_0605854 | 3300045049 | Bacteria | 737 |
| 664 | Ga0451576_0000056 | 3300045051 | Bacteria | 303398 |
| 665 | Ga0451576_0029144 | 3300045051 | Bacteria | 5907 |
| 666 | Ga0451576_0039821 | 3300045051 | Bacteria | 4975 |
| 667 | Ga0451576_0068197 | 3300045051 | Bacteria | 3702 |
| 668 | Ga0466967_1311309 | 3300045976 | Bacteria | 721 |
| 669 | Ga0466967_1594568 | 3300045976 | Bacteria | 650 |
| 670 | Ga0466967_2195042 | 3300045976 | Bacteria | 548 |
| 671 | Ga0495592_0206736 | 3300046454 | Bacteria | 1321 |
| 672 | Ga0495603_0168385 | 3300046455 | Bacteria | 1269 |
| 673 | Ga0495629_0022196 | 3300046459 | Bacteria | 4527 |
| 674 | Ga0495662_0109511 | 3300046476 | Bacteria | 1353 |
| 675 | Ga0495585_0124678 | 3300046492 | Bacteria | 1360 |
| 676 | Ga0495620_0140607 | 3300046515 | Bacteria | 944 |
| 677 | Ga0495628_0128507 | 3300046516 | Bacteria | 1940 |
| 678 | Ga0495628_0275252 | 3300046516 | Bacteria | 1251 |
| 679 | Ga0495630_0424299 | 3300046517 | Bacteria | 1019 |
| 680 | Ga0495637_0071187 | 3300046520 | Bacteria | 1403 |
| 681 | Ga0495642_0037897 | 3300046528 | Bacteria | 1952 |
| 682 | Ga0495642_0315291 | 3300046528 | Bacteria | 686 |
| 683 | Ga0495654_0005887 | 3300046530 | Bacteria | 7050 |
| 684 | Ga0495640_0652127 | 3300046533 | Bacteria | 633 |
| 685 | Ga0495586_0020552 | 3300046535 | Bacteria | 3516 |
| 686 | Ga0495621_0081060 | 3300046539 | Bacteria | 1210 |
| 687 | Ga0495597_0003221 | 3300046542 | Bacteria | 9707 |
| 688 | Ga0495645_0689533 | 3300046543 | Bacteria | 621 |
| 689 | Ga0495622_0002500 | 3300046557 | Bacteria | 8893 |
| 690 | Ga0495622_0306511 | 3300046557 | Bacteria | 691 |
| 691 | Ga0495622_0333363 | 3300046557 | Bacteria | 658 |
| 692 | Ga0495633_0063945 | 3300046558 | Bacteria | 1720 |
| 693 | Ga0495667_0108182 | 3300046559 | Bacteria | 1796 |
| 694 | Ga0495668_0013371 | 3300046616 | Bacteria | 4844 |
| 695 | Ga0495668_0076521 | 3300046616 | Bacteria | 1837 |
| 696 | Ga0495668_0108122 | 3300046616 | Bacteria | 1521 |
| 697 | Ga0495634_0257573 | 3300046642 | Bacteria | 1065 |
| 698 | Ga0495625_0302633 | 3300046660 | Bacteria | 1023 |
| 699 | Ga0495625_0587722 | 3300046660 | Bacteria | 670 |
| 700 | Ga0495635_0259075 | 3300046663 | Bacteria | 1171 |
| 701 | Ga0495659_0024676 | 3300046664 | Bacteria | 2052 |
| 702 | Ga0495661_0028858 | 3300046665 | Bacteria | 3547 |
| 703 | Ga0495657_0228395 | 3300046675 | Bacteria | 1127 |
| 704 | Ga0495599_0060610 | 3300046678 | Bacteria | 2366 |
| 705 | Ga0495623_0418879 | 3300046679 | Bacteria | 718 |
| 706 | Ga0495624_0532169 | 3300046690 | Bacteria | 702 |
| 707 | Ga0495649_0004932 | 3300046694 | Bacteria | 8606 |
| 708 | Ga0495604_0647559 | 3300047317 | Bacteria | 674 |
| 709 | Ga0495636_0481151 | 3300047318 | Bacteria | 599 |
| 710 | Ga0495672_0003627 | 3300047320 | Bacteria | 13084 |
| 711 | Ga0495680_0100507 | 3300047322 | Bacteria | 2155 |
| 712 | Ga0495687_071455 | 3300047443 | Bacteria | 1390 |
| 713 | Ga0495677_0018957 | 3300047445 | Bacteria | 2495 |
| 714 | Ga0495673_0077190 | 3300047469 | Bacteria | 1388 |
| 715 | Ga0495686_0000714 | 3300047472 | Bacteria | 44576 |
| 716 | Ga0495686_0006789 | 3300047472 | Bacteria | 8687 |
| 717 | Ga0495626_0068514 | 3300048091 | Bacteria | 1600 |
| 718 | Ga0496100_0337118 | 3300048903 | Bacteria | 1136 |
| 719 | Ga0496100_0699100 | 3300048903 | Bacteria | 791 |
| 720 | Ga0496101_0194386 | 3300048904 | Bacteria | 1567 |
| 721 | Ga0496102_0003691 | 3300048905 | Bacteria | 12946 |
| 722 | Ga0496102_0007368 | 3300048905 | Bacteria | 9400 |
| 723 | Ga0496102_0028391 | 3300048905 | Bacteria | 4997 |
| 724 | Ga0496102_0171685 | 3300048905 | Bacteria | 2041 |
| 725 | Ga0496102_0612634 | 3300048905 | Bacteria | 1012 |
| 726 | Ga0496102_0777570 | 3300048905 | Bacteria | 880 |
| 727 | Ga0496103_0000788 | 3300048906 | Bacteria | 23326 |
| 728 | Ga0496103_0139244 | 3300048906 | Bacteria | 1551 |
| 729 | Ga0496103_0764610 | 3300048906 | Bacteria | 610 |
| 730 | Ga0496104_0021859 | 3300048907 | Bacteria | 5876 |
| 731 | Ga0496104_0097508 | 3300048907 | Bacteria | 2814 |
| 732 | Ga0496104_0548968 | 3300048907 | Bacteria | 1066 |
| 733 | Ga0496105_0212657 | 3300048908 | Bacteria | 1576 |
| 734 | Ga0496105_1107260 | 3300048908 | Bacteria | 588 |
| 735 | Ga0496106_0001606 | 3300048909 | Bacteria | 16997 |
| 736 | Ga0496106_0196646 | 3300048909 | Bacteria | 1604 |
| 737 | Ga0496107_0095692 | 3300048910 | Bacteria | 2173 |
| 738 | Ga0496107_0207031 | 3300048910 | Bacteria | 1458 |
| 739 | Ga0496107_0334784 | 3300048910 | Bacteria | 1126 |
| 740 | Ga0496107_0388641 | 3300048910 | Bacteria | 1038 |
| 741 | Ga0496108_0114730 | 3300048911 | Bacteria | 2307 |
| 742 | Ga0496108_0633786 | 3300048911 | Bacteria | 930 |
| 743 | Ga0496108_1182602 | 3300048911 | Bacteria | 647 |
| 744 | Ga0496109_0664271 | 3300048912 | Bacteria | 979 |
| 745 | Ga0496110_0066827 | 3300048913 | Bacteria | 3180 |
| 746 | Ga0496110_0211728 | 3300048913 | Bacteria | 1762 |
| 747 | Ga0496110_0831696 | 3300048913 | Bacteria | 828 |
| 748 | Ga0496110_1115033 | 3300048913 | Bacteria | 697 |
| 749 | Ga0496111_0333017 | 3300048914 | Bacteria | 1124 |
| 750 | Ga0496111_0984859 | 3300048914 | Bacteria | 605 |
| 751 | Ga0496112_0072810 | 3300048915 | Bacteria | 3397 |
| 752 | Ga0496112_0571208 | 3300048915 | Bacteria | 1064 |
| 753 | Ga0496113_0210526 | 3300048916 | Bacteria | 1548 |
| 754 | Ga0496113_0597502 | 3300048916 | Bacteria | 884 |
| 755 | Ga0496115_0000536 | 3300048918 | Bacteria | 29579 |
| 756 | Ga0496115_0701871 | 3300048918 | Bacteria | 795 |
| 757 | Ga0496116_0047680 | 3300048919 | Bacteria | 2882 |
| 758 | Ga0496117_0004665 | 3300048920 | Bacteria | 14901 |
| 759 | Ga0496117_0015332 | 3300048920 | Bacteria | 6540 |
| 760 | Ga0496117_0087861 | 3300048920 | Bacteria | 2013 |
| 761 | Ga0496118_0008568 | 3300048921 | Bacteria | 10533 |
| 762 | Ga0496118_0030716 | 3300048921 | Bacteria | 4474 |
| 763 | Ga0496118_0075106 | 3300048921 | Bacteria | 2412 |
| 764 | Ga0496118_0323765 | 3300048921 | Bacteria | 835 |
| 765 | Ga0496119_0069388 | 3300048922 | Bacteria | 2071 |
| 766 | Ga0496119_0194678 | 3300048922 | Bacteria | 1054 |
| 767 | Ga0496119_0242397 | 3300048922 | Bacteria | 913 |
| 768 | Ga0496120_0016269 | 3300048923 | Bacteria | 4866 |
| 769 | Ga0496120_0122729 | 3300048923 | Bacteria | 1341 |
| 770 | Ga0496120_0149851 | 3300048923 | Bacteria | 1174 |
| 771 | Ga0496121_0000088 | 3300048924 | Bacteria | 219728 |
| 772 | Ga0496121_0132973 | 3300048924 | Bacteria | 1858 |
| 773 | Ga0496121_0188375 | 3300048924 | Bacteria | 1482 |
| 774 | Ga0496122_0043757 | 3300048925 | Bacteria | 3504 |
| 775 | Ga0496122_0171028 | 3300048925 | Bacteria | 1310 |
| 776 | Ga0496123_0102774 | 3300048926 | Bacteria | 1657 |
| 777 | Ga0496125_0054236 | 3300048928 | Bacteria | 3278 |
| 778 | Ga0496126_1046555 | 3300048929 | Bacteria | 609 |
| 779 | Ga0501033_0040738 | 3300049570 | Bacteria | 3468 |
| 780 | Ga0501033_0075120 | 3300049570 | Bacteria | 2481 |
| 781 | Ga0501034_0090456 | 3300049571 | Bacteria | 3058 |
| 782 | Ga0501036_0546778 | 3300049572 | Bacteria | 962 |
| 783 | Ga0501037_0101730 | 3300049573 | Bacteria | 2073 |
| 784 | Ga0501037_0328641 | 3300049573 | Bacteria | 1058 |
| 785 | Ga0501038_0362105 | 3300049574 | Bacteria | 1128 |
| 786 | Ga0501039_0101877 | 3300049575 | Bacteria | 2241 |
| 787 | Ga0501040_0153580 | 3300049576 | Bacteria | 1625 |
| 788 | Ga0501040_0503660 | 3300049576 | Bacteria | 873 |
| 789 | Ga0501040_1208853 | 3300049576 | Bacteria | 548 |
| 790 | Ga0501041_0567699 | 3300049577 | Bacteria | 723 |
| 791 | Ga0501043_0210056 | 3300049579 | Bacteria | 1509 |
| 792 | Ga0501043_0343965 | 3300049579 | Bacteria | 1134 |
| 793 | Ga0501043_0602130 | 3300049579 | Bacteria | 812 |
| 794 | Ga0501046_0855519 | 3300049580 | Bacteria | 636 |
| 795 | Ga0501047_0095488 | 3300049581 | Bacteria | 2852 |
| 796 | Ga0501047_0401600 | 3300049581 | Bacteria | 1203 |
| 797 | Ga0501048_0156096 | 3300049582 | Bacteria | 1614 |
| 798 | Ga0501048_0787818 | 3300049582 | Bacteria | 683 |
| 799 | Ga0501068_0226620 | 3300049584 | Bacteria | 1188 |
| 800 | Ga0501069_0326865 | 3300049585 | Bacteria | 902 |
| 801 | Ga0501070_0821166 | 3300049586 | Bacteria | 729 |
| 802 | Ga0501072_0320206 | 3300049588 | Bacteria | 1232 |
| 803 | Ga0501072_0396634 | 3300049588 | Bacteria | 1095 |
| 804 | Ga0501074_0161439 | 3300049590 | Bacteria | 1601 |
| 805 | Ga0501075_0926471 | 3300049591 | Bacteria | 662 |
| 806 | Ga0501076_0895876 | 3300049592 | Bacteria | 731 |
| 807 | Ga0501077_0082023 | 3300049593 | Bacteria | 2043 |
| 808 | Ga0501223_109255 | 3300049663 | Bacteria | 576 |
| 809 | Ga0501257_000066 | 3300049686 | Bacteria | 28746 |
| 810 | Ga0501079_1077301 | 3300049741 | Bacteria | 633 |
| 811 | Ga0501080_0156987 | 3300049742 | Bacteria | 2101 |
| 812 | Ga0501080_0549889 | 3300049742 | Bacteria | 1028 |
| 813 | Ga0501080_0868002 | 3300049742 | Bacteria | 788 |
| 814 | Ga0501083_0053620 | 3300049744 | Bacteria | 2707 |
| 815 | Ga0501271_016163 | 3300049768 | Bacteria | 838 |
| 816 | Ga0501035_0225911 | 3300049822 | Bacteria | 1597 |
| 817 | Ga0501044_0004477 | 3300049823 | Bacteria | 15619 |
| 818 | Ga0501044_0007795 | 3300049823 | Bacteria | 11770 |
| 819 | Ga0501044_0168639 | 3300049823 | Bacteria | 2162 |
| 820 | Ga0501044_0235637 | 3300049823 | Bacteria | 1776 |
| 821 | Ga0501044_0560397 | 3300049823 | Bacteria | 1039 |
| 822 | Ga0501044_0844238 | 3300049823 | Bacteria | 793 |
| 823 | Ga0501044_0946018 | 3300049823 | Bacteria | 735 |
| 824 | Ga0501045_0014809 | 3300049824 | Bacteria | 5530 |
| 825 | nmdc:mga03n38_772589_c1 | 3300050490 | Bacteria | 558 |
| 826 | nmdc:mga00v17_7282_c1 | 3300050491 | Bacteria | 5896 |
| 827 | nmdc:mga0yw44_169839_c1 | 3300050492 | Bacteria | 1431 |
| 828 | nmdc:mga0yw44_173595_c1 | 3300050492 | Bacteria | 1416 |
| 829 | nmdc:mga0k408_122761_c1 | 3300050493 | Bacteria | 1539 |
| 830 | nmdc:mga0k408_139057_c1 | 3300050493 | Bacteria | 1444 |
| 831 | nmdc:mga0k408_167388_c1 | 3300050493 | Bacteria | 1310 |
| 832 | nmdc:mga0k408_307992_c1 | 3300050493 | Bacteria | 945 |
| 833 | nmdc:mga0k408_36927_c1 | 3300050493 | Bacteria | 2804 |
| 834 | nmdc:mga06z11_95817_c1 | 3300050494 | Bacteria | 1620 |
| 835 | nmdc:mga04h51_8169_c1 | 3300050495 | Bacteria | 2793 |
| 836 | nmdc:mga07m45_144800_c1 | 3300050496 | Bacteria | 1377 |
| 837 | nmdc:mga07m45_23209_c1 | 3300050496 | Bacteria | 3390 |
| 838 | nmdc:mga07m45_529836_c1 | 3300050496 | Bacteria | 682 |
| 839 | nmdc:mga05p37_1553459_c1 | 3300050507 | Bacteria | 655 |
| 840 | nmdc:mga05p37_751_c1 | 3300050507 | Bacteria | 35968 |
| 841 | nmdc:mga09592_4545_c1 | 3300050508 | Bacteria | 11226 |
| 842 | nmdc:mga09592_66500_c1 | 3300050508 | Bacteria | 3055 |
| 843 | nmdc:mga09592_9701_c1 | 3300050508 | Bacteria | 7818 |
| 844 | nmdc:mga0qj67_29711_c1 | 3300050509 | Bacteria | 4246 |
| 845 | nmdc:mga0qj67_6214_c1 | 3300050509 | Bacteria | 8767 |
| 846 | nmdc:mga0qj67_624570_c1 | 3300050509 | Bacteria | 861 |
| 847 | nmdc:mga0qj67_8300_c1 | 3300050509 | Bacteria | 7701 |
| 848 | nmdc:mga06r32_12823_c1 | 3300050510 | Bacteria | 7576 |
| 849 | nmdc:mga06r32_22515_c1 | 3300050510 | Bacteria | 5826 |
| 850 | nmdc:mga06r32_3190_c1 | 3300050510 | Bacteria | 14688 |
| 851 | nmdc:mga06r32_86156_c1 | 3300050510 | Bacteria | 3063 |
| 852 | nmdc:mga06r32_93_c1 | 3300050510 | Bacteria | 62195 |
| 853 | nmdc:mga08y16_10831_c1 | 3300050511 | Bacteria | 9574 |
| 854 | nmdc:mga08y16_117424_c1 | 3300050511 | Bacteria | 2769 |
| 855 | nmdc:mga08y16_206552_c1 | 3300050511 | Bacteria | 2035 |
| 856 | nmdc:mga08y16_35897_c1 | 3300050511 | Bacteria | 5207 |
| 857 | nmdc:mga0n895_802135_c1 | 3300050512 | Bacteria | 932 |
| 858 | nmdc:mga0a205_1193580_c1 | 3300050515 | Bacteria | 609 |
| 859 | nmdc:mga0sz30_275686_c1 | 3300050516 | Bacteria | 749 |
| 860 | Ga0495601_0006748 | 3300053077 | Bacteria | 6721 |
| 861 | Ga0500635_0000373 | 3300053080 | Bacteria | 14034 |
| 862 | Ga0500635_0001982 | 3300053080 | Bacteria | 5000 |
| 863 | Ga0495595_0039453 | 3300053084 | Bacteria | 2154 |
| 864 | Ga0495619_0017029 | 3300053085 | Bacteria | 4607 |
| 865 | Ga0495619_0096077 | 3300053085 | Bacteria | 2011 |
| 866 | Ga0500578_0201694 | 3300053086 | Bacteria | 1217 |
| 867 | Ga0500643_000236 | 3300053087 | Bacteria | 51341 |
| 868 | Ga0500647_0068120 | 3300053091 | Bacteria | 1712 |
| 869 | Ga0500651_0033997 | 3300053093 | Bacteria | 3214 |
| 870 | Ga0500566_0071812 | 3300053094 | Bacteria | 1942 |
| 871 | Ga0500641_0000136 | 3300053096 | Bacteria | 27409 |
| 872 | Ga0500641_0143401 | 3300053096 | Bacteria | 1032 |
| 873 | Ga0500641_0346298 | 3300053096 | Bacteria | 598 |
| 874 | Ga0500556_0018879 | 3300053104 | Bacteria | 2183 |
| 875 | Ga0500562_002835 | 3300053108 | Bacteria | 4320 |
| 876 | Ga0500562_041232 | 3300053108 | Bacteria | 1227 |
| 877 | Ga0500569_001405 | 3300053109 | Bacteria | 4528 |
| 878 | Ga0500592_000681 | 3300053116 | Bacteria | 5593 |
| 879 | Ga0500593_178027 | 3300053117 | Bacteria | 793 |
| 880 | Ga0500595_126635 | 3300053119 | Bacteria | 720 |
| 881 | Ga0500608_000386 | 3300053122 | Bacteria | 16913 |
| 882 | Ga0500614_002199 | 3300053123 | Bacteria | 4419 |
| 883 | Ga0500655_008848 | 3300053133 | Bacteria | 1812 |
| 884 | Ga0500655_010707 | 3300053133 | Bacteria | 1657 |
| 885 | Ga0500559_0003632 | 3300053136 | Bacteria | 7547 |
| 886 | Ga0500559_0016256 | 3300053136 | Bacteria | 3142 |
| 887 | Ga0500559_0133597 | 3300053136 | Bacteria | 1160 |
| 888 | Ga0500603_077386 | 3300053150 | Bacteria | 958 |
| 889 | Ga0500604_0026888 | 3300053151 | Bacteria | 1662 |
| 890 | Ga0500604_0196981 | 3300053151 | Bacteria | 692 |
| 891 | Ga0500616_0030736 | 3300053153 | Bacteria | 2947 |
| 892 | Ga0500622_0021192 | 3300053156 | Bacteria | 3451 |
| 893 | Ga0500622_0066355 | 3300053156 | Bacteria | 1832 |
| 894 | Ga0500622_0355112 | 3300053156 | Bacteria | 607 |
| 895 | Ga0500624_000005 | 3300053157 | Bacteria | 187122 |
| 896 | Ga0500627_0000115 | 3300053158 | Bacteria | 25685 |
| 897 | Ga0500636_0067374 | 3300053177 | Bacteria | 2080 |
| 898 | Ga0500636_0186712 | 3300053177 | Bacteria | 1108 |
| 899 | Ga0500637_0001038 | 3300053178 | Bacteria | 11398 |
| 900 | Ga0500637_0008727 | 3300053178 | Bacteria | 5127 |
| 901 | Ga0500637_0137721 | 3300053178 | Bacteria | 1413 |
| 902 | Ga0500657_096173 | 3300053728 | Bacteria | 1235 |
| 903 | Ga0500625_065204 | 3300053729 | Bacteria | 1639 |
| 904 | Ga0500645_000932 | 3300053730 | Bacteria | 16738 |
| 905 | Ga0500645_005935 | 3300053730 | Bacteria | 4423 |
| 906 | Ga0500656_046934 | 3300053732 | Bacteria | 619 |
| 907 | Ga0500596_000098 | 3300053735 | Bacteria | 11930 |
| 908 | Ga0501084_0093064 | 3300054114 | Bacteria | 2530 |
| 909 | Ga0590075_022764 | 3300059424 | Bacteria | 1569 |
| 910 | Ga0501082_0176599 | 3300060353 | Bacteria | 1857 |
| 911 | Ga0466962_0261303 | 3300061719 | Bacteria | 852 |
| 912 | Ga0466962_0330164 | 3300061719 | Bacteria | 757 |
| 913 | Ga0530510_0119479 | 3300061734 | Bacteria | 1934 |
| 914 | Ga0530510_0429037 | 3300061734 | Bacteria | 998 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300002772 | JGI25164J39214_1013956 | JGI25164J39214_10139562 | 129 |
| 2 | 3300045976 | Ga0466967_1311309 | Ga0466967_1311309_10_399 | 129 |
| 3 | 3300044712 | Ga0453684_0023503 | Ga0453684_0023503_7869_8330 | 138 |
| 4 | 3300025911 | Ga0207654_10002810 | Ga0207654_1000281010 | 144 |
| 5 | 3300035117 | Ga0373953_0041532 | Ga0373953_0041532_805_1239 | 144 |
| 6 | 3300035118 | Ga0373954_0004243 | Ga0373954_0004243_919_1353 | 144 |
| 7 | 3300035724 | Ga0373933_0007330 | Ga0373933_0007330_1923_2357 | 144 |
| 8 | 3300035725 | Ga0373947_0539777 | Ga0373947_0539777_199_633 | 144 |
| 9 | 3300046533 | Ga0495640_0652127 | Ga0495640_0652127_98_532 | 144 |
| 10 | 3300046675 | Ga0495657_0228395 | Ga0495657_0228395_394_828 | 144 |
| 11 | 3300047317 | Ga0495604_0647559 | Ga0495604_0647559_122_556 | 144 |
| 12 | 3300053085 | Ga0495619_0017029 | Ga0495619_0017029_3477_3911 | 144 |
| 13 | iso_pu_bacteria | 2885429604 | 2885429831 | 144 |
| 14 | 3300006195 | Ga0075366_10118768 | Ga0075366_101187682 | 145 |
| 15 | 3300006358 | Ga0068871_100889370 | Ga0068871_1008893702 | 145 |
| 16 | 3300009553 | Ga0105249_10040669 | Ga0105249_100406693 | 145 |
| 17 | 3300010375 | Ga0105239_10724445 | Ga0105239_107244452 | 145 |
| 18 | 3300011119 | Ga0105246_10066374 | Ga0105246_100663742 | 145 |
| 19 | 3300014326 | Ga0157380_10726849 | Ga0157380_107268492 | 145 |
| 20 | 3300021388 | Ga0213875_10107095 | Ga0213875_101070951 | 145 |
| 21 | 3300025934 | Ga0207686_11170379 | Ga0207686_111703792 | 145 |
| 22 | 3300028573 | Ga0265334_10006729 | Ga0265334_100067295 | 145 |
| 23 | 3300028786 | Ga0307517_10374994 | Ga0307517_103749941 | 145 |
| 24 | 3300028800 | Ga0265338_10022804 | Ga0265338_100228046 | 145 |
| 25 | 3300028800 | Ga0265338_10026523 | Ga0265338_100265231 | 145 |
| 26 | 3300028800 | Ga0265338_10094210 | Ga0265338_100942104 | 145 |
| 27 | 3300028800 | Ga0265338_10335903 | Ga0265338_103359031 | 145 |
| 28 | 3300031247 | Ga0265340_10140923 | Ga0265340_101409232 | 145 |
| 29 | 3300031251 | Ga0265327_10000928 | Ga0265327_1000092824 | 145 |
| 30 | 3300031711 | Ga0265314_10143936 | Ga0265314_101439362 | 145 |
| 31 | 3300031730 | Ga0307516_10000002 | Ga0307516_10000002320 | 145 |
| 32 | 3300034819 | Ga0373958_0027320 | Ga0373958_0027320_249_686 | 145 |
| 33 | 3300035084 | Ga0373928_0286993 | Ga0373928_0286993_19_456 | 145 |
| 34 | 3300035115 | Ga0373941_0086296 | Ga0373941_0086296_31_468 | 145 |
| 35 | 3300035691 | Ga0373931_0058733 | Ga0373931_0058733_1513_1950 | 145 |
| 36 | 3300036401 | Ga0373937_0312383 | Ga0373937_0312383_602_1054 | 145 |
| 37 | 3300037853 | Ga0436364_0252525 | Ga0436364_0252525_155_607 | 145 |
| 38 | 3300037853 | Ga0436364_0740827 | Ga0436364_0740827_855_1292 | 145 |
| 39 | 3300039437 | Ga0436365_0223789 | Ga0436365_0223789_392_829 | 145 |
| 40 | 3300048905 | Ga0496102_0003691 | Ga0496102_0003691_3018_3455 | 145 |
| 41 | 3300048906 | Ga0496103_0139244 | Ga0496103_0139244_939_1376 | 145 |
| 42 | 3300048907 | Ga0496104_0021859 | Ga0496104_0021859_1961_2398 | 145 |
| 43 | 3300048908 | Ga0496105_1107260 | Ga0496105_1107260_124_576 | 145 |
| 44 | 3300048909 | Ga0496106_0001606 | Ga0496106_0001606_8553_8990 | 145 |
| 45 | 3300049581 | Ga0501047_0095488 | Ga0501047_0095488_453_902 | 145 |
| 46 | 3300049823 | Ga0501044_0168639 | Ga0501044_0168639_251_700 | 145 |
| 47 | 3300050493 | nmdc:mga0k408_167388_c1 | nmdc:mga0k408_167388_c1_700_1149 | 145 |
| 48 | 3300005331 | Ga0070670_100000042 | Ga0070670_10000004226 | 146 |
| 49 | 3300005335 | Ga0070666_10180284 | Ga0070666_101802842 | 146 |
| 50 | 3300005336 | Ga0070680_100128513 | Ga0070680_1001285133 | 146 |
| 51 | 3300005336 | Ga0070680_100328182 | Ga0070680_1003281821 | 146 |
| 52 | 3300005341 | Ga0070691_10003404 | Ga0070691_100034046 | 146 |
| 53 | 3300005347 | Ga0070668_100000274 | Ga0070668_1000002746 | 146 |
| 54 | 3300005347 | Ga0070668_100000576 | Ga0070668_1000005764 | 146 |
| 55 | 3300005347 | Ga0070668_100025796 | Ga0070668_1000257962 | 146 |
| 56 | 3300005347 | Ga0070668_100073534 | Ga0070668_1000735342 | 146 |
| 57 | 3300005353 | Ga0070669_100926427 | Ga0070669_1009264271 | 146 |
| 58 | 3300005355 | Ga0070671_100220342 | Ga0070671_1002203422 | 146 |
| 59 | 3300005367 | Ga0070667_100000152 | Ga0070667_10000015252 | 146 |
| 60 | 3300005367 | Ga0070667_100009964 | Ga0070667_1000099643 | 146 |
| 61 | 3300005367 | Ga0070667_100052643 | Ga0070667_1000526434 | 146 |
| 62 | 3300005457 | Ga0070662_100506176 | Ga0070662_1005061762 | 146 |
| 63 | 3300005458 | Ga0070681_10014076 | Ga0070681_100140767 | 146 |
| 64 | 3300005458 | Ga0070681_10487511 | Ga0070681_104875112 | 146 |
| 65 | 3300005530 | Ga0070679_100026774 | Ga0070679_1000267742 | 146 |
| 66 | 3300005530 | Ga0070679_100537191 | Ga0070679_1005371912 | 146 |
| 67 | 3300005539 | Ga0068853_100458931 | Ga0068853_1004589312 | 146 |
| 68 | 3300005548 | Ga0070665_100003473 | Ga0070665_10000347312 | 146 |
| 69 | 3300005563 | Ga0068855_100037376 | Ga0068855_1000373766 | 146 |
| 70 | 3300005563 | Ga0068855_100043532 | Ga0068855_1000435324 | 146 |
| 71 | 3300005563 | Ga0068855_100351476 | Ga0068855_1003514761 | 146 |
| 72 | 3300005564 | Ga0070664_100432852 | Ga0070664_1004328521 | 146 |
| 73 | 3300005578 | Ga0068854_100360305 | Ga0068854_1003603052 | 146 |
| 74 | 3300005614 | Ga0068856_100097628 | Ga0068856_1000976283 | 146 |
| 75 | 3300005614 | Ga0068856_100202593 | Ga0068856_1002025933 | 146 |
| 76 | 3300005617 | Ga0068859_100020980 | Ga0068859_1000209804 | 146 |
| 77 | 3300005618 | Ga0068864_100000245 | Ga0068864_10000024540 | 146 |
| 78 | 3300005618 | Ga0068864_100043422 | Ga0068864_1000434224 | 146 |
| 79 | 3300005618 | Ga0068864_100058115 | Ga0068864_1000581152 | 146 |
| 80 | 3300005719 | Ga0068861_100450585 | Ga0068861_1004505852 | 146 |
| 81 | 3300005841 | Ga0068863_100000516 | Ga0068863_10000051629 | 146 |
| 82 | 3300005842 | Ga0068858_100000821 | Ga0068858_10000082110 | 146 |
| 83 | 3300005842 | Ga0068858_100038866 | Ga0068858_1000388661 | 146 |
| 84 | 3300005843 | Ga0068860_100000032 | Ga0068860_10000003222 | 146 |
| 85 | 3300005843 | Ga0068860_100000653 | Ga0068860_10000065333 | 146 |
| 86 | 3300005843 | Ga0068860_100009274 | Ga0068860_1000092747 | 146 |
| 87 | 3300005844 | Ga0068862_100000638 | Ga0068862_10000063812 | 146 |
| 88 | 3300005844 | Ga0068862_100005614 | Ga0068862_10000561411 | 146 |
| 89 | 3300005844 | Ga0068862_100070950 | Ga0068862_1000709501 | 146 |
| 90 | 3300005844 | Ga0068862_100456420 | Ga0068862_1004564201 | 146 |
| 91 | 3300005844 | Ga0068862_101121240 | Ga0068862_1011212401 | 146 |
| 92 | 3300006042 | Ga0075368_10079600 | Ga0075368_100796001 | 146 |
| 93 | 3300006051 | Ga0075364_10003424 | Ga0075364_100034242 | 146 |
| 94 | 3300006178 | Ga0075367_10011760 | Ga0075367_100117602 | 146 |
| 95 | 3300006186 | Ga0075369_10494375 | Ga0075369_104943751 | 146 |
| 96 | 3300006195 | Ga0075366_10114155 | Ga0075366_101141551 | 146 |
| 97 | 3300006353 | Ga0075370_10020138 | Ga0075370_100201383 | 146 |
| 98 | 3300006353 | Ga0075370_10061778 | Ga0075370_100617781 | 146 |
| 99 | 3300006353 | Ga0075370_10574283 | Ga0075370_105742831 | 146 |
| 100 | 3300006931 | Ga0097620_100020981 | Ga0097620_1000209817 | 146 |
| 101 | 3300009093 | Ga0105240_10000671 | Ga0105240_1000067161 | 146 |
| 102 | 3300009093 | Ga0105240_10018243 | Ga0105240_100182434 | 146 |
| 103 | 3300009093 | Ga0105240_10381121 | Ga0105240_103811211 | 146 |
| 104 | 3300009098 | Ga0105245_10543610 | Ga0105245_105436102 | 146 |
| 105 | 3300009101 | Ga0105247_10035094 | Ga0105247_100350944 | 146 |
| 106 | 3300009174 | Ga0105241_10086169 | Ga0105241_100861694 | 146 |
| 107 | 3300009176 | Ga0105242_10594840 | Ga0105242_105948401 | 146 |
| 108 | 3300009177 | Ga0105248_10003063 | Ga0105248_1000306310 | 146 |
| 109 | 3300009177 | Ga0105248_10218333 | Ga0105248_102183332 | 146 |
| 110 | 3300009177 | Ga0105248_10629335 | Ga0105248_106293352 | 146 |
| 111 | 3300009551 | Ga0105238_10019049 | Ga0105238_100190491 | 146 |
| 112 | 3300009551 | Ga0105238_10022500 | Ga0105238_1002250011 | 146 |
| 113 | 3300009553 | Ga0105249_10006288 | Ga0105249_100062883 | 146 |
| 114 | 3300009553 | Ga0105249_10768915 | Ga0105249_107689151 | 146 |
| 115 | 3300010375 | Ga0105239_10204065 | Ga0105239_102040653 | 146 |
| 116 | 3300010375 | Ga0105239_12793220 | Ga0105239_127932201 | 146 |
| 117 | 3300013104 | Ga0157370_10494797 | Ga0157370_104947972 | 146 |
| 118 | 3300013105 | Ga0157369_10677775 | Ga0157369_106777751 | 146 |
| 119 | 3300013296 | Ga0157374_11980524 | Ga0157374_119805241 | 146 |
| 120 | 3300013306 | Ga0163162_10170855 | Ga0163162_101708551 | 146 |
| 121 | 3300013306 | Ga0163162_10781695 | Ga0163162_107816952 | 146 |
| 122 | 3300013306 | Ga0163162_11298004 | Ga0163162_112980041 | 146 |
| 123 | 3300013307 | Ga0157372_10104618 | Ga0157372_101046182 | 146 |
| 124 | 3300013308 | Ga0157375_10308033 | Ga0157375_103080332 | 146 |
| 125 | 3300014325 | Ga0163163_10056749 | Ga0163163_100567493 | 146 |
| 126 | 3300014326 | Ga0157380_10726379 | Ga0157380_107263791 | 146 |
| 127 | 3300014968 | Ga0157379_10005894 | Ga0157379_100058943 | 146 |
| 128 | 3300014968 | Ga0157379_10713845 | Ga0157379_107138453 | 146 |
| 129 | 3300014968 | Ga0157379_10893049 | Ga0157379_108930491 | 146 |
| 130 | 3300025900 | Ga0207710_10327655 | Ga0207710_103276551 | 146 |
| 131 | 3300025909 | Ga0207705_10105946 | Ga0207705_101059462 | 146 |
| 132 | 3300025911 | Ga0207654_10184888 | Ga0207654_101848882 | 146 |
| 133 | 3300025912 | Ga0207707_10068274 | Ga0207707_100682742 | 146 |
| 134 | 3300025912 | Ga0207707_10260687 | Ga0207707_102606871 | 146 |
| 135 | 3300025913 | Ga0207695_10000876 | Ga0207695_1000087641 | 146 |
| 136 | 3300025913 | Ga0207695_10002095 | Ga0207695_1000209519 | 146 |
| 137 | 3300025913 | Ga0207695_10004968 | Ga0207695_1000496811 | 146 |
| 138 | 3300025913 | Ga0207695_10146550 | Ga0207695_101465502 | 146 |
| 139 | 3300025917 | Ga0207660_10059463 | Ga0207660_100594631 | 146 |
| 140 | 3300025917 | Ga0207660_10196094 | Ga0207660_101960942 | 146 |
| 141 | 3300025919 | Ga0207657_10240877 | Ga0207657_102408772 | 146 |
| 142 | 3300025921 | Ga0207652_10396289 | Ga0207652_103962891 | 146 |
| 143 | 3300025923 | Ga0207681_10763842 | Ga0207681_107638421 | 146 |
| 144 | 3300025924 | Ga0207694_10090258 | Ga0207694_100902583 | 146 |
| 145 | 3300025924 | Ga0207694_10303669 | Ga0207694_103036691 | 146 |
| 146 | 3300025924 | Ga0207694_11323055 | Ga0207694_113230552 | 146 |
| 147 | 3300025925 | Ga0207650_10000378 | Ga0207650_1000037827 | 146 |
| 148 | 3300025931 | Ga0207644_10103058 | Ga0207644_101030583 | 146 |
| 149 | 3300025933 | Ga0207706_10051223 | Ga0207706_100512232 | 146 |
| 150 | 3300025941 | Ga0207711_10005259 | Ga0207711_100052594 | 146 |
| 151 | 3300025941 | Ga0207711_10043340 | Ga0207711_100433402 | 146 |
| 152 | 3300025941 | Ga0207711_10079035 | Ga0207711_100790351 | 146 |
| 153 | 3300025941 | Ga0207711_10545579 | Ga0207711_105455792 | 146 |
| 154 | 3300025949 | Ga0207667_10041103 | Ga0207667_100411033 | 146 |
| 155 | 3300025949 | Ga0207667_10202140 | Ga0207667_102021401 | 146 |
| 156 | 3300025972 | Ga0207668_10001618 | Ga0207668_100016185 | 146 |
| 157 | 3300025972 | Ga0207668_10011845 | Ga0207668_100118454 | 146 |
| 158 | 3300025972 | Ga0207668_10020444 | Ga0207668_100204445 | 146 |
| 159 | 3300025972 | Ga0207668_10172515 | Ga0207668_101725152 | 146 |
| 160 | 3300025986 | Ga0207658_10000189 | Ga0207658_1000018944 | 146 |
| 161 | 3300025986 | Ga0207658_10007593 | Ga0207658_100075934 | 146 |
| 162 | 3300026035 | Ga0207703_10000278 | Ga0207703_1000027843 | 146 |
| 163 | 3300026041 | Ga0207639_10321776 | Ga0207639_103217761 | 146 |
| 164 | 3300026078 | Ga0207702_10029757 | Ga0207702_100297573 | 146 |
| 165 | 3300026078 | Ga0207702_10452033 | Ga0207702_104520331 | 146 |
| 166 | 3300026088 | Ga0207641_10000260 | Ga0207641_1000026059 | 146 |
| 167 | 3300026095 | Ga0207676_10000233 | Ga0207676_1000023336 | 146 |
| 168 | 3300026095 | Ga0207676_10048314 | Ga0207676_100483145 | 146 |
| 169 | 3300026095 | Ga0207676_10104251 | Ga0207676_101042512 | 146 |
| 170 | 3300026095 | Ga0207676_10253368 | Ga0207676_102533683 | 146 |
| 171 | 3300026118 | Ga0207675_100047567 | Ga0207675_1000475672 | 146 |
| 172 | 3300026118 | Ga0207675_100884716 | Ga0207675_1008847161 | 146 |
| 173 | 3300028379 | Ga0268266_10000805 | Ga0268266_1000080530 | 146 |
| 174 | 3300028380 | Ga0268265_10000445 | Ga0268265_1000044535 | 146 |
| 175 | 3300028380 | Ga0268265_10004220 | Ga0268265_1000422010 | 146 |
| 176 | 3300028380 | Ga0268265_10004653 | Ga0268265_100046535 | 146 |
| 177 | 3300028380 | Ga0268265_10058315 | Ga0268265_100583153 | 146 |
| 178 | 3300028381 | Ga0268264_10000045 | Ga0268264_10000045330 | 146 |
| 179 | 3300028381 | Ga0268264_10000248 | Ga0268264_1000024838 | 146 |
| 180 | 3300028381 | Ga0268264_10007926 | Ga0268264_100079265 | 146 |
| 181 | 3300028800 | Ga0265338_10026178 | Ga0265338_100261787 | 146 |
| 182 | 3300030521 | Ga0307511_10005612 | Ga0307511_100056127 | 146 |
| 183 | 3300031090 | Ga0265760_10018652 | Ga0265760_100186522 | 146 |
| 184 | 3300031251 | Ga0265327_10488398 | Ga0265327_104883981 | 146 |
| 185 | 3300031995 | Ga0307409_100044588 | Ga0307409_1000445882 | 146 |
| 186 | 3300032004 | Ga0307414_10051626 | Ga0307414_100516261 | 146 |
| 187 | 3300035121 | Ga0373960_0067528 | Ga0373960_0067528_384_830 | 146 |
| 188 | 3300035242 | Ga0373962_0009228 | Ga0373962_0009228_1881_2327 | 146 |
| 189 | 3300035691 | Ga0373931_0269096 | Ga0373931_0269096_55_501 | 146 |
| 190 | 3300037312 | Ga0395899_0000178 | Ga0395899_0000178_23310_23765 | 146 |
| 191 | 3300037418 | Ga0395900_0001522 | Ga0395900_0001522_18484_18939 | 146 |
| 192 | 3300037466 | Ga0395898_0006429 | Ga0395898_0006429_4682_5137 | 146 |
| 193 | 3300037471 | Ga0395905_0010228 | Ga0395905_0010228_4810_5265 | 146 |
| 194 | 3300037471 | Ga0395905_0352779 | Ga0395905_0352779_227_682 | 146 |
| 195 | 3300037471 | Ga0395905_0757071 | Ga0395905_0757071_219_674 | 146 |
| 196 | 3300038443 | Ga0395901_0000001 | Ga0395901_0000001_34316_34771 | 146 |
| 197 | 3300039437 | Ga0436365_1846196 | Ga0436365_1846196_2994_3449 | 146 |
| 198 | 3300039438 | Ga0436360_0091052 | Ga0436360_0091052_28_495 | 146 |
| 199 | 3300039438 | Ga0436360_0343564 | Ga0436360_0343564_62_511 | 146 |
| 200 | 3300041453 | Ga0451797_0790261 | Ga0451797_0790261_73_543 | 146 |
| 201 | 3300044712 | Ga0453684_0215293 | Ga0453684_0215293_483_923 | 146 |
| 202 | 3300045049 | Ga0466959_0605854 | Ga0466959_0605854_25_480 | 146 |
| 203 | 3300046459 | Ga0495629_0022196 | Ga0495629_0022196_572_1027 | 146 |
| 204 | 3300046492 | Ga0495585_0124678 | Ga0495585_0124678_849_1304 | 146 |
| 205 | 3300046515 | Ga0495620_0140607 | Ga0495620_0140607_310_765 | 146 |
| 206 | 3300046516 | Ga0495628_0128507 | Ga0495628_0128507_1409_1864 | 146 |
| 207 | 3300046520 | Ga0495637_0071187 | Ga0495637_0071187_896_1351 | 146 |
| 208 | 3300046528 | Ga0495642_0315291 | Ga0495642_0315291_45_500 | 146 |
| 209 | 3300046539 | Ga0495621_0081060 | Ga0495621_0081060_504_959 | 146 |
| 210 | 3300046542 | Ga0495597_0003221 | Ga0495597_0003221_2231_2686 | 146 |
| 211 | 3300046543 | Ga0495645_0689533 | Ga0495645_0689533_108_563 | 146 |
| 212 | 3300046557 | Ga0495622_0306511 | Ga0495622_0306511_53_508 | 146 |
| 213 | 3300046616 | Ga0495668_0013371 | Ga0495668_0013371_3195_3650 | 146 |
| 214 | 3300046616 | Ga0495668_0076521 | Ga0495668_0076521_407_862 | 146 |
| 215 | 3300046616 | Ga0495668_0108122 | Ga0495668_0108122_259_714 | 146 |
| 216 | 3300046660 | Ga0495625_0302633 | Ga0495625_0302633_300_755 | 146 |
| 217 | 3300046664 | Ga0495659_0024676 | Ga0495659_0024676_1305_1760 | 146 |
| 218 | 3300046690 | Ga0495624_0532169 | Ga0495624_0532169_131_586 | 146 |
| 219 | 3300047318 | Ga0495636_0481151 | Ga0495636_0481151_86_541 | 146 |
| 220 | 3300047443 | Ga0495687_071455 | Ga0495687_071455_255_761 | 146 |
| 221 | 3300047445 | Ga0495677_0018957 | Ga0495677_0018957_990_1445 | 146 |
| 222 | 3300048903 | Ga0496100_0699100 | Ga0496100_0699100_58_513 | 146 |
| 223 | 3300048905 | Ga0496102_0028391 | Ga0496102_0028391_558_1013 | 146 |
| 224 | 3300048905 | Ga0496102_0171685 | Ga0496102_0171685_454_909 | 146 |
| 225 | 3300048906 | Ga0496103_0764610 | Ga0496103_0764610_42_497 | 146 |
| 226 | 3300048907 | Ga0496104_0548968 | Ga0496104_0548968_117_572 | 146 |
| 227 | 3300048910 | Ga0496107_0334784 | Ga0496107_0334784_553_1008 | 146 |
| 228 | 3300048911 | Ga0496108_0114730 | Ga0496108_0114730_769_1224 | 146 |
| 229 | 3300048911 | Ga0496108_0633786 | Ga0496108_0633786_120_575 | 146 |
| 230 | 3300048912 | Ga0496109_0664271 | Ga0496109_0664271_318_773 | 146 |
| 231 | 3300048913 | Ga0496110_0066827 | Ga0496110_0066827_1734_2189 | 146 |
| 232 | 3300048916 | Ga0496113_0597502 | Ga0496113_0597502_124_579 | 146 |
| 233 | 3300048918 | Ga0496115_0000536 | Ga0496115_0000536_2049_2504 | 146 |
| 234 | 3300048918 | Ga0496115_0701871 | Ga0496115_0701871_313_768 | 146 |
| 235 | 3300048920 | Ga0496117_0004665 | Ga0496117_0004665_5296_5751 | 146 |
| 236 | 3300048921 | Ga0496118_0075106 | Ga0496118_0075106_690_1145 | 146 |
| 237 | 3300048922 | Ga0496119_0242397 | Ga0496119_0242397_346_801 | 146 |
| 238 | 3300048923 | Ga0496120_0122729 | Ga0496120_0122729_466_921 | 146 |
| 239 | 3300048924 | Ga0496121_0000088 | Ga0496121_0000088_150403_150858 | 146 |
| 240 | 3300049570 | Ga0501033_0040738 | Ga0501033_0040738_1105_1560 | 146 |
| 241 | 3300049574 | Ga0501038_0362105 | Ga0501038_0362105_347_802 | 146 |
| 242 | 3300049576 | Ga0501040_1208853 | Ga0501040_1208853_70_525 | 146 |
| 243 | 3300049579 | Ga0501043_0602130 | Ga0501043_0602130_301_756 | 146 |
| 244 | 3300049581 | Ga0501047_0401600 | Ga0501047_0401600_724_1179 | 146 |
| 245 | 3300049823 | Ga0501044_0004477 | Ga0501044_0004477_5451_5906 | 146 |
| 246 | 3300049823 | Ga0501044_0946018 | Ga0501044_0946018_221_676 | 146 |
| 247 | 3300050491 | nmdc:mga00v17_7282_c1 | nmdc:mga00v17_7282_c1_4585_5040 | 146 |
| 248 | 3300050493 | nmdc:mga0k408_139057_c1 | nmdc:mga0k408_139057_c1_137_592 | 146 |
| 249 | 3300050496 | nmdc:mga07m45_23209_c1 | nmdc:mga07m45_23209_c1_2064_2519 | 146 |
| 250 | 3300050496 | nmdc:mga07m45_529836_c1 | nmdc:mga07m45_529836_c1_212_667 | 146 |
| 251 | 3300053080 | Ga0500635_0000373 | Ga0500635_0000373_13270_13776 | 146 |
| 252 | 3300053086 | Ga0500578_0201694 | Ga0500578_0201694_721_1176 | 146 |
| 253 | 3300053087 | Ga0500643_000236 | Ga0500643_000236_22123_22578 | 146 |
| 254 | 3300053091 | Ga0500647_0068120 | Ga0500647_0068120_378_884 | 146 |
| 255 | 3300053093 | Ga0500651_0033997 | Ga0500651_0033997_2621_3076 | 146 |
| 256 | 3300053094 | Ga0500566_0071812 | Ga0500566_0071812_811_1266 | 146 |
| 257 | 3300053096 | Ga0500641_0000136 | Ga0500641_0000136_22084_22539 | 146 |
| 258 | 3300053096 | Ga0500641_0346298 | Ga0500641_0346298_90_545 | 146 |
| 259 | 3300053104 | Ga0500556_0018879 | Ga0500556_0018879_1479_1934 | 146 |
| 260 | 3300053108 | Ga0500562_002835 | Ga0500562_002835_1004_1459 | 146 |
| 261 | 3300053108 | Ga0500562_041232 | Ga0500562_041232_172_627 | 146 |
| 262 | 3300053109 | Ga0500569_001405 | Ga0500569_001405_2411_2866 | 146 |
| 263 | 3300053117 | Ga0500593_178027 | Ga0500593_178027_216_671 | 146 |
| 264 | 3300053119 | Ga0500595_126635 | Ga0500595_126635_224_679 | 146 |
| 265 | 3300053122 | Ga0500608_000386 | Ga0500608_000386_8480_8935 | 146 |
| 266 | 3300053123 | Ga0500614_002199 | Ga0500614_002199_645_1100 | 146 |
| 267 | 3300053133 | Ga0500655_010707 | Ga0500655_010707_325_780 | 146 |
| 268 | 3300053136 | Ga0500559_0003632 | Ga0500559_0003632_6456_6911 | 146 |
| 269 | 3300053136 | Ga0500559_0133597 | Ga0500559_0133597_55_561 | 146 |
| 270 | 3300053150 | Ga0500603_077386 | Ga0500603_077386_319_825 | 146 |
| 271 | 3300053151 | Ga0500604_0196981 | Ga0500604_0196981_208_663 | 146 |
| 272 | 3300053153 | Ga0500616_0030736 | Ga0500616_0030736_1975_2430 | 146 |
| 273 | 3300053156 | Ga0500622_0021192 | Ga0500622_0021192_761_1216 | 146 |
| 274 | 3300053156 | Ga0500622_0066355 | Ga0500622_0066355_909_1364 | 146 |
| 275 | 3300053156 | Ga0500622_0355112 | Ga0500622_0355112_113_568 | 146 |
| 276 | 3300053177 | Ga0500636_0067374 | Ga0500636_0067374_268_774 | 146 |
| 277 | 3300053178 | Ga0500637_0008727 | Ga0500637_0008727_4238_4693 | 146 |
| 278 | 3300053178 | Ga0500637_0137721 | Ga0500637_0137721_254_760 | 146 |
| 279 | 3300053728 | Ga0500657_096173 | Ga0500657_096173_219_674 | 146 |
| 280 | 3300053729 | Ga0500625_065204 | Ga0500625_065204_1062_1517 | 146 |
| 281 | 3300053730 | Ga0500645_000932 | Ga0500645_000932_5168_5662 | 146 |
| 282 | 3300053730 | Ga0500645_005935 | Ga0500645_005935_874_1329 | 146 |
| 283 | 3300053732 | Ga0500656_046934 | Ga0500656_046934_82_537 | 146 |
| 284 | 3300053735 | Ga0500596_000098 | Ga0500596_000098_5186_5641 | 146 |
| 285 | 3300003187 | JGI25151J46595_10000038 | JGI25151J46595_10000038152 | 147 |
| 286 | 3300003771 | Ga0055526_1000500 | Ga0055526_100050021 | 147 |
| 287 | 3300003771 | Ga0055526_1031178 | Ga0055526_10311782 | 147 |
| 288 | 3300003775 | Ga0055524_1000091 | Ga0055524_100009188 | 147 |
| 289 | 3300003775 | Ga0055524_1014261 | Ga0055524_10142613 | 147 |
| 290 | 3300003790 | Ga0055528_1044668 | Ga0055528_10446683 | 147 |
| 291 | 3300005440 | Ga0070705_100214254 | Ga0070705_1002142542 | 147 |
| 292 | 3300005844 | Ga0068862_100159574 | Ga0068862_1001595742 | 147 |
| 293 | 3300006237 | Ga0097621_100441456 | Ga0097621_1004414563 | 147 |
| 294 | 3300006353 | Ga0075370_10173999 | Ga0075370_101739992 | 147 |
| 295 | 3300006844 | Ga0075428_100282668 | Ga0075428_1002826682 | 147 |
| 296 | 3300006846 | Ga0075430_100008751 | Ga0075430_1000087517 | 147 |
| 297 | 3300006847 | Ga0075431_100287958 | Ga0075431_1002879582 | 147 |
| 298 | 3300009094 | Ga0111539_10837644 | Ga0111539_108376442 | 147 |
| 299 | 3300009176 | Ga0105242_11101440 | Ga0105242_111014402 | 147 |
| 300 | 3300013250 | Ga0171462_1033 | Ga0171462_103381 | 147 |
| 301 | 3300021361 | Ga0213872_10010483 | Ga0213872_100104833 | 147 |
| 302 | 3300021361 | Ga0213872_10037050 | Ga0213872_100370503 | 147 |
| 303 | 3300025273 | Ga0209673_1016862 | Ga0209673_10168623 | 147 |
| 304 | 3300025294 | Ga0209025_1000014 | Ga0209025_1000014146 | 147 |
| 305 | 3300025294 | Ga0209025_1028265 | Ga0209025_10282653 | 147 |
| 306 | 3300025295 | Ga0209564_1000017 | Ga0209564_1000017505 | 147 |
| 307 | 3300025295 | Ga0209564_1000150 | Ga0209564_100015056 | 147 |
| 308 | 3300025299 | Ga0209256_1000108 | Ga0209256_100010856 | 147 |
| 309 | 3300025299 | Ga0209256_1000338 | Ga0209256_100033841 | 147 |
| 310 | 3300025304 | Ga0209257_1124285 | Ga0209257_11242851 | 147 |
| 311 | 3300025907 | Ga0207645_10568816 | Ga0207645_105688161 | 147 |
| 312 | 3300025927 | Ga0207687_10997577 | Ga0207687_109975772 | 147 |
| 313 | 3300026067 | Ga0207678_10286350 | Ga0207678_102863502 | 147 |
| 314 | 3300027907 | Ga0207428_10128038 | Ga0207428_101280382 | 147 |
| 315 | 3300028380 | Ga0268265_10248731 | Ga0268265_102487311 | 147 |
| 316 | 3300031239 | Ga0265328_10004612 | Ga0265328_100046123 | 147 |
| 317 | 3300031240 | Ga0265320_10000765 | Ga0265320_1000076519 | 147 |
| 318 | 3300031250 | Ga0265331_10000019 | Ga0265331_10000019228 | 147 |
| 319 | 3300031548 | Ga0307408_100050214 | Ga0307408_1000502141 | 147 |
| 320 | 3300031595 | Ga0265313_10000644 | Ga0265313_1000064412 | 147 |
| 321 | 3300031901 | Ga0307406_10333774 | Ga0307406_103337742 | 147 |
| 322 | 3300031901 | Ga0307406_10907461 | Ga0307406_109074612 | 147 |
| 323 | 3300031911 | Ga0307412_10059815 | Ga0307412_100598153 | 147 |
| 324 | 3300032004 | Ga0307414_11338820 | Ga0307414_113388202 | 147 |
| 325 | 3300035088 | Ga0373940_0029440 | Ga0373940_0029440_220_678 | 147 |
| 326 | 3300035114 | Ga0373939_0017187 | Ga0373939_0017187_1144_1602 | 147 |
| 327 | 3300035115 | Ga0373941_0064254 | Ga0373941_0064254_12_470 | 147 |
| 328 | 3300035207 | Ga0373942_0080996 | Ga0373942_0080996_63_521 | 147 |
| 329 | 3300037418 | Ga0395900_1138488 | Ga0395900_1138488_36_482 | 147 |
| 330 | 3300039447 | Ga0436361_0205614 | Ga0436361_0205614_156_608 | 147 |
| 331 | 3300039447 | Ga0436361_0215284 | Ga0436361_0215284_1798_2250 | 147 |
| 332 | 3300039447 | Ga0436361_0540899 | Ga0436361_0540899_307_759 | 147 |
| 333 | 3300039447 | Ga0436361_0641214 | Ga0436361_0641214_1470_1922 | 147 |
| 334 | 3300042011 | Ga0439454_018205 | Ga0439454_018205_490_951 | 147 |
| 335 | 3300046455 | Ga0495603_0168385 | Ga0495603_0168385_351_809 | 147 |
| 336 | 3300046528 | Ga0495642_0037897 | Ga0495642_0037897_1235_1693 | 147 |
| 337 | 3300046557 | Ga0495622_0002500 | Ga0495622_0002500_215_673 | 147 |
| 338 | 3300046694 | Ga0495649_0004932 | Ga0495649_0004932_7059_7517 | 147 |
| 339 | 3300047320 | Ga0495672_0003627 | Ga0495672_0003627_6920_7378 | 147 |
| 340 | 3300047469 | Ga0495673_0077190 | Ga0495673_0077190_349_807 | 147 |
| 341 | 3300048091 | Ga0495626_0068514 | Ga0495626_0068514_669_1127 | 147 |
| 342 | 3300048913 | Ga0496110_0831696 | Ga0496110_0831696_201_662 | 147 |
| 343 | 3300048920 | Ga0496117_0087861 | Ga0496117_0087861_1478_1933 | 147 |
| 344 | 3300048921 | Ga0496118_0323765 | Ga0496118_0323765_36_491 | 147 |
| 345 | 3300048923 | Ga0496120_0149851 | Ga0496120_0149851_270_725 | 147 |
| 346 | 3300048925 | Ga0496122_0043757 | Ga0496122_0043757_1169_1624 | 147 |
| 347 | 3300048925 | Ga0496122_0171028 | Ga0496122_0171028_168_623 | 147 |
| 348 | 3300048926 | Ga0496123_0102774 | Ga0496123_0102774_725_1180 | 147 |
| 349 | 3300049571 | Ga0501034_0090456 | Ga0501034_0090456_1116_1571 | 147 |
| 350 | 3300049572 | Ga0501036_0546778 | Ga0501036_0546778_427_888 | 147 |
| 351 | 3300049573 | Ga0501037_0101730 | Ga0501037_0101730_258_713 | 147 |
| 352 | 3300049573 | Ga0501037_0328641 | Ga0501037_0328641_494_961 | 147 |
| 353 | 3300049575 | Ga0501039_0101877 | Ga0501039_0101877_1175_1636 | 147 |
| 354 | 3300049576 | Ga0501040_0153580 | Ga0501040_0153580_166_627 | 147 |
| 355 | 3300049577 | Ga0501041_0567699 | Ga0501041_0567699_221_688 | 147 |
| 356 | 3300049579 | Ga0501043_0210056 | Ga0501043_0210056_998_1465 | 147 |
| 357 | 3300049580 | Ga0501046_0855519 | Ga0501046_0855519_97_558 | 147 |
| 358 | 3300049582 | Ga0501048_0156096 | Ga0501048_0156096_191_658 | 147 |
| 359 | 3300049584 | Ga0501068_0226620 | Ga0501068_0226620_593_1060 | 147 |
| 360 | 3300049585 | Ga0501069_0326865 | Ga0501069_0326865_176_637 | 147 |
| 361 | 3300049586 | Ga0501070_0821166 | Ga0501070_0821166_224_691 | 147 |
| 362 | 3300049588 | Ga0501072_0320206 | Ga0501072_0320206_592_1053 | 147 |
| 363 | 3300049590 | Ga0501074_0161439 | Ga0501074_0161439_113_574 | 147 |
| 364 | 3300049592 | Ga0501076_0895876 | Ga0501076_0895876_190_651 | 147 |
| 365 | 3300049593 | Ga0501077_0082023 | Ga0501077_0082023_770_1237 | 147 |
| 366 | 3300049741 | Ga0501079_1077301 | Ga0501079_1077301_38_505 | 147 |
| 367 | 3300049742 | Ga0501080_0156987 | Ga0501080_0156987_1297_1746 | 147 |
| 368 | 3300049742 | Ga0501080_0549889 | Ga0501080_0549889_513_974 | 147 |
| 369 | 3300049742 | Ga0501080_0868002 | Ga0501080_0868002_151_618 | 147 |
| 370 | 3300049744 | Ga0501083_0053620 | Ga0501083_0053620_448_915 | 147 |
| 371 | 3300049822 | Ga0501035_0225911 | Ga0501035_0225911_698_1153 | 147 |
| 372 | 3300049823 | Ga0501044_0560397 | Ga0501044_0560397_299_751 | 147 |
| 373 | 3300049823 | Ga0501044_0844238 | Ga0501044_0844238_210_677 | 147 |
| 374 | 3300049824 | Ga0501045_0014809 | Ga0501045_0014809_2087_2554 | 147 |
| 375 | 3300050492 | nmdc:mga0yw44_169839_c1 | nmdc:mga0yw44_169839_c1_774_1229 | 147 |
| 376 | 3300050496 | nmdc:mga07m45_144800_c1 | nmdc:mga07m45_144800_c1_734_1189 | 147 |
| 377 | 3300050508 | nmdc:mga09592_66500_c1 | nmdc:mga09592_66500_c1_2294_2755 | 147 |
| 378 | 3300050509 | nmdc:mga0qj67_6214_c1 | nmdc:mga0qj67_6214_c1_2337_2798 | 147 |
| 379 | 3300050510 | nmdc:mga06r32_3190_c1 | nmdc:mga06r32_3190_c1_5430_5891 | 147 |
| 380 | 3300050511 | nmdc:mga08y16_10831_c1 | nmdc:mga08y16_10831_c1_1407_1868 | 147 |
| 381 | 3300050516 | nmdc:mga0sz30_275686_c1 | nmdc:mga0sz30_275686_c1_22_477 | 147 |
| 382 | 3300053080 | Ga0500635_0001982 | Ga0500635_0001982_4271_4729 | 147 |
| 383 | 3300053133 | Ga0500655_008848 | Ga0500655_008848_367_825 | 147 |
| 384 | 3300053178 | Ga0500637_0001038 | Ga0500637_0001038_9795_10253 | 147 |
| 385 | 3300054114 | Ga0501084_0093064 | Ga0501084_0093064_1544_2011 | 147 |
| 386 | 3300060353 | Ga0501082_0176599 | Ga0501082_0176599_172_621 | 147 |
| 387 | 3300061719 | Ga0466962_0261303 | Ga0466962_0261303_349_804 | 147 |
| 388 | 3300061734 | Ga0530510_0429037 | Ga0530510_0429037_28_489 | 147 |
| 389 | iso_pu_bacteria | 2643221733 | 2644729398 | 147 |
| 390 | iso_pu_bacteria | 2643221734 | 2644735544 | 147 |
| 391 | iso_pu_bacteria | 2818991467 | 2819718005 | 147 |
| 392 | iso_pu_bacteria | 2841911363 | 2841916457 | 147 |
| 393 | iso_pu_bacteria | 2841917233 | 2841922354 | 147 |
| 394 | iso_pu_bacteria | 2917699015 | 2917700534 | 147 |
| 395 | iso_pu_bacteria | 2990265787 | 2990268225 | 147 |
| 396 | iso_pu_bacteria | 2993693658 | 2993696748 | 147 |
| 397 | 3300001904 | JGI24736J21556_1000034 | JGI24736J21556_10000343 | 148 |
| 398 | 3300001915 | JGI24741J21665_1031856 | JGI24741J21665_10318561 | 148 |
| 399 | 3300001976 | JGI24752J21851_1000458 | JGI24752J21851_10004586 | 148 |
| 400 | 3300001989 | JGI24739J22299_10002575 | JGI24739J22299_100025755 | 148 |
| 401 | 3300001989 | JGI24739J22299_10031232 | JGI24739J22299_100312322 | 148 |
| 402 | 3300001990 | JGI24737J22298_10065785 | JGI24737J22298_100657852 | 148 |
| 403 | 3300002067 | JGI24735J21928_10016828 | JGI24735J21928_100168282 | 148 |
| 404 | 3300002067 | JGI24735J21928_10098894 | JGI24735J21928_100988942 | 148 |
| 405 | 3300002074 | JGI24748J21848_1000034 | JGI24748J21848_100003427 | 148 |
| 406 | 3300002075 | JGI24738J21930_10000114 | JGI24738J21930_1000011417 | 148 |
| 407 | 3300002075 | JGI24738J21930_10034486 | JGI24738J21930_100344862 | 148 |
| 408 | 3300002239 | JGI24034J26672_10000018 | JGI24034J26672_1000001833 | 148 |
| 409 | 3300002244 | JGI24742J22300_10046678 | JGI24742J22300_100466782 | 148 |
| 410 | 3300002459 | JGI24751J29686_10030297 | JGI24751J29686_100302972 | 148 |
| 411 | 3300003781 | Ga0055536_1001520 | Ga0055536_10015202 | 148 |
| 412 | 3300005330 | Ga0070690_100000008 | Ga0070690_10000000834 | 148 |
| 413 | 3300005330 | Ga0070690_100038551 | Ga0070690_1000385514 | 148 |
| 414 | 3300005331 | Ga0070670_100005780 | Ga0070670_10000578012 | 148 |
| 415 | 3300005331 | Ga0070670_100096794 | Ga0070670_1000967943 | 148 |
| 416 | 3300005331 | Ga0070670_100096842 | Ga0070670_1000968422 | 148 |
| 417 | 3300005333 | Ga0070677_10034874 | Ga0070677_100348741 | 148 |
| 418 | 3300005335 | Ga0070666_10000032 | Ga0070666_1000003289 | 148 |
| 419 | 3300005335 | Ga0070666_10211537 | Ga0070666_102115373 | 148 |
| 420 | 3300005336 | Ga0070680_100049496 | Ga0070680_1000494964 | 148 |
| 421 | 3300005336 | Ga0070680_100588819 | Ga0070680_1005888192 | 148 |
| 422 | 3300005336 | Ga0070680_101053298 | Ga0070680_1010532981 | 148 |
| 423 | 3300005336 | Ga0070680_101520445 | Ga0070680_1015204451 | 148 |
| 424 | 3300005337 | Ga0070682_100044349 | Ga0070682_1000443494 | 148 |
| 425 | 3300005339 | Ga0070660_100039885 | Ga0070660_1000398853 | 148 |
| 426 | 3300005339 | Ga0070660_100122873 | Ga0070660_1001228732 | 148 |
| 427 | 3300005340 | Ga0070689_100003709 | Ga0070689_10000370912 | 148 |
| 428 | 3300005340 | Ga0070689_100021089 | Ga0070689_1000210891 | 148 |
| 429 | 3300005343 | Ga0070687_100018525 | Ga0070687_1000185252 | 148 |
| 430 | 3300005343 | Ga0070687_100148008 | Ga0070687_1001480082 | 148 |
| 431 | 3300005344 | Ga0070661_100090408 | Ga0070661_1000904082 | 148 |
| 432 | 3300005344 | Ga0070661_100168477 | Ga0070661_1001684772 | 148 |
| 433 | 3300005345 | Ga0070692_10182334 | Ga0070692_101823343 | 148 |
| 434 | 3300005347 | Ga0070668_100054490 | Ga0070668_1000544902 | 148 |
| 435 | 3300005347 | Ga0070668_100087645 | Ga0070668_1000876452 | 148 |
| 436 | 3300005347 | Ga0070668_100412195 | Ga0070668_1004121952 | 148 |
| 437 | 3300005353 | Ga0070669_100000211 | Ga0070669_10000021141 | 148 |
| 438 | 3300005353 | Ga0070669_100003446 | Ga0070669_1000034469 | 148 |
| 439 | 3300005353 | Ga0070669_100861126 | Ga0070669_1008611262 | 148 |
| 440 | 3300005354 | Ga0070675_100000318 | Ga0070675_10000031814 | 148 |
| 441 | 3300005355 | Ga0070671_100658785 | Ga0070671_1006587852 | 148 |
| 442 | 3300005356 | Ga0070674_100007694 | Ga0070674_1000076942 | 148 |
| 443 | 3300005356 | Ga0070674_100329627 | Ga0070674_1003296273 | 148 |
| 444 | 3300005364 | Ga0070673_100056396 | Ga0070673_1000563962 | 148 |
| 445 | 3300005365 | Ga0070688_100000278 | Ga0070688_1000002785 | 148 |
| 446 | 3300005365 | Ga0070688_100078692 | Ga0070688_1000786921 | 148 |
| 447 | 3300005366 | Ga0070659_100178217 | Ga0070659_1001782171 | 148 |
| 448 | 3300005366 | Ga0070659_100529669 | Ga0070659_1005296692 | 148 |
| 449 | 3300005367 | Ga0070667_100818656 | Ga0070667_1008186562 | 148 |
| 450 | 3300005367 | Ga0070667_101973677 | Ga0070667_1019736771 | 148 |
| 451 | 3300005406 | Ga0070703_10434170 | Ga0070703_104341701 | 148 |
| 452 | 3300005435 | Ga0070714_100104092 | Ga0070714_1001040923 | 148 |
| 453 | 3300005435 | Ga0070714_100384567 | Ga0070714_1003845671 | 148 |
| 454 | 3300005435 | Ga0070714_100856549 | Ga0070714_1008565491 | 148 |
| 455 | 3300005436 | Ga0070713_101633643 | Ga0070713_1016336431 | 148 |
| 456 | 3300005437 | Ga0070710_10567670 | Ga0070710_105676702 | 148 |
| 457 | 3300005439 | Ga0070711_100061252 | Ga0070711_1000612523 | 148 |
| 458 | 3300005439 | Ga0070711_100356676 | Ga0070711_1003566762 | 148 |
| 459 | 3300005440 | Ga0070705_100036828 | Ga0070705_1000368283 | 148 |
| 460 | 3300005440 | Ga0070705_100045966 | Ga0070705_1000459662 | 148 |
| 461 | 3300005441 | Ga0070700_100005755 | Ga0070700_1000057551 | 148 |
| 462 | 3300005444 | Ga0070694_100227163 | Ga0070694_1002271633 | 148 |
| 463 | 3300005445 | Ga0070708_102210372 | Ga0070708_1022103721 | 148 |
| 464 | 3300005455 | Ga0070663_100407695 | Ga0070663_1004076952 | 148 |
| 465 | 3300005456 | Ga0070678_100123226 | Ga0070678_1001232262 | 148 |
| 466 | 3300005457 | Ga0070662_100005437 | Ga0070662_1000054374 | 148 |
| 467 | 3300005457 | Ga0070662_100066497 | Ga0070662_1000664972 | 148 |
| 468 | 3300005457 | Ga0070662_100151577 | Ga0070662_1001515773 | 148 |
| 469 | 3300005457 | Ga0070662_100154225 | Ga0070662_1001542253 | 148 |
| 470 | 3300005458 | Ga0070681_10030742 | Ga0070681_100307422 | 148 |
| 471 | 3300005458 | Ga0070681_10041636 | Ga0070681_100416362 | 148 |
| 472 | 3300005458 | Ga0070681_10229958 | Ga0070681_102299582 | 148 |
| 473 | 3300005459 | Ga0068867_100007408 | Ga0068867_1000074086 | 148 |
| 474 | 3300005466 | Ga0070685_10000046 | Ga0070685_100000468 | 148 |
| 475 | 3300005467 | Ga0070706_100078812 | Ga0070706_1000788124 | 148 |
| 476 | 3300005518 | Ga0070699_101395048 | Ga0070699_1013950481 | 148 |
| 477 | 3300005530 | Ga0070679_100281383 | Ga0070679_1002813833 | 148 |
| 478 | 3300005530 | Ga0070679_100606486 | Ga0070679_1006064862 | 148 |
| 479 | 3300005535 | Ga0070684_100016494 | Ga0070684_1000164944 | 148 |
| 480 | 3300005535 | Ga0070684_100988247 | Ga0070684_1009882472 | 148 |
| 481 | 3300005536 | Ga0070697_100284636 | Ga0070697_1002846362 | 148 |
| 482 | 3300005539 | Ga0068853_100163578 | Ga0068853_1001635783 | 148 |
| 483 | 3300005539 | Ga0068853_100410391 | Ga0068853_1004103912 | 148 |
| 484 | 3300005539 | Ga0068853_100565972 | Ga0068853_1005659722 | 148 |
| 485 | 3300005539 | Ga0068853_101193898 | Ga0068853_1011938981 | 148 |
| 486 | 3300005543 | Ga0070672_100092685 | Ga0070672_1000926852 | 148 |
| 487 | 3300005543 | Ga0070672_101008875 | Ga0070672_1010088752 | 148 |
| 488 | 3300005544 | Ga0070686_100000030 | Ga0070686_10000003091 | 148 |
| 489 | 3300005545 | Ga0070695_100011453 | Ga0070695_1000114533 | 148 |
| 490 | 3300005545 | Ga0070695_100083595 | Ga0070695_1000835952 | 148 |
| 491 | 3300005545 | Ga0070695_100961278 | Ga0070695_1009612781 | 148 |
| 492 | 3300005546 | Ga0070696_100514055 | Ga0070696_1005140551 | 148 |
| 493 | 3300005546 | Ga0070696_100553811 | Ga0070696_1005538111 | 148 |
| 494 | 3300005546 | Ga0070696_100804731 | Ga0070696_1008047311 | 148 |
| 495 | 3300005546 | Ga0070696_101194723 | Ga0070696_1011947231 | 148 |
| 496 | 3300005547 | Ga0070693_100011046 | Ga0070693_1000110465 | 148 |
| 497 | 3300005547 | Ga0070693_100452526 | Ga0070693_1004525262 | 148 |
| 498 | 3300005548 | Ga0070665_100000056 | Ga0070665_100000056161 | 148 |
| 499 | 3300005549 | Ga0070704_100209537 | Ga0070704_1002095372 | 148 |
| 500 | 3300005549 | Ga0070704_101749865 | Ga0070704_1017498651 | 148 |
| 501 | 3300005563 | Ga0068855_100184107 | Ga0068855_1001841073 | 148 |
| 502 | 3300005563 | Ga0068855_100408913 | Ga0068855_1004089133 | 148 |
| 503 | 3300005564 | Ga0070664_100034473 | Ga0070664_1000344734 | 148 |
| 504 | 3300005577 | Ga0068857_100008220 | Ga0068857_1000082204 | 148 |
| 505 | 3300005577 | Ga0068857_100010280 | Ga0068857_1000102808 | 148 |
| 506 | 3300005577 | Ga0068857_100241386 | Ga0068857_1002413862 | 148 |
| 507 | 3300005577 | Ga0068857_100280925 | Ga0068857_1002809252 | 148 |
| 508 | 3300005577 | Ga0068857_100563182 | Ga0068857_1005631822 | 148 |
| 509 | 3300005578 | Ga0068854_100077681 | Ga0068854_1000776814 | 148 |
| 510 | 3300005614 | Ga0068856_101153245 | Ga0068856_1011532452 | 148 |
| 511 | 3300005614 | Ga0068856_101973726 | Ga0068856_1019737261 | 148 |
| 512 | 3300005615 | Ga0070702_100167066 | Ga0070702_1001670662 | 148 |
| 513 | 3300005616 | Ga0068852_100079878 | Ga0068852_1000798785 | 148 |
| 514 | 3300005616 | Ga0068852_100268440 | Ga0068852_1002684402 | 148 |
| 515 | 3300005616 | Ga0068852_100949643 | Ga0068852_1009496432 | 148 |
| 516 | 3300005617 | Ga0068859_100002159 | Ga0068859_10000215918 | 148 |
| 517 | 3300005617 | Ga0068859_100003975 | Ga0068859_10000397519 | 148 |
| 518 | 3300005617 | Ga0068859_100161616 | Ga0068859_1001616162 | 148 |
| 519 | 3300005618 | Ga0068864_100001636 | Ga0068864_1000016362 | 148 |
| 520 | 3300005618 | Ga0068864_100222676 | Ga0068864_1002226762 | 148 |
| 521 | 3300005618 | Ga0068864_101647623 | Ga0068864_1016476231 | 148 |
| 522 | 3300005718 | Ga0068866_10037881 | Ga0068866_100378812 | 148 |
| 523 | 3300005719 | Ga0068861_100006545 | Ga0068861_10000654510 | 148 |
| 524 | 3300005719 | Ga0068861_100650806 | Ga0068861_1006508062 | 148 |
| 525 | 3300005834 | Ga0068851_10060087 | Ga0068851_100600872 | 148 |
| 526 | 3300005840 | Ga0068870_10308889 | Ga0068870_103088892 | 148 |
| 527 | 3300005841 | Ga0068863_100000065 | Ga0068863_10000006536 | 148 |
| 528 | 3300005841 | Ga0068863_100003234 | Ga0068863_10000323412 | 148 |
| 529 | 3300005842 | Ga0068858_100005370 | Ga0068858_1000053707 | 148 |
| 530 | 3300005842 | Ga0068858_100035804 | Ga0068858_1000358042 | 148 |
| 531 | 3300005843 | Ga0068860_100000132 | Ga0068860_10000013238 | 148 |
| 532 | 3300005844 | Ga0068862_100000356 | Ga0068862_10000035636 | 148 |
| 533 | 3300005844 | Ga0068862_100026325 | Ga0068862_1000263252 | 148 |
| 534 | 3300005844 | Ga0068862_100197499 | Ga0068862_1001974991 | 148 |
| 535 | 3300005844 | Ga0068862_100565487 | Ga0068862_1005654872 | 148 |
| 536 | 3300005844 | Ga0068862_100600347 | Ga0068862_1006003472 | 148 |
| 537 | 3300005981 | Ga0081538_10177576 | Ga0081538_101775762 | 148 |
| 538 | 3300005983 | Ga0081540_1055329 | Ga0081540_10553292 | 148 |
| 539 | 3300006028 | Ga0070717_10006289 | Ga0070717_100062892 | 148 |
| 540 | 3300006028 | Ga0070717_10533754 | Ga0070717_105337542 | 148 |
| 541 | 3300006173 | Ga0070716_100932721 | Ga0070716_1009327211 | 148 |
| 542 | 3300006175 | Ga0070712_100263270 | Ga0070712_1002632702 | 148 |
| 543 | 3300006178 | Ga0075367_10063393 | Ga0075367_100633933 | 148 |
| 544 | 3300006358 | Ga0068871_100088100 | Ga0068871_1000881002 | 148 |
| 545 | 3300006844 | Ga0075428_100066407 | Ga0075428_1000664077 | 148 |
| 546 | 3300006844 | Ga0075428_100102914 | Ga0075428_1001029142 | 148 |
| 547 | 3300006844 | Ga0075428_100335721 | Ga0075428_1003357212 | 148 |
| 548 | 3300006844 | Ga0075428_100644051 | Ga0075428_1006440512 | 148 |
| 549 | 3300006846 | Ga0075430_100008579 | Ga0075430_1000085796 | 148 |
| 550 | 3300006846 | Ga0075430_100034569 | Ga0075430_1000345693 | 148 |
| 551 | 3300006846 | Ga0075430_100174590 | Ga0075430_1001745903 | 148 |
| 552 | 3300006847 | Ga0075431_100055566 | Ga0075431_1000555665 | 148 |
| 553 | 3300006847 | Ga0075431_100084807 | Ga0075431_1000848072 | 148 |
| 554 | 3300006847 | Ga0075431_100124950 | Ga0075431_1001249502 | 148 |
| 555 | 3300006847 | Ga0075431_100655631 | Ga0075431_1006556312 | 148 |
| 556 | 3300006847 | Ga0075431_102034268 | Ga0075431_1020342681 | 148 |
| 557 | 3300006852 | Ga0075433_10458406 | Ga0075433_104584062 | 148 |
| 558 | 3300006871 | Ga0075434_100214345 | Ga0075434_1002143452 | 148 |
| 559 | 3300006871 | Ga0075434_101808012 | Ga0075434_1018080121 | 148 |
| 560 | 3300006880 | Ga0075429_100052398 | Ga0075429_1000523985 | 148 |
| 561 | 3300006880 | Ga0075429_100424513 | Ga0075429_1004245132 | 148 |
| 562 | 3300006880 | Ga0075429_101134592 | Ga0075429_1011345921 | 148 |
| 563 | 3300006881 | Ga0068865_100283651 | Ga0068865_1002836512 | 148 |
| 564 | 3300006931 | Ga0097620_100002159 | Ga0097620_10000215918 | 148 |
| 565 | 3300006931 | Ga0097620_100003975 | Ga0097620_10000397519 | 148 |
| 566 | 3300006931 | Ga0097620_100161615 | Ga0097620_1001616152 | 148 |
| 567 | 3300006931 | Ga0097620_100676952 | Ga0097620_1006769522 | 148 |
| 568 | 3300007076 | Ga0075435_100188539 | Ga0075435_1001885392 | 148 |
| 569 | 3300007076 | Ga0075435_101505653 | Ga0075435_1015056532 | 148 |
| 570 | 3300009036 | Ga0105244_10252797 | Ga0105244_102527971 | 148 |
| 571 | 3300009092 | Ga0105250_10097612 | Ga0105250_100976122 | 148 |
| 572 | 3300009093 | Ga0105240_11121365 | Ga0105240_111213652 | 148 |
| 573 | 3300009094 | Ga0111539_10589405 | Ga0111539_105894052 | 148 |
| 574 | 3300009094 | Ga0111539_10766970 | Ga0111539_107669702 | 148 |
| 575 | 3300009094 | Ga0111539_10938887 | Ga0111539_109388872 | 148 |
| 576 | 3300009094 | Ga0111539_11004405 | Ga0111539_110044052 | 148 |
| 577 | 3300009094 | Ga0111539_11617824 | Ga0111539_116178241 | 148 |
| 578 | 3300009098 | Ga0105245_10076531 | Ga0105245_100765312 | 148 |
| 579 | 3300009098 | Ga0105245_11464734 | Ga0105245_114647342 | 148 |
| 580 | 3300009098 | Ga0105245_12329724 | Ga0105245_123297241 | 148 |
| 581 | 3300009101 | Ga0105247_10098873 | Ga0105247_100988733 | 148 |
| 582 | 3300009101 | Ga0105247_10652288 | Ga0105247_106522881 | 148 |
| 583 | 3300009147 | Ga0114129_10000745 | Ga0114129_1000074529 | 148 |
| 584 | 3300009147 | Ga0114129_10216471 | Ga0114129_102164713 | 148 |
| 585 | 3300009147 | Ga0114129_10375634 | Ga0114129_103756342 | 148 |
| 586 | 3300009147 | Ga0114129_10532586 | Ga0114129_105325863 | 148 |
| 587 | 3300009147 | Ga0114129_10793836 | Ga0114129_107938362 | 148 |
| 588 | 3300009147 | Ga0114129_10808146 | Ga0114129_108081462 | 148 |
| 589 | 3300009148 | Ga0105243_10391776 | Ga0105243_103917762 | 148 |
| 590 | 3300009148 | Ga0105243_10805468 | Ga0105243_108054682 | 148 |
| 591 | 3300009174 | Ga0105241_11644588 | Ga0105241_116445881 | 148 |
| 592 | 3300009176 | Ga0105242_10194425 | Ga0105242_101944252 | 148 |
| 593 | 3300009177 | Ga0105248_10168892 | Ga0105248_101688922 | 148 |
| 594 | 3300009177 | Ga0105248_10326716 | Ga0105248_103267162 | 148 |
| 595 | 3300009177 | Ga0105248_12200769 | Ga0105248_122007692 | 148 |
| 596 | 3300009545 | Ga0105237_10041422 | Ga0105237_100414223 | 148 |
| 597 | 3300009545 | Ga0105237_10072029 | Ga0105237_100720293 | 148 |
| 598 | 3300009545 | Ga0105237_11257466 | Ga0105237_112574661 | 148 |
| 599 | 3300009551 | Ga0105238_10100629 | Ga0105238_101006292 | 148 |
| 600 | 3300009551 | Ga0105238_10168351 | Ga0105238_101683513 | 148 |
| 601 | 3300009551 | Ga0105238_10491129 | Ga0105238_104911292 | 148 |
| 602 | 3300009553 | Ga0105249_10000109 | Ga0105249_1000010937 | 148 |
| 603 | 3300009553 | Ga0105249_10044880 | Ga0105249_100448805 | 148 |
| 604 | 3300009553 | Ga0105249_11726440 | Ga0105249_117264401 | 148 |
| 605 | 3300010375 | Ga0105239_10529788 | Ga0105239_105297882 | 148 |
| 606 | 3300010375 | Ga0105239_10708147 | Ga0105239_107081472 | 148 |
| 607 | 3300011119 | Ga0105246_11071271 | Ga0105246_110712711 | 148 |
| 608 | 3300013100 | Ga0157373_10136481 | Ga0157373_101364812 | 148 |
| 609 | 3300013100 | Ga0157373_10140232 | Ga0157373_101402322 | 148 |
| 610 | 3300013104 | Ga0157370_10087756 | Ga0157370_100877563 | 148 |
| 611 | 3300013105 | Ga0157369_10402814 | Ga0157369_104028142 | 148 |
| 612 | 3300013306 | Ga0163162_10077860 | Ga0163162_100778602 | 148 |
| 613 | 3300013306 | Ga0163162_10106902 | Ga0163162_101069022 | 148 |
| 614 | 3300013307 | Ga0157372_10271507 | Ga0157372_102715073 | 148 |
| 615 | 3300013307 | Ga0157372_12649118 | Ga0157372_126491181 | 148 |
| 616 | 3300013308 | Ga0157375_10007541 | Ga0157375_100075419 | 148 |
| 617 | 3300014325 | Ga0163163_10000744 | Ga0163163_1000074422 | 148 |
| 618 | 3300014325 | Ga0163163_10371393 | Ga0163163_103713932 | 148 |
| 619 | 3300014325 | Ga0163163_11222863 | Ga0163163_112228632 | 148 |
| 620 | 3300014326 | Ga0157380_10000599 | Ga0157380_100005993 | 148 |
| 621 | 3300014326 | Ga0157380_10403480 | Ga0157380_104034802 | 148 |
| 622 | 3300014745 | Ga0157377_10014975 | Ga0157377_100149755 | 148 |
| 623 | 3300014968 | Ga0157379_10022792 | Ga0157379_100227924 | 148 |
| 624 | 3300017792 | Ga0163161_10000084 | Ga0163161_1000008480 | 148 |
| 625 | 3300021358 | Ga0213873_10093913 | Ga0213873_100939131 | 148 |
| 626 | 3300021388 | Ga0213875_10176951 | Ga0213875_101769512 | 148 |
| 627 | 3300025223 | Ga0207672_1000296 | Ga0207672_10002966 | 148 |
| 628 | 3300025292 | Ga0209676_1000343 | Ga0209676_100034316 | 148 |
| 629 | 3300025321 | Ga0207656_10074562 | Ga0207656_100745621 | 148 |
| 630 | 3300025898 | Ga0207692_10126826 | Ga0207692_101268262 | 148 |
| 631 | 3300025899 | Ga0207642_10004579 | Ga0207642_100045792 | 148 |
| 632 | 3300025899 | Ga0207642_10512501 | Ga0207642_105125011 | 148 |
| 633 | 3300025900 | Ga0207710_10051986 | Ga0207710_100519863 | 148 |
| 634 | 3300025900 | Ga0207710_10552090 | Ga0207710_105520902 | 148 |
| 635 | 3300025901 | Ga0207688_10010554 | Ga0207688_100105544 | 148 |
| 636 | 3300025903 | Ga0207680_10000009 | Ga0207680_10000009360 | 148 |
| 637 | 3300025904 | Ga0207647_10000766 | Ga0207647_1000076623 | 148 |
| 638 | 3300025904 | Ga0207647_10106875 | Ga0207647_101068753 | 148 |
| 639 | 3300025908 | Ga0207643_10093320 | Ga0207643_100933202 | 148 |
| 640 | 3300025909 | Ga0207705_10004861 | Ga0207705_1000486110 | 148 |
| 641 | 3300025909 | Ga0207705_10762507 | Ga0207705_107625071 | 148 |
| 642 | 3300025910 | Ga0207684_10147688 | Ga0207684_101476883 | 148 |
| 643 | 3300025911 | Ga0207654_10000868 | Ga0207654_100008682 | 148 |
| 644 | 3300025911 | Ga0207654_10522774 | Ga0207654_105227741 | 148 |
| 645 | 3300025912 | Ga0207707_10114316 | Ga0207707_101143162 | 148 |
| 646 | 3300025912 | Ga0207707_10156135 | Ga0207707_101561352 | 148 |
| 647 | 3300025912 | Ga0207707_10222486 | Ga0207707_102224862 | 148 |
| 648 | 3300025913 | Ga0207695_10003070 | Ga0207695_100030703 | 148 |
| 649 | 3300025913 | Ga0207695_10201215 | Ga0207695_102012152 | 148 |
| 650 | 3300025914 | Ga0207671_10006894 | Ga0207671_100068949 | 148 |
| 651 | 3300025914 | Ga0207671_10070299 | Ga0207671_100702993 | 148 |
| 652 | 3300025915 | Ga0207693_10011477 | Ga0207693_100114773 | 148 |
| 653 | 3300025915 | Ga0207693_10238743 | Ga0207693_102387432 | 148 |
| 654 | 3300025916 | Ga0207663_10076004 | Ga0207663_100760042 | 148 |
| 655 | 3300025916 | Ga0207663_10307577 | Ga0207663_103075771 | 148 |
| 656 | 3300025917 | Ga0207660_10147324 | Ga0207660_101473242 | 148 |
| 657 | 3300025917 | Ga0207660_11365648 | Ga0207660_113656481 | 148 |
| 658 | 3300025918 | Ga0207662_10502415 | Ga0207662_105024151 | 148 |
| 659 | 3300025919 | Ga0207657_10007686 | Ga0207657_100076864 | 148 |
| 660 | 3300025919 | Ga0207657_10040691 | Ga0207657_100406915 | 148 |
| 661 | 3300025919 | Ga0207657_10612786 | Ga0207657_106127861 | 148 |
| 662 | 3300025920 | Ga0207649_10157546 | Ga0207649_101575462 | 148 |
| 663 | 3300025921 | Ga0207652_11190684 | Ga0207652_111906841 | 148 |
| 664 | 3300025923 | Ga0207681_10000965 | Ga0207681_1000096518 | 148 |
| 665 | 3300025924 | Ga0207694_10125317 | Ga0207694_101253172 | 148 |
| 666 | 3300025924 | Ga0207694_10559462 | Ga0207694_105594621 | 148 |
| 667 | 3300025925 | Ga0207650_10122997 | Ga0207650_101229972 | 148 |
| 668 | 3300025925 | Ga0207650_10186042 | Ga0207650_101860423 | 148 |
| 669 | 3300025925 | Ga0207650_10611152 | Ga0207650_106111521 | 148 |
| 670 | 3300025926 | Ga0207659_10004912 | Ga0207659_100049124 | 148 |
| 671 | 3300025926 | Ga0207659_10182710 | Ga0207659_101827102 | 148 |
| 672 | 3300025927 | Ga0207687_10533384 | Ga0207687_105333841 | 148 |
| 673 | 3300025928 | Ga0207700_10546791 | Ga0207700_105467912 | 148 |
| 674 | 3300025929 | Ga0207664_10151107 | Ga0207664_101511072 | 148 |
| 675 | 3300025931 | Ga0207644_10003709 | Ga0207644_100037092 | 148 |
| 676 | 3300025931 | Ga0207644_10117953 | Ga0207644_101179532 | 148 |
| 677 | 3300025932 | Ga0207690_10137604 | Ga0207690_101376042 | 148 |
| 678 | 3300025932 | Ga0207690_10596165 | Ga0207690_105961652 | 148 |
| 679 | 3300025933 | Ga0207706_10020148 | Ga0207706_100201483 | 148 |
| 680 | 3300025933 | Ga0207706_10040317 | Ga0207706_100403173 | 148 |
| 681 | 3300025933 | Ga0207706_10501732 | Ga0207706_105017321 | 148 |
| 682 | 3300025933 | Ga0207706_10501733 | Ga0207706_105017331 | 148 |
| 683 | 3300025935 | Ga0207709_10525045 | Ga0207709_105250451 | 148 |
| 684 | 3300025936 | Ga0207670_10022376 | Ga0207670_100223762 | 148 |
| 685 | 3300025936 | Ga0207670_10054735 | Ga0207670_100547351 | 148 |
| 686 | 3300025937 | Ga0207669_10301972 | Ga0207669_103019721 | 148 |
| 687 | 3300025940 | Ga0207691_10018446 | Ga0207691_100184469 | 148 |
| 688 | 3300025941 | Ga0207711_10004477 | Ga0207711_100044776 | 148 |
| 689 | 3300025941 | Ga0207711_10106037 | Ga0207711_101060372 | 148 |
| 690 | 3300025944 | Ga0207661_10904371 | Ga0207661_109043712 | 148 |
| 691 | 3300025945 | Ga0207679_10013683 | Ga0207679_100136835 | 148 |
| 692 | 3300025945 | Ga0207679_10700207 | Ga0207679_107002072 | 148 |
| 693 | 3300025949 | Ga0207667_10013251 | Ga0207667_100132512 | 148 |
| 694 | 3300025949 | Ga0207667_10067709 | Ga0207667_100677092 | 148 |
| 695 | 3300025949 | Ga0207667_10361064 | Ga0207667_103610642 | 148 |
| 696 | 3300025960 | Ga0207651_10028339 | Ga0207651_100283395 | 148 |
| 697 | 3300025961 | Ga0207712_10000046 | Ga0207712_1000004648 | 148 |
| 698 | 3300025961 | Ga0207712_10014037 | Ga0207712_100140375 | 148 |
| 699 | 3300025972 | Ga0207668_10021901 | Ga0207668_100219012 | 148 |
| 700 | 3300025972 | Ga0207668_10440739 | Ga0207668_104407392 | 148 |
| 701 | 3300025972 | Ga0207668_10473346 | Ga0207668_104733462 | 148 |
| 702 | 3300025972 | Ga0207668_11144001 | Ga0207668_111440011 | 148 |
| 703 | 3300025972 | Ga0207668_11219305 | Ga0207668_112193052 | 148 |
| 704 | 3300025981 | Ga0207640_10101558 | Ga0207640_101015583 | 148 |
| 705 | 3300025986 | Ga0207658_10000784 | Ga0207658_100007848 | 148 |
| 706 | 3300026035 | Ga0207703_10005251 | Ga0207703_100052517 | 148 |
| 707 | 3300026035 | Ga0207703_10023484 | Ga0207703_100234842 | 148 |
| 708 | 3300026035 | Ga0207703_11280694 | Ga0207703_112806941 | 148 |
| 709 | 3300026041 | Ga0207639_10008983 | Ga0207639_100089834 | 148 |
| 710 | 3300026041 | Ga0207639_10551073 | Ga0207639_105510732 | 148 |
| 711 | 3300026067 | Ga0207678_10014887 | Ga0207678_100148878 | 148 |
| 712 | 3300026067 | Ga0207678_10476904 | Ga0207678_104769042 | 148 |
| 713 | 3300026075 | Ga0207708_10168093 | Ga0207708_101680933 | 148 |
| 714 | 3300026078 | Ga0207702_10001550 | Ga0207702_100015502 | 148 |
| 715 | 3300026088 | Ga0207641_10000063 | Ga0207641_10000063125 | 148 |
| 716 | 3300026088 | Ga0207641_10006925 | Ga0207641_100069258 | 148 |
| 717 | 3300026095 | Ga0207676_10003249 | Ga0207676_100032492 | 148 |
| 718 | 3300026095 | Ga0207676_10067629 | Ga0207676_100676291 | 148 |
| 719 | 3300026095 | Ga0207676_10171124 | Ga0207676_101711241 | 148 |
| 720 | 3300026116 | Ga0207674_10000811 | Ga0207674_1000081144 | 148 |
| 721 | 3300026116 | Ga0207674_10005308 | Ga0207674_1000530817 | 148 |
| 722 | 3300026116 | Ga0207674_10063883 | Ga0207674_100638835 | 148 |
| 723 | 3300026116 | Ga0207674_10329138 | Ga0207674_103291382 | 148 |
| 724 | 3300026116 | Ga0207674_10640391 | Ga0207674_106403912 | 148 |
| 725 | 3300026118 | Ga0207675_100000167 | Ga0207675_10000016726 | 148 |
| 726 | 3300026118 | Ga0207675_100667485 | Ga0207675_1006674851 | 148 |
| 727 | 3300026121 | Ga0207683_10036937 | Ga0207683_100369372 | 148 |
| 728 | 3300026142 | Ga0207698_10018372 | Ga0207698_100183723 | 148 |
| 729 | 3300026142 | Ga0207698_10689508 | Ga0207698_106895081 | 148 |
| 730 | 3300026142 | Ga0207698_11296025 | Ga0207698_112960251 | 148 |
| 731 | 3300027907 | Ga0207428_10266497 | Ga0207428_102664972 | 148 |
| 732 | 3300028379 | Ga0268266_10000066 | Ga0268266_1000006693 | 148 |
| 733 | 3300028379 | Ga0268266_10209637 | Ga0268266_102096372 | 148 |
| 734 | 3300028379 | Ga0268266_10399807 | Ga0268266_103998072 | 148 |
| 735 | 3300028380 | Ga0268265_10000129 | Ga0268265_1000012934 | 148 |
| 736 | 3300028380 | Ga0268265_10003546 | Ga0268265_100035465 | 148 |
| 737 | 3300028380 | Ga0268265_10169989 | Ga0268265_101699892 | 148 |
| 738 | 3300028380 | Ga0268265_10544775 | Ga0268265_105447752 | 148 |
| 739 | 3300028381 | Ga0268264_10000130 | Ga0268264_1000013067 | 148 |
| 740 | 3300028381 | Ga0268264_10042602 | Ga0268264_100426023 | 148 |
| 741 | 3300028381 | Ga0268264_11105894 | Ga0268264_111058942 | 148 |
| 742 | 3300028577 | Ga0265318_10019261 | Ga0265318_100192613 | 148 |
| 743 | 3300028800 | Ga0265338_10119775 | Ga0265338_101197752 | 148 |
| 744 | 3300031241 | Ga0265325_10058885 | Ga0265325_100588853 | 148 |
| 745 | 3300031249 | Ga0265339_10376476 | Ga0265339_103764761 | 148 |
| 746 | 3300031456 | Ga0307513_10075345 | Ga0307513_100753452 | 148 |
| 747 | 3300031548 | Ga0307408_100102895 | Ga0307408_1001028952 | 148 |
| 748 | 3300031548 | Ga0307408_100511061 | Ga0307408_1005110611 | 148 |
| 749 | 3300031548 | Ga0307408_101094255 | Ga0307408_1010942552 | 148 |
| 750 | 3300031595 | Ga0265313_10004334 | Ga0265313_100043349 | 148 |
| 751 | 3300031616 | Ga0307508_10742356 | Ga0307508_107423561 | 148 |
| 752 | 3300031691 | Ga0316579_10006754 | Ga0316579_100067542 | 148 |
| 753 | 3300031711 | Ga0265314_10159320 | Ga0265314_101593202 | 148 |
| 754 | 3300031727 | Ga0316576_10048037 | Ga0316576_100480372 | 148 |
| 755 | 3300031728 | Ga0316578_10002183 | Ga0316578_100021837 | 148 |
| 756 | 3300031731 | Ga0307405_10152973 | Ga0307405_101529732 | 148 |
| 757 | 3300031733 | Ga0316577_10056675 | Ga0316577_100566752 | 148 |
| 758 | 3300031824 | Ga0307413_10108930 | Ga0307413_101089302 | 148 |
| 759 | 3300031901 | Ga0307406_10202447 | Ga0307406_102024471 | 148 |
| 760 | 3300031901 | Ga0307406_11179754 | Ga0307406_111797541 | 148 |
| 761 | 3300032002 | Ga0307416_100213800 | Ga0307416_1002138002 | 148 |
| 762 | 3300032004 | Ga0307414_10263254 | Ga0307414_102632541 | 148 |
| 763 | 3300032004 | Ga0307414_10562100 | Ga0307414_105621002 | 148 |
| 764 | 3300032005 | Ga0307411_10733024 | Ga0307411_107330242 | 148 |
| 765 | 3300032005 | Ga0307411_10741506 | Ga0307411_107415061 | 148 |
| 766 | 3300032137 | Ga0316585_10033052 | Ga0316585_100330522 | 148 |
| 767 | 3300032139 | Ga0316580_10021695 | Ga0316580_100216952 | 148 |
| 768 | 3300033180 | Ga0307510_10163086 | Ga0307510_101630862 | 148 |
| 769 | 3300034957 | Ga0373938_0122792 | Ga0373938_0122792_165_611 | 148 |
| 770 | 3300035112 | Ga0373932_0324789 | Ga0373932_0324789_75_539 | 148 |
| 771 | 3300035117 | Ga0373953_0195470 | Ga0373953_0195470_191_637 | 148 |
| 772 | 3300035119 | Ga0373956_0058473 | Ga0373956_0058473_262_708 | 148 |
| 773 | 3300035207 | Ga0373942_0262969 | Ga0373942_0262969_54_518 | 148 |
| 774 | 3300035398 | Ga0316574_0010852 | Ga0316574_0010852_3563_4045 | 148 |
| 775 | 3300035410 | Ga0373924_0033263 | Ga0373924_0033263_238_696 | 148 |
| 776 | 3300035691 | Ga0373931_0524428 | Ga0373931_0524428_222_686 | 148 |
| 777 | 3300035695 | Ga0373927_0077921 | Ga0373927_0077921_189_668 | 148 |
| 778 | 3300036401 | Ga0373937_1079723 | Ga0373937_1079723_201_647 | 148 |
| 779 | 3300036647 | Ga0316582_0035297 | Ga0316582_0035297_610_1092 | 148 |
| 780 | 3300036712 | Ga0316584_0066758 | Ga0316584_0066758_1398_1880 | 148 |
| 781 | 3300037068 | Ga0373925_0421645 | Ga0373925_0421645_347_805 | 148 |
| 782 | 3300037312 | Ga0395899_0096936 | Ga0395899_0096936_889_1368 | 148 |
| 783 | 3300037418 | Ga0395900_0013620 | Ga0395900_0013620_2008_2487 | 148 |
| 784 | 3300037418 | Ga0395900_0060994 | Ga0395900_0060994_659_1123 | 148 |
| 785 | 3300037418 | Ga0395900_0283939 | Ga0395900_0283939_689_1168 | 148 |
| 786 | 3300037466 | Ga0395898_0086977 | Ga0395898_0086977_707_1186 | 148 |
| 787 | 3300037466 | Ga0395898_0123742 | Ga0395898_0123742_1304_1783 | 148 |
| 788 | 3300037471 | Ga0395905_0313980 | Ga0395905_0313980_568_1026 | 148 |
| 789 | 3300037471 | Ga0395905_0829320 | Ga0395905_0829320_272_736 | 148 |
| 790 | 3300037853 | Ga0436364_0828364 | Ga0436364_0828364_581_1030 | 148 |
| 791 | 3300038443 | Ga0395901_0101972 | Ga0395901_0101972_1826_2305 | 148 |
| 792 | 3300038443 | Ga0395901_0879661 | Ga0395901_0879661_355_834 | 148 |
| 793 | 3300038443 | Ga0395901_0909059 | Ga0395901_0909059_183_647 | 148 |
| 794 | 3300038996 | Ga0242420_069071 | Ga0242420_069071_116_577 | 148 |
| 795 | 3300039062 | Ga0400483_062723 | Ga0400483_062723_6043_6504 | 148 |
| 796 | 3300039437 | Ga0436365_1441610 | Ga0436365_1441610_142_588 | 148 |
| 797 | 3300039438 | Ga0436360_0735785 | Ga0436360_0735785_459_929 | 148 |
| 798 | 3300039447 | Ga0436361_0016812 | Ga0436361_0016812_64_528 | 148 |
| 799 | 3300039447 | Ga0436361_1001866 | Ga0436361_1001866_26942_27397 | 148 |
| 800 | 3300039450 | Ga0436363_0057851 | Ga0436363_0057851_290_736 | 148 |
| 801 | 3300039450 | Ga0436363_1627005 | Ga0436363_1627005_323_805 | 148 |
| 802 | 3300039450 | Ga0436363_1685778 | Ga0436363_1685778_70_537 | 148 |
| 803 | 3300039453 | Ga0436362_1235293 | Ga0436362_1235293_292_738 | 148 |
| 804 | 3300039453 | Ga0436362_1289189 | Ga0436362_1289189_114_563 | 148 |
| 805 | 3300041498 | Ga0451841_0404297 | Ga0451841_0404297_28_489 | 148 |
| 806 | 3300042005 | Ga0439448_0088266 | Ga0439448_0088266_425_889 | 148 |
| 807 | 3300042133 | Ga0450896_019627 | Ga0450896_019627_334_798 | 148 |
| 808 | 3300042156 | Ga0439446_0065351 | Ga0439446_0065351_230_676 | 148 |
| 809 | 3300042876 | Ga0451577_0002876 | Ga0451577_0002876_13785_14279 | 148 |
| 810 | 3300042876 | Ga0451577_0029071 | Ga0451577_0029071_389_853 | 148 |
| 811 | 3300042876 | Ga0451577_0031237 | Ga0451577_0031237_2888_3370 | 148 |
| 812 | 3300042876 | Ga0451577_0121174 | Ga0451577_0121174_370_834 | 148 |
| 813 | 3300042876 | Ga0451577_0595897 | Ga0451577_0595897_187_669 | 148 |
| 814 | 3300044673 | Ga0453683_0029861 | Ga0453683_0029861_727_1209 | 148 |
| 815 | 3300044712 | Ga0453684_0102090 | Ga0453684_0102090_2618_3100 | 148 |
| 816 | 3300044712 | Ga0453684_0242739 | Ga0453684_0242739_1112_1576 | 148 |
| 817 | 3300044712 | Ga0453684_0280256 | Ga0453684_0280256_163_657 | 148 |
| 818 | 3300044712 | Ga0453684_0576712 | Ga0453684_0576712_738_1208 | 148 |
| 819 | 3300044765 | Ga0466970_0803340 | Ga0466970_0803340_46_501 | 148 |
| 820 | 3300044842 | Ga0466957_0027436 | Ga0466957_0027436_1135_1596 | 148 |
| 821 | 3300044842 | Ga0466957_0784845 | Ga0466957_0784845_52_516 | 148 |
| 822 | 3300045051 | Ga0451576_0000056 | Ga0451576_0000056_17001_17465 | 148 |
| 823 | 3300045051 | Ga0451576_0029144 | Ga0451576_0029144_5154_5615 | 148 |
| 824 | 3300045051 | Ga0451576_0039821 | Ga0451576_0039821_3182_3676 | 148 |
| 825 | 3300045051 | Ga0451576_0068197 | Ga0451576_0068197_2089_2571 | 148 |
| 826 | 3300045976 | Ga0466967_1594568 | Ga0466967_1594568_76_540 | 148 |
| 827 | 3300045976 | Ga0466967_2195042 | Ga0466967_2195042_56_520 | 148 |
| 828 | 3300046454 | Ga0495592_0206736 | Ga0495592_0206736_295_741 | 148 |
| 829 | 3300046476 | Ga0495662_0109511 | Ga0495662_0109511_801_1247 | 148 |
| 830 | 3300046516 | Ga0495628_0275252 | Ga0495628_0275252_622_1068 | 148 |
| 831 | 3300046517 | Ga0495630_0424299 | Ga0495630_0424299_220_666 | 148 |
| 832 | 3300046530 | Ga0495654_0005887 | Ga0495654_0005887_714_1160 | 148 |
| 833 | 3300046535 | Ga0495586_0020552 | Ga0495586_0020552_702_1148 | 148 |
| 834 | 3300046557 | Ga0495622_0333363 | Ga0495622_0333363_88_549 | 148 |
| 835 | 3300046558 | Ga0495633_0063945 | Ga0495633_0063945_1071_1532 | 148 |
| 836 | 3300046559 | Ga0495667_0108182 | Ga0495667_0108182_377_823 | 148 |
| 837 | 3300046642 | Ga0495634_0257573 | Ga0495634_0257573_424_870 | 148 |
| 838 | 3300046660 | Ga0495625_0587722 | Ga0495625_0587722_44_490 | 148 |
| 839 | 3300046663 | Ga0495635_0259075 | Ga0495635_0259075_358_804 | 148 |
| 840 | 3300046665 | Ga0495661_0028858 | Ga0495661_0028858_2899_3345 | 148 |
| 841 | 3300046678 | Ga0495599_0060610 | Ga0495599_0060610_805_1251 | 148 |
| 842 | 3300046679 | Ga0495623_0418879 | Ga0495623_0418879_216_674 | 148 |
| 843 | 3300047322 | Ga0495680_0100507 | Ga0495680_0100507_1247_1693 | 148 |
| 844 | 3300047472 | Ga0495686_0000714 | Ga0495686_0000714_16045_16491 | 148 |
| 845 | 3300047472 | Ga0495686_0006789 | Ga0495686_0006789_1127_1573 | 148 |
| 846 | 3300048903 | Ga0496100_0337118 | Ga0496100_0337118_439_885 | 148 |
| 847 | 3300048904 | Ga0496101_0194386 | Ga0496101_0194386_459_905 | 148 |
| 848 | 3300048905 | Ga0496102_0007368 | Ga0496102_0007368_6632_7078 | 148 |
| 849 | 3300048905 | Ga0496102_0612634 | Ga0496102_0612634_270_734 | 148 |
| 850 | 3300048905 | Ga0496102_0777570 | Ga0496102_0777570_335_796 | 148 |
| 851 | 3300048906 | Ga0496103_0000788 | Ga0496103_0000788_11211_11657 | 148 |
| 852 | 3300048907 | Ga0496104_0097508 | Ga0496104_0097508_23_469 | 148 |
| 853 | 3300048908 | Ga0496105_0212657 | Ga0496105_0212657_531_977 | 148 |
| 854 | 3300048909 | Ga0496106_0196646 | Ga0496106_0196646_778_1224 | 148 |
| 855 | 3300048910 | Ga0496107_0095692 | Ga0496107_0095692_953_1414 | 148 |
| 856 | 3300048910 | Ga0496107_0207031 | Ga0496107_0207031_637_1083 | 148 |
| 857 | 3300048910 | Ga0496107_0388641 | Ga0496107_0388641_545_1009 | 148 |
| 858 | 3300048911 | Ga0496108_1182602 | Ga0496108_1182602_150_596 | 148 |
| 859 | 3300048913 | Ga0496110_0211728 | Ga0496110_0211728_308_769 | 148 |
| 860 | 3300048913 | Ga0496110_1115033 | Ga0496110_1115033_142_606 | 148 |
| 861 | 3300048914 | Ga0496111_0333017 | Ga0496111_0333017_340_786 | 148 |
| 862 | 3300048914 | Ga0496111_0984859 | Ga0496111_0984859_41_505 | 148 |
| 863 | 3300048915 | Ga0496112_0072810 | Ga0496112_0072810_616_1077 | 148 |
| 864 | 3300048915 | Ga0496112_0571208 | Ga0496112_0571208_171_632 | 148 |
| 865 | 3300048916 | Ga0496113_0210526 | Ga0496113_0210526_234_695 | 148 |
| 866 | 3300048919 | Ga0496116_0047680 | Ga0496116_0047680_235_681 | 148 |
| 867 | 3300048920 | Ga0496117_0015332 | Ga0496117_0015332_1220_1666 | 148 |
| 868 | 3300048921 | Ga0496118_0008568 | Ga0496118_0008568_5213_5659 | 148 |
| 869 | 3300048921 | Ga0496118_0030716 | Ga0496118_0030716_896_1348 | 148 |
| 870 | 3300048922 | Ga0496119_0069388 | Ga0496119_0069388_1175_1627 | 148 |
| 871 | 3300048922 | Ga0496119_0194678 | Ga0496119_0194678_371_817 | 148 |
| 872 | 3300048923 | Ga0496120_0016269 | Ga0496120_0016269_784_1236 | 148 |
| 873 | 3300048924 | Ga0496121_0132973 | Ga0496121_0132973_450_902 | 148 |
| 874 | 3300048924 | Ga0496121_0188375 | Ga0496121_0188375_80_526 | 148 |
| 875 | 3300048928 | Ga0496125_0054236 | Ga0496125_0054236_252_704 | 148 |
| 876 | 3300048929 | Ga0496126_1046555 | Ga0496126_1046555_30_482 | 148 |
| 877 | 3300049570 | Ga0501033_0075120 | Ga0501033_0075120_1554_2000 | 148 |
| 878 | 3300049576 | Ga0501040_0503660 | Ga0501040_0503660_282_746 | 148 |
| 879 | 3300049579 | Ga0501043_0343965 | Ga0501043_0343965_309_764 | 148 |
| 880 | 3300049582 | Ga0501048_0787818 | Ga0501048_0787818_56_517 | 148 |
| 881 | 3300049588 | Ga0501072_0396634 | Ga0501072_0396634_479_943 | 148 |
| 882 | 3300049591 | Ga0501075_0926471 | Ga0501075_0926471_91_555 | 148 |
| 883 | 3300049663 | Ga0501223_109255 | Ga0501223_109255_13_459 | 148 |
| 884 | 3300049686 | Ga0501257_000066 | Ga0501257_000066_12085_12531 | 148 |
| 885 | 3300049768 | Ga0501271_016163 | Ga0501271_016163_266_730 | 148 |
| 886 | 3300049823 | Ga0501044_0007795 | Ga0501044_0007795_5181_5654 | 148 |
| 887 | 3300049823 | Ga0501044_0235637 | Ga0501044_0235637_956_1411 | 148 |
| 888 | 3300050490 | nmdc:mga03n38_772589_c1 | nmdc:mga03n38_772589_c1_12_494 | 148 |
| 889 | 3300050492 | nmdc:mga0yw44_173595_c1 | nmdc:mga0yw44_173595_c1_424_906 | 148 |
| 890 | 3300050493 | nmdc:mga0k408_122761_c1 | nmdc:mga0k408_122761_c1_521_985 | 148 |
| 891 | 3300050493 | nmdc:mga0k408_307992_c1 | nmdc:mga0k408_307992_c1_91_555 | 148 |
| 892 | 3300050493 | nmdc:mga0k408_36927_c1 | nmdc:mga0k408_36927_c1_636_1094 | 148 |
| 893 | 3300050494 | nmdc:mga06z11_95817_c1 | nmdc:mga06z11_95817_c1_14_496 | 148 |
| 894 | 3300050495 | nmdc:mga04h51_8169_c1 | nmdc:mga04h51_8169_c1_705_1187 | 148 |
| 895 | 3300050507 | nmdc:mga05p37_1553459_c1 | nmdc:mga05p37_1553459_c1_48_509 | 148 |
| 896 | 3300050507 | nmdc:mga05p37_751_c1 | nmdc:mga05p37_751_c1_30216_30677 | 148 |
| 897 | 3300050508 | nmdc:mga09592_4545_c1 | nmdc:mga09592_4545_c1_3653_4117 | 148 |
| 898 | 3300050508 | nmdc:mga09592_9701_c1 | nmdc:mga09592_9701_c1_4116_4577 | 148 |
| 899 | 3300050509 | nmdc:mga0qj67_29711_c1 | nmdc:mga0qj67_29711_c1_2336_2800 | 148 |
| 900 | 3300050509 | nmdc:mga0qj67_624570_c1 | nmdc:mga0qj67_624570_c1_43_507 | 148 |
| 901 | 3300050509 | nmdc:mga0qj67_8300_c1 | nmdc:mga0qj67_8300_c1_5048_5509 | 148 |
| 902 | 3300050510 | nmdc:mga06r32_12823_c1 | nmdc:mga06r32_12823_c1_5802_6266 | 148 |
| 903 | 3300050510 | nmdc:mga06r32_22515_c1 | nmdc:mga06r32_22515_c1_1913_2374 | 148 |
| 904 | 3300050510 | nmdc:mga06r32_86156_c1 | nmdc:mga06r32_86156_c1_2312_2782 | 148 |
| 905 | 3300050510 | nmdc:mga06r32_93_c1 | nmdc:mga06r32_93_c1_52243_52707 | 148 |
| 906 | 3300050511 | nmdc:mga08y16_117424_c1 | nmdc:mga08y16_117424_c1_1351_1812 | 148 |
| 907 | 3300050511 | nmdc:mga08y16_206552_c1 | nmdc:mga08y16_206552_c1_1065_1529 | 148 |
| 908 | 3300050511 | nmdc:mga08y16_35897_c1 | nmdc:mga08y16_35897_c1_107_568 | 148 |
| 909 | 3300050512 | nmdc:mga0n895_802135_c1 | nmdc:mga0n895_802135_c1_238_702 | 148 |
| 910 | 3300050515 | nmdc:mga0a205_1193580_c1 | nmdc:mga0a205_1193580_c1_63_527 | 148 |
| 911 | 3300053077 | Ga0495601_0006748 | Ga0495601_0006748_4792_5238 | 148 |
| 912 | 3300053084 | Ga0495595_0039453 | Ga0495595_0039453_891_1337 | 148 |
| 913 | 3300053085 | Ga0495619_0096077 | Ga0495619_0096077_436_882 | 148 |
| 914 | 3300053096 | Ga0500641_0143401 | Ga0500641_0143401_296_832 | 148 |
| 915 | 3300053116 | Ga0500592_000681 | Ga0500592_000681_185_679 | 148 |
| 916 | 3300053136 | Ga0500559_0016256 | Ga0500559_0016256_1177_1641 | 148 |
| 917 | 3300053151 | Ga0500604_0026888 | Ga0500604_0026888_387_833 | 148 |
| 918 | 3300053157 | Ga0500624_000005 | Ga0500624_000005_182944_183405 | 148 |
| 919 | 3300053158 | Ga0500627_0000115 | Ga0500627_0000115_8782_9228 | 148 |
| 920 | 3300053177 | Ga0500636_0186712 | Ga0500636_0186712_129_605 | 148 |
| 921 | 3300059424 | Ga0590075_022764 | Ga0590075_022764_880_1341 | 148 |
| 922 | 3300061719 | Ga0466962_0330164 | Ga0466962_0330164_100_546 | 148 |
| 923 | 3300061734 | Ga0530510_0119479 | Ga0530510_0119479_532_996 | 148 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4f8b-assembly1.cif.gz_B-2 | crystal structure of the covalent thioimide intermediate of unimodular nitrile reductase quef | 0.928 | 21 | 133 |
| 5k0p-assembly1.cif.gz_B | crystal structure of the archaeosine synthase quef-like in the apo form | 0.918 | 34 | 131 |
| 6z89-assembly1.cif.gz_D-2 | human gtp cyclohydrolase i in complex with allosteric inhibitor | 0.9134 | 33 | 128 |
| 6z88-assembly1.cif.gz_J | human gtp cyclohydrolase i in complex with allosteric inhibitor | 0.9106 | 34 | 128 |
| 7alc-assembly1.cif.gz_B-2 | human gch-gfrp stimulatory complex | 0.9084 | 34 | 126 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2G081_22_166_3.30.1130.10 | Alpha Beta;2-Layer Sandwich;GTP Cyclohydrolase I, domain 2;GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain | 0.8994 | 9 | 131 | 3.30.1130.10 |
| 3rzpD02 | Alpha Beta;2-Layer Sandwich;GTP Cyclohydrolase I, domain 2;GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain | 0.8905 | 30 | 130 | 3.30.1130.10 |
| 1a8rA02 | Alpha Beta;2-Layer Sandwich;GTP Cyclohydrolase I, domain 2;GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain | 0.8606 | 22 | 128 | 3.30.1130.10 |
| af_A0A1D6DUT0_342_468_3.30.1130.10 | Alpha Beta;2-Layer Sandwich;GTP Cyclohydrolase I, domain 2;GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain | 0.8377 | 34 | 128 | 3.30.1130.10 |
| af_B4FH02_104_236_3.30.1130.10 | Alpha Beta;2-Layer Sandwich;GTP Cyclohydrolase I, domain 2;GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain | 0.8244 | 34 | 128 | 3.30.1130.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4Q2ZAY5-F1-model_v4 | PreQ(1) synthase (EC 1.7.1.13) | 0.9924 | 2 | 97 |
GO:0005737
GO:0008616 GO:0033739 |
| AF-Q9RNJ7-F1-model_v4 | NADPH-dependent 7-cyano-7-deazaguanine reductase (EC 1.7.1.13) (7-cyano-7-carbaguanine reductase) (NADPH-dependent nitrile oxidoreductase) (PreQ(0) reductase) | 0.9899 | 1 | 113 |
GO:0005737
GO:0006400 GO:0008616 GO:0033739 |
| AF-A0A2W6TH54-F1-model_v4 | NADPH-dependent 7-cyano-7-deazaguanine reductase (EC 1.7.1.13) (7-cyano-7-carbaguanine reductase) (NADPH-dependent nitrile oxidoreductase) (PreQ(0) reductase) | 0.9818 | 1 | 148 |
GO:0005737
GO:0006400 GO:0008616 GO:0033739 |
| AF-A0A1T5ASV7-F1-model_v4 | NADPH-dependent 7-cyano-7-deazaguanine reductase (EC 1.7.1.13) (7-cyano-7-carbaguanine reductase) (NADPH-dependent nitrile oxidoreductase) (PreQ(0) reductase) | 0.9817 | 20 | 148 |
GO:0005737
GO:0006400 GO:0008616 GO:0033739 |
| AF-A0A520IJI0-F1-model_v4 | PreQ(1) synthase (EC 1.7.1.13) | 0.9815 | 1 | 110 |
GO:0005737
GO:0008616 GO:0033739 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar