F485828

General Info

Members Datasets Scaffolds Average Seq Length
923 444 914 152

Family's Representative Sequence

Representative Sequence 3300025911|Ga0207654_10002810|Ga0207654_1000281010
Length 144
Sequence MDPLHLGRTSELPSSPEAATLDYVPNPRPGRLYLVRFAAPEFTSLCPVTGQPDFAHLVIDYAIVESKSLKLFLGSYRNHAAFHEDCTLGIAERLVEEMEPRWLRIGGYWYPRGGIPIDVFWQSGPPPEGLWLPDQGVAPYRGRG

Samples

Sample ID Description Type Environment
1 2643221733 Bosea sp. Root381 Isolate Unclassified
2 2643221734 Bosea sp. Root670 Isolate Unclassified
3 2818991467 Bosea vestrisii 3192 Isolate Unclassified
4 2841911363 Bosea caraganae RCAM04685 Isolate Nodule
5 2841917233 Bosea caraganae RCAM04680 Isolate Nodule
6 2885429604 Sphingomonas sp. WZY 27 Isolate Rhizosphere
7 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
8 2990265787 Sphingomonas sp. SORGH_AS802 Isolate Aerial Root
9 2993693658 Sphingomonas sp. SORGH_AS438 Isolate Aerial Root
10 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
11 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
12 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
13 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
14 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
15 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
16 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
17 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
18 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
19 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
20 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
21 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
22 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
23 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
24 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
25 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
26 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
27 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
28 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
29 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
30 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
31 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
32 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
33 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
34 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
35 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
36 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
37 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
38 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
39 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
40 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
41 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
42 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
43 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
44 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
45 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
46 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
47 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
48 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
49 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
50 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
51 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
52 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
53 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
54 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
55 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
56 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
57 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
58 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
59 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
60 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
61 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
62 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
63 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
64 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
65 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
66 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
67 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
68 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
69 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
70 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
71 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
72 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
73 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
74 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
75 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
76 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
77 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
78 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
79 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
80 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
81 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
82 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
83 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
84 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
85 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
86 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
87 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
88 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
89 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
90 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
91 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
92 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
93 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
94 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
95 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
96 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
97 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
98 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
99 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
100 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
101 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
102 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
103 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
104 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
105 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
106 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
107 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
108 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
109 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
110 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
111 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
112 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
113 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
114 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
115 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
116 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
117 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
118 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
119 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
120 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
121 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
122 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
123 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
124 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
125 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
126 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
127 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
128 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
129 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
130 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
131 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
132 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
133 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
134 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
135 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
136 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
137 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
138 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
139 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
140 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
141 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
142 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
143 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
144 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
145 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
146 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
147 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
149 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
150 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
151 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
152 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
153 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
154 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
212 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
216 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
217 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
218 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
219 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
220 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
221 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
222 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
223 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
224 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
225 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
226 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
227 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
228 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
229 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
230 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
231 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
232 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
233 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
234 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
235 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
236 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
237 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
238 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
239 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
240 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
241 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
242 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
243 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
244 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
245 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
246 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
247 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
248 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
249 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
250 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
251 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
252 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
253 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
254 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
255 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
256 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
257 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
258 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
259 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
260 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
261 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
262 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
263 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
264 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
265 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
266 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
267 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
268 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
269 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
270 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
271 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
272 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
273 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
274 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
275 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
276 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
277 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
278 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
279 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
280 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
281 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
282 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
283 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
284 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
285 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
286 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
287 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
288 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
289 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
290 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
291 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
292 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
293 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
294 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
295 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
296 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
297 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
298 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
299 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
300 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
301 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
302 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
303 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
304 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
305 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
306 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
307 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
308 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
309 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
310 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
311 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
312 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
313 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
314 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
315 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
316 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
317 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
318 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
319 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
320 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
321 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
322 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
323 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
324 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
325 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
326 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
327 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
328 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
329 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
330 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
331 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
332 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
333 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
334 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
335 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
336 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
337 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
338 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
339 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
340 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
341 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
342 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
343 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
344 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
345 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
346 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
347 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
348 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
349 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
350 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
351 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
352 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
353 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
354 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
355 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
356 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
357 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
358 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
359 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
360 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
361 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
362 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
363 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
364 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
365 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
366 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
367 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
368 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
369 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
370 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
371 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
372 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
373 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
374 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
375 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
376 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
377 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
378 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
379 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
380 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
381 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
382 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
383 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
384 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
385 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
386 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
387 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
388 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
389 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
390 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
391 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
392 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
393 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
394 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
395 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
396 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
397 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
398 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
399 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
400 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
401 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
402 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
403 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
404 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
405 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
406 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
407 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
408 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
409 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
410 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
411 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
412 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
413 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
414 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
415 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
416 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
417 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
418 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
419 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
420 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
421 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
422 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
423 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
424 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
425 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
426 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
427 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
428 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
429 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
430 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
431 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
432 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
433 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
434 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
435 3300053728 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 endosphere Metagenome Endosphere
436 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
437 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
438 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
439 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
440 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
441 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
442 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
443 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
444 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.92
Metatranscriptomes 0.11
Isolates 0.98

Biome Distribution

Category Percentage (%)
Aerial Root 0.22
Bulb 0
Endosphere 9.43
Nodule 0.22
Rhizoplane 4.33
Rhizosphere 81.04
Stem 0
Stem Tuber 0
Unclassified 4.77

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1000034 3300001904 Bacteria 23064
2 JGI24741J21665_1031856 3300001915 Bacteria 788
3 JGI24752J21851_1000458 3300001976 Bacteria 5505
4 JGI24739J22299_10002575 3300001989 Bacteria 6989
5 JGI24739J22299_10031232 3300001989 Bacteria 1841
6 JGI24737J22298_10065785 3300001990 Bacteria 1086
7 JGI24735J21928_10016828 3300002067 Bacteria 2264
8 JGI24735J21928_10098894 3300002067 Bacteria 838
9 JGI24748J21848_1000034 3300002074 Bacteria 74812
10 JGI24738J21930_10000114 3300002075 Bacteria 18967
11 JGI24738J21930_10034486 3300002075 Bacteria 1031
12 JGI24034J26672_10000018 3300002239 Bacteria 130180
13 JGI24742J22300_10046678 3300002244 Bacteria 779
14 JGI24751J29686_10030297 3300002459 Bacteria 1122
15 JGI25164J39214_1013956 3300002772 Bacteria 747
16 JGI25151J46595_10000038 3300003187 Bacteria 180430
17 Ga0055526_1000500 3300003771 Bacteria 31211
18 Ga0055526_1031178 3300003771 Bacteria 1535
19 Ga0055524_1000091 3300003775 Bacteria 113761
20 Ga0055524_1014261 3300003775 Bacteria 2955
21 Ga0055536_1001520 3300003781 Bacteria 13913
22 Ga0055528_1044668 3300003790 Bacteria 951
23 Ga0070690_100000008 3300005330 Bacteria 118441
24 Ga0070690_100038551 3300005330 Bacteria 3016
25 Ga0070670_100000042 3300005331 Bacteria 143266
26 Ga0070670_100005780 3300005331 Bacteria 10453
27 Ga0070670_100096794 3300005331 Bacteria 2539
28 Ga0070670_100096842 3300005331 Bacteria 2538
29 Ga0070677_10034874 3300005333 Bacteria 1946
30 Ga0070666_10000032 3300005335 Bacteria 129142
31 Ga0070666_10180284 3300005335 Bacteria 1481
32 Ga0070666_10211537 3300005335 Bacteria 1366
33 Ga0070680_100049496 3300005336 Bacteria 3426
34 Ga0070680_100128513 3300005336 Bacteria 2118
35 Ga0070680_100328182 3300005336 Bacteria 1299
36 Ga0070680_100588819 3300005336 Bacteria 954
37 Ga0070680_101053298 3300005336 Bacteria 703
38 Ga0070680_101520445 3300005336 Bacteria 580
39 Ga0070682_100044349 3300005337 Bacteria 2753
40 Ga0070660_100039885 3300005339 Bacteria 3570
41 Ga0070660_100122873 3300005339 Bacteria 2072
42 Ga0070689_100003709 3300005340 Bacteria 10213
43 Ga0070689_100021089 3300005340 Bacteria 4844
44 Ga0070691_10003404 3300005341 Bacteria 7154
45 Ga0070687_100018525 3300005343 Bacteria 3223
46 Ga0070687_100148008 3300005343 Bacteria 1375
47 Ga0070661_100090408 3300005344 Bacteria 2267
48 Ga0070661_100168477 3300005344 Bacteria 1662
49 Ga0070692_10182334 3300005345 Bacteria 1218
50 Ga0070668_100000274 3300005347 Bacteria 34084
51 Ga0070668_100000576 3300005347 Bacteria 24618
52 Ga0070668_100025796 3300005347 Bacteria 4458
53 Ga0070668_100054490 3300005347 Bacteria 3084
54 Ga0070668_100073534 3300005347 Bacteria 2665
55 Ga0070668_100087645 3300005347 Bacteria 2449
56 Ga0070668_100412195 3300005347 Bacteria 1155
57 Ga0070669_100000211 3300005353 Bacteria 48717
58 Ga0070669_100003446 3300005353 Bacteria 11398
59 Ga0070669_100861126 3300005353 Bacteria 773
60 Ga0070669_100926427 3300005353 Bacteria 745
61 Ga0070675_100000318 3300005354 Bacteria 32359
62 Ga0070671_100220342 3300005355 Bacteria 1610
63 Ga0070671_100658785 3300005355 Bacteria 907
64 Ga0070674_100007694 3300005356 Bacteria 6365
65 Ga0070674_100329627 3300005356 Bacteria 1226
66 Ga0070673_100056396 3300005364 Bacteria 3100
67 Ga0070688_100000278 3300005365 Bacteria 26547
68 Ga0070688_100078692 3300005365 Bacteria 2127
69 Ga0070659_100178217 3300005366 Bacteria 1743
70 Ga0070659_100529669 3300005366 Bacteria 1007
71 Ga0070667_100000152 3300005367 Bacteria 86556
72 Ga0070667_100009964 3300005367 Bacteria 7876
73 Ga0070667_100052643 3300005367 Bacteria 3436
74 Ga0070667_100818656 3300005367 Bacteria 865
75 Ga0070667_101973677 3300005367 Bacteria 550
76 Ga0070703_10434170 3300005406 Bacteria 578
77 Ga0070714_100104092 3300005435 Bacteria 2504
78 Ga0070714_100384567 3300005435 Bacteria 1324
79 Ga0070714_100856549 3300005435 Bacteria 881
80 Ga0070713_101633643 3300005436 Bacteria 625
81 Ga0070710_10567670 3300005437 Bacteria 786
82 Ga0070711_100061252 3300005439 Bacteria 2619
83 Ga0070711_100356676 3300005439 Bacteria 1177
84 Ga0070705_100036828 3300005440 Bacteria 2754
85 Ga0070705_100045966 3300005440 Bacteria 2515
86 Ga0070705_100214254 3300005440 Bacteria 1330
87 Ga0070700_100005755 3300005441 Bacteria 6578
88 Ga0070694_100227163 3300005444 Bacteria 1403
89 Ga0070708_102210372 3300005445 Bacteria 508
90 Ga0070663_100407695 3300005455 Bacteria 1112
91 Ga0070678_100123226 3300005456 Bacteria 2047
92 Ga0070662_100005437 3300005457 Bacteria 8135
93 Ga0070662_100066497 3300005457 Bacteria 2644
94 Ga0070662_100151577 3300005457 Bacteria 1805
95 Ga0070662_100154225 3300005457 Bacteria 1791
96 Ga0070662_100506176 3300005457 Bacteria 1008
97 Ga0070681_10014076 3300005458 Bacteria 7961
98 Ga0070681_10030742 3300005458 Bacteria 5389
99 Ga0070681_10041636 3300005458 Bacteria 4604
100 Ga0070681_10229958 3300005458 Bacteria 1769
101 Ga0070681_10487511 3300005458 Bacteria 1145
102 Ga0068867_100007408 3300005459 Bacteria 7760
103 Ga0070685_10000046 3300005466 Bacteria 73999
104 Ga0070706_100078812 3300005467 Bacteria 3050
105 Ga0070699_101395048 3300005518 Bacteria 643
106 Ga0070679_100026774 3300005530 Bacteria 5671
107 Ga0070679_100281383 3300005530 Bacteria 1616
108 Ga0070679_100537191 3300005530 Bacteria 1113
109 Ga0070679_100606486 3300005530 Bacteria 1038
110 Ga0070684_100016494 3300005535 Bacteria 6038
111 Ga0070684_100988247 3300005535 Bacteria 790
112 Ga0070697_100284636 3300005536 Bacteria 1419
113 Ga0068853_100163578 3300005539 Bacteria 2009
114 Ga0068853_100410391 3300005539 Bacteria 1269
115 Ga0068853_100458931 3300005539 Bacteria 1199
116 Ga0068853_100565972 3300005539 Bacteria 1077
117 Ga0068853_101193898 3300005539 Bacteria 734
118 Ga0070672_100092685 3300005543 Bacteria 2439
119 Ga0070672_101008875 3300005543 Bacteria 738
120 Ga0070686_100000030 3300005544 Bacteria 118308
121 Ga0070695_100011453 3300005545 Bacteria 5304
122 Ga0070695_100083595 3300005545 Bacteria 2115
123 Ga0070695_100961278 3300005545 Bacteria 693
124 Ga0070696_100514055 3300005546 Bacteria 955
125 Ga0070696_100553811 3300005546 Bacteria 922
126 Ga0070696_100804731 3300005546 Bacteria 774
127 Ga0070696_101194723 3300005546 Bacteria 642
128 Ga0070693_100011046 3300005547 Bacteria 4542
129 Ga0070693_100452526 3300005547 Bacteria 901
130 Ga0070665_100000056 3300005548 Bacteria 242622
131 Ga0070665_100003473 3300005548 Bacteria 16785
132 Ga0070704_100209537 3300005549 Bacteria 1578
133 Ga0070704_101749865 3300005549 Bacteria 575
134 Ga0068855_100037376 3300005563 Bacteria 5774
135 Ga0068855_100043532 3300005563 Bacteria 5318
136 Ga0068855_100184107 3300005563 Bacteria 2360
137 Ga0068855_100351476 3300005563 Bacteria 1624
138 Ga0068855_100408913 3300005563 Bacteria 1486
139 Ga0070664_100034473 3300005564 Bacteria 4246
140 Ga0070664_100432852 3300005564 Bacteria 1206
141 Ga0068857_100008220 3300005577 Bacteria 9019
142 Ga0068857_100010280 3300005577 Bacteria 8132
143 Ga0068857_100241386 3300005577 Bacteria 1654
144 Ga0068857_100280925 3300005577 Bacteria 1531
145 Ga0068857_100563182 3300005577 Bacteria 1074
146 Ga0068854_100077681 3300005578 Bacteria 2444
147 Ga0068854_100360305 3300005578 Bacteria 1193
148 Ga0068856_100097628 3300005614 Bacteria 2927
149 Ga0068856_100202593 3300005614 Bacteria 1999
150 Ga0068856_101153245 3300005614 Bacteria 792
151 Ga0068856_101973726 3300005614 Bacteria 594
152 Ga0070702_100167066 3300005615 Bacteria 1428
153 Ga0068852_100079878 3300005616 Bacteria 2898
154 Ga0068852_100268440 3300005616 Bacteria 1641
155 Ga0068852_100949643 3300005616 Bacteria 878
156 Ga0068859_100002159 3300005617 Bacteria 19984
157 Ga0068859_100003975 3300005617 Bacteria 15087
158 Ga0068859_100020980 3300005617 Bacteria 6558
159 Ga0068859_100161616 3300005617 Bacteria 2319
160 Ga0068864_100000245 3300005618 Bacteria 48553
161 Ga0068864_100001636 3300005618 Bacteria 18474
162 Ga0068864_100043422 3300005618 Bacteria 3849
163 Ga0068864_100058115 3300005618 Bacteria 3342
164 Ga0068864_100222676 3300005618 Bacteria 1741
165 Ga0068864_101647623 3300005618 Bacteria 646
166 Ga0068866_10037881 3300005718 Bacteria 2371
167 Ga0068861_100006545 3300005719 Bacteria 7948
168 Ga0068861_100450585 3300005719 Bacteria 1153
169 Ga0068861_100650806 3300005719 Bacteria 973
170 Ga0068851_10060087 3300005834 Bacteria 1945
171 Ga0068870_10308889 3300005840 Bacteria 1001
172 Ga0068863_100000065 3300005841 Bacteria 117925
173 Ga0068863_100000516 3300005841 Bacteria 39335
174 Ga0068863_100003234 3300005841 Bacteria 16132
175 Ga0068858_100000821 3300005842 Bacteria 32408
176 Ga0068858_100005370 3300005842 Bacteria 12561
177 Ga0068858_100035804 3300005842 Bacteria 4604
178 Ga0068858_100038866 3300005842 Bacteria 4414
179 Ga0068860_100000032 3300005843 Bacteria 251624
180 Ga0068860_100000132 3300005843 Bacteria 120657
181 Ga0068860_100000653 3300005843 Bacteria 40425
182 Ga0068860_100009274 3300005843 Bacteria 9782
183 Ga0068862_100000356 3300005844 Bacteria 49670
184 Ga0068862_100000638 3300005844 Bacteria 36283
185 Ga0068862_100005614 3300005844 Bacteria 10484
186 Ga0068862_100026325 3300005844 Bacteria 4889
187 Ga0068862_100070950 3300005844 Bacteria 3008
188 Ga0068862_100159574 3300005844 Bacteria 2012
189 Ga0068862_100197499 3300005844 Bacteria 1812
190 Ga0068862_100456420 3300005844 Bacteria 1205
191 Ga0068862_100565487 3300005844 Bacteria 1087
192 Ga0068862_100600347 3300005844 Bacteria 1057
193 Ga0068862_101121240 3300005844 Bacteria 782
194 Ga0081538_10177576 3300005981 Bacteria 917
195 Ga0081540_1055329 3300005983 Bacteria 1933
196 Ga0070717_10006289 3300006028 Bacteria 8722
197 Ga0070717_10533754 3300006028 Bacteria 1062
198 Ga0075368_10079600 3300006042 Bacteria 1332
199 Ga0075364_10003424 3300006051 Bacteria 9017
200 Ga0070716_100932721 3300006173 Bacteria 682
201 Ga0070712_100263270 3300006175 Bacteria 1382
202 Ga0075367_10011760 3300006178 Bacteria 4645
203 Ga0075367_10063393 3300006178 Bacteria 2209
204 Ga0075369_10494375 3300006186 Bacteria 581
205 Ga0075366_10114155 3300006195 Bacteria 1626
206 Ga0075366_10118768 3300006195 Bacteria 1593
207 Ga0097621_100441456 3300006237 Bacteria 1171
208 Ga0075370_10020138 3300006353 Bacteria 3643
209 Ga0075370_10061778 3300006353 Bacteria 2134
210 Ga0075370_10173999 3300006353 Bacteria 1266
211 Ga0075370_10574283 3300006353 Bacteria 682
212 Ga0068871_100088100 3300006358 Bacteria 2582
213 Ga0068871_100889370 3300006358 Bacteria 825
214 Ga0075428_100066407 3300006844 Bacteria 3949
215 Ga0075428_100102914 3300006844 Bacteria 3114
216 Ga0075428_100282668 3300006844 Bacteria 1785
217 Ga0075428_100335721 3300006844 Bacteria 1623
218 Ga0075428_100644051 3300006844 Bacteria 1130
219 Ga0075430_100008579 3300006846 Bacteria 8623
220 Ga0075430_100008751 3300006846 Bacteria 8542
221 Ga0075430_100034569 3300006846 Bacteria 4290
222 Ga0075430_100174590 3300006846 Bacteria 1788
223 Ga0075431_100055566 3300006847 Bacteria 4084
224 Ga0075431_100084807 3300006847 Bacteria 3270
225 Ga0075431_100124950 3300006847 Bacteria 2655
226 Ga0075431_100287958 3300006847 Bacteria 1662
227 Ga0075431_100655631 3300006847 Bacteria 1030
228 Ga0075431_102034268 3300006847 Bacteria 529
229 Ga0075433_10458406 3300006852 Bacteria 1123
230 Ga0075434_100214345 3300006871 Bacteria 1945
231 Ga0075434_101808012 3300006871 Bacteria 618
232 Ga0075429_100052398 3300006880 Bacteria 3550
233 Ga0075429_100424513 3300006880 Bacteria 1164
234 Ga0075429_101134592 3300006880 Bacteria 683
235 Ga0068865_100283651 3300006881 Bacteria 1319
236 Ga0097620_100002159 3300006931 Bacteria 19984
237 Ga0097620_100003975 3300006931 Bacteria 15087
238 Ga0097620_100020981 3300006931 Bacteria 6558
239 Ga0097620_100161615 3300006931 Bacteria 2319
240 Ga0097620_100676952 3300006931 Bacteria 1123
241 Ga0075435_100188539 3300007076 Bacteria 1745
242 Ga0075435_101505653 3300007076 Bacteria 590
243 Ga0105244_10252797 3300009036 Bacteria 821
244 Ga0105250_10097612 3300009092 Bacteria 1198
245 Ga0105240_10000671 3300009093 Bacteria 62794
246 Ga0105240_10018243 3300009093 Bacteria 9431
247 Ga0105240_10381121 3300009093 Bacteria 1593
248 Ga0105240_11121365 3300009093 Bacteria 836
249 Ga0111539_10589405 3300009094 Bacteria 1295
250 Ga0111539_10766970 3300009094 Bacteria 1122
251 Ga0111539_10837644 3300009094 Bacteria 1070
252 Ga0111539_10938887 3300009094 Bacteria 1006
253 Ga0111539_11004405 3300009094 Bacteria 970
254 Ga0111539_11617824 3300009094 Bacteria 751
255 Ga0105245_10076531 3300009098 Bacteria 3049
256 Ga0105245_10543610 3300009098 Bacteria 1183
257 Ga0105245_11464734 3300009098 Bacteria 733
258 Ga0105245_12329724 3300009098 Bacteria 589
259 Ga0105247_10035094 3300009101 Bacteria 3056
260 Ga0105247_10098873 3300009101 Bacteria 1863
261 Ga0105247_10652288 3300009101 Bacteria 786
262 Ga0114129_10000745 3300009147 Bacteria 41347
263 Ga0114129_10216471 3300009147 Bacteria 2586
264 Ga0114129_10375634 3300009147 Bacteria 1878
265 Ga0114129_10532586 3300009147 Bacteria 1530
266 Ga0114129_10793836 3300009147 Bacteria 1208
267 Ga0114129_10808146 3300009147 Bacteria 1196
268 Ga0105243_10391776 3300009148 Bacteria 1288
269 Ga0105243_10805468 3300009148 Bacteria 926
270 Ga0105241_10086169 3300009174 Bacteria 2470
271 Ga0105241_11644588 3300009174 Bacteria 622
272 Ga0105242_10194425 3300009176 Bacteria 1798
273 Ga0105242_10594840 3300009176 Bacteria 1068
274 Ga0105242_11101440 3300009176 Bacteria 808
275 Ga0105248_10003063 3300009177 Bacteria 18537
276 Ga0105248_10168892 3300009177 Bacteria 2465
277 Ga0105248_10218333 3300009177 Bacteria 2147
278 Ga0105248_10326716 3300009177 Bacteria 1728
279 Ga0105248_10629335 3300009177 Bacteria 1211
280 Ga0105248_12200769 3300009177 Bacteria 627
281 Ga0105237_10041422 3300009545 Bacteria 4644
282 Ga0105237_10072029 3300009545 Bacteria 3450
283 Ga0105237_11257466 3300009545 Bacteria 747
284 Ga0105238_10019049 3300009551 Bacteria 6992
285 Ga0105238_10022500 3300009551 Bacteria 6424
286 Ga0105238_10100629 3300009551 Bacteria 2873
287 Ga0105238_10168351 3300009551 Bacteria 2167
288 Ga0105238_10491129 3300009551 Bacteria 1228
289 Ga0105249_10000109 3300009553 Bacteria 112308
290 Ga0105249_10006288 3300009553 Bacteria 10316
291 Ga0105249_10040669 3300009553 Bacteria 4223
292 Ga0105249_10044880 3300009553 Bacteria 4019
293 Ga0105249_10768915 3300009553 Bacteria 1026
294 Ga0105249_11726440 3300009553 Bacteria 698
295 Ga0105239_10204065 3300010375 Bacteria 2215
296 Ga0105239_10529788 3300010375 Bacteria 1341
297 Ga0105239_10708147 3300010375 Bacteria 1151
298 Ga0105239_10724445 3300010375 Bacteria 1138
299 Ga0105239_12793220 3300010375 Bacteria 570
300 Ga0105246_10066374 3300011119 Bacteria 2526
301 Ga0105246_11071271 3300011119 Bacteria 734
302 Ga0157373_10136481 3300013100 Bacteria 1725
303 Ga0157373_10140232 3300013100 Bacteria 1700
304 Ga0157370_10087756 3300013104 Bacteria 2922
305 Ga0157370_10494797 3300013104 Bacteria 1123
306 Ga0157369_10402814 3300013105 Bacteria 1419
307 Ga0157369_10677775 3300013105 Bacteria 1062
308 Ga0171462_1033 3300013250 Bacteria 90238
309 Ga0157374_11980524 3300013296 Bacteria 609
310 Ga0163162_10077860 3300013306 Bacteria 3380
311 Ga0163162_10106902 3300013306 Bacteria 2893
312 Ga0163162_10170855 3300013306 Bacteria 2299
313 Ga0163162_10781695 3300013306 Bacteria 1073
314 Ga0163162_11298004 3300013306 Bacteria 827
315 Ga0157372_10104618 3300013307 Bacteria 3236
316 Ga0157372_10271507 3300013307 Bacteria 1971
317 Ga0157372_12649118 3300013307 Bacteria 575
318 Ga0157375_10007541 3300013308 Bacteria 9512
319 Ga0157375_10308033 3300013308 Bacteria 1748
320 Ga0163163_10000744 3300014325 Bacteria 27738
321 Ga0163163_10056749 3300014325 Bacteria 3870
322 Ga0163163_10371393 3300014325 Bacteria 1487
323 Ga0163163_11222863 3300014325 Bacteria 814
324 Ga0157380_10000599 3300014326 Bacteria 22227
325 Ga0157380_10403480 3300014326 Bacteria 1298
326 Ga0157380_10726379 3300014326 Bacteria 1001
327 Ga0157380_10726849 3300014326 Bacteria 1001
328 Ga0157377_10014975 3300014745 Bacteria 3954
329 Ga0157379_10005894 3300014968 Bacteria 10546
330 Ga0157379_10022792 3300014968 Bacteria 5549
331 Ga0157379_10713845 3300014968 Bacteria 942
332 Ga0157379_10893049 3300014968 Bacteria 843
333 Ga0163161_10000084 3300017792 Bacteria 93742
334 Ga0213873_10093913 3300021358 Bacteria 855
335 Ga0213872_10010483 3300021361 Bacteria 4409
336 Ga0213872_10037050 3300021361 Bacteria 2227
337 Ga0213875_10107095 3300021388 Bacteria 1305
338 Ga0213875_10176951 3300021388 Bacteria 1002
339 Ga0207672_1000296 3300025223 Bacteria 6734
340 Ga0209673_1016862 3300025273 Bacteria 2715
341 Ga0209676_1000343 3300025292 Bacteria 88398
342 Ga0209025_1000014 3300025294 Bacteria 865448
343 Ga0209025_1028265 3300025294 Bacteria 2755
344 Ga0209564_1000017 3300025295 Bacteria 594063
345 Ga0209564_1000150 3300025295 Bacteria 170318
346 Ga0209256_1000108 3300025299 Bacteria 185884
347 Ga0209256_1000338 3300025299 Bacteria 78064
348 Ga0209257_1124285 3300025304 Bacteria 599
349 Ga0207656_10074562 3300025321 Bacteria 1514
350 Ga0207692_10126826 3300025898 Bacteria 1436
351 Ga0207642_10004579 3300025899 Bacteria 4466
352 Ga0207642_10512501 3300025899 Bacteria 736
353 Ga0207710_10051986 3300025900 Bacteria 1842
354 Ga0207710_10327655 3300025900 Bacteria 777
355 Ga0207710_10552090 3300025900 Bacteria 600
356 Ga0207688_10010554 3300025901 Bacteria 5024
357 Ga0207680_10000009 3300025903 Bacteria 464571
358 Ga0207647_10000766 3300025904 Bacteria 25085
359 Ga0207647_10106875 3300025904 Bacteria 1656
360 Ga0207645_10568816 3300025907 Bacteria 769
361 Ga0207643_10093320 3300025908 Bacteria 1757
362 Ga0207705_10004861 3300025909 Bacteria 10087
363 Ga0207705_10105946 3300025909 Bacteria 2073
364 Ga0207705_10762507 3300025909 Bacteria 751
365 Ga0207684_10147688 3300025910 Bacteria 2022
366 Ga0207654_10000868 3300025911 Bacteria 16743
367 Ga0207654_10002810 3300025911 Bacteria 8833
368 Ga0207654_10184888 3300025911 Bacteria 1362
369 Ga0207654_10522774 3300025911 Bacteria 840
370 Ga0207707_10068274 3300025912 Bacteria 3097
371 Ga0207707_10114316 3300025912 Bacteria 2359
372 Ga0207707_10156135 3300025912 Bacteria 1996
373 Ga0207707_10222486 3300025912 Bacteria 1643
374 Ga0207707_10260687 3300025912 Bacteria 1504
375 Ga0207695_10000876 3300025913 Bacteria 54758
376 Ga0207695_10002095 3300025913 Bacteria 30360
377 Ga0207695_10003070 3300025913 Bacteria 23930
378 Ga0207695_10004968 3300025913 Bacteria 17901
379 Ga0207695_10146550 3300025913 Bacteria 2304
380 Ga0207695_10201215 3300025913 Bacteria 1906
381 Ga0207671_10006894 3300025914 Bacteria 10023
382 Ga0207671_10070299 3300025914 Bacteria 2609
383 Ga0207693_10011477 3300025915 Bacteria 7166
384 Ga0207693_10238743 3300025915 Bacteria 1427
385 Ga0207663_10076004 3300025916 Bacteria 2181
386 Ga0207663_10307577 3300025916 Bacteria 1187
387 Ga0207660_10059463 3300025917 Bacteria 2744
388 Ga0207660_10147324 3300025917 Bacteria 1805
389 Ga0207660_10196094 3300025917 Bacteria 1575
390 Ga0207660_11365648 3300025917 Bacteria 575
391 Ga0207662_10502415 3300025918 Bacteria 835
392 Ga0207657_10007686 3300025919 Bacteria 11017
393 Ga0207657_10040691 3300025919 Bacteria 4116
394 Ga0207657_10240877 3300025919 Bacteria 1444
395 Ga0207657_10612786 3300025919 Bacteria 849
396 Ga0207649_10157546 3300025920 Bacteria 1570
397 Ga0207652_10396289 3300025921 Bacteria 1246
398 Ga0207652_11190684 3300025921 Bacteria 663
399 Ga0207681_10000965 3300025923 Bacteria 18765
400 Ga0207681_10763842 3300025923 Bacteria 806
401 Ga0207694_10090258 3300025924 Bacteria 2417
402 Ga0207694_10125317 3300025924 Bacteria 2054
403 Ga0207694_10303669 3300025924 Bacteria 1314
404 Ga0207694_10559462 3300025924 Bacteria 960
405 Ga0207694_11323055 3300025924 Bacteria 609
406 Ga0207650_10000378 3300025925 Bacteria 41832
407 Ga0207650_10122997 3300025925 Bacteria 2022
408 Ga0207650_10186042 3300025925 Bacteria 1657
409 Ga0207650_10611152 3300025925 Bacteria 917
410 Ga0207659_10004912 3300025926 Bacteria 8098
411 Ga0207659_10182710 3300025926 Bacteria 1663
412 Ga0207687_10533384 3300025927 Bacteria 983
413 Ga0207687_10997577 3300025927 Bacteria 718
414 Ga0207700_10546791 3300025928 Bacteria 1028
415 Ga0207664_10151107 3300025929 Bacteria 1973
416 Ga0207644_10003709 3300025931 Bacteria 9897
417 Ga0207644_10103058 3300025931 Bacteria 2147
418 Ga0207644_10117953 3300025931 Bacteria 2016
419 Ga0207690_10137604 3300025932 Bacteria 1795
420 Ga0207690_10596165 3300025932 Bacteria 901
421 Ga0207706_10020148 3300025933 Bacteria 5993
422 Ga0207706_10040317 3300025933 Bacteria 4139
423 Ga0207706_10051223 3300025933 Bacteria 3646
424 Ga0207706_10501732 3300025933 Bacteria 1047
425 Ga0207706_10501733 3300025933 Bacteria 1047
426 Ga0207686_11170379 3300025934 Bacteria 629
427 Ga0207709_10525045 3300025935 Bacteria 927
428 Ga0207670_10022376 3300025936 Bacteria 3917
429 Ga0207670_10054735 3300025936 Bacteria 2693
430 Ga0207669_10301972 3300025937 Bacteria 1217
431 Ga0207691_10018446 3300025940 Bacteria 6612
432 Ga0207711_10004477 3300025941 Bacteria 11910
433 Ga0207711_10005259 3300025941 Bacteria 10973
434 Ga0207711_10043340 3300025941 Bacteria 3837
435 Ga0207711_10079035 3300025941 Bacteria 2870
436 Ga0207711_10106037 3300025941 Bacteria 2493
437 Ga0207711_10545579 3300025941 Bacteria 1081
438 Ga0207661_10904371 3300025944 Bacteria 813
439 Ga0207679_10013683 3300025945 Bacteria 5320
440 Ga0207679_10700207 3300025945 Bacteria 919
441 Ga0207667_10013251 3300025949 Bacteria 9450
442 Ga0207667_10041103 3300025949 Bacteria 4919
443 Ga0207667_10067709 3300025949 Bacteria 3719
444 Ga0207667_10202140 3300025949 Bacteria 2038
445 Ga0207667_10361064 3300025949 Bacteria 1481
446 Ga0207651_10028339 3300025960 Bacteria 3531
447 Ga0207712_10000046 3300025961 Bacteria 162468
448 Ga0207712_10014037 3300025961 Bacteria 5142
449 Ga0207668_10001618 3300025972 Bacteria 13153
450 Ga0207668_10011845 3300025972 Bacteria 5316
451 Ga0207668_10020444 3300025972 Bacteria 4206
452 Ga0207668_10021901 3300025972 Bacteria 4082
453 Ga0207668_10172515 3300025972 Bacteria 1697
454 Ga0207668_10440739 3300025972 Bacteria 1109
455 Ga0207668_10473346 3300025972 Bacteria 1073
456 Ga0207668_11144001 3300025972 Bacteria 698
457 Ga0207668_11219305 3300025972 Bacteria 676
458 Ga0207640_10101558 3300025981 Bacteria 2018
459 Ga0207658_10000189 3300025986 Bacteria 65788
460 Ga0207658_10000784 3300025986 Bacteria 27123
461 Ga0207658_10007593 3300025986 Bacteria 7388
462 Ga0207703_10000278 3300026035 Bacteria 56746
463 Ga0207703_10005251 3300026035 Bacteria 10446
464 Ga0207703_10023484 3300026035 Bacteria 4844
465 Ga0207703_11280694 3300026035 Bacteria 705
466 Ga0207639_10008983 3300026041 Bacteria 6881
467 Ga0207639_10321776 3300026041 Bacteria 1373
468 Ga0207639_10551073 3300026041 Bacteria 1059
469 Ga0207678_10014887 3300026067 Bacteria 6841
470 Ga0207678_10286350 3300026067 Bacteria 1415
471 Ga0207678_10476904 3300026067 Bacteria 1086
472 Ga0207708_10168093 3300026075 Bacteria 1735
473 Ga0207702_10001550 3300026078 Bacteria 22735
474 Ga0207702_10029757 3300026078 Bacteria 4545
475 Ga0207702_10452033 3300026078 Bacteria 1246
476 Ga0207641_10000063 3300026088 Bacteria 159283
477 Ga0207641_10000260 3300026088 Bacteria 66830
478 Ga0207641_10006925 3300026088 Bacteria 9488
479 Ga0207676_10000233 3300026095 Bacteria 48533
480 Ga0207676_10003249 3300026095 Bacteria 11573
481 Ga0207676_10048314 3300026095 Bacteria 3303
482 Ga0207676_10067629 3300026095 Bacteria 2854
483 Ga0207676_10104251 3300026095 Bacteria 2358
484 Ga0207676_10171124 3300026095 Bacteria 1893
485 Ga0207676_10253368 3300026095 Bacteria 1586
486 Ga0207674_10000811 3300026116 Bacteria 40585
487 Ga0207674_10005308 3300026116 Bacteria 15329
488 Ga0207674_10063883 3300026116 Bacteria 3714
489 Ga0207674_10329138 3300026116 Bacteria 1477
490 Ga0207674_10640391 3300026116 Bacteria 1026
491 Ga0207675_100000167 3300026118 Bacteria 58637
492 Ga0207675_100047567 3300026118 Bacteria 4005
493 Ga0207675_100667485 3300026118 Bacteria 1046
494 Ga0207675_100884716 3300026118 Bacteria 909
495 Ga0207683_10036937 3300026121 Bacteria 4254
496 Ga0207698_10018372 3300026142 Bacteria 4762
497 Ga0207698_10689508 3300026142 Bacteria 1015
498 Ga0207698_11296025 3300026142 Bacteria 743
499 Ga0207428_10128038 3300027907 Bacteria 1944
500 Ga0207428_10266497 3300027907 Bacteria 1275
501 Ga0268266_10000066 3300028379 Bacteria 242637
502 Ga0268266_10000805 3300028379 Bacteria 41604
503 Ga0268266_10209637 3300028379 Bacteria 1786
504 Ga0268266_10399807 3300028379 Bacteria 1299
505 Ga0268265_10000129 3300028380 Bacteria 96060
506 Ga0268265_10000445 3300028380 Bacteria 43689
507 Ga0268265_10003546 3300028380 Bacteria 11161
508 Ga0268265_10004220 3300028380 Bacteria 10038
509 Ga0268265_10004653 3300028380 Bacteria 9475
510 Ga0268265_10058315 3300028380 Bacteria 2947
511 Ga0268265_10169989 3300028380 Bacteria 1862
512 Ga0268265_10248731 3300028380 Bacteria 1573
513 Ga0268265_10544775 3300028380 Bacteria 1100
514 Ga0268264_10000045 3300028381 Bacteria 364764
515 Ga0268264_10000130 3300028381 Bacteria 181732
516 Ga0268264_10000248 3300028381 Bacteria 101501
517 Ga0268264_10007926 3300028381 Bacteria 8837
518 Ga0268264_10042602 3300028381 Bacteria 3758
519 Ga0268264_11105894 3300028381 Bacteria 801
520 Ga0265334_10006729 3300028573 Bacteria 4937
521 Ga0265318_10019261 3300028577 Bacteria 2770
522 Ga0307517_10374994 3300028786 Bacteria 763
523 Ga0265338_10022804 3300028800 Bacteria 6463
524 Ga0265338_10026178 3300028800 Bacteria 5894
525 Ga0265338_10026523 3300028800 Bacteria 5841
526 Ga0265338_10094210 3300028800 Bacteria 2464
527 Ga0265338_10119775 3300028800 Bacteria 2101
528 Ga0265338_10335903 3300028800 Bacteria 1090
529 Ga0307511_10005612 3300030521 Bacteria 12736
530 Ga0265760_10018652 3300031090 Bacteria 1998
531 Ga0265328_10004612 3300031239 Bacteria 5967
532 Ga0265320_10000765 3300031240 Bacteria 24662
533 Ga0265325_10058885 3300031241 Bacteria 1955
534 Ga0265340_10140923 3300031247 Bacteria 1103
535 Ga0265339_10376476 3300031249 Bacteria 666
536 Ga0265331_10000019 3300031250 Bacteria 258837
537 Ga0265327_10000928 3300031251 Bacteria 42902
538 Ga0265327_10488398 3300031251 Bacteria 531
539 Ga0307513_10075345 3300031456 Bacteria 3504
540 Ga0307408_100050214 3300031548 Bacteria 2999
541 Ga0307408_100102895 3300031548 Bacteria 2179
542 Ga0307408_100511061 3300031548 Bacteria 1053
543 Ga0307408_101094255 3300031548 Bacteria 739
544 Ga0265313_10000644 3300031595 Bacteria 35985
545 Ga0265313_10004334 3300031595 Bacteria 10976
546 Ga0307508_10742356 3300031616 Bacteria 594
547 Ga0316579_10006754 3300031691 Bacteria 4699
548 Ga0265314_10143936 3300031711 Bacteria 1470
549 Ga0265314_10159320 3300031711 Bacteria 1375
550 Ga0316576_10048037 3300031727 Bacteria 3093
551 Ga0316578_10002183 3300031728 Bacteria 8451
552 Ga0307516_10000002 3300031730 Bacteria 467851
553 Ga0307405_10152973 3300031731 Bacteria 1624
554 Ga0316577_10056675 3300031733 Bacteria 2187
555 Ga0307413_10108930 3300031824 Bacteria 1850
556 Ga0307406_10202447 3300031901 Bacteria 1462
557 Ga0307406_10333774 3300031901 Bacteria 1178
558 Ga0307406_10907461 3300031901 Bacteria 750
559 Ga0307406_11179754 3300031901 Bacteria 664
560 Ga0307412_10059815 3300031911 Bacteria 2555
561 Ga0307409_100044588 3300031995 Bacteria 3342
562 Ga0307416_100213800 3300032002 Bacteria 1842
563 Ga0307414_10051626 3300032004 Bacteria 2856
564 Ga0307414_10263254 3300032004 Bacteria 1440
565 Ga0307414_10562100 3300032004 Bacteria 1018
566 Ga0307414_11338820 3300032004 Bacteria 665
567 Ga0307411_10733024 3300032005 Bacteria 864
568 Ga0307411_10741506 3300032005 Bacteria 860
569 Ga0316585_10033052 3300032137 Bacteria 1631
570 Ga0316580_10021695 3300032139 Bacteria 1980
571 Ga0307510_10163086 3300033180 Bacteria 1822
572 Ga0373958_0027320 3300034819 Bacteria 1098
573 Ga0373938_0122792 3300034957 Bacteria 671
574 Ga0373928_0286993 3300035084 Bacteria 500
575 Ga0373940_0029440 3300035088 Bacteria 1455
576 Ga0373932_0324789 3300035112 Bacteria 580
577 Ga0373939_0017187 3300035114 Bacteria 1919
578 Ga0373941_0064254 3300035115 Bacteria 1202
579 Ga0373941_0086296 3300035115 Bacteria 1069
580 Ga0373953_0041532 3300035117 Bacteria 1830
581 Ga0373953_0195470 3300035117 Bacteria 874
582 Ga0373954_0004243 3300035118 Bacteria 6158
583 Ga0373956_0058473 3300035119 Bacteria 1743
584 Ga0373960_0067528 3300035121 Bacteria 1098
585 Ga0373942_0080996 3300035207 Bacteria 964
586 Ga0373942_0262969 3300035207 Bacteria 590
587 Ga0373962_0009228 3300035242 Bacteria 2439
588 Ga0316574_0010852 3300035398 Bacteria 5161
589 Ga0373924_0033263 3300035410 Bacteria 2081
590 Ga0373931_0058733 3300035691 Bacteria 2067
591 Ga0373931_0269096 3300035691 Bacteria 1042
592 Ga0373931_0524428 3300035691 Bacteria 767
593 Ga0373927_0077921 3300035695 Bacteria 2147
594 Ga0373933_0007330 3300035724 Bacteria 6018
595 Ga0373947_0539777 3300035725 Bacteria 793
596 Ga0373937_0312383 3300036401 Bacteria 1487
597 Ga0373937_1079723 3300036401 Bacteria 751
598 Ga0316582_0035297 3300036647 Bacteria 3086
599 Ga0316584_0066758 3300036712 Bacteria 2695
600 Ga0373925_0421645 3300037068 Bacteria 1090
601 Ga0395899_0000178 3300037312 Bacteria 93671
602 Ga0395899_0096936 3300037312 Bacteria 2132
603 Ga0395900_0001522 3300037418 Bacteria 27543
604 Ga0395900_0013620 3300037418 Bacteria 8304
605 Ga0395900_0060994 3300037418 Bacteria 3879
606 Ga0395900_0283939 3300037418 Bacteria 1646
607 Ga0395900_1138488 3300037418 Bacteria 697
608 Ga0395898_0006429 3300037466 Bacteria 12549
609 Ga0395898_0086977 3300037466 Bacteria 3011
610 Ga0395898_0123742 3300037466 Bacteria 2478
611 Ga0395905_0010228 3300037471 Bacteria 9143
612 Ga0395905_0313980 3300037471 Bacteria 1456
613 Ga0395905_0352779 3300037471 Bacteria 1363
614 Ga0395905_0757071 3300037471 Bacteria 874
615 Ga0395905_0829320 3300037471 Bacteria 827
616 Ga0436364_0252525 3300037853 Bacteria 644
617 Ga0436364_0740827 3300037853 Bacteria 1564
618 Ga0436364_0828364 3300037853 Bacteria 1404
619 Ga0395901_0000001 3300038443 Bacteria 800383
620 Ga0395901_0101972 3300038443 Bacteria 3011
621 Ga0395901_0879661 3300038443 Bacteria 879
622 Ga0395901_0909059 3300038443 Bacteria 862
623 Ga0242420_069071 3300038996 Bacteria 716
624 Ga0400483_062723 3300039062 Bacteria 13444
625 Ga0436365_0223789 3300039437 Bacteria 888
626 Ga0436365_1441610 3300039437 Bacteria 827
627 Ga0436365_1846196 3300039437 Bacteria 4881
628 Ga0436360_0091052 3300039438 Bacteria 514
629 Ga0436360_0343564 3300039438 Bacteria 632
630 Ga0436360_0735785 3300039438 Bacteria 1054
631 Ga0436361_0016812 3300039447 Bacteria 2234
632 Ga0436361_0205614 3300039447 Bacteria 1512
633 Ga0436361_0215284 3300039447 Bacteria 11054
634 Ga0436361_0540899 3300039447 Bacteria 1843
635 Ga0436361_0641214 3300039447 Bacteria 2667
636 Ga0436361_1001866 3300039447 Bacteria 37490
637 Ga0436363_0057851 3300039450 Bacteria 2194
638 Ga0436363_1627005 3300039450 Bacteria 917
639 Ga0436363_1685778 3300039450 Bacteria 2894
640 Ga0436362_1235293 3300039453 Bacteria 1270
641 Ga0436362_1289189 3300039453 Bacteria 592
642 Ga0451797_0790261 3300041453 Bacteria 697
643 Ga0451841_0404297 3300041498 Bacteria 504
644 Ga0439448_0088266 3300042005 Bacteria 1046
645 Ga0439454_018205 3300042011 Bacteria 1011
646 Ga0450896_019627 3300042133 Bacteria 985
647 Ga0439446_0065351 3300042156 Bacteria 1105
648 Ga0451577_0002876 3300042876 Bacteria 19794
649 Ga0451577_0029071 3300042876 Bacteria 4997
650 Ga0451577_0031237 3300042876 Bacteria 4807
651 Ga0451577_0121174 3300042876 Bacteria 2343
652 Ga0451577_0595897 3300042876 Bacteria 1003
653 Ga0453683_0029861 3300044673 Bacteria 3445
654 Ga0453684_0023503 3300044712 Bacteria 9071
655 Ga0453684_0102090 3300044712 Bacteria 3507
656 Ga0453684_0215293 3300044712 Bacteria 2229
657 Ga0453684_0242739 3300044712 Bacteria 2073
658 Ga0453684_0280256 3300044712 Bacteria 1901
659 Ga0453684_0576712 3300044712 Bacteria 1236
660 Ga0466970_0803340 3300044765 Bacteria 551
661 Ga0466957_0027436 3300044842 Bacteria 3384
662 Ga0466957_0784845 3300044842 Bacteria 676
663 Ga0466959_0605854 3300045049 Bacteria 737
664 Ga0451576_0000056 3300045051 Bacteria 303398
665 Ga0451576_0029144 3300045051 Bacteria 5907
666 Ga0451576_0039821 3300045051 Bacteria 4975
667 Ga0451576_0068197 3300045051 Bacteria 3702
668 Ga0466967_1311309 3300045976 Bacteria 721
669 Ga0466967_1594568 3300045976 Bacteria 650
670 Ga0466967_2195042 3300045976 Bacteria 548
671 Ga0495592_0206736 3300046454 Bacteria 1321
672 Ga0495603_0168385 3300046455 Bacteria 1269
673 Ga0495629_0022196 3300046459 Bacteria 4527
674 Ga0495662_0109511 3300046476 Bacteria 1353
675 Ga0495585_0124678 3300046492 Bacteria 1360
676 Ga0495620_0140607 3300046515 Bacteria 944
677 Ga0495628_0128507 3300046516 Bacteria 1940
678 Ga0495628_0275252 3300046516 Bacteria 1251
679 Ga0495630_0424299 3300046517 Bacteria 1019
680 Ga0495637_0071187 3300046520 Bacteria 1403
681 Ga0495642_0037897 3300046528 Bacteria 1952
682 Ga0495642_0315291 3300046528 Bacteria 686
683 Ga0495654_0005887 3300046530 Bacteria 7050
684 Ga0495640_0652127 3300046533 Bacteria 633
685 Ga0495586_0020552 3300046535 Bacteria 3516
686 Ga0495621_0081060 3300046539 Bacteria 1210
687 Ga0495597_0003221 3300046542 Bacteria 9707
688 Ga0495645_0689533 3300046543 Bacteria 621
689 Ga0495622_0002500 3300046557 Bacteria 8893
690 Ga0495622_0306511 3300046557 Bacteria 691
691 Ga0495622_0333363 3300046557 Bacteria 658
692 Ga0495633_0063945 3300046558 Bacteria 1720
693 Ga0495667_0108182 3300046559 Bacteria 1796
694 Ga0495668_0013371 3300046616 Bacteria 4844
695 Ga0495668_0076521 3300046616 Bacteria 1837
696 Ga0495668_0108122 3300046616 Bacteria 1521
697 Ga0495634_0257573 3300046642 Bacteria 1065
698 Ga0495625_0302633 3300046660 Bacteria 1023
699 Ga0495625_0587722 3300046660 Bacteria 670
700 Ga0495635_0259075 3300046663 Bacteria 1171
701 Ga0495659_0024676 3300046664 Bacteria 2052
702 Ga0495661_0028858 3300046665 Bacteria 3547
703 Ga0495657_0228395 3300046675 Bacteria 1127
704 Ga0495599_0060610 3300046678 Bacteria 2366
705 Ga0495623_0418879 3300046679 Bacteria 718
706 Ga0495624_0532169 3300046690 Bacteria 702
707 Ga0495649_0004932 3300046694 Bacteria 8606
708 Ga0495604_0647559 3300047317 Bacteria 674
709 Ga0495636_0481151 3300047318 Bacteria 599
710 Ga0495672_0003627 3300047320 Bacteria 13084
711 Ga0495680_0100507 3300047322 Bacteria 2155
712 Ga0495687_071455 3300047443 Bacteria 1390
713 Ga0495677_0018957 3300047445 Bacteria 2495
714 Ga0495673_0077190 3300047469 Bacteria 1388
715 Ga0495686_0000714 3300047472 Bacteria 44576
716 Ga0495686_0006789 3300047472 Bacteria 8687
717 Ga0495626_0068514 3300048091 Bacteria 1600
718 Ga0496100_0337118 3300048903 Bacteria 1136
719 Ga0496100_0699100 3300048903 Bacteria 791
720 Ga0496101_0194386 3300048904 Bacteria 1567
721 Ga0496102_0003691 3300048905 Bacteria 12946
722 Ga0496102_0007368 3300048905 Bacteria 9400
723 Ga0496102_0028391 3300048905 Bacteria 4997
724 Ga0496102_0171685 3300048905 Bacteria 2041
725 Ga0496102_0612634 3300048905 Bacteria 1012
726 Ga0496102_0777570 3300048905 Bacteria 880
727 Ga0496103_0000788 3300048906 Bacteria 23326
728 Ga0496103_0139244 3300048906 Bacteria 1551
729 Ga0496103_0764610 3300048906 Bacteria 610
730 Ga0496104_0021859 3300048907 Bacteria 5876
731 Ga0496104_0097508 3300048907 Bacteria 2814
732 Ga0496104_0548968 3300048907 Bacteria 1066
733 Ga0496105_0212657 3300048908 Bacteria 1576
734 Ga0496105_1107260 3300048908 Bacteria 588
735 Ga0496106_0001606 3300048909 Bacteria 16997
736 Ga0496106_0196646 3300048909 Bacteria 1604
737 Ga0496107_0095692 3300048910 Bacteria 2173
738 Ga0496107_0207031 3300048910 Bacteria 1458
739 Ga0496107_0334784 3300048910 Bacteria 1126
740 Ga0496107_0388641 3300048910 Bacteria 1038
741 Ga0496108_0114730 3300048911 Bacteria 2307
742 Ga0496108_0633786 3300048911 Bacteria 930
743 Ga0496108_1182602 3300048911 Bacteria 647
744 Ga0496109_0664271 3300048912 Bacteria 979
745 Ga0496110_0066827 3300048913 Bacteria 3180
746 Ga0496110_0211728 3300048913 Bacteria 1762
747 Ga0496110_0831696 3300048913 Bacteria 828
748 Ga0496110_1115033 3300048913 Bacteria 697
749 Ga0496111_0333017 3300048914 Bacteria 1124
750 Ga0496111_0984859 3300048914 Bacteria 605
751 Ga0496112_0072810 3300048915 Bacteria 3397
752 Ga0496112_0571208 3300048915 Bacteria 1064
753 Ga0496113_0210526 3300048916 Bacteria 1548
754 Ga0496113_0597502 3300048916 Bacteria 884
755 Ga0496115_0000536 3300048918 Bacteria 29579
756 Ga0496115_0701871 3300048918 Bacteria 795
757 Ga0496116_0047680 3300048919 Bacteria 2882
758 Ga0496117_0004665 3300048920 Bacteria 14901
759 Ga0496117_0015332 3300048920 Bacteria 6540
760 Ga0496117_0087861 3300048920 Bacteria 2013
761 Ga0496118_0008568 3300048921 Bacteria 10533
762 Ga0496118_0030716 3300048921 Bacteria 4474
763 Ga0496118_0075106 3300048921 Bacteria 2412
764 Ga0496118_0323765 3300048921 Bacteria 835
765 Ga0496119_0069388 3300048922 Bacteria 2071
766 Ga0496119_0194678 3300048922 Bacteria 1054
767 Ga0496119_0242397 3300048922 Bacteria 913
768 Ga0496120_0016269 3300048923 Bacteria 4866
769 Ga0496120_0122729 3300048923 Bacteria 1341
770 Ga0496120_0149851 3300048923 Bacteria 1174
771 Ga0496121_0000088 3300048924 Bacteria 219728
772 Ga0496121_0132973 3300048924 Bacteria 1858
773 Ga0496121_0188375 3300048924 Bacteria 1482
774 Ga0496122_0043757 3300048925 Bacteria 3504
775 Ga0496122_0171028 3300048925 Bacteria 1310
776 Ga0496123_0102774 3300048926 Bacteria 1657
777 Ga0496125_0054236 3300048928 Bacteria 3278
778 Ga0496126_1046555 3300048929 Bacteria 609
779 Ga0501033_0040738 3300049570 Bacteria 3468
780 Ga0501033_0075120 3300049570 Bacteria 2481
781 Ga0501034_0090456 3300049571 Bacteria 3058
782 Ga0501036_0546778 3300049572 Bacteria 962
783 Ga0501037_0101730 3300049573 Bacteria 2073
784 Ga0501037_0328641 3300049573 Bacteria 1058
785 Ga0501038_0362105 3300049574 Bacteria 1128
786 Ga0501039_0101877 3300049575 Bacteria 2241
787 Ga0501040_0153580 3300049576 Bacteria 1625
788 Ga0501040_0503660 3300049576 Bacteria 873
789 Ga0501040_1208853 3300049576 Bacteria 548
790 Ga0501041_0567699 3300049577 Bacteria 723
791 Ga0501043_0210056 3300049579 Bacteria 1509
792 Ga0501043_0343965 3300049579 Bacteria 1134
793 Ga0501043_0602130 3300049579 Bacteria 812
794 Ga0501046_0855519 3300049580 Bacteria 636
795 Ga0501047_0095488 3300049581 Bacteria 2852
796 Ga0501047_0401600 3300049581 Bacteria 1203
797 Ga0501048_0156096 3300049582 Bacteria 1614
798 Ga0501048_0787818 3300049582 Bacteria 683
799 Ga0501068_0226620 3300049584 Bacteria 1188
800 Ga0501069_0326865 3300049585 Bacteria 902
801 Ga0501070_0821166 3300049586 Bacteria 729
802 Ga0501072_0320206 3300049588 Bacteria 1232
803 Ga0501072_0396634 3300049588 Bacteria 1095
804 Ga0501074_0161439 3300049590 Bacteria 1601
805 Ga0501075_0926471 3300049591 Bacteria 662
806 Ga0501076_0895876 3300049592 Bacteria 731
807 Ga0501077_0082023 3300049593 Bacteria 2043
808 Ga0501223_109255 3300049663 Bacteria 576
809 Ga0501257_000066 3300049686 Bacteria 28746
810 Ga0501079_1077301 3300049741 Bacteria 633
811 Ga0501080_0156987 3300049742 Bacteria 2101
812 Ga0501080_0549889 3300049742 Bacteria 1028
813 Ga0501080_0868002 3300049742 Bacteria 788
814 Ga0501083_0053620 3300049744 Bacteria 2707
815 Ga0501271_016163 3300049768 Bacteria 838
816 Ga0501035_0225911 3300049822 Bacteria 1597
817 Ga0501044_0004477 3300049823 Bacteria 15619
818 Ga0501044_0007795 3300049823 Bacteria 11770
819 Ga0501044_0168639 3300049823 Bacteria 2162
820 Ga0501044_0235637 3300049823 Bacteria 1776
821 Ga0501044_0560397 3300049823 Bacteria 1039
822 Ga0501044_0844238 3300049823 Bacteria 793
823 Ga0501044_0946018 3300049823 Bacteria 735
824 Ga0501045_0014809 3300049824 Bacteria 5530
825 nmdc:mga03n38_772589_c1 3300050490 Bacteria 558
826 nmdc:mga00v17_7282_c1 3300050491 Bacteria 5896
827 nmdc:mga0yw44_169839_c1 3300050492 Bacteria 1431
828 nmdc:mga0yw44_173595_c1 3300050492 Bacteria 1416
829 nmdc:mga0k408_122761_c1 3300050493 Bacteria 1539
830 nmdc:mga0k408_139057_c1 3300050493 Bacteria 1444
831 nmdc:mga0k408_167388_c1 3300050493 Bacteria 1310
832 nmdc:mga0k408_307992_c1 3300050493 Bacteria 945
833 nmdc:mga0k408_36927_c1 3300050493 Bacteria 2804
834 nmdc:mga06z11_95817_c1 3300050494 Bacteria 1620
835 nmdc:mga04h51_8169_c1 3300050495 Bacteria 2793
836 nmdc:mga07m45_144800_c1 3300050496 Bacteria 1377
837 nmdc:mga07m45_23209_c1 3300050496 Bacteria 3390
838 nmdc:mga07m45_529836_c1 3300050496 Bacteria 682
839 nmdc:mga05p37_1553459_c1 3300050507 Bacteria 655
840 nmdc:mga05p37_751_c1 3300050507 Bacteria 35968
841 nmdc:mga09592_4545_c1 3300050508 Bacteria 11226
842 nmdc:mga09592_66500_c1 3300050508 Bacteria 3055
843 nmdc:mga09592_9701_c1 3300050508 Bacteria 7818
844 nmdc:mga0qj67_29711_c1 3300050509 Bacteria 4246
845 nmdc:mga0qj67_6214_c1 3300050509 Bacteria 8767
846 nmdc:mga0qj67_624570_c1 3300050509 Bacteria 861
847 nmdc:mga0qj67_8300_c1 3300050509 Bacteria 7701
848 nmdc:mga06r32_12823_c1 3300050510 Bacteria 7576
849 nmdc:mga06r32_22515_c1 3300050510 Bacteria 5826
850 nmdc:mga06r32_3190_c1 3300050510 Bacteria 14688
851 nmdc:mga06r32_86156_c1 3300050510 Bacteria 3063
852 nmdc:mga06r32_93_c1 3300050510 Bacteria 62195
853 nmdc:mga08y16_10831_c1 3300050511 Bacteria 9574
854 nmdc:mga08y16_117424_c1 3300050511 Bacteria 2769
855 nmdc:mga08y16_206552_c1 3300050511 Bacteria 2035
856 nmdc:mga08y16_35897_c1 3300050511 Bacteria 5207
857 nmdc:mga0n895_802135_c1 3300050512 Bacteria 932
858 nmdc:mga0a205_1193580_c1 3300050515 Bacteria 609
859 nmdc:mga0sz30_275686_c1 3300050516 Bacteria 749
860 Ga0495601_0006748 3300053077 Bacteria 6721
861 Ga0500635_0000373 3300053080 Bacteria 14034
862 Ga0500635_0001982 3300053080 Bacteria 5000
863 Ga0495595_0039453 3300053084 Bacteria 2154
864 Ga0495619_0017029 3300053085 Bacteria 4607
865 Ga0495619_0096077 3300053085 Bacteria 2011
866 Ga0500578_0201694 3300053086 Bacteria 1217
867 Ga0500643_000236 3300053087 Bacteria 51341
868 Ga0500647_0068120 3300053091 Bacteria 1712
869 Ga0500651_0033997 3300053093 Bacteria 3214
870 Ga0500566_0071812 3300053094 Bacteria 1942
871 Ga0500641_0000136 3300053096 Bacteria 27409
872 Ga0500641_0143401 3300053096 Bacteria 1032
873 Ga0500641_0346298 3300053096 Bacteria 598
874 Ga0500556_0018879 3300053104 Bacteria 2183
875 Ga0500562_002835 3300053108 Bacteria 4320
876 Ga0500562_041232 3300053108 Bacteria 1227
877 Ga0500569_001405 3300053109 Bacteria 4528
878 Ga0500592_000681 3300053116 Bacteria 5593
879 Ga0500593_178027 3300053117 Bacteria 793
880 Ga0500595_126635 3300053119 Bacteria 720
881 Ga0500608_000386 3300053122 Bacteria 16913
882 Ga0500614_002199 3300053123 Bacteria 4419
883 Ga0500655_008848 3300053133 Bacteria 1812
884 Ga0500655_010707 3300053133 Bacteria 1657
885 Ga0500559_0003632 3300053136 Bacteria 7547
886 Ga0500559_0016256 3300053136 Bacteria 3142
887 Ga0500559_0133597 3300053136 Bacteria 1160
888 Ga0500603_077386 3300053150 Bacteria 958
889 Ga0500604_0026888 3300053151 Bacteria 1662
890 Ga0500604_0196981 3300053151 Bacteria 692
891 Ga0500616_0030736 3300053153 Bacteria 2947
892 Ga0500622_0021192 3300053156 Bacteria 3451
893 Ga0500622_0066355 3300053156 Bacteria 1832
894 Ga0500622_0355112 3300053156 Bacteria 607
895 Ga0500624_000005 3300053157 Bacteria 187122
896 Ga0500627_0000115 3300053158 Bacteria 25685
897 Ga0500636_0067374 3300053177 Bacteria 2080
898 Ga0500636_0186712 3300053177 Bacteria 1108
899 Ga0500637_0001038 3300053178 Bacteria 11398
900 Ga0500637_0008727 3300053178 Bacteria 5127
901 Ga0500637_0137721 3300053178 Bacteria 1413
902 Ga0500657_096173 3300053728 Bacteria 1235
903 Ga0500625_065204 3300053729 Bacteria 1639
904 Ga0500645_000932 3300053730 Bacteria 16738
905 Ga0500645_005935 3300053730 Bacteria 4423
906 Ga0500656_046934 3300053732 Bacteria 619
907 Ga0500596_000098 3300053735 Bacteria 11930
908 Ga0501084_0093064 3300054114 Bacteria 2530
909 Ga0590075_022764 3300059424 Bacteria 1569
910 Ga0501082_0176599 3300060353 Bacteria 1857
911 Ga0466962_0261303 3300061719 Bacteria 852
912 Ga0466962_0330164 3300061719 Bacteria 757
913 Ga0530510_0119479 3300061734 Bacteria 1934
914 Ga0530510_0429037 3300061734 Bacteria 998

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300002772 JGI25164J39214_1013956 JGI25164J39214_10139562 129
2 3300045976 Ga0466967_1311309 Ga0466967_1311309_10_399 129
3 3300044712 Ga0453684_0023503 Ga0453684_0023503_7869_8330 138
4 3300025911 Ga0207654_10002810 Ga0207654_1000281010 144
5 3300035117 Ga0373953_0041532 Ga0373953_0041532_805_1239 144
6 3300035118 Ga0373954_0004243 Ga0373954_0004243_919_1353 144
7 3300035724 Ga0373933_0007330 Ga0373933_0007330_1923_2357 144
8 3300035725 Ga0373947_0539777 Ga0373947_0539777_199_633 144
9 3300046533 Ga0495640_0652127 Ga0495640_0652127_98_532 144
10 3300046675 Ga0495657_0228395 Ga0495657_0228395_394_828 144
11 3300047317 Ga0495604_0647559 Ga0495604_0647559_122_556 144
12 3300053085 Ga0495619_0017029 Ga0495619_0017029_3477_3911 144
13 iso_pu_bacteria 2885429604 2885429831 144
14 3300006195 Ga0075366_10118768 Ga0075366_101187682 145
15 3300006358 Ga0068871_100889370 Ga0068871_1008893702 145
16 3300009553 Ga0105249_10040669 Ga0105249_100406693 145
17 3300010375 Ga0105239_10724445 Ga0105239_107244452 145
18 3300011119 Ga0105246_10066374 Ga0105246_100663742 145
19 3300014326 Ga0157380_10726849 Ga0157380_107268492 145
20 3300021388 Ga0213875_10107095 Ga0213875_101070951 145
21 3300025934 Ga0207686_11170379 Ga0207686_111703792 145
22 3300028573 Ga0265334_10006729 Ga0265334_100067295 145
23 3300028786 Ga0307517_10374994 Ga0307517_103749941 145
24 3300028800 Ga0265338_10022804 Ga0265338_100228046 145
25 3300028800 Ga0265338_10026523 Ga0265338_100265231 145
26 3300028800 Ga0265338_10094210 Ga0265338_100942104 145
27 3300028800 Ga0265338_10335903 Ga0265338_103359031 145
28 3300031247 Ga0265340_10140923 Ga0265340_101409232 145
29 3300031251 Ga0265327_10000928 Ga0265327_1000092824 145
30 3300031711 Ga0265314_10143936 Ga0265314_101439362 145
31 3300031730 Ga0307516_10000002 Ga0307516_10000002320 145
32 3300034819 Ga0373958_0027320 Ga0373958_0027320_249_686 145
33 3300035084 Ga0373928_0286993 Ga0373928_0286993_19_456 145
34 3300035115 Ga0373941_0086296 Ga0373941_0086296_31_468 145
35 3300035691 Ga0373931_0058733 Ga0373931_0058733_1513_1950 145
36 3300036401 Ga0373937_0312383 Ga0373937_0312383_602_1054 145
37 3300037853 Ga0436364_0252525 Ga0436364_0252525_155_607 145
38 3300037853 Ga0436364_0740827 Ga0436364_0740827_855_1292 145
39 3300039437 Ga0436365_0223789 Ga0436365_0223789_392_829 145
40 3300048905 Ga0496102_0003691 Ga0496102_0003691_3018_3455 145
41 3300048906 Ga0496103_0139244 Ga0496103_0139244_939_1376 145
42 3300048907 Ga0496104_0021859 Ga0496104_0021859_1961_2398 145
43 3300048908 Ga0496105_1107260 Ga0496105_1107260_124_576 145
44 3300048909 Ga0496106_0001606 Ga0496106_0001606_8553_8990 145
45 3300049581 Ga0501047_0095488 Ga0501047_0095488_453_902 145
46 3300049823 Ga0501044_0168639 Ga0501044_0168639_251_700 145
47 3300050493 nmdc:mga0k408_167388_c1 nmdc:mga0k408_167388_c1_700_1149 145
48 3300005331 Ga0070670_100000042 Ga0070670_10000004226 146
49 3300005335 Ga0070666_10180284 Ga0070666_101802842 146
50 3300005336 Ga0070680_100128513 Ga0070680_1001285133 146
51 3300005336 Ga0070680_100328182 Ga0070680_1003281821 146
52 3300005341 Ga0070691_10003404 Ga0070691_100034046 146
53 3300005347 Ga0070668_100000274 Ga0070668_1000002746 146
54 3300005347 Ga0070668_100000576 Ga0070668_1000005764 146
55 3300005347 Ga0070668_100025796 Ga0070668_1000257962 146
56 3300005347 Ga0070668_100073534 Ga0070668_1000735342 146
57 3300005353 Ga0070669_100926427 Ga0070669_1009264271 146
58 3300005355 Ga0070671_100220342 Ga0070671_1002203422 146
59 3300005367 Ga0070667_100000152 Ga0070667_10000015252 146
60 3300005367 Ga0070667_100009964 Ga0070667_1000099643 146
61 3300005367 Ga0070667_100052643 Ga0070667_1000526434 146
62 3300005457 Ga0070662_100506176 Ga0070662_1005061762 146
63 3300005458 Ga0070681_10014076 Ga0070681_100140767 146
64 3300005458 Ga0070681_10487511 Ga0070681_104875112 146
65 3300005530 Ga0070679_100026774 Ga0070679_1000267742 146
66 3300005530 Ga0070679_100537191 Ga0070679_1005371912 146
67 3300005539 Ga0068853_100458931 Ga0068853_1004589312 146
68 3300005548 Ga0070665_100003473 Ga0070665_10000347312 146
69 3300005563 Ga0068855_100037376 Ga0068855_1000373766 146
70 3300005563 Ga0068855_100043532 Ga0068855_1000435324 146
71 3300005563 Ga0068855_100351476 Ga0068855_1003514761 146
72 3300005564 Ga0070664_100432852 Ga0070664_1004328521 146
73 3300005578 Ga0068854_100360305 Ga0068854_1003603052 146
74 3300005614 Ga0068856_100097628 Ga0068856_1000976283 146
75 3300005614 Ga0068856_100202593 Ga0068856_1002025933 146
76 3300005617 Ga0068859_100020980 Ga0068859_1000209804 146
77 3300005618 Ga0068864_100000245 Ga0068864_10000024540 146
78 3300005618 Ga0068864_100043422 Ga0068864_1000434224 146
79 3300005618 Ga0068864_100058115 Ga0068864_1000581152 146
80 3300005719 Ga0068861_100450585 Ga0068861_1004505852 146
81 3300005841 Ga0068863_100000516 Ga0068863_10000051629 146
82 3300005842 Ga0068858_100000821 Ga0068858_10000082110 146
83 3300005842 Ga0068858_100038866 Ga0068858_1000388661 146
84 3300005843 Ga0068860_100000032 Ga0068860_10000003222 146
85 3300005843 Ga0068860_100000653 Ga0068860_10000065333 146
86 3300005843 Ga0068860_100009274 Ga0068860_1000092747 146
87 3300005844 Ga0068862_100000638 Ga0068862_10000063812 146
88 3300005844 Ga0068862_100005614 Ga0068862_10000561411 146
89 3300005844 Ga0068862_100070950 Ga0068862_1000709501 146
90 3300005844 Ga0068862_100456420 Ga0068862_1004564201 146
91 3300005844 Ga0068862_101121240 Ga0068862_1011212401 146
92 3300006042 Ga0075368_10079600 Ga0075368_100796001 146
93 3300006051 Ga0075364_10003424 Ga0075364_100034242 146
94 3300006178 Ga0075367_10011760 Ga0075367_100117602 146
95 3300006186 Ga0075369_10494375 Ga0075369_104943751 146
96 3300006195 Ga0075366_10114155 Ga0075366_101141551 146
97 3300006353 Ga0075370_10020138 Ga0075370_100201383 146
98 3300006353 Ga0075370_10061778 Ga0075370_100617781 146
99 3300006353 Ga0075370_10574283 Ga0075370_105742831 146
100 3300006931 Ga0097620_100020981 Ga0097620_1000209817 146
101 3300009093 Ga0105240_10000671 Ga0105240_1000067161 146
102 3300009093 Ga0105240_10018243 Ga0105240_100182434 146
103 3300009093 Ga0105240_10381121 Ga0105240_103811211 146
104 3300009098 Ga0105245_10543610 Ga0105245_105436102 146
105 3300009101 Ga0105247_10035094 Ga0105247_100350944 146
106 3300009174 Ga0105241_10086169 Ga0105241_100861694 146
107 3300009176 Ga0105242_10594840 Ga0105242_105948401 146
108 3300009177 Ga0105248_10003063 Ga0105248_1000306310 146
109 3300009177 Ga0105248_10218333 Ga0105248_102183332 146
110 3300009177 Ga0105248_10629335 Ga0105248_106293352 146
111 3300009551 Ga0105238_10019049 Ga0105238_100190491 146
112 3300009551 Ga0105238_10022500 Ga0105238_1002250011 146
113 3300009553 Ga0105249_10006288 Ga0105249_100062883 146
114 3300009553 Ga0105249_10768915 Ga0105249_107689151 146
115 3300010375 Ga0105239_10204065 Ga0105239_102040653 146
116 3300010375 Ga0105239_12793220 Ga0105239_127932201 146
117 3300013104 Ga0157370_10494797 Ga0157370_104947972 146
118 3300013105 Ga0157369_10677775 Ga0157369_106777751 146
119 3300013296 Ga0157374_11980524 Ga0157374_119805241 146
120 3300013306 Ga0163162_10170855 Ga0163162_101708551 146
121 3300013306 Ga0163162_10781695 Ga0163162_107816952 146
122 3300013306 Ga0163162_11298004 Ga0163162_112980041 146
123 3300013307 Ga0157372_10104618 Ga0157372_101046182 146
124 3300013308 Ga0157375_10308033 Ga0157375_103080332 146
125 3300014325 Ga0163163_10056749 Ga0163163_100567493 146
126 3300014326 Ga0157380_10726379 Ga0157380_107263791 146
127 3300014968 Ga0157379_10005894 Ga0157379_100058943 146
128 3300014968 Ga0157379_10713845 Ga0157379_107138453 146
129 3300014968 Ga0157379_10893049 Ga0157379_108930491 146
130 3300025900 Ga0207710_10327655 Ga0207710_103276551 146
131 3300025909 Ga0207705_10105946 Ga0207705_101059462 146
132 3300025911 Ga0207654_10184888 Ga0207654_101848882 146
133 3300025912 Ga0207707_10068274 Ga0207707_100682742 146
134 3300025912 Ga0207707_10260687 Ga0207707_102606871 146
135 3300025913 Ga0207695_10000876 Ga0207695_1000087641 146
136 3300025913 Ga0207695_10002095 Ga0207695_1000209519 146
137 3300025913 Ga0207695_10004968 Ga0207695_1000496811 146
138 3300025913 Ga0207695_10146550 Ga0207695_101465502 146
139 3300025917 Ga0207660_10059463 Ga0207660_100594631 146
140 3300025917 Ga0207660_10196094 Ga0207660_101960942 146
141 3300025919 Ga0207657_10240877 Ga0207657_102408772 146
142 3300025921 Ga0207652_10396289 Ga0207652_103962891 146
143 3300025923 Ga0207681_10763842 Ga0207681_107638421 146
144 3300025924 Ga0207694_10090258 Ga0207694_100902583 146
145 3300025924 Ga0207694_10303669 Ga0207694_103036691 146
146 3300025924 Ga0207694_11323055 Ga0207694_113230552 146
147 3300025925 Ga0207650_10000378 Ga0207650_1000037827 146
148 3300025931 Ga0207644_10103058 Ga0207644_101030583 146
149 3300025933 Ga0207706_10051223 Ga0207706_100512232 146
150 3300025941 Ga0207711_10005259 Ga0207711_100052594 146
151 3300025941 Ga0207711_10043340 Ga0207711_100433402 146
152 3300025941 Ga0207711_10079035 Ga0207711_100790351 146
153 3300025941 Ga0207711_10545579 Ga0207711_105455792 146
154 3300025949 Ga0207667_10041103 Ga0207667_100411033 146
155 3300025949 Ga0207667_10202140 Ga0207667_102021401 146
156 3300025972 Ga0207668_10001618 Ga0207668_100016185 146
157 3300025972 Ga0207668_10011845 Ga0207668_100118454 146
158 3300025972 Ga0207668_10020444 Ga0207668_100204445 146
159 3300025972 Ga0207668_10172515 Ga0207668_101725152 146
160 3300025986 Ga0207658_10000189 Ga0207658_1000018944 146
161 3300025986 Ga0207658_10007593 Ga0207658_100075934 146
162 3300026035 Ga0207703_10000278 Ga0207703_1000027843 146
163 3300026041 Ga0207639_10321776 Ga0207639_103217761 146
164 3300026078 Ga0207702_10029757 Ga0207702_100297573 146
165 3300026078 Ga0207702_10452033 Ga0207702_104520331 146
166 3300026088 Ga0207641_10000260 Ga0207641_1000026059 146
167 3300026095 Ga0207676_10000233 Ga0207676_1000023336 146
168 3300026095 Ga0207676_10048314 Ga0207676_100483145 146
169 3300026095 Ga0207676_10104251 Ga0207676_101042512 146
170 3300026095 Ga0207676_10253368 Ga0207676_102533683 146
171 3300026118 Ga0207675_100047567 Ga0207675_1000475672 146
172 3300026118 Ga0207675_100884716 Ga0207675_1008847161 146
173 3300028379 Ga0268266_10000805 Ga0268266_1000080530 146
174 3300028380 Ga0268265_10000445 Ga0268265_1000044535 146
175 3300028380 Ga0268265_10004220 Ga0268265_1000422010 146
176 3300028380 Ga0268265_10004653 Ga0268265_100046535 146
177 3300028380 Ga0268265_10058315 Ga0268265_100583153 146
178 3300028381 Ga0268264_10000045 Ga0268264_10000045330 146
179 3300028381 Ga0268264_10000248 Ga0268264_1000024838 146
180 3300028381 Ga0268264_10007926 Ga0268264_100079265 146
181 3300028800 Ga0265338_10026178 Ga0265338_100261787 146
182 3300030521 Ga0307511_10005612 Ga0307511_100056127 146
183 3300031090 Ga0265760_10018652 Ga0265760_100186522 146
184 3300031251 Ga0265327_10488398 Ga0265327_104883981 146
185 3300031995 Ga0307409_100044588 Ga0307409_1000445882 146
186 3300032004 Ga0307414_10051626 Ga0307414_100516261 146
187 3300035121 Ga0373960_0067528 Ga0373960_0067528_384_830 146
188 3300035242 Ga0373962_0009228 Ga0373962_0009228_1881_2327 146
189 3300035691 Ga0373931_0269096 Ga0373931_0269096_55_501 146
190 3300037312 Ga0395899_0000178 Ga0395899_0000178_23310_23765 146
191 3300037418 Ga0395900_0001522 Ga0395900_0001522_18484_18939 146
192 3300037466 Ga0395898_0006429 Ga0395898_0006429_4682_5137 146
193 3300037471 Ga0395905_0010228 Ga0395905_0010228_4810_5265 146
194 3300037471 Ga0395905_0352779 Ga0395905_0352779_227_682 146
195 3300037471 Ga0395905_0757071 Ga0395905_0757071_219_674 146
196 3300038443 Ga0395901_0000001 Ga0395901_0000001_34316_34771 146
197 3300039437 Ga0436365_1846196 Ga0436365_1846196_2994_3449 146
198 3300039438 Ga0436360_0091052 Ga0436360_0091052_28_495 146
199 3300039438 Ga0436360_0343564 Ga0436360_0343564_62_511 146
200 3300041453 Ga0451797_0790261 Ga0451797_0790261_73_543 146
201 3300044712 Ga0453684_0215293 Ga0453684_0215293_483_923 146
202 3300045049 Ga0466959_0605854 Ga0466959_0605854_25_480 146
203 3300046459 Ga0495629_0022196 Ga0495629_0022196_572_1027 146
204 3300046492 Ga0495585_0124678 Ga0495585_0124678_849_1304 146
205 3300046515 Ga0495620_0140607 Ga0495620_0140607_310_765 146
206 3300046516 Ga0495628_0128507 Ga0495628_0128507_1409_1864 146
207 3300046520 Ga0495637_0071187 Ga0495637_0071187_896_1351 146
208 3300046528 Ga0495642_0315291 Ga0495642_0315291_45_500 146
209 3300046539 Ga0495621_0081060 Ga0495621_0081060_504_959 146
210 3300046542 Ga0495597_0003221 Ga0495597_0003221_2231_2686 146
211 3300046543 Ga0495645_0689533 Ga0495645_0689533_108_563 146
212 3300046557 Ga0495622_0306511 Ga0495622_0306511_53_508 146
213 3300046616 Ga0495668_0013371 Ga0495668_0013371_3195_3650 146
214 3300046616 Ga0495668_0076521 Ga0495668_0076521_407_862 146
215 3300046616 Ga0495668_0108122 Ga0495668_0108122_259_714 146
216 3300046660 Ga0495625_0302633 Ga0495625_0302633_300_755 146
217 3300046664 Ga0495659_0024676 Ga0495659_0024676_1305_1760 146
218 3300046690 Ga0495624_0532169 Ga0495624_0532169_131_586 146
219 3300047318 Ga0495636_0481151 Ga0495636_0481151_86_541 146
220 3300047443 Ga0495687_071455 Ga0495687_071455_255_761 146
221 3300047445 Ga0495677_0018957 Ga0495677_0018957_990_1445 146
222 3300048903 Ga0496100_0699100 Ga0496100_0699100_58_513 146
223 3300048905 Ga0496102_0028391 Ga0496102_0028391_558_1013 146
224 3300048905 Ga0496102_0171685 Ga0496102_0171685_454_909 146
225 3300048906 Ga0496103_0764610 Ga0496103_0764610_42_497 146
226 3300048907 Ga0496104_0548968 Ga0496104_0548968_117_572 146
227 3300048910 Ga0496107_0334784 Ga0496107_0334784_553_1008 146
228 3300048911 Ga0496108_0114730 Ga0496108_0114730_769_1224 146
229 3300048911 Ga0496108_0633786 Ga0496108_0633786_120_575 146
230 3300048912 Ga0496109_0664271 Ga0496109_0664271_318_773 146
231 3300048913 Ga0496110_0066827 Ga0496110_0066827_1734_2189 146
232 3300048916 Ga0496113_0597502 Ga0496113_0597502_124_579 146
233 3300048918 Ga0496115_0000536 Ga0496115_0000536_2049_2504 146
234 3300048918 Ga0496115_0701871 Ga0496115_0701871_313_768 146
235 3300048920 Ga0496117_0004665 Ga0496117_0004665_5296_5751 146
236 3300048921 Ga0496118_0075106 Ga0496118_0075106_690_1145 146
237 3300048922 Ga0496119_0242397 Ga0496119_0242397_346_801 146
238 3300048923 Ga0496120_0122729 Ga0496120_0122729_466_921 146
239 3300048924 Ga0496121_0000088 Ga0496121_0000088_150403_150858 146
240 3300049570 Ga0501033_0040738 Ga0501033_0040738_1105_1560 146
241 3300049574 Ga0501038_0362105 Ga0501038_0362105_347_802 146
242 3300049576 Ga0501040_1208853 Ga0501040_1208853_70_525 146
243 3300049579 Ga0501043_0602130 Ga0501043_0602130_301_756 146
244 3300049581 Ga0501047_0401600 Ga0501047_0401600_724_1179 146
245 3300049823 Ga0501044_0004477 Ga0501044_0004477_5451_5906 146
246 3300049823 Ga0501044_0946018 Ga0501044_0946018_221_676 146
247 3300050491 nmdc:mga00v17_7282_c1 nmdc:mga00v17_7282_c1_4585_5040 146
248 3300050493 nmdc:mga0k408_139057_c1 nmdc:mga0k408_139057_c1_137_592 146
249 3300050496 nmdc:mga07m45_23209_c1 nmdc:mga07m45_23209_c1_2064_2519 146
250 3300050496 nmdc:mga07m45_529836_c1 nmdc:mga07m45_529836_c1_212_667 146
251 3300053080 Ga0500635_0000373 Ga0500635_0000373_13270_13776 146
252 3300053086 Ga0500578_0201694 Ga0500578_0201694_721_1176 146
253 3300053087 Ga0500643_000236 Ga0500643_000236_22123_22578 146
254 3300053091 Ga0500647_0068120 Ga0500647_0068120_378_884 146
255 3300053093 Ga0500651_0033997 Ga0500651_0033997_2621_3076 146
256 3300053094 Ga0500566_0071812 Ga0500566_0071812_811_1266 146
257 3300053096 Ga0500641_0000136 Ga0500641_0000136_22084_22539 146
258 3300053096 Ga0500641_0346298 Ga0500641_0346298_90_545 146
259 3300053104 Ga0500556_0018879 Ga0500556_0018879_1479_1934 146
260 3300053108 Ga0500562_002835 Ga0500562_002835_1004_1459 146
261 3300053108 Ga0500562_041232 Ga0500562_041232_172_627 146
262 3300053109 Ga0500569_001405 Ga0500569_001405_2411_2866 146
263 3300053117 Ga0500593_178027 Ga0500593_178027_216_671 146
264 3300053119 Ga0500595_126635 Ga0500595_126635_224_679 146
265 3300053122 Ga0500608_000386 Ga0500608_000386_8480_8935 146
266 3300053123 Ga0500614_002199 Ga0500614_002199_645_1100 146
267 3300053133 Ga0500655_010707 Ga0500655_010707_325_780 146
268 3300053136 Ga0500559_0003632 Ga0500559_0003632_6456_6911 146
269 3300053136 Ga0500559_0133597 Ga0500559_0133597_55_561 146
270 3300053150 Ga0500603_077386 Ga0500603_077386_319_825 146
271 3300053151 Ga0500604_0196981 Ga0500604_0196981_208_663 146
272 3300053153 Ga0500616_0030736 Ga0500616_0030736_1975_2430 146
273 3300053156 Ga0500622_0021192 Ga0500622_0021192_761_1216 146
274 3300053156 Ga0500622_0066355 Ga0500622_0066355_909_1364 146
275 3300053156 Ga0500622_0355112 Ga0500622_0355112_113_568 146
276 3300053177 Ga0500636_0067374 Ga0500636_0067374_268_774 146
277 3300053178 Ga0500637_0008727 Ga0500637_0008727_4238_4693 146
278 3300053178 Ga0500637_0137721 Ga0500637_0137721_254_760 146
279 3300053728 Ga0500657_096173 Ga0500657_096173_219_674 146
280 3300053729 Ga0500625_065204 Ga0500625_065204_1062_1517 146
281 3300053730 Ga0500645_000932 Ga0500645_000932_5168_5662 146
282 3300053730 Ga0500645_005935 Ga0500645_005935_874_1329 146
283 3300053732 Ga0500656_046934 Ga0500656_046934_82_537 146
284 3300053735 Ga0500596_000098 Ga0500596_000098_5186_5641 146
285 3300003187 JGI25151J46595_10000038 JGI25151J46595_10000038152 147
286 3300003771 Ga0055526_1000500 Ga0055526_100050021 147
287 3300003771 Ga0055526_1031178 Ga0055526_10311782 147
288 3300003775 Ga0055524_1000091 Ga0055524_100009188 147
289 3300003775 Ga0055524_1014261 Ga0055524_10142613 147
290 3300003790 Ga0055528_1044668 Ga0055528_10446683 147
291 3300005440 Ga0070705_100214254 Ga0070705_1002142542 147
292 3300005844 Ga0068862_100159574 Ga0068862_1001595742 147
293 3300006237 Ga0097621_100441456 Ga0097621_1004414563 147
294 3300006353 Ga0075370_10173999 Ga0075370_101739992 147
295 3300006844 Ga0075428_100282668 Ga0075428_1002826682 147
296 3300006846 Ga0075430_100008751 Ga0075430_1000087517 147
297 3300006847 Ga0075431_100287958 Ga0075431_1002879582 147
298 3300009094 Ga0111539_10837644 Ga0111539_108376442 147
299 3300009176 Ga0105242_11101440 Ga0105242_111014402 147
300 3300013250 Ga0171462_1033 Ga0171462_103381 147
301 3300021361 Ga0213872_10010483 Ga0213872_100104833 147
302 3300021361 Ga0213872_10037050 Ga0213872_100370503 147
303 3300025273 Ga0209673_1016862 Ga0209673_10168623 147
304 3300025294 Ga0209025_1000014 Ga0209025_1000014146 147
305 3300025294 Ga0209025_1028265 Ga0209025_10282653 147
306 3300025295 Ga0209564_1000017 Ga0209564_1000017505 147
307 3300025295 Ga0209564_1000150 Ga0209564_100015056 147
308 3300025299 Ga0209256_1000108 Ga0209256_100010856 147
309 3300025299 Ga0209256_1000338 Ga0209256_100033841 147
310 3300025304 Ga0209257_1124285 Ga0209257_11242851 147
311 3300025907 Ga0207645_10568816 Ga0207645_105688161 147
312 3300025927 Ga0207687_10997577 Ga0207687_109975772 147
313 3300026067 Ga0207678_10286350 Ga0207678_102863502 147
314 3300027907 Ga0207428_10128038 Ga0207428_101280382 147
315 3300028380 Ga0268265_10248731 Ga0268265_102487311 147
316 3300031239 Ga0265328_10004612 Ga0265328_100046123 147
317 3300031240 Ga0265320_10000765 Ga0265320_1000076519 147
318 3300031250 Ga0265331_10000019 Ga0265331_10000019228 147
319 3300031548 Ga0307408_100050214 Ga0307408_1000502141 147
320 3300031595 Ga0265313_10000644 Ga0265313_1000064412 147
321 3300031901 Ga0307406_10333774 Ga0307406_103337742 147
322 3300031901 Ga0307406_10907461 Ga0307406_109074612 147
323 3300031911 Ga0307412_10059815 Ga0307412_100598153 147
324 3300032004 Ga0307414_11338820 Ga0307414_113388202 147
325 3300035088 Ga0373940_0029440 Ga0373940_0029440_220_678 147
326 3300035114 Ga0373939_0017187 Ga0373939_0017187_1144_1602 147
327 3300035115 Ga0373941_0064254 Ga0373941_0064254_12_470 147
328 3300035207 Ga0373942_0080996 Ga0373942_0080996_63_521 147
329 3300037418 Ga0395900_1138488 Ga0395900_1138488_36_482 147
330 3300039447 Ga0436361_0205614 Ga0436361_0205614_156_608 147
331 3300039447 Ga0436361_0215284 Ga0436361_0215284_1798_2250 147
332 3300039447 Ga0436361_0540899 Ga0436361_0540899_307_759 147
333 3300039447 Ga0436361_0641214 Ga0436361_0641214_1470_1922 147
334 3300042011 Ga0439454_018205 Ga0439454_018205_490_951 147
335 3300046455 Ga0495603_0168385 Ga0495603_0168385_351_809 147
336 3300046528 Ga0495642_0037897 Ga0495642_0037897_1235_1693 147
337 3300046557 Ga0495622_0002500 Ga0495622_0002500_215_673 147
338 3300046694 Ga0495649_0004932 Ga0495649_0004932_7059_7517 147
339 3300047320 Ga0495672_0003627 Ga0495672_0003627_6920_7378 147
340 3300047469 Ga0495673_0077190 Ga0495673_0077190_349_807 147
341 3300048091 Ga0495626_0068514 Ga0495626_0068514_669_1127 147
342 3300048913 Ga0496110_0831696 Ga0496110_0831696_201_662 147
343 3300048920 Ga0496117_0087861 Ga0496117_0087861_1478_1933 147
344 3300048921 Ga0496118_0323765 Ga0496118_0323765_36_491 147
345 3300048923 Ga0496120_0149851 Ga0496120_0149851_270_725 147
346 3300048925 Ga0496122_0043757 Ga0496122_0043757_1169_1624 147
347 3300048925 Ga0496122_0171028 Ga0496122_0171028_168_623 147
348 3300048926 Ga0496123_0102774 Ga0496123_0102774_725_1180 147
349 3300049571 Ga0501034_0090456 Ga0501034_0090456_1116_1571 147
350 3300049572 Ga0501036_0546778 Ga0501036_0546778_427_888 147
351 3300049573 Ga0501037_0101730 Ga0501037_0101730_258_713 147
352 3300049573 Ga0501037_0328641 Ga0501037_0328641_494_961 147
353 3300049575 Ga0501039_0101877 Ga0501039_0101877_1175_1636 147
354 3300049576 Ga0501040_0153580 Ga0501040_0153580_166_627 147
355 3300049577 Ga0501041_0567699 Ga0501041_0567699_221_688 147
356 3300049579 Ga0501043_0210056 Ga0501043_0210056_998_1465 147
357 3300049580 Ga0501046_0855519 Ga0501046_0855519_97_558 147
358 3300049582 Ga0501048_0156096 Ga0501048_0156096_191_658 147
359 3300049584 Ga0501068_0226620 Ga0501068_0226620_593_1060 147
360 3300049585 Ga0501069_0326865 Ga0501069_0326865_176_637 147
361 3300049586 Ga0501070_0821166 Ga0501070_0821166_224_691 147
362 3300049588 Ga0501072_0320206 Ga0501072_0320206_592_1053 147
363 3300049590 Ga0501074_0161439 Ga0501074_0161439_113_574 147
364 3300049592 Ga0501076_0895876 Ga0501076_0895876_190_651 147
365 3300049593 Ga0501077_0082023 Ga0501077_0082023_770_1237 147
366 3300049741 Ga0501079_1077301 Ga0501079_1077301_38_505 147
367 3300049742 Ga0501080_0156987 Ga0501080_0156987_1297_1746 147
368 3300049742 Ga0501080_0549889 Ga0501080_0549889_513_974 147
369 3300049742 Ga0501080_0868002 Ga0501080_0868002_151_618 147
370 3300049744 Ga0501083_0053620 Ga0501083_0053620_448_915 147
371 3300049822 Ga0501035_0225911 Ga0501035_0225911_698_1153 147
372 3300049823 Ga0501044_0560397 Ga0501044_0560397_299_751 147
373 3300049823 Ga0501044_0844238 Ga0501044_0844238_210_677 147
374 3300049824 Ga0501045_0014809 Ga0501045_0014809_2087_2554 147
375 3300050492 nmdc:mga0yw44_169839_c1 nmdc:mga0yw44_169839_c1_774_1229 147
376 3300050496 nmdc:mga07m45_144800_c1 nmdc:mga07m45_144800_c1_734_1189 147
377 3300050508 nmdc:mga09592_66500_c1 nmdc:mga09592_66500_c1_2294_2755 147
378 3300050509 nmdc:mga0qj67_6214_c1 nmdc:mga0qj67_6214_c1_2337_2798 147
379 3300050510 nmdc:mga06r32_3190_c1 nmdc:mga06r32_3190_c1_5430_5891 147
380 3300050511 nmdc:mga08y16_10831_c1 nmdc:mga08y16_10831_c1_1407_1868 147
381 3300050516 nmdc:mga0sz30_275686_c1 nmdc:mga0sz30_275686_c1_22_477 147
382 3300053080 Ga0500635_0001982 Ga0500635_0001982_4271_4729 147
383 3300053133 Ga0500655_008848 Ga0500655_008848_367_825 147
384 3300053178 Ga0500637_0001038 Ga0500637_0001038_9795_10253 147
385 3300054114 Ga0501084_0093064 Ga0501084_0093064_1544_2011 147
386 3300060353 Ga0501082_0176599 Ga0501082_0176599_172_621 147
387 3300061719 Ga0466962_0261303 Ga0466962_0261303_349_804 147
388 3300061734 Ga0530510_0429037 Ga0530510_0429037_28_489 147
389 iso_pu_bacteria 2643221733 2644729398 147
390 iso_pu_bacteria 2643221734 2644735544 147
391 iso_pu_bacteria 2818991467 2819718005 147
392 iso_pu_bacteria 2841911363 2841916457 147
393 iso_pu_bacteria 2841917233 2841922354 147
394 iso_pu_bacteria 2917699015 2917700534 147
395 iso_pu_bacteria 2990265787 2990268225 147
396 iso_pu_bacteria 2993693658 2993696748 147
397 3300001904 JGI24736J21556_1000034 JGI24736J21556_10000343 148
398 3300001915 JGI24741J21665_1031856 JGI24741J21665_10318561 148
399 3300001976 JGI24752J21851_1000458 JGI24752J21851_10004586 148
400 3300001989 JGI24739J22299_10002575 JGI24739J22299_100025755 148
401 3300001989 JGI24739J22299_10031232 JGI24739J22299_100312322 148
402 3300001990 JGI24737J22298_10065785 JGI24737J22298_100657852 148
403 3300002067 JGI24735J21928_10016828 JGI24735J21928_100168282 148
404 3300002067 JGI24735J21928_10098894 JGI24735J21928_100988942 148
405 3300002074 JGI24748J21848_1000034 JGI24748J21848_100003427 148
406 3300002075 JGI24738J21930_10000114 JGI24738J21930_1000011417 148
407 3300002075 JGI24738J21930_10034486 JGI24738J21930_100344862 148
408 3300002239 JGI24034J26672_10000018 JGI24034J26672_1000001833 148
409 3300002244 JGI24742J22300_10046678 JGI24742J22300_100466782 148
410 3300002459 JGI24751J29686_10030297 JGI24751J29686_100302972 148
411 3300003781 Ga0055536_1001520 Ga0055536_10015202 148
412 3300005330 Ga0070690_100000008 Ga0070690_10000000834 148
413 3300005330 Ga0070690_100038551 Ga0070690_1000385514 148
414 3300005331 Ga0070670_100005780 Ga0070670_10000578012 148
415 3300005331 Ga0070670_100096794 Ga0070670_1000967943 148
416 3300005331 Ga0070670_100096842 Ga0070670_1000968422 148
417 3300005333 Ga0070677_10034874 Ga0070677_100348741 148
418 3300005335 Ga0070666_10000032 Ga0070666_1000003289 148
419 3300005335 Ga0070666_10211537 Ga0070666_102115373 148
420 3300005336 Ga0070680_100049496 Ga0070680_1000494964 148
421 3300005336 Ga0070680_100588819 Ga0070680_1005888192 148
422 3300005336 Ga0070680_101053298 Ga0070680_1010532981 148
423 3300005336 Ga0070680_101520445 Ga0070680_1015204451 148
424 3300005337 Ga0070682_100044349 Ga0070682_1000443494 148
425 3300005339 Ga0070660_100039885 Ga0070660_1000398853 148
426 3300005339 Ga0070660_100122873 Ga0070660_1001228732 148
427 3300005340 Ga0070689_100003709 Ga0070689_10000370912 148
428 3300005340 Ga0070689_100021089 Ga0070689_1000210891 148
429 3300005343 Ga0070687_100018525 Ga0070687_1000185252 148
430 3300005343 Ga0070687_100148008 Ga0070687_1001480082 148
431 3300005344 Ga0070661_100090408 Ga0070661_1000904082 148
432 3300005344 Ga0070661_100168477 Ga0070661_1001684772 148
433 3300005345 Ga0070692_10182334 Ga0070692_101823343 148
434 3300005347 Ga0070668_100054490 Ga0070668_1000544902 148
435 3300005347 Ga0070668_100087645 Ga0070668_1000876452 148
436 3300005347 Ga0070668_100412195 Ga0070668_1004121952 148
437 3300005353 Ga0070669_100000211 Ga0070669_10000021141 148
438 3300005353 Ga0070669_100003446 Ga0070669_1000034469 148
439 3300005353 Ga0070669_100861126 Ga0070669_1008611262 148
440 3300005354 Ga0070675_100000318 Ga0070675_10000031814 148
441 3300005355 Ga0070671_100658785 Ga0070671_1006587852 148
442 3300005356 Ga0070674_100007694 Ga0070674_1000076942 148
443 3300005356 Ga0070674_100329627 Ga0070674_1003296273 148
444 3300005364 Ga0070673_100056396 Ga0070673_1000563962 148
445 3300005365 Ga0070688_100000278 Ga0070688_1000002785 148
446 3300005365 Ga0070688_100078692 Ga0070688_1000786921 148
447 3300005366 Ga0070659_100178217 Ga0070659_1001782171 148
448 3300005366 Ga0070659_100529669 Ga0070659_1005296692 148
449 3300005367 Ga0070667_100818656 Ga0070667_1008186562 148
450 3300005367 Ga0070667_101973677 Ga0070667_1019736771 148
451 3300005406 Ga0070703_10434170 Ga0070703_104341701 148
452 3300005435 Ga0070714_100104092 Ga0070714_1001040923 148
453 3300005435 Ga0070714_100384567 Ga0070714_1003845671 148
454 3300005435 Ga0070714_100856549 Ga0070714_1008565491 148
455 3300005436 Ga0070713_101633643 Ga0070713_1016336431 148
456 3300005437 Ga0070710_10567670 Ga0070710_105676702 148
457 3300005439 Ga0070711_100061252 Ga0070711_1000612523 148
458 3300005439 Ga0070711_100356676 Ga0070711_1003566762 148
459 3300005440 Ga0070705_100036828 Ga0070705_1000368283 148
460 3300005440 Ga0070705_100045966 Ga0070705_1000459662 148
461 3300005441 Ga0070700_100005755 Ga0070700_1000057551 148
462 3300005444 Ga0070694_100227163 Ga0070694_1002271633 148
463 3300005445 Ga0070708_102210372 Ga0070708_1022103721 148
464 3300005455 Ga0070663_100407695 Ga0070663_1004076952 148
465 3300005456 Ga0070678_100123226 Ga0070678_1001232262 148
466 3300005457 Ga0070662_100005437 Ga0070662_1000054374 148
467 3300005457 Ga0070662_100066497 Ga0070662_1000664972 148
468 3300005457 Ga0070662_100151577 Ga0070662_1001515773 148
469 3300005457 Ga0070662_100154225 Ga0070662_1001542253 148
470 3300005458 Ga0070681_10030742 Ga0070681_100307422 148
471 3300005458 Ga0070681_10041636 Ga0070681_100416362 148
472 3300005458 Ga0070681_10229958 Ga0070681_102299582 148
473 3300005459 Ga0068867_100007408 Ga0068867_1000074086 148
474 3300005466 Ga0070685_10000046 Ga0070685_100000468 148
475 3300005467 Ga0070706_100078812 Ga0070706_1000788124 148
476 3300005518 Ga0070699_101395048 Ga0070699_1013950481 148
477 3300005530 Ga0070679_100281383 Ga0070679_1002813833 148
478 3300005530 Ga0070679_100606486 Ga0070679_1006064862 148
479 3300005535 Ga0070684_100016494 Ga0070684_1000164944 148
480 3300005535 Ga0070684_100988247 Ga0070684_1009882472 148
481 3300005536 Ga0070697_100284636 Ga0070697_1002846362 148
482 3300005539 Ga0068853_100163578 Ga0068853_1001635783 148
483 3300005539 Ga0068853_100410391 Ga0068853_1004103912 148
484 3300005539 Ga0068853_100565972 Ga0068853_1005659722 148
485 3300005539 Ga0068853_101193898 Ga0068853_1011938981 148
486 3300005543 Ga0070672_100092685 Ga0070672_1000926852 148
487 3300005543 Ga0070672_101008875 Ga0070672_1010088752 148
488 3300005544 Ga0070686_100000030 Ga0070686_10000003091 148
489 3300005545 Ga0070695_100011453 Ga0070695_1000114533 148
490 3300005545 Ga0070695_100083595 Ga0070695_1000835952 148
491 3300005545 Ga0070695_100961278 Ga0070695_1009612781 148
492 3300005546 Ga0070696_100514055 Ga0070696_1005140551 148
493 3300005546 Ga0070696_100553811 Ga0070696_1005538111 148
494 3300005546 Ga0070696_100804731 Ga0070696_1008047311 148
495 3300005546 Ga0070696_101194723 Ga0070696_1011947231 148
496 3300005547 Ga0070693_100011046 Ga0070693_1000110465 148
497 3300005547 Ga0070693_100452526 Ga0070693_1004525262 148
498 3300005548 Ga0070665_100000056 Ga0070665_100000056161 148
499 3300005549 Ga0070704_100209537 Ga0070704_1002095372 148
500 3300005549 Ga0070704_101749865 Ga0070704_1017498651 148
501 3300005563 Ga0068855_100184107 Ga0068855_1001841073 148
502 3300005563 Ga0068855_100408913 Ga0068855_1004089133 148
503 3300005564 Ga0070664_100034473 Ga0070664_1000344734 148
504 3300005577 Ga0068857_100008220 Ga0068857_1000082204 148
505 3300005577 Ga0068857_100010280 Ga0068857_1000102808 148
506 3300005577 Ga0068857_100241386 Ga0068857_1002413862 148
507 3300005577 Ga0068857_100280925 Ga0068857_1002809252 148
508 3300005577 Ga0068857_100563182 Ga0068857_1005631822 148
509 3300005578 Ga0068854_100077681 Ga0068854_1000776814 148
510 3300005614 Ga0068856_101153245 Ga0068856_1011532452 148
511 3300005614 Ga0068856_101973726 Ga0068856_1019737261 148
512 3300005615 Ga0070702_100167066 Ga0070702_1001670662 148
513 3300005616 Ga0068852_100079878 Ga0068852_1000798785 148
514 3300005616 Ga0068852_100268440 Ga0068852_1002684402 148
515 3300005616 Ga0068852_100949643 Ga0068852_1009496432 148
516 3300005617 Ga0068859_100002159 Ga0068859_10000215918 148
517 3300005617 Ga0068859_100003975 Ga0068859_10000397519 148
518 3300005617 Ga0068859_100161616 Ga0068859_1001616162 148
519 3300005618 Ga0068864_100001636 Ga0068864_1000016362 148
520 3300005618 Ga0068864_100222676 Ga0068864_1002226762 148
521 3300005618 Ga0068864_101647623 Ga0068864_1016476231 148
522 3300005718 Ga0068866_10037881 Ga0068866_100378812 148
523 3300005719 Ga0068861_100006545 Ga0068861_10000654510 148
524 3300005719 Ga0068861_100650806 Ga0068861_1006508062 148
525 3300005834 Ga0068851_10060087 Ga0068851_100600872 148
526 3300005840 Ga0068870_10308889 Ga0068870_103088892 148
527 3300005841 Ga0068863_100000065 Ga0068863_10000006536 148
528 3300005841 Ga0068863_100003234 Ga0068863_10000323412 148
529 3300005842 Ga0068858_100005370 Ga0068858_1000053707 148
530 3300005842 Ga0068858_100035804 Ga0068858_1000358042 148
531 3300005843 Ga0068860_100000132 Ga0068860_10000013238 148
532 3300005844 Ga0068862_100000356 Ga0068862_10000035636 148
533 3300005844 Ga0068862_100026325 Ga0068862_1000263252 148
534 3300005844 Ga0068862_100197499 Ga0068862_1001974991 148
535 3300005844 Ga0068862_100565487 Ga0068862_1005654872 148
536 3300005844 Ga0068862_100600347 Ga0068862_1006003472 148
537 3300005981 Ga0081538_10177576 Ga0081538_101775762 148
538 3300005983 Ga0081540_1055329 Ga0081540_10553292 148
539 3300006028 Ga0070717_10006289 Ga0070717_100062892 148
540 3300006028 Ga0070717_10533754 Ga0070717_105337542 148
541 3300006173 Ga0070716_100932721 Ga0070716_1009327211 148
542 3300006175 Ga0070712_100263270 Ga0070712_1002632702 148
543 3300006178 Ga0075367_10063393 Ga0075367_100633933 148
544 3300006358 Ga0068871_100088100 Ga0068871_1000881002 148
545 3300006844 Ga0075428_100066407 Ga0075428_1000664077 148
546 3300006844 Ga0075428_100102914 Ga0075428_1001029142 148
547 3300006844 Ga0075428_100335721 Ga0075428_1003357212 148
548 3300006844 Ga0075428_100644051 Ga0075428_1006440512 148
549 3300006846 Ga0075430_100008579 Ga0075430_1000085796 148
550 3300006846 Ga0075430_100034569 Ga0075430_1000345693 148
551 3300006846 Ga0075430_100174590 Ga0075430_1001745903 148
552 3300006847 Ga0075431_100055566 Ga0075431_1000555665 148
553 3300006847 Ga0075431_100084807 Ga0075431_1000848072 148
554 3300006847 Ga0075431_100124950 Ga0075431_1001249502 148
555 3300006847 Ga0075431_100655631 Ga0075431_1006556312 148
556 3300006847 Ga0075431_102034268 Ga0075431_1020342681 148
557 3300006852 Ga0075433_10458406 Ga0075433_104584062 148
558 3300006871 Ga0075434_100214345 Ga0075434_1002143452 148
559 3300006871 Ga0075434_101808012 Ga0075434_1018080121 148
560 3300006880 Ga0075429_100052398 Ga0075429_1000523985 148
561 3300006880 Ga0075429_100424513 Ga0075429_1004245132 148
562 3300006880 Ga0075429_101134592 Ga0075429_1011345921 148
563 3300006881 Ga0068865_100283651 Ga0068865_1002836512 148
564 3300006931 Ga0097620_100002159 Ga0097620_10000215918 148
565 3300006931 Ga0097620_100003975 Ga0097620_10000397519 148
566 3300006931 Ga0097620_100161615 Ga0097620_1001616152 148
567 3300006931 Ga0097620_100676952 Ga0097620_1006769522 148
568 3300007076 Ga0075435_100188539 Ga0075435_1001885392 148
569 3300007076 Ga0075435_101505653 Ga0075435_1015056532 148
570 3300009036 Ga0105244_10252797 Ga0105244_102527971 148
571 3300009092 Ga0105250_10097612 Ga0105250_100976122 148
572 3300009093 Ga0105240_11121365 Ga0105240_111213652 148
573 3300009094 Ga0111539_10589405 Ga0111539_105894052 148
574 3300009094 Ga0111539_10766970 Ga0111539_107669702 148
575 3300009094 Ga0111539_10938887 Ga0111539_109388872 148
576 3300009094 Ga0111539_11004405 Ga0111539_110044052 148
577 3300009094 Ga0111539_11617824 Ga0111539_116178241 148
578 3300009098 Ga0105245_10076531 Ga0105245_100765312 148
579 3300009098 Ga0105245_11464734 Ga0105245_114647342 148
580 3300009098 Ga0105245_12329724 Ga0105245_123297241 148
581 3300009101 Ga0105247_10098873 Ga0105247_100988733 148
582 3300009101 Ga0105247_10652288 Ga0105247_106522881 148
583 3300009147 Ga0114129_10000745 Ga0114129_1000074529 148
584 3300009147 Ga0114129_10216471 Ga0114129_102164713 148
585 3300009147 Ga0114129_10375634 Ga0114129_103756342 148
586 3300009147 Ga0114129_10532586 Ga0114129_105325863 148
587 3300009147 Ga0114129_10793836 Ga0114129_107938362 148
588 3300009147 Ga0114129_10808146 Ga0114129_108081462 148
589 3300009148 Ga0105243_10391776 Ga0105243_103917762 148
590 3300009148 Ga0105243_10805468 Ga0105243_108054682 148
591 3300009174 Ga0105241_11644588 Ga0105241_116445881 148
592 3300009176 Ga0105242_10194425 Ga0105242_101944252 148
593 3300009177 Ga0105248_10168892 Ga0105248_101688922 148
594 3300009177 Ga0105248_10326716 Ga0105248_103267162 148
595 3300009177 Ga0105248_12200769 Ga0105248_122007692 148
596 3300009545 Ga0105237_10041422 Ga0105237_100414223 148
597 3300009545 Ga0105237_10072029 Ga0105237_100720293 148
598 3300009545 Ga0105237_11257466 Ga0105237_112574661 148
599 3300009551 Ga0105238_10100629 Ga0105238_101006292 148
600 3300009551 Ga0105238_10168351 Ga0105238_101683513 148
601 3300009551 Ga0105238_10491129 Ga0105238_104911292 148
602 3300009553 Ga0105249_10000109 Ga0105249_1000010937 148
603 3300009553 Ga0105249_10044880 Ga0105249_100448805 148
604 3300009553 Ga0105249_11726440 Ga0105249_117264401 148
605 3300010375 Ga0105239_10529788 Ga0105239_105297882 148
606 3300010375 Ga0105239_10708147 Ga0105239_107081472 148
607 3300011119 Ga0105246_11071271 Ga0105246_110712711 148
608 3300013100 Ga0157373_10136481 Ga0157373_101364812 148
609 3300013100 Ga0157373_10140232 Ga0157373_101402322 148
610 3300013104 Ga0157370_10087756 Ga0157370_100877563 148
611 3300013105 Ga0157369_10402814 Ga0157369_104028142 148
612 3300013306 Ga0163162_10077860 Ga0163162_100778602 148
613 3300013306 Ga0163162_10106902 Ga0163162_101069022 148
614 3300013307 Ga0157372_10271507 Ga0157372_102715073 148
615 3300013307 Ga0157372_12649118 Ga0157372_126491181 148
616 3300013308 Ga0157375_10007541 Ga0157375_100075419 148
617 3300014325 Ga0163163_10000744 Ga0163163_1000074422 148
618 3300014325 Ga0163163_10371393 Ga0163163_103713932 148
619 3300014325 Ga0163163_11222863 Ga0163163_112228632 148
620 3300014326 Ga0157380_10000599 Ga0157380_100005993 148
621 3300014326 Ga0157380_10403480 Ga0157380_104034802 148
622 3300014745 Ga0157377_10014975 Ga0157377_100149755 148
623 3300014968 Ga0157379_10022792 Ga0157379_100227924 148
624 3300017792 Ga0163161_10000084 Ga0163161_1000008480 148
625 3300021358 Ga0213873_10093913 Ga0213873_100939131 148
626 3300021388 Ga0213875_10176951 Ga0213875_101769512 148
627 3300025223 Ga0207672_1000296 Ga0207672_10002966 148
628 3300025292 Ga0209676_1000343 Ga0209676_100034316 148
629 3300025321 Ga0207656_10074562 Ga0207656_100745621 148
630 3300025898 Ga0207692_10126826 Ga0207692_101268262 148
631 3300025899 Ga0207642_10004579 Ga0207642_100045792 148
632 3300025899 Ga0207642_10512501 Ga0207642_105125011 148
633 3300025900 Ga0207710_10051986 Ga0207710_100519863 148
634 3300025900 Ga0207710_10552090 Ga0207710_105520902 148
635 3300025901 Ga0207688_10010554 Ga0207688_100105544 148
636 3300025903 Ga0207680_10000009 Ga0207680_10000009360 148
637 3300025904 Ga0207647_10000766 Ga0207647_1000076623 148
638 3300025904 Ga0207647_10106875 Ga0207647_101068753 148
639 3300025908 Ga0207643_10093320 Ga0207643_100933202 148
640 3300025909 Ga0207705_10004861 Ga0207705_1000486110 148
641 3300025909 Ga0207705_10762507 Ga0207705_107625071 148
642 3300025910 Ga0207684_10147688 Ga0207684_101476883 148
643 3300025911 Ga0207654_10000868 Ga0207654_100008682 148
644 3300025911 Ga0207654_10522774 Ga0207654_105227741 148
645 3300025912 Ga0207707_10114316 Ga0207707_101143162 148
646 3300025912 Ga0207707_10156135 Ga0207707_101561352 148
647 3300025912 Ga0207707_10222486 Ga0207707_102224862 148
648 3300025913 Ga0207695_10003070 Ga0207695_100030703 148
649 3300025913 Ga0207695_10201215 Ga0207695_102012152 148
650 3300025914 Ga0207671_10006894 Ga0207671_100068949 148
651 3300025914 Ga0207671_10070299 Ga0207671_100702993 148
652 3300025915 Ga0207693_10011477 Ga0207693_100114773 148
653 3300025915 Ga0207693_10238743 Ga0207693_102387432 148
654 3300025916 Ga0207663_10076004 Ga0207663_100760042 148
655 3300025916 Ga0207663_10307577 Ga0207663_103075771 148
656 3300025917 Ga0207660_10147324 Ga0207660_101473242 148
657 3300025917 Ga0207660_11365648 Ga0207660_113656481 148
658 3300025918 Ga0207662_10502415 Ga0207662_105024151 148
659 3300025919 Ga0207657_10007686 Ga0207657_100076864 148
660 3300025919 Ga0207657_10040691 Ga0207657_100406915 148
661 3300025919 Ga0207657_10612786 Ga0207657_106127861 148
662 3300025920 Ga0207649_10157546 Ga0207649_101575462 148
663 3300025921 Ga0207652_11190684 Ga0207652_111906841 148
664 3300025923 Ga0207681_10000965 Ga0207681_1000096518 148
665 3300025924 Ga0207694_10125317 Ga0207694_101253172 148
666 3300025924 Ga0207694_10559462 Ga0207694_105594621 148
667 3300025925 Ga0207650_10122997 Ga0207650_101229972 148
668 3300025925 Ga0207650_10186042 Ga0207650_101860423 148
669 3300025925 Ga0207650_10611152 Ga0207650_106111521 148
670 3300025926 Ga0207659_10004912 Ga0207659_100049124 148
671 3300025926 Ga0207659_10182710 Ga0207659_101827102 148
672 3300025927 Ga0207687_10533384 Ga0207687_105333841 148
673 3300025928 Ga0207700_10546791 Ga0207700_105467912 148
674 3300025929 Ga0207664_10151107 Ga0207664_101511072 148
675 3300025931 Ga0207644_10003709 Ga0207644_100037092 148
676 3300025931 Ga0207644_10117953 Ga0207644_101179532 148
677 3300025932 Ga0207690_10137604 Ga0207690_101376042 148
678 3300025932 Ga0207690_10596165 Ga0207690_105961652 148
679 3300025933 Ga0207706_10020148 Ga0207706_100201483 148
680 3300025933 Ga0207706_10040317 Ga0207706_100403173 148
681 3300025933 Ga0207706_10501732 Ga0207706_105017321 148
682 3300025933 Ga0207706_10501733 Ga0207706_105017331 148
683 3300025935 Ga0207709_10525045 Ga0207709_105250451 148
684 3300025936 Ga0207670_10022376 Ga0207670_100223762 148
685 3300025936 Ga0207670_10054735 Ga0207670_100547351 148
686 3300025937 Ga0207669_10301972 Ga0207669_103019721 148
687 3300025940 Ga0207691_10018446 Ga0207691_100184469 148
688 3300025941 Ga0207711_10004477 Ga0207711_100044776 148
689 3300025941 Ga0207711_10106037 Ga0207711_101060372 148
690 3300025944 Ga0207661_10904371 Ga0207661_109043712 148
691 3300025945 Ga0207679_10013683 Ga0207679_100136835 148
692 3300025945 Ga0207679_10700207 Ga0207679_107002072 148
693 3300025949 Ga0207667_10013251 Ga0207667_100132512 148
694 3300025949 Ga0207667_10067709 Ga0207667_100677092 148
695 3300025949 Ga0207667_10361064 Ga0207667_103610642 148
696 3300025960 Ga0207651_10028339 Ga0207651_100283395 148
697 3300025961 Ga0207712_10000046 Ga0207712_1000004648 148
698 3300025961 Ga0207712_10014037 Ga0207712_100140375 148
699 3300025972 Ga0207668_10021901 Ga0207668_100219012 148
700 3300025972 Ga0207668_10440739 Ga0207668_104407392 148
701 3300025972 Ga0207668_10473346 Ga0207668_104733462 148
702 3300025972 Ga0207668_11144001 Ga0207668_111440011 148
703 3300025972 Ga0207668_11219305 Ga0207668_112193052 148
704 3300025981 Ga0207640_10101558 Ga0207640_101015583 148
705 3300025986 Ga0207658_10000784 Ga0207658_100007848 148
706 3300026035 Ga0207703_10005251 Ga0207703_100052517 148
707 3300026035 Ga0207703_10023484 Ga0207703_100234842 148
708 3300026035 Ga0207703_11280694 Ga0207703_112806941 148
709 3300026041 Ga0207639_10008983 Ga0207639_100089834 148
710 3300026041 Ga0207639_10551073 Ga0207639_105510732 148
711 3300026067 Ga0207678_10014887 Ga0207678_100148878 148
712 3300026067 Ga0207678_10476904 Ga0207678_104769042 148
713 3300026075 Ga0207708_10168093 Ga0207708_101680933 148
714 3300026078 Ga0207702_10001550 Ga0207702_100015502 148
715 3300026088 Ga0207641_10000063 Ga0207641_10000063125 148
716 3300026088 Ga0207641_10006925 Ga0207641_100069258 148
717 3300026095 Ga0207676_10003249 Ga0207676_100032492 148
718 3300026095 Ga0207676_10067629 Ga0207676_100676291 148
719 3300026095 Ga0207676_10171124 Ga0207676_101711241 148
720 3300026116 Ga0207674_10000811 Ga0207674_1000081144 148
721 3300026116 Ga0207674_10005308 Ga0207674_1000530817 148
722 3300026116 Ga0207674_10063883 Ga0207674_100638835 148
723 3300026116 Ga0207674_10329138 Ga0207674_103291382 148
724 3300026116 Ga0207674_10640391 Ga0207674_106403912 148
725 3300026118 Ga0207675_100000167 Ga0207675_10000016726 148
726 3300026118 Ga0207675_100667485 Ga0207675_1006674851 148
727 3300026121 Ga0207683_10036937 Ga0207683_100369372 148
728 3300026142 Ga0207698_10018372 Ga0207698_100183723 148
729 3300026142 Ga0207698_10689508 Ga0207698_106895081 148
730 3300026142 Ga0207698_11296025 Ga0207698_112960251 148
731 3300027907 Ga0207428_10266497 Ga0207428_102664972 148
732 3300028379 Ga0268266_10000066 Ga0268266_1000006693 148
733 3300028379 Ga0268266_10209637 Ga0268266_102096372 148
734 3300028379 Ga0268266_10399807 Ga0268266_103998072 148
735 3300028380 Ga0268265_10000129 Ga0268265_1000012934 148
736 3300028380 Ga0268265_10003546 Ga0268265_100035465 148
737 3300028380 Ga0268265_10169989 Ga0268265_101699892 148
738 3300028380 Ga0268265_10544775 Ga0268265_105447752 148
739 3300028381 Ga0268264_10000130 Ga0268264_1000013067 148
740 3300028381 Ga0268264_10042602 Ga0268264_100426023 148
741 3300028381 Ga0268264_11105894 Ga0268264_111058942 148
742 3300028577 Ga0265318_10019261 Ga0265318_100192613 148
743 3300028800 Ga0265338_10119775 Ga0265338_101197752 148
744 3300031241 Ga0265325_10058885 Ga0265325_100588853 148
745 3300031249 Ga0265339_10376476 Ga0265339_103764761 148
746 3300031456 Ga0307513_10075345 Ga0307513_100753452 148
747 3300031548 Ga0307408_100102895 Ga0307408_1001028952 148
748 3300031548 Ga0307408_100511061 Ga0307408_1005110611 148
749 3300031548 Ga0307408_101094255 Ga0307408_1010942552 148
750 3300031595 Ga0265313_10004334 Ga0265313_100043349 148
751 3300031616 Ga0307508_10742356 Ga0307508_107423561 148
752 3300031691 Ga0316579_10006754 Ga0316579_100067542 148
753 3300031711 Ga0265314_10159320 Ga0265314_101593202 148
754 3300031727 Ga0316576_10048037 Ga0316576_100480372 148
755 3300031728 Ga0316578_10002183 Ga0316578_100021837 148
756 3300031731 Ga0307405_10152973 Ga0307405_101529732 148
757 3300031733 Ga0316577_10056675 Ga0316577_100566752 148
758 3300031824 Ga0307413_10108930 Ga0307413_101089302 148
759 3300031901 Ga0307406_10202447 Ga0307406_102024471 148
760 3300031901 Ga0307406_11179754 Ga0307406_111797541 148
761 3300032002 Ga0307416_100213800 Ga0307416_1002138002 148
762 3300032004 Ga0307414_10263254 Ga0307414_102632541 148
763 3300032004 Ga0307414_10562100 Ga0307414_105621002 148
764 3300032005 Ga0307411_10733024 Ga0307411_107330242 148
765 3300032005 Ga0307411_10741506 Ga0307411_107415061 148
766 3300032137 Ga0316585_10033052 Ga0316585_100330522 148
767 3300032139 Ga0316580_10021695 Ga0316580_100216952 148
768 3300033180 Ga0307510_10163086 Ga0307510_101630862 148
769 3300034957 Ga0373938_0122792 Ga0373938_0122792_165_611 148
770 3300035112 Ga0373932_0324789 Ga0373932_0324789_75_539 148
771 3300035117 Ga0373953_0195470 Ga0373953_0195470_191_637 148
772 3300035119 Ga0373956_0058473 Ga0373956_0058473_262_708 148
773 3300035207 Ga0373942_0262969 Ga0373942_0262969_54_518 148
774 3300035398 Ga0316574_0010852 Ga0316574_0010852_3563_4045 148
775 3300035410 Ga0373924_0033263 Ga0373924_0033263_238_696 148
776 3300035691 Ga0373931_0524428 Ga0373931_0524428_222_686 148
777 3300035695 Ga0373927_0077921 Ga0373927_0077921_189_668 148
778 3300036401 Ga0373937_1079723 Ga0373937_1079723_201_647 148
779 3300036647 Ga0316582_0035297 Ga0316582_0035297_610_1092 148
780 3300036712 Ga0316584_0066758 Ga0316584_0066758_1398_1880 148
781 3300037068 Ga0373925_0421645 Ga0373925_0421645_347_805 148
782 3300037312 Ga0395899_0096936 Ga0395899_0096936_889_1368 148
783 3300037418 Ga0395900_0013620 Ga0395900_0013620_2008_2487 148
784 3300037418 Ga0395900_0060994 Ga0395900_0060994_659_1123 148
785 3300037418 Ga0395900_0283939 Ga0395900_0283939_689_1168 148
786 3300037466 Ga0395898_0086977 Ga0395898_0086977_707_1186 148
787 3300037466 Ga0395898_0123742 Ga0395898_0123742_1304_1783 148
788 3300037471 Ga0395905_0313980 Ga0395905_0313980_568_1026 148
789 3300037471 Ga0395905_0829320 Ga0395905_0829320_272_736 148
790 3300037853 Ga0436364_0828364 Ga0436364_0828364_581_1030 148
791 3300038443 Ga0395901_0101972 Ga0395901_0101972_1826_2305 148
792 3300038443 Ga0395901_0879661 Ga0395901_0879661_355_834 148
793 3300038443 Ga0395901_0909059 Ga0395901_0909059_183_647 148
794 3300038996 Ga0242420_069071 Ga0242420_069071_116_577 148
795 3300039062 Ga0400483_062723 Ga0400483_062723_6043_6504 148
796 3300039437 Ga0436365_1441610 Ga0436365_1441610_142_588 148
797 3300039438 Ga0436360_0735785 Ga0436360_0735785_459_929 148
798 3300039447 Ga0436361_0016812 Ga0436361_0016812_64_528 148
799 3300039447 Ga0436361_1001866 Ga0436361_1001866_26942_27397 148
800 3300039450 Ga0436363_0057851 Ga0436363_0057851_290_736 148
801 3300039450 Ga0436363_1627005 Ga0436363_1627005_323_805 148
802 3300039450 Ga0436363_1685778 Ga0436363_1685778_70_537 148
803 3300039453 Ga0436362_1235293 Ga0436362_1235293_292_738 148
804 3300039453 Ga0436362_1289189 Ga0436362_1289189_114_563 148
805 3300041498 Ga0451841_0404297 Ga0451841_0404297_28_489 148
806 3300042005 Ga0439448_0088266 Ga0439448_0088266_425_889 148
807 3300042133 Ga0450896_019627 Ga0450896_019627_334_798 148
808 3300042156 Ga0439446_0065351 Ga0439446_0065351_230_676 148
809 3300042876 Ga0451577_0002876 Ga0451577_0002876_13785_14279 148
810 3300042876 Ga0451577_0029071 Ga0451577_0029071_389_853 148
811 3300042876 Ga0451577_0031237 Ga0451577_0031237_2888_3370 148
812 3300042876 Ga0451577_0121174 Ga0451577_0121174_370_834 148
813 3300042876 Ga0451577_0595897 Ga0451577_0595897_187_669 148
814 3300044673 Ga0453683_0029861 Ga0453683_0029861_727_1209 148
815 3300044712 Ga0453684_0102090 Ga0453684_0102090_2618_3100 148
816 3300044712 Ga0453684_0242739 Ga0453684_0242739_1112_1576 148
817 3300044712 Ga0453684_0280256 Ga0453684_0280256_163_657 148
818 3300044712 Ga0453684_0576712 Ga0453684_0576712_738_1208 148
819 3300044765 Ga0466970_0803340 Ga0466970_0803340_46_501 148
820 3300044842 Ga0466957_0027436 Ga0466957_0027436_1135_1596 148
821 3300044842 Ga0466957_0784845 Ga0466957_0784845_52_516 148
822 3300045051 Ga0451576_0000056 Ga0451576_0000056_17001_17465 148
823 3300045051 Ga0451576_0029144 Ga0451576_0029144_5154_5615 148
824 3300045051 Ga0451576_0039821 Ga0451576_0039821_3182_3676 148
825 3300045051 Ga0451576_0068197 Ga0451576_0068197_2089_2571 148
826 3300045976 Ga0466967_1594568 Ga0466967_1594568_76_540 148
827 3300045976 Ga0466967_2195042 Ga0466967_2195042_56_520 148
828 3300046454 Ga0495592_0206736 Ga0495592_0206736_295_741 148
829 3300046476 Ga0495662_0109511 Ga0495662_0109511_801_1247 148
830 3300046516 Ga0495628_0275252 Ga0495628_0275252_622_1068 148
831 3300046517 Ga0495630_0424299 Ga0495630_0424299_220_666 148
832 3300046530 Ga0495654_0005887 Ga0495654_0005887_714_1160 148
833 3300046535 Ga0495586_0020552 Ga0495586_0020552_702_1148 148
834 3300046557 Ga0495622_0333363 Ga0495622_0333363_88_549 148
835 3300046558 Ga0495633_0063945 Ga0495633_0063945_1071_1532 148
836 3300046559 Ga0495667_0108182 Ga0495667_0108182_377_823 148
837 3300046642 Ga0495634_0257573 Ga0495634_0257573_424_870 148
838 3300046660 Ga0495625_0587722 Ga0495625_0587722_44_490 148
839 3300046663 Ga0495635_0259075 Ga0495635_0259075_358_804 148
840 3300046665 Ga0495661_0028858 Ga0495661_0028858_2899_3345 148
841 3300046678 Ga0495599_0060610 Ga0495599_0060610_805_1251 148
842 3300046679 Ga0495623_0418879 Ga0495623_0418879_216_674 148
843 3300047322 Ga0495680_0100507 Ga0495680_0100507_1247_1693 148
844 3300047472 Ga0495686_0000714 Ga0495686_0000714_16045_16491 148
845 3300047472 Ga0495686_0006789 Ga0495686_0006789_1127_1573 148
846 3300048903 Ga0496100_0337118 Ga0496100_0337118_439_885 148
847 3300048904 Ga0496101_0194386 Ga0496101_0194386_459_905 148
848 3300048905 Ga0496102_0007368 Ga0496102_0007368_6632_7078 148
849 3300048905 Ga0496102_0612634 Ga0496102_0612634_270_734 148
850 3300048905 Ga0496102_0777570 Ga0496102_0777570_335_796 148
851 3300048906 Ga0496103_0000788 Ga0496103_0000788_11211_11657 148
852 3300048907 Ga0496104_0097508 Ga0496104_0097508_23_469 148
853 3300048908 Ga0496105_0212657 Ga0496105_0212657_531_977 148
854 3300048909 Ga0496106_0196646 Ga0496106_0196646_778_1224 148
855 3300048910 Ga0496107_0095692 Ga0496107_0095692_953_1414 148
856 3300048910 Ga0496107_0207031 Ga0496107_0207031_637_1083 148
857 3300048910 Ga0496107_0388641 Ga0496107_0388641_545_1009 148
858 3300048911 Ga0496108_1182602 Ga0496108_1182602_150_596 148
859 3300048913 Ga0496110_0211728 Ga0496110_0211728_308_769 148
860 3300048913 Ga0496110_1115033 Ga0496110_1115033_142_606 148
861 3300048914 Ga0496111_0333017 Ga0496111_0333017_340_786 148
862 3300048914 Ga0496111_0984859 Ga0496111_0984859_41_505 148
863 3300048915 Ga0496112_0072810 Ga0496112_0072810_616_1077 148
864 3300048915 Ga0496112_0571208 Ga0496112_0571208_171_632 148
865 3300048916 Ga0496113_0210526 Ga0496113_0210526_234_695 148
866 3300048919 Ga0496116_0047680 Ga0496116_0047680_235_681 148
867 3300048920 Ga0496117_0015332 Ga0496117_0015332_1220_1666 148
868 3300048921 Ga0496118_0008568 Ga0496118_0008568_5213_5659 148
869 3300048921 Ga0496118_0030716 Ga0496118_0030716_896_1348 148
870 3300048922 Ga0496119_0069388 Ga0496119_0069388_1175_1627 148
871 3300048922 Ga0496119_0194678 Ga0496119_0194678_371_817 148
872 3300048923 Ga0496120_0016269 Ga0496120_0016269_784_1236 148
873 3300048924 Ga0496121_0132973 Ga0496121_0132973_450_902 148
874 3300048924 Ga0496121_0188375 Ga0496121_0188375_80_526 148
875 3300048928 Ga0496125_0054236 Ga0496125_0054236_252_704 148
876 3300048929 Ga0496126_1046555 Ga0496126_1046555_30_482 148
877 3300049570 Ga0501033_0075120 Ga0501033_0075120_1554_2000 148
878 3300049576 Ga0501040_0503660 Ga0501040_0503660_282_746 148
879 3300049579 Ga0501043_0343965 Ga0501043_0343965_309_764 148
880 3300049582 Ga0501048_0787818 Ga0501048_0787818_56_517 148
881 3300049588 Ga0501072_0396634 Ga0501072_0396634_479_943 148
882 3300049591 Ga0501075_0926471 Ga0501075_0926471_91_555 148
883 3300049663 Ga0501223_109255 Ga0501223_109255_13_459 148
884 3300049686 Ga0501257_000066 Ga0501257_000066_12085_12531 148
885 3300049768 Ga0501271_016163 Ga0501271_016163_266_730 148
886 3300049823 Ga0501044_0007795 Ga0501044_0007795_5181_5654 148
887 3300049823 Ga0501044_0235637 Ga0501044_0235637_956_1411 148
888 3300050490 nmdc:mga03n38_772589_c1 nmdc:mga03n38_772589_c1_12_494 148
889 3300050492 nmdc:mga0yw44_173595_c1 nmdc:mga0yw44_173595_c1_424_906 148
890 3300050493 nmdc:mga0k408_122761_c1 nmdc:mga0k408_122761_c1_521_985 148
891 3300050493 nmdc:mga0k408_307992_c1 nmdc:mga0k408_307992_c1_91_555 148
892 3300050493 nmdc:mga0k408_36927_c1 nmdc:mga0k408_36927_c1_636_1094 148
893 3300050494 nmdc:mga06z11_95817_c1 nmdc:mga06z11_95817_c1_14_496 148
894 3300050495 nmdc:mga04h51_8169_c1 nmdc:mga04h51_8169_c1_705_1187 148
895 3300050507 nmdc:mga05p37_1553459_c1 nmdc:mga05p37_1553459_c1_48_509 148
896 3300050507 nmdc:mga05p37_751_c1 nmdc:mga05p37_751_c1_30216_30677 148
897 3300050508 nmdc:mga09592_4545_c1 nmdc:mga09592_4545_c1_3653_4117 148
898 3300050508 nmdc:mga09592_9701_c1 nmdc:mga09592_9701_c1_4116_4577 148
899 3300050509 nmdc:mga0qj67_29711_c1 nmdc:mga0qj67_29711_c1_2336_2800 148
900 3300050509 nmdc:mga0qj67_624570_c1 nmdc:mga0qj67_624570_c1_43_507 148
901 3300050509 nmdc:mga0qj67_8300_c1 nmdc:mga0qj67_8300_c1_5048_5509 148
902 3300050510 nmdc:mga06r32_12823_c1 nmdc:mga06r32_12823_c1_5802_6266 148
903 3300050510 nmdc:mga06r32_22515_c1 nmdc:mga06r32_22515_c1_1913_2374 148
904 3300050510 nmdc:mga06r32_86156_c1 nmdc:mga06r32_86156_c1_2312_2782 148
905 3300050510 nmdc:mga06r32_93_c1 nmdc:mga06r32_93_c1_52243_52707 148
906 3300050511 nmdc:mga08y16_117424_c1 nmdc:mga08y16_117424_c1_1351_1812 148
907 3300050511 nmdc:mga08y16_206552_c1 nmdc:mga08y16_206552_c1_1065_1529 148
908 3300050511 nmdc:mga08y16_35897_c1 nmdc:mga08y16_35897_c1_107_568 148
909 3300050512 nmdc:mga0n895_802135_c1 nmdc:mga0n895_802135_c1_238_702 148
910 3300050515 nmdc:mga0a205_1193580_c1 nmdc:mga0a205_1193580_c1_63_527 148
911 3300053077 Ga0495601_0006748 Ga0495601_0006748_4792_5238 148
912 3300053084 Ga0495595_0039453 Ga0495595_0039453_891_1337 148
913 3300053085 Ga0495619_0096077 Ga0495619_0096077_436_882 148
914 3300053096 Ga0500641_0143401 Ga0500641_0143401_296_832 148
915 3300053116 Ga0500592_000681 Ga0500592_000681_185_679 148
916 3300053136 Ga0500559_0016256 Ga0500559_0016256_1177_1641 148
917 3300053151 Ga0500604_0026888 Ga0500604_0026888_387_833 148
918 3300053157 Ga0500624_000005 Ga0500624_000005_182944_183405 148
919 3300053158 Ga0500627_0000115 Ga0500627_0000115_8782_9228 148
920 3300053177 Ga0500636_0186712 Ga0500636_0186712_129_605 148
921 3300059424 Ga0590075_022764 Ga0590075_022764_880_1341 148
922 3300061719 Ga0466962_0330164 Ga0466962_0330164_100_546 148
923 3300061734 Ga0530510_0119479 Ga0530510_0119479_532_996 148

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14489

QueF

QueF-like protein

52

128

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
4f8b-assembly1.cif.gz_B-2 crystal structure of the covalent thioimide intermediate of unimodular nitrile reductase quef 0.928 21 133
5k0p-assembly1.cif.gz_B crystal structure of the archaeosine synthase quef-like in the apo form 0.918 34 131
6z89-assembly1.cif.gz_D-2 human gtp cyclohydrolase i in complex with allosteric inhibitor 0.9134 33 128
6z88-assembly1.cif.gz_J human gtp cyclohydrolase i in complex with allosteric inhibitor 0.9106 34 128
7alc-assembly1.cif.gz_B-2 human gch-gfrp stimulatory complex 0.9084 34 126
ID Description Score Start End Superfamily
af_Q2G081_22_166_3.30.1130.10 Alpha Beta;2-Layer Sandwich;GTP Cyclohydrolase I, domain 2;GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain 0.8994 9 131 3.30.1130.10
3rzpD02 Alpha Beta;2-Layer Sandwich;GTP Cyclohydrolase I, domain 2;GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain 0.8905 30 130 3.30.1130.10
1a8rA02 Alpha Beta;2-Layer Sandwich;GTP Cyclohydrolase I, domain 2;GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain 0.8606 22 128 3.30.1130.10
af_A0A1D6DUT0_342_468_3.30.1130.10 Alpha Beta;2-Layer Sandwich;GTP Cyclohydrolase I, domain 2;GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain 0.8377 34 128 3.30.1130.10
af_B4FH02_104_236_3.30.1130.10 Alpha Beta;2-Layer Sandwich;GTP Cyclohydrolase I, domain 2;GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain 0.8244 34 128 3.30.1130.10
ID Description Score Start End GO Terms
AF-A0A4Q2ZAY5-F1-model_v4 PreQ(1) synthase (EC 1.7.1.13) 0.9924 2 97 GO:0005737
GO:0008616
GO:0033739
AF-Q9RNJ7-F1-model_v4 NADPH-dependent 7-cyano-7-deazaguanine reductase (EC 1.7.1.13) (7-cyano-7-carbaguanine reductase) (NADPH-dependent nitrile oxidoreductase) (PreQ(0) reductase) 0.9899 1 113 GO:0005737
GO:0006400
GO:0008616
GO:0033739
AF-A0A2W6TH54-F1-model_v4 NADPH-dependent 7-cyano-7-deazaguanine reductase (EC 1.7.1.13) (7-cyano-7-carbaguanine reductase) (NADPH-dependent nitrile oxidoreductase) (PreQ(0) reductase) 0.9818 1 148 GO:0005737
GO:0006400
GO:0008616
GO:0033739
AF-A0A1T5ASV7-F1-model_v4 NADPH-dependent 7-cyano-7-deazaguanine reductase (EC 1.7.1.13) (7-cyano-7-carbaguanine reductase) (NADPH-dependent nitrile oxidoreductase) (PreQ(0) reductase) 0.9817 20 148 GO:0005737
GO:0006400
GO:0008616
GO:0033739
AF-A0A520IJI0-F1-model_v4 PreQ(1) synthase (EC 1.7.1.13) 0.9815 1 110 GO:0005737
GO:0008616
GO:0033739

Feature Viewer

pLDDT pTM Quality
93.39 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map