F485568

General Info

Members Datasets Scaffolds Average Seq Length
914 482 883 125

Family's Representative Sequence

Representative Sequence 3300013104|Ga0157370_11322111|Ga0157370_113221112
Length 137
Sequence MPKMKTHRGAAKRFKVTGTGKITKRKVTLERASGYRGQRSRLYRKAKEQVTHSLGYAYRDRRARKGDFRRLWIQWINAGARANGMTYNRFIQGLKASGVEVDRKILADLAVTDAAAFTALVEIARANVPAAGASDAA

Samples

Sample ID Description Type Environment
1 2515154155 Actinopolymorpha alba DSM 45243 Isolate Rhizosphere
2 2515154202 Salinispora pacifica CNT084 Isolate Rhizosphere
3 2585427649 Amycolatopsis japonica MG417-CF17, DSM 44213 Isolate Unclassified
4 2643221567 Phycicoccus sp. Root563 Isolate Unclassified
5 2643221576 Nocardioides sp. Root614 Isolate Unclassified
6 2643221590 Nocardioides sp. Root682 Isolate Unclassified
7 2643221624 Phycicoccus sp. Root101 Isolate Unclassified
8 2643221679 Angustibacter sp. Root456 Isolate Unclassified
9 2643221711 Terrabacter sp. Root85 Isolate Unclassified
10 2675902999 Frankia asymbiotica NRRL B-16386 Isolate Nodule
11 2687453737 Frankia sp. BMG5.36 Isolate Nodule
12 2773857921 Frankia asymbiotica NRRL B-16386 Isolate Nodule
13 2773857933 Frankia sp. BMG5.30 Isolate Nodule
14 2791355222 Paenibacillus oryzae 1DrF-4 Isolate Unclassified
15 2808606365 Phycicoccus sp. SLBN-51 Isolate Unclassified
16 2808606522 Amycolatopsis sp. BJA-103 Isolate Unclassified
17 2811994882 Terrabacter sp. SLBN-196 Isolate Unclassified
18 2818991318 Humibacillus xanthopallidus SLBN-155 Isolate Unclassified
19 2818991458 Terrabacter sp. 3211 Isolate Rhizosphere
20 2818991462 Terrabacter sp. 3264 Isolate Rhizosphere
21 2818991469 Terrabacter lapilli 3265 Isolate Rhizosphere
22 2867302475 Micromonospora globbae WPS1-2 Isolate Unclassified
23 2870622029 Conyzicola lurida DSM 105784 Isolate Unclassified
24 2887443736 Ruania rhizosphaerae LNNU 22110 Isolate Rhizosphere
25 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified
26 2899359706 Amycolatopsis anabasis EGI 650086 Isolate Unclassified
27 2915768154 Amycolatopsis pittospori PIP199 Isolate Unclassified
28 2919446982 Phycicoccus sp. 3266 Isolate Rhizosphere
29 2928121344 Plantibacter flavus 1756 Isolate Rhizosphere
30 2939657138 Conyzicola nivalis 2857 Isolate Rhizosphere
31 3001889506 Janibacter sp. YIM B02568 Isolate Unclassified
32 3300000305 Blue grama grass rhizosphere microbial communities from Sevilleta, New Mexico, USA - Combined Assembly Metatranscriptome Rhizosphere
33 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
34 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
35 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
36 3300003308 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
37 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
38 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
39 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
40 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
41 3300003611 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_27 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
42 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
43 3300004785 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-1 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
44 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
45 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
46 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
47 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
48 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
49 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
50 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
51 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
52 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
53 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
54 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
55 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
56 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
57 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
58 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
59 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
60 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
61 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
62 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
63 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
64 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
65 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
66 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
67 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
68 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
69 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
70 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
71 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
72 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
73 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
74 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
75 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
76 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
77 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
78 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
79 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
80 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
81 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
82 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
83 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
84 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
85 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
86 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
87 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
88 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
89 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
90 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
91 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
92 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
93 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
94 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
95 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
96 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
97 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
98 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
99 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
100 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
101 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
102 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
103 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
104 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
105 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
106 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
107 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
108 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
109 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
110 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
111 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
112 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
113 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
114 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
115 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
116 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
117 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
118 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
119 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
120 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
121 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
122 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
123 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
124 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
125 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
126 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
127 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
128 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
129 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
130 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
131 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
132 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
133 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
134 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
135 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
136 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
137 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
138 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
139 3300012485 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.7.old.040610 Metagenome Rhizosphere
140 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
141 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
142 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
143 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
144 3300013045 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
145 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
146 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
147 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
148 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
149 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
150 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
151 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
152 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
153 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
154 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
155 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
156 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
157 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
158 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
159 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
160 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
161 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
162 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
163 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
164 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
165 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
166 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
167 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
219 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
220 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
224 3300029277 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.ctcc.R1 Metatranscriptome Rhizosphere
225 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
226 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
227 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
228 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
229 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
230 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
231 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
232 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
233 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
234 3300031592 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRA4 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
235 3300031614 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRI4 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
236 3300031633 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU4 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
237 3300031667 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
238 3300031686 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRA6 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
239 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
240 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
241 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
242 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
243 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
244 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
245 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
246 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
247 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
248 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
249 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
250 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
251 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
252 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
253 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
254 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
255 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
256 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
257 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
258 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
259 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
260 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
261 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
262 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
263 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
264 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
265 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
266 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
267 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
268 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
269 3300036458 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
270 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
271 3300036534 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
272 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
273 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
274 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
275 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
276 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
277 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
278 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
279 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
280 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
281 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
282 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
283 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
284 3300041445 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaT Metatranscriptome Rhizoplane
285 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
286 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
287 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
288 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
289 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
290 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
291 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
292 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
293 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
294 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
295 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
296 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
297 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
298 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
299 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
300 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
301 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
302 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
303 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
304 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
305 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
306 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
307 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
308 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
309 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
310 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
311 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
312 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
313 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
314 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
315 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
316 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
317 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
318 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
319 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
320 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
321 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
322 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
323 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
324 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
325 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
326 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
327 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
328 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
329 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
330 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
331 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
332 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
333 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
334 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
335 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
336 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
337 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
338 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
339 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
340 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
341 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
342 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
343 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
344 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
345 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
346 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
347 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
348 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
349 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
350 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
351 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
352 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
353 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
354 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
355 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
356 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
357 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
358 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
359 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
360 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
361 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
362 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
363 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
364 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
365 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
366 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
367 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
368 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
369 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
370 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
371 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
372 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
373 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
374 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
375 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
376 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
377 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
378 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
379 3300049131 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
380 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
381 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
382 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
383 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
384 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
385 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
386 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
387 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
388 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
389 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
390 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
391 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
392 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
393 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
394 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
395 3300049549 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
396 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
397 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
398 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
399 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
400 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
401 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
402 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
403 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
404 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
405 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
406 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
407 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
408 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
409 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
410 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
411 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
412 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
413 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
414 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
415 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
416 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
417 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
418 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
419 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
420 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
421 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
422 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
423 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
424 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
425 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
426 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
427 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
428 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
429 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
430 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
431 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
432 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
433 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
434 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
435 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
436 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
437 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
438 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
439 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
440 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
441 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
442 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
443 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
444 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
445 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
446 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
447 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
448 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
449 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
450 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
451 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
452 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
453 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
454 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
455 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
456 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
457 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
458 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
459 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
460 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
461 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
462 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
463 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
464 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
465 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
466 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
467 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
468 3300059622 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
469 3300059625 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 151R_CD_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
470 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
471 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
472 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
473 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
474 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
475 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
476 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
477 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
478 3300059660 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 161R_SW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
479 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
480 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
481 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
482 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 80.96
Metatranscriptomes 15.65
Isolates 3.39

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.19
Nodule 0.44
Rhizoplane 8.53
Rhizosphere 82.71
Stem 0
Stem Tuber 0
Unclassified 6.13

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 bgg_mtDRAFT_1034183 3300000305 Bacteria 873
2 JGI24739J22299_10107071 3300001989 Bacteria 841
3 JGI24737J22298_10100500 3300001990 Bacteria 857
4 JGI24744J21845_10078740 3300002077 Bacteria 602
5 Ga0006777J48905_1010862 3300003308 Bacteria 1786
6 JGI25407J50210_10038405 3300003373 Bacteria 1229
7 Ga0007410J51695_1013837 3300003574 Bacteria 881
8 Ga0007416J51690_1010708 3300003577 Bacteria 1730
9 Ga0007429J51699_1006245 3300003579 Bacteria 1787
10 Ga0007411J51799_111023 3300003611 Bacteria 638
11 Ga0032354_1024637 3300003693 Bacteria 689
12 Ga0058858_1321591 3300004785 Bacteria 539
13 Ga0058859_11606581 3300004798 Bacteria 1507
14 Ga0058861_10039264 3300004800 Bacteria 819
15 Ga0058861_12049027 3300004800 Bacteria 504
16 Ga0058860_10075105 3300004801 Bacteria 1485
17 Ga0065712_10480791 3300005290 Bacteria 663
18 Ga0070658_10016077 3300005327 Bacteria 5984
19 Ga0070683_100138044 3300005329 Bacteria 2309
20 Ga0070683_100162734 3300005329 Bacteria 2117
21 Ga0070683_100265558 3300005329 Bacteria 1633
22 Ga0070683_101755533 3300005329 Bacteria 597
23 Ga0070670_100176307 3300005331 Bacteria 1855
24 Ga0070670_100488816 3300005331 Bacteria 1094
25 Ga0070677_10048185 3300005333 Bacteria 1711
26 Ga0068869_100292375 3300005334 Bacteria 1313
27 Ga0068869_100456541 3300005334 Bacteria 1060
28 Ga0070666_10896382 3300005335 Bacteria 655
29 Ga0070680_100076550 3300005336 Bacteria 2754
30 Ga0070680_100532122 3300005336 Bacteria 1007
31 Ga0070682_100064333 3300005337 Bacteria 2328
32 Ga0070682_100108363 3300005337 Bacteria 1846
33 Ga0070660_100039249 3300005339 Bacteria 3598
34 Ga0070660_100397556 3300005339 Bacteria 1139
35 Ga0070660_100469885 3300005339 Bacteria 1044
36 Ga0070689_100245523 3300005340 Bacteria 1476
37 Ga0070691_10218203 3300005341 Bacteria 1009
38 Ga0070687_100637907 3300005343 Bacteria 737
39 Ga0070661_100053746 3300005344 Bacteria 2949
40 Ga0070661_100406666 3300005344 Bacteria 1077
41 Ga0070668_100276250 3300005347 Bacteria 1402
42 Ga0070668_100520658 3300005347 Bacteria 1032
43 Ga0070668_102198086 3300005347 Bacteria 510
44 Ga0070669_100261576 3300005353 Bacteria 1381
45 Ga0070675_100140226 3300005354 Bacteria 2066
46 Ga0070675_101052595 3300005354 Bacteria 748
47 Ga0070671_100157807 3300005355 Bacteria 1917
48 Ga0070671_100560391 3300005355 Bacteria 986
49 Ga0070674_100055900 3300005356 Bacteria 2735
50 Ga0070674_100082938 3300005356 Bacteria 2294
51 Ga0070673_100133823 3300005364 Bacteria 2084
52 Ga0070688_100246409 3300005365 Bacteria 1271
53 Ga0070659_100035645 3300005366 Bacteria 3875
54 Ga0070659_100264206 3300005366 Bacteria 1428
55 Ga0070659_100603077 3300005366 Bacteria 944
56 Ga0070709_10005108 3300005434 Bacteria 7096
57 Ga0070709_10076141 3300005434 Bacteria 2178
58 Ga0070714_100707000 3300005435 Bacteria 972
59 Ga0070713_100096655 3300005436 Bacteria 2550
60 Ga0070713_100417463 3300005436 Bacteria 1255
61 Ga0070713_100884813 3300005436 Bacteria 858
62 Ga0070701_10178204 3300005438 Bacteria 1242
63 Ga0070711_100317625 3300005439 Bacteria 1243
64 Ga0070705_100130886 3300005440 Bacteria 1636
65 Ga0070663_100258932 3300005455 Bacteria 1379
66 Ga0070678_100070555 3300005456 Bacteria 2613
67 Ga0070678_100445304 3300005456 Bacteria 1133
68 Ga0070678_101464625 3300005456 Bacteria 639
69 Ga0070681_10754852 3300005458 Bacteria 889
70 Ga0070681_11005459 3300005458 Bacteria 754
71 Ga0070685_10063525 3300005466 Bacteria 2168
72 Ga0070706_101167390 3300005467 Bacteria 708
73 Ga0070706_102016214 3300005467 Bacteria 523
74 Ga0070707_100051210 3300005468 Bacteria 3958
75 Ga0070698_100005507 3300005471 Bacteria 13825
76 Ga0070699_100400017 3300005518 Bacteria 1242
77 Ga0070679_100135552 3300005530 Bacteria 2443
78 Ga0070684_100079301 3300005535 Bacteria 2902
79 Ga0070684_100540774 3300005535 Bacteria 1081
80 Ga0070684_101512930 3300005535 Bacteria 633
81 Ga0068853_101127575 3300005539 Bacteria 757
82 Ga0070672_100029670 3300005543 Bacteria 4104
83 Ga0070672_100782766 3300005543 Bacteria 839
84 Ga0070686_100368128 3300005544 Bacteria 1084
85 Ga0070693_100071853 3300005547 Bacteria 2040
86 Ga0070665_100245542 3300005548 Bacteria 1791
87 Ga0070665_100862216 3300005548 Bacteria 919
88 Ga0068855_101015168 3300005563 Bacteria 871
89 Ga0068857_100039495 3300005577 Bacteria 4180
90 Ga0068857_100496736 3300005577 Bacteria 1145
91 Ga0068857_101381444 3300005577 Bacteria 685
92 Ga0068854_101003959 3300005578 Bacteria 739
93 Ga0068854_101245438 3300005578 Bacteria 668
94 Ga0068856_100429789 3300005614 Bacteria 1341
95 Ga0070702_100000907 3300005615 Bacteria 11562
96 Ga0070702_100268791 3300005615 Bacteria 1165
97 Ga0070702_100269722 3300005615 Bacteria 1163
98 Ga0068852_100196995 3300005616 Bacteria 1904
99 Ga0068852_100350854 3300005616 Bacteria 1441
100 Ga0068852_100452985 3300005616 Bacteria 1271
101 Ga0068864_100348249 3300005618 Bacteria 1397
102 Ga0068861_100042273 3300005719 Bacteria 3415
103 Ga0068861_100166143 3300005719 Bacteria 1825
104 Ga0068870_10773424 3300005840 Bacteria 669
105 Ga0068863_100000454 3300005841 Bacteria 41713
106 Ga0068863_100249306 3300005841 Bacteria 1715
107 Ga0068860_101818840 3300005843 Bacteria 631
108 Ga0068862_100000021 3300005844 Bacteria 218035
109 Ga0068862_100152764 3300005844 Bacteria 2056
110 Ga0081455_10014667 3300005937 Bacteria 7659
111 Ga0081455_10056135 3300005937 Bacteria 3346
112 Ga0081455_10230695 3300005937 Bacteria 1366
113 Ga0081455_10288833 3300005937 Bacteria 1182
114 Ga0081538_10002518 3300005981 Bacteria 17845
115 Ga0070717_10309524 3300006028 Bacteria 1405
116 Ga0075363_100355524 3300006048 Bacteria 856
117 Ga0075432_10001180 3300006058 Bacteria 8368
118 Ga0075432_10001981 3300006058 Bacteria 6810
119 Ga0070716_100228081 3300006173 Bacteria 1255
120 Ga0070712_100328567 3300006175 Bacteria 1245
121 Ga0075427_10006958 3300006194 Bacteria 1654
122 Ga0075366_10216500 3300006195 Bacteria 1166
123 Ga0097621_100161859 3300006237 Bacteria 1924
124 Ga0097621_101129317 3300006237 Bacteria 736
125 Ga0075370_10188764 3300006353 Bacteria 1214
126 Ga0075370_10381386 3300006353 Bacteria 845
127 Ga0068871_100103154 3300006358 Bacteria 2391
128 Ga0075428_100000040 3300006844 Bacteria 102788
129 Ga0075428_100100897 3300006844 Bacteria 3147
130 Ga0075428_100355768 3300006844 Bacteria 1571
131 Ga0075428_100576073 3300006844 Bacteria 1203
132 Ga0075428_101221817 3300006844 Bacteria 792
133 Ga0075430_100138383 3300006846 Bacteria 2028
134 Ga0075430_100157070 3300006846 Bacteria 1893
135 Ga0075431_100105764 3300006847 Bacteria 2903
136 Ga0075433_10004850 3300006852 Bacteria 10519
137 Ga0075433_10029068 3300006852 Bacteria 4706
138 Ga0075434_100003049 3300006871 Bacteria 14905
139 Ga0075429_100072200 3300006880 Bacteria 3005
140 Ga0075429_100159841 3300006880 Bacteria 1973
141 Ga0068865_100126898 3300006881 Bacteria 1906
142 Ga0068865_100128479 3300006881 Bacteria 1895
143 Ga0075436_100008198 3300006914 Bacteria 7150
144 Ga0097620_100002262 3300006931 Bacteria 19531
145 Ga0075435_100005162 3300007076 Bacteria 9080
146 Ga0075435_100018949 3300007076 Bacteria 5245
147 Ga0105244_10043572 3300009036 Bacteria 2315
148 Ga0105240_10245419 3300009093 Bacteria 2074
149 Ga0105240_10900637 3300009093 Bacteria 952
150 Ga0111539_10000158 3300009094 Bacteria 76916
151 Ga0111539_10006978 3300009094 Bacteria 14495
152 Ga0111539_10642916 3300009094 Bacteria 1235
153 Ga0105245_10075454 3300009098 Bacteria 3070
154 Ga0105245_10149576 3300009098 Bacteria 2206
155 Ga0105245_10184993 3300009098 Bacteria 1993
156 Ga0105247_10154969 3300009101 Bacteria 1513
157 Ga0114129_10003880 3300009147 Bacteria 21096
158 Ga0114129_10501662 3300009147 Bacteria 1585
159 Ga0105243_10287583 3300009148 Bacteria 1484
160 Ga0105243_10346250 3300009148 Bacteria 1363
161 Ga0105241_11365860 3300009174 Bacteria 677
162 Ga0105242_10077206 3300009176 Bacteria 2778
163 Ga0105242_10226239 3300009176 Bacteria 1674
164 Ga0105242_11030276 3300009176 Bacteria 833
165 Ga0105248_10132883 3300009177 Bacteria 2808
166 Ga0105248_11220244 3300009177 Bacteria 850
167 Ga0105237_10342779 3300009545 Bacteria 1498
168 Ga0105237_10711945 3300009545 Bacteria 1010
169 Ga0105238_10064212 3300009551 Bacteria 3672
170 Ga0105238_10090480 3300009551 Bacteria 3047
171 Ga0105238_10286796 3300009551 Bacteria 1628
172 Ga0105238_10355131 3300009551 Bacteria 1455
173 Ga0105238_10787131 3300009551 Bacteria 966
174 Ga0105238_12042347 3300009551 Bacteria 607
175 Ga0105249_10030399 3300009553 Bacteria 4882
176 Ga0105249_10055105 3300009553 Bacteria 3636
177 Ga0105249_10121062 3300009553 Bacteria 2487
178 Ga0105249_10255352 3300009553 Bacteria 1739
179 Ga0105249_10795882 3300009553 Bacteria 1009
180 Ga0105249_13426761 3300009553 Bacteria 510
181 Ga0105239_10122430 3300010375 Bacteria 2890
182 Ga0105239_10513745 3300010375 Bacteria 1362
183 Ga0105239_12627641 3300010375 Bacteria 587
184 Ga0105246_10052545 3300011119 Bacteria 2801
185 Ga0157325_1002978 3300012485 Bacteria 904
186 Ga0157319_1027569 3300012497 Bacteria 594
187 Ga0157319_1027913 3300012497 Bacteria 592
188 Ga0157345_1009711 3300012498 Bacteria 826
189 Ga0157345_1046666 3300012498 Bacteria 539
190 Ga0157342_1002723 3300012507 Bacteria 1459
191 Ga0157326_1024626 3300012513 Bacteria 764
192 Ga0154016_120491 3300013045 Bacteria 502
193 Ga0157370_10086887 3300013104 Bacteria 2937
194 Ga0157370_11322111 3300013104 Bacteria 649
195 Ga0157369_10468414 3300013105 Bacteria 1304
196 Ga0157369_10761392 3300013105 Bacteria 996
197 Ga0157374_10397847 3300013296 Bacteria 1374
198 Ga0163162_10070044 3300013306 Bacteria 3559
199 Ga0163162_10107812 3300013306 Bacteria 2881
200 Ga0163162_10260383 3300013306 Bacteria 1866
201 Ga0163162_11116454 3300013306 Bacteria 893
202 Ga0157372_10014531 3300013307 Bacteria 8425
203 Ga0157372_10022090 3300013307 Bacteria 6882
204 Ga0157372_10299596 3300013307 Bacteria 1870
205 Ga0157372_10391438 3300013307 Bacteria 1619
206 Ga0157372_11395815 3300013307 Bacteria 807
207 Ga0157372_11942601 3300013307 Bacteria 676
208 Ga0157375_10126072 3300013308 Bacteria 2675
209 Ga0157375_10221685 3300013308 Bacteria 2049
210 Ga0157375_10683629 3300013308 Bacteria 1181
211 Ga0157375_11638960 3300013308 Bacteria 761
212 Ga0163163_10038653 3300014325 Bacteria 4652
213 Ga0163163_10050064 3300014325 Bacteria 4113
214 Ga0163163_10211338 3300014325 Bacteria 1989
215 Ga0163163_10749520 3300014325 Bacteria 1040
216 Ga0163163_11073078 3300014325 Bacteria 868
217 Ga0163163_11130466 3300014325 Bacteria 846
218 Ga0163163_12145644 3300014325 Bacteria 618
219 Ga0157380_10197669 3300014326 Bacteria 1781
220 Ga0157380_10326842 3300014326 Bacteria 1424
221 Ga0157380_10999637 3300014326 Bacteria 870
222 Ga0157377_10166507 3300014745 Bacteria 1375
223 Ga0157377_11319933 3300014745 Bacteria 565
224 Ga0157379_10969577 3300014968 Bacteria 809
225 Ga0157379_11024236 3300014968 Bacteria 788
226 Ga0157376_10506599 3300014969 Bacteria 1187
227 Ga0157376_11910279 3300014969 Bacteria 631
228 Ga0163161_10017982 3300017792 Bacteria 4955
229 Ga0163161_10667106 3300017792 Bacteria 863
230 Ga0163161_11589849 3300017792 Bacteria 576
231 Ga0197907_11084971 3300020069 Bacteria 1053
232 Ga0197907_11163051 3300020069 Bacteria 745
233 Ga0197907_11402576 3300020069 Bacteria 1027
234 Ga0197907_11507371 3300020069 Bacteria 1158
235 Ga0206356_10235624 3300020070 Bacteria 529
236 Ga0206356_10342838 3300020070 Bacteria 2469
237 Ga0206356_11663862 3300020070 Bacteria 865
238 Ga0206349_1119767 3300020075 Bacteria 1130
239 Ga0206349_1227335 3300020075 Bacteria 820
240 Ga0206349_1295472 3300020075 Bacteria 725
241 Ga0206355_1018285 3300020076 Bacteria 1011
242 Ga0206355_1157355 3300020076 Bacteria 865
243 Ga0206355_1196559 3300020076 Bacteria 1173
244 Ga0206355_1290850 3300020076 Bacteria 616
245 Ga0206355_1436410 3300020076 Bacteria 796
246 Ga0206355_1678641 3300020076 Bacteria 534
247 Ga0206351_10242066 3300020077 Bacteria 741
248 Ga0206351_10349906 3300020077 Bacteria 1858
249 Ga0206351_10925769 3300020077 Bacteria 738
250 Ga0206352_10728115 3300020078 Bacteria 1780
251 Ga0206352_11090449 3300020078 Bacteria 859
252 Ga0206352_11355473 3300020078 Bacteria 1932
253 Ga0206350_10685797 3300020080 Bacteria 1131
254 Ga0206354_10144092 3300020081 Bacteria 802
255 Ga0206354_10201171 3300020081 Bacteria 1641
256 Ga0206354_10406115 3300020081 Bacteria 1265
257 Ga0206354_10479002 3300020081 Bacteria 1500
258 Ga0206354_10770711 3300020081 Bacteria 1110
259 Ga0206354_11652329 3300020081 Bacteria 1264
260 Ga0206353_10223354 3300020082 Bacteria 4430
261 Ga0206353_10268640 3300020082 Bacteria 580
262 Ga0206353_10515275 3300020082 Bacteria 510
263 Ga0206353_10609952 3300020082 Bacteria 582
264 Ga0206353_10743311 3300020082 Bacteria 1463
265 Ga0206353_10835504 3300020082 Bacteria 3910
266 Ga0206353_10856742 3300020082 Bacteria 1540
267 Ga0206353_11166848 3300020082 Bacteria 661
268 Ga0154015_1121433 3300020610 Bacteria 1599
269 Ga0154015_1313599 3300020610 Bacteria 929
270 Ga0154015_1611020 3300020610 Bacteria 762
271 Ga0154015_1670310 3300020610 Bacteria 1575
272 Ga0207682_10234516 3300025893 Bacteria 851
273 Ga0207642_10501364 3300025899 Bacteria 743
274 Ga0207688_10196028 3300025901 Bacteria 1210
275 Ga0207688_10228263 3300025901 Bacteria 1123
276 Ga0207688_10257878 3300025901 Bacteria 1058
277 Ga0207680_10160003 3300025903 Bacteria 1509
278 Ga0207647_10206425 3300025904 Bacteria 1136
279 Ga0207685_10012727 3300025905 Bacteria 2578
280 Ga0207699_10093442 3300025906 Bacteria 1893
281 Ga0207699_10301989 3300025906 Bacteria 1118
282 Ga0207643_10855511 3300025908 Bacteria 589
283 Ga0207705_11093888 3300025909 Bacteria 614
284 Ga0207707_10002485 3300025912 Bacteria 16588
285 Ga0207707_10430211 3300025912 Bacteria 1131
286 Ga0207660_10035116 3300025917 Bacteria 3478
287 Ga0207660_10363262 3300025917 Bacteria 1162
288 Ga0207662_10190591 3300025918 Bacteria 1323
289 Ga0207657_10015478 3300025919 Bacteria 7389
290 Ga0207657_10782258 3300025919 Bacteria 738
291 Ga0207649_10818135 3300025920 Bacteria 728
292 Ga0207652_10125908 3300025921 Bacteria 2282
293 Ga0207652_10196152 3300025921 Bacteria 1816
294 Ga0207652_10489013 3300025921 Bacteria 1108
295 Ga0207652_11350694 3300025921 Bacteria 616
296 Ga0207646_10068183 3300025922 Bacteria 3177
297 Ga0207681_10365729 3300025923 Bacteria 1158
298 Ga0207694_10063730 3300025924 Bacteria 2872
299 Ga0207694_10664129 3300025924 Bacteria 878
300 Ga0207694_10911313 3300025924 Bacteria 743
301 Ga0207650_10200313 3300025925 Bacteria 1599
302 Ga0207650_10374309 3300025925 Bacteria 1175
303 Ga0207650_11029933 3300025925 Bacteria 700
304 Ga0207659_10158333 3300025926 Bacteria 1775
305 Ga0207659_10222556 3300025926 Bacteria 1518
306 Ga0207687_10159895 3300025927 Bacteria 1728
307 Ga0207687_10402656 3300025927 Bacteria 1126
308 Ga0207700_10159457 3300025928 Bacteria 1872
309 Ga0207700_10176622 3300025928 Bacteria 1785
310 Ga0207700_10377374 3300025928 Bacteria 1239
311 Ga0207664_10114979 3300025929 Bacteria 2243
312 Ga0207664_10337414 3300025929 Bacteria 1332
313 Ga0207664_10460888 3300025929 Bacteria 1135
314 Ga0207644_11276549 3300025931 Bacteria 617
315 Ga0207690_10540821 3300025932 Bacteria 946
316 Ga0207690_11464286 3300025932 Bacteria 571
317 Ga0207706_10475953 3300025933 Bacteria 1079
318 Ga0207706_10784118 3300025933 Bacteria 810
319 Ga0207686_10131812 3300025934 Bacteria 1715
320 Ga0207686_11719904 3300025934 Bacteria 519
321 Ga0207709_10010363 3300025935 Bacteria 5132
322 Ga0207709_10021535 3300025935 Bacteria 3651
323 Ga0207709_10395892 3300025935 Bacteria 1055
324 Ga0207709_10531216 3300025935 Bacteria 922
325 Ga0207669_10087605 3300025937 Bacteria 2017
326 Ga0207669_10101646 3300025937 Bacteria 1902
327 Ga0207704_10228747 3300025938 Bacteria 1381
328 Ga0207691_10314884 3300025940 Bacteria 1342
329 Ga0207691_10844915 3300025940 Bacteria 768
330 Ga0207711_10152956 3300025941 Bacteria 2083
331 Ga0207689_10146104 3300025942 Bacteria 1948
332 Ga0207689_10159920 3300025942 Bacteria 1856
333 Ga0207661_10052660 3300025944 Bacteria 3253
334 Ga0207661_10432291 3300025944 Bacteria 1197
335 Ga0207661_10760121 3300025944 Bacteria 892
336 Ga0207679_11058376 3300025945 Bacteria 744
337 Ga0207667_10816517 3300025949 Bacteria 928
338 Ga0207651_10229927 3300025960 Bacteria 1505
339 Ga0207712_10061090 3300025961 Bacteria 2673
340 Ga0207712_10157879 3300025961 Bacteria 1759
341 Ga0207712_10186765 3300025961 Bacteria 1633
342 Ga0207712_10806069 3300025961 Bacteria 826
343 Ga0207668_10086951 3300025972 Bacteria 2285
344 Ga0207668_10240624 3300025972 Bacteria 1464
345 Ga0207668_10647785 3300025972 Bacteria 924
346 Ga0207640_10552062 3300025981 Bacteria 968
347 Ga0207640_11497903 3300025981 Bacteria 606
348 Ga0207658_10306074 3300025986 Bacteria 1371
349 Ga0207703_10018834 3300026035 Bacteria 5392
350 Ga0207703_11214405 3300026035 Bacteria 725
351 Ga0207678_10041027 3300026067 Bacteria 4012
352 Ga0207678_10490055 3300026067 Bacteria 1071
353 Ga0207708_10063816 3300026075 Bacteria 2814
354 Ga0207708_10223277 3300026075 Bacteria 1510
355 Ga0207702_11610480 3300026078 Bacteria 642
356 Ga0207641_10142869 3300026088 Bacteria 2162
357 Ga0207676_10159232 3300026095 Bacteria 1954
358 Ga0207674_10032541 3300026116 Bacteria 5469
359 Ga0207674_10379395 3300026116 Bacteria 1367
360 Ga0207674_11243936 3300026116 Bacteria 714
361 Ga0207675_100078604 3300026118 Bacteria 3091
362 Ga0207675_100158617 3300026118 Bacteria 2157
363 Ga0207683_10135451 3300026121 Bacteria 2217
364 Ga0207698_11113946 3300026142 Bacteria 802
365 Ga0209813_10377924 3300027866 Bacteria 566
366 Ga0207428_10002308 3300027907 Bacteria 19098
367 Ga0207428_10010072 3300027907 Bacteria 8461
368 Ga0268266_10146171 3300028379 Bacteria 2126
369 Ga0268265_10000034 3300028380 Bacteria 218695
370 Ga0268265_10131451 3300028380 Bacteria 2081
371 Ga0268264_10248854 3300028381 Bacteria 1650
372 Ga0265338_10006730 3300028800 Bacteria 14513
373 Ga0265338_10008525 3300028800 Bacteria 12418
374 Ga0311001_1011636 3300029277 Bacteria 750
375 Ga0265324_10019023 3300029957 Bacteria 2476
376 Ga0307512_10227811 3300030522 Bacteria 963
377 Ga0316181_1015560 3300030744 Bacteria 810
378 Ga0265328_10182671 3300031239 Bacteria 793
379 Ga0265331_10000024 3300031250 Bacteria 235118
380 Ga0265327_10000079 3300031251 Bacteria 206892
381 Ga0265327_10000809 3300031251 Bacteria 47572
382 Ga0265316_10557545 3300031344 Bacteria 815
383 Ga0307509_10339485 3300031507 Bacteria 1230
384 Ga0307408_100004069 3300031548 Bacteria 9974
385 Ga0307408_100015031 3300031548 Bacteria 5150
386 Ga0307408_100089661 3300031548 Bacteria 2319
387 Ga0307408_101458443 3300031548 Bacteria 646
388 Ga0310117_101992 3300031592 Bacteria 2009
389 Ga0310117_109033 3300031592 Bacteria 1061
390 Ga0310103_103486 3300031614 Bacteria 1989
391 Ga0310108_106062 3300031633 Bacteria 1365
392 Ga0310111_121340 3300031667 Bacteria 786
393 Ga0310119_115941 3300031686 Bacteria 850
394 Ga0316579_10027372 3300031691 Bacteria 2589
395 Ga0316576_10002632 3300031727 Bacteria 10251
396 Ga0316576_10005103 3300031727 Bacteria 7967
397 Ga0316576_10137429 3300031727 Bacteria 1839
398 Ga0316576_10285713 3300031727 Bacteria 1235
399 Ga0316578_10041347 3300031728 Bacteria 2669
400 Ga0316578_10222265 3300031728 Bacteria 1135
401 Ga0316578_10291459 3300031728 Bacteria 976
402 Ga0307405_10001230 3300031731 Bacteria 10654
403 Ga0307405_10039301 3300031731 Bacteria 2858
404 Ga0307405_10404843 3300031731 Bacteria 1069
405 Ga0307405_11039857 3300031731 Bacteria 701
406 Ga0316577_10073785 3300031733 Bacteria 1905
407 Ga0307413_10002256 3300031824 Bacteria 7785
408 Ga0307413_10016216 3300031824 Bacteria 3841
409 Ga0307413_10018584 3300031824 Bacteria 3652
410 Ga0307413_10096108 3300031824 Bacteria 1944
411 Ga0307413_10324346 3300031824 Bacteria 1178
412 Ga0307413_10370763 3300031824 Bacteria 1112
413 Ga0307518_10001053 3300031838 Bacteria 20666
414 Ga0307410_10000140 3300031852 Bacteria 25566
415 Ga0307410_10009228 3300031852 Bacteria 5520
416 Ga0307410_10013939 3300031852 Bacteria 4709
417 Ga0307410_10763663 3300031852 Bacteria 819
418 Ga0307410_11739119 3300031852 Bacteria 553
419 Ga0307406_10000083 3300031901 Bacteria 52941
420 Ga0307406_10013901 3300031901 Bacteria 4621
421 Ga0307406_10017422 3300031901 Bacteria 4181
422 Ga0307406_10026226 3300031901 Bacteria 3497
423 Ga0307406_10549167 3300031901 Bacteria 945
424 Ga0307407_10000354 3300031903 Bacteria 13805
425 Ga0307407_10010126 3300031903 Bacteria 4431
426 Ga0307407_10011756 3300031903 Bacteria 4182
427 Ga0307407_10014812 3300031903 Bacteria 3830
428 Ga0307407_10017034 3300031903 Bacteria 3634
429 Ga0307412_10065993 3300031911 Bacteria 2451
430 Ga0307412_10229969 3300031911 Bacteria 1427
431 Ga0307409_100000915 3300031995 Bacteria 13685
432 Ga0307409_100001294 3300031995 Bacteria 12130
433 Ga0307409_100002255 3300031995 Bacteria 9972
434 Ga0307409_100395561 3300031995 Bacteria 1318
435 Ga0307409_100413056 3300031995 Bacteria 1292
436 Ga0307409_102821537 3300031995 Bacteria 513
437 Ga0307416_100000105 3300032002 Bacteria 51970
438 Ga0307416_100124593 3300032002 Bacteria 2305
439 Ga0307416_100233955 3300032002 Bacteria 1774
440 Ga0307416_100418303 3300032002 Bacteria 1383
441 Ga0307416_101400895 3300032002 Bacteria 805
442 Ga0307416_101588766 3300032002 Bacteria 759
443 Ga0307414_10062118 3300032004 Bacteria 2649
444 Ga0307414_10064685 3300032004 Bacteria 2605
445 Ga0307414_10175029 3300032004 Bacteria 1720
446 Ga0307411_10000440 3300032005 Bacteria 14243
447 Ga0307411_10371610 3300032005 Bacteria 1173
448 Ga0307415_100060966 3300032126 Bacteria 2609
449 Ga0307415_100069969 3300032126 Bacteria 2462
450 Ga0316580_10021174 3300032139 Bacteria 2003
451 Ga0316593_10023162 3300032168 Bacteria 1958
452 Ga0316593_10138446 3300032168 Bacteria 881
453 Ga0316592_1018302 3300033524 Bacteria 1475
454 Ga0316588_1055751 3300033528 Bacteria 961
455 Ga0316596_1024805 3300033541 Bacteria 1541
456 Ga0373959_0080415 3300034820 Bacteria 750
457 Ga0373959_0209763 3300034820 Bacteria 518
458 Ga0373952_0195135 3300035092 Bacteria 590
459 Ga0373939_0223712 3300035114 Bacteria 722
460 Ga0373960_0098492 3300035121 Bacteria 945
461 Ga0373960_0225759 3300035121 Bacteria 672
462 Ga0373946_0582352 3300035171 Bacteria 579
463 Ga0316574_0057919 3300035398 Bacteria 2426
464 Ga0316574_0070325 3300035398 Bacteria 2210
465 Ga0373931_0081714 3300035691 Bacteria 1785
466 Ga0373931_0517022 3300035691 Bacteria 772
467 Ga0373935_0839745 3300035692 Bacteria 679
468 Ga0373933_0057797 3300035724 Bacteria 2332
469 Ga0310112_028666 3300036458 Bacteria 767
470 Ga0372808_007578 3300036459 Bacteria 1488
471 Ga0310109_002515 3300036534 Bacteria 2068
472 Ga0316582_0028367 3300036647 Bacteria 3391
473 Ga0316582_0177530 3300036647 Bacteria 1448
474 Ga0316582_0447062 3300036647 Bacteria 891
475 Ga0316584_0020659 3300036712 Bacteria 4778
476 Ga0316584_0077317 3300036712 Bacteria 2493
477 Ga0316584_0168076 3300036712 Bacteria 1628
478 Ga0316584_0702136 3300036712 Bacteria 693
479 Ga0373925_0000030 3300037068 Bacteria 146196
480 Ga0373925_1686850 3300037068 Bacteria 517
481 Ga0395899_0147893 3300037312 Bacteria 1667
482 Ga0395900_0064278 3300037418 Bacteria 3772
483 Ga0395900_0327705 3300037418 Bacteria 1510
484 Ga0395898_0010483 3300037466 Bacteria 9687
485 Ga0395898_0925617 3300037466 Bacteria 809
486 Ga0395905_0844856 3300037471 Bacteria 819
487 Ga0395901_0092735 3300038443 Bacteria 3161
488 Ga0395901_0504819 3300038443 Bacteria 1231
489 Ga0395901_0554238 3300038443 Bacteria 1165
490 Ga0395901_0864788 3300038443 Bacteria 888
491 Ga0436360_0655317 3300039438 Bacteria 765
492 Ga0436361_0429175 3300039447 Bacteria 810
493 Ga0436361_0461818 3300039447 Bacteria 521
494 Ga0436363_0226958 3300039450 Bacteria 1557
495 Ga0439465_0106889 3300041413 Bacteria 971
496 Ga0451792_00917 3300041445 Bacteria 611
497 Ga0451791_0268782 3300041451 Bacteria 541
498 Ga0451791_0481282 3300041451 Bacteria 723
499 Ga0451793_0067162 3300041452 Bacteria 4335
500 Ga0451797_0289670 3300041453 Bacteria 1251
501 Ga0451841_1179883 3300041498 Bacteria 916
502 Ga0451849_0375908 3300041505 Bacteria 1143
503 Ga0451843_0190972 3300041509 Bacteria 1640
504 Ga0451853_2063332 3300041512 Bacteria 664
505 Ga0451853_2978480 3300041512 Bacteria 1075
506 Ga0439442_071082 3300042002 Bacteria 741
507 Ga0439448_0165847 3300042005 Bacteria 770
508 Ga0439448_0189147 3300042005 Bacteria 720
509 Ga0439448_0292498 3300042005 Bacteria 578
510 Ga0439450_002148 3300042008 Bacteria 3043
511 Ga0439450_215208 3300042008 Bacteria 516
512 Ga0439463_028178 3300042016 Bacteria 1414
513 Ga0439463_039450 3300042016 Bacteria 1199
514 Ga0439463_069799 3300042016 Bacteria 900
515 Ga0439458_0117229 3300042157 Bacteria 699
516 Ga0439435_0004240 3300042436 Bacteria 3068
517 Ga0450901_034233 3300042533 Bacteria 566
518 Ga0439440_0020429 3300042993 Bacteria 1485
519 Ga0439440_0173739 3300042993 Bacteria 628
520 Ga0466969_0230832 3300044656 Bacteria 841
521 Ga0466972_0009895 3300044658 Bacteria 4785
522 Ga0466972_0179414 3300044658 Bacteria 993
523 Ga0466961_0145095 3300044693 Bacteria 1484
524 Ga0466963_0010740 3300044694 Bacteria 5558
525 Ga0466964_0099289 3300044706 Bacteria 1281
526 Ga0466968_0207093 3300044735 Bacteria 920
527 Ga0466968_0292792 3300044735 Bacteria 781
528 Ga0466970_0418659 3300044765 Bacteria 766
529 Ga0466970_0460429 3300044765 Bacteria 730
530 Ga0466970_0558398 3300044765 Bacteria 662
531 Ga0466960_0222009 3300044901 Bacteria 1040
532 Ga0466967_0623253 3300045976 Bacteria 1065
533 Ga0495603_0093149 3300046455 Bacteria 1761
534 Ga0495603_0303455 3300046455 Bacteria 917
535 Ga0495591_108979 3300046458 Bacteria 681
536 Ga0495629_0514530 3300046459 Bacteria 806
537 Ga0495629_1034284 3300046459 Bacteria 533
538 Ga0495641_0168331 3300046461 Bacteria 980
539 Ga0495641_0243895 3300046461 Bacteria 807
540 Ga0495653_0077303 3300046463 Bacteria 2472
541 Ga0495653_0085165 3300046463 Bacteria 2326
542 Ga0495582_0506150 3300046473 Bacteria 698
543 Ga0495639_0453772 3300046475 Bacteria 651
544 Ga0495584_0139992 3300046491 Bacteria 1229
545 Ga0495584_0514673 3300046491 Bacteria 610
546 Ga0495616_0086476 3300046513 Bacteria 1491
547 Ga0495620_0080177 3300046515 Bacteria 1321
548 Ga0495631_0211919 3300046518 Bacteria 828
549 Ga0495643_0367837 3300046522 Bacteria 640
550 Ga0495644_0383101 3300046523 Bacteria 556
551 Ga0495663_0358683 3300046525 Bacteria 532
552 Ga0495586_0073166 3300046535 Bacteria 1875
553 Ga0495587_0440186 3300046536 Bacteria 722
554 Ga0495597_0137940 3300046542 Bacteria 1008
555 Ga0495633_0413595 3300046558 Bacteria 610
556 Ga0495667_0263861 3300046559 Bacteria 1095
557 Ga0495667_0358388 3300046559 Bacteria 921
558 Ga0495656_0440684 3300046615 Bacteria 685
559 Ga0495668_0326107 3300046616 Bacteria 842
560 Ga0495668_0484265 3300046616 Bacteria 682
561 Ga0495635_0409138 3300046663 Bacteria 900
562 Ga0495661_0357940 3300046665 Bacteria 717
563 Ga0495599_0837542 3300046678 Bacteria 524
564 Ga0495647_0335915 3300046681 Bacteria 686
565 Ga0495658_0987534 3300046683 Bacteria 538
566 Ga0495669_0603203 3300046684 Bacteria 534
567 Ga0495613_0273364 3300046689 Bacteria 1175
568 Ga0495670_0157041 3300046691 Bacteria 1194
569 Ga0495670_0270954 3300046691 Bacteria 907
570 Ga0495670_0527014 3300046691 Bacteria 642
571 Ga0495649_0256083 3300046694 Bacteria 898
572 Ga0495589_0082995 3300046794 Bacteria 1558
573 Ga0495589_0526336 3300046794 Bacteria 539
574 Ga0495600_0327751 3300046809 Bacteria 962
575 Ga0495581_0140462 3300047315 Bacteria 1409
576 Ga0495674_0313331 3300047319 Bacteria 1280
577 Ga0495674_1074190 3300047319 Bacteria 614
578 Ga0495676_0345889 3300047321 Bacteria 995
579 Ga0495680_0155040 3300047322 Bacteria 1667
580 Ga0495680_0216510 3300047322 Bacteria 1369
581 Ga0495680_0514356 3300047322 Bacteria 811
582 Ga0495675_0412514 3300047444 Bacteria 786
583 Ga0495677_0294625 3300047445 Bacteria 638
584 Ga0495686_0240812 3300047472 Bacteria 1020
585 Ga0495615_0028206 3300048090 Bacteria 1324
586 Ga0496100_0119030 3300048903 Bacteria 1845
587 Ga0496100_0238461 3300048903 Bacteria 1341
588 Ga0496101_0019994 3300048904 Bacteria 4579
589 Ga0496101_0061151 3300048904 Bacteria 2734
590 Ga0496101_0257440 3300048904 Bacteria 1360
591 Ga0496101_0986381 3300048904 Bacteria 663
592 Ga0496102_0001262 3300048905 Bacteria 22825
593 Ga0496102_0053791 3300048905 Bacteria 3669
594 Ga0496102_0161323 3300048905 Bacteria 2109
595 Ga0496102_1758799 3300048905 Bacteria 537
596 Ga0496102_1874164 3300048905 Bacteria 516
597 Ga0496103_0031078 3300048906 Bacteria 3252
598 Ga0496104_0006711 3300048907 Bacteria 10131
599 Ga0496104_0049816 3300048907 Bacteria 3950
600 Ga0496104_0321250 3300048907 Bacteria 1461
601 Ga0496104_0472516 3300048907 Bacteria 1165
602 Ga0496104_0484103 3300048907 Bacteria 1149
603 Ga0496104_0540184 3300048907 Bacteria 1076
604 Ga0496104_0715566 3300048907 Bacteria 909
605 Ga0496104_1771473 3300048907 Bacteria 520
606 Ga0496105_0001730 3300048908 Bacteria 15611
607 Ga0496105_0050059 3300048908 Bacteria 3451
608 Ga0496105_0079671 3300048908 Bacteria 2705
609 Ga0496105_0083523 3300048908 Bacteria 2637
610 Ga0496105_0294706 3300048908 Bacteria 1305
611 Ga0496105_0819611 3300048908 Bacteria 706
612 Ga0496106_0052764 3300048909 Bacteria 3069
613 Ga0496106_0271673 3300048909 Bacteria 1357
614 Ga0496106_0620689 3300048909 Bacteria 865
615 Ga0496106_1526738 3300048909 Bacteria 513
616 Ga0496107_0304076 3300048910 Bacteria 1187
617 Ga0496107_0960406 3300048910 Bacteria 621
618 Ga0496108_0012599 3300048911 Bacteria 6888
619 Ga0496108_0171867 3300048911 Bacteria 1875
620 Ga0496108_0316607 3300048911 Bacteria 1360
621 Ga0496108_0333229 3300048911 Bacteria 1323
622 Ga0496108_0592332 3300048911 Bacteria 966
623 Ga0496108_0756814 3300048911 Bacteria 840
624 Ga0496109_0049566 3300048912 Bacteria 3823
625 Ga0496109_0110250 3300048912 Bacteria 2559
626 Ga0496109_0157817 3300048912 Bacteria 2125
627 Ga0496109_0408337 3300048912 Bacteria 1283
628 Ga0496109_0440015 3300048912 Bacteria 1231
629 Ga0496109_0458680 3300048912 Bacteria 1204
630 Ga0496109_0469672 3300048912 Bacteria 1188
631 Ga0496109_0708639 3300048912 Bacteria 944
632 Ga0496109_0797667 3300048912 Bacteria 882
633 Ga0496109_1431051 3300048912 Bacteria 627
634 Ga0496110_0118663 3300048913 Bacteria 2382
635 Ga0496110_0135103 3300048913 Bacteria 2228
636 Ga0496110_0352561 3300048913 Bacteria 1340
637 Ga0496110_0483052 3300048913 Bacteria 1128
638 Ga0496111_0096042 3300048914 Bacteria 2175
639 Ga0496111_0173930 3300048914 Bacteria 1600
640 Ga0496111_0248776 3300048914 Bacteria 1320
641 Ga0496111_0566069 3300048914 Bacteria 833
642 Ga0496111_0619529 3300048914 Bacteria 791
643 Ga0496112_0081356 3300048915 Bacteria 3203
644 Ga0496112_0442853 3300048915 Bacteria 1237
645 Ga0496112_0690699 3300048915 Bacteria 949
646 Ga0496113_0233780 3300048916 Bacteria 1466
647 Ga0496113_0703859 3300048916 Bacteria 806
648 Ga0496113_0870679 3300048916 Bacteria 713
649 Ga0496113_1396552 3300048916 Bacteria 542
650 Ga0496114_0001926 3300048917 Bacteria 15798
651 Ga0496114_0038344 3300048917 Bacteria 3964
652 Ga0496114_0138996 3300048917 Bacteria 2102
653 Ga0496114_0166808 3300048917 Bacteria 1917
654 Ga0496114_0256493 3300048917 Bacteria 1539
655 Ga0496114_0393476 3300048917 Bacteria 1227
656 Ga0496114_1273358 3300048917 Bacteria 622
657 Ga0496115_1280397 3300048918 Bacteria 547
658 Ga0496115_1382985 3300048918 Bacteria 520
659 Ga0496116_0002373 3300048919 Bacteria 19885
660 Ga0496117_0237112 3300048920 Bacteria 1004
661 Ga0496118_0520045 3300048921 Bacteria 587
662 Ga0496119_0044088 3300048922 Bacteria 2812
663 Ga0496119_0198133 3300048922 Bacteria 1041
664 Ga0496119_0216693 3300048922 Bacteria 982
665 Ga0496120_0195228 3300048923 Bacteria 984
666 Ga0496120_0402015 3300048923 Bacteria 605
667 Ga0496122_0058387 3300048925 Bacteria 2856
668 Ga0496123_0010979 3300048926 Bacteria 7922
669 Ga0496124_0002213 3300048927 Bacteria 25889
670 Ga0496124_0679787 3300048927 Bacteria 656
671 Ga0496125_0001581 3300048928 Bacteria 32367
672 Ga0496126_0075067 3300048929 Bacteria 3001
673 Ga0496126_0194489 3300048929 Bacteria 1716
674 Ga0496126_0523820 3300048929 Bacteria 944
675 Ga0496126_0588942 3300048929 Bacteria 878
676 Ga0501306_009589 3300049127 Bacteria 1203
677 Ga0501306_015346 3300049127 Bacteria 1019
678 Ga0501306_026797 3300049127 Bacteria 836
679 Ga0501308_022009 3300049128 Bacteria 804
680 Ga0501308_036095 3300049128 Bacteria 681
681 Ga0501309_016165 3300049129 Bacteria 1015
682 Ga0501310_025832 3300049130 Bacteria 758
683 Ga0501310_035609 3300049130 Bacteria 676
684 Ga0501310_055199 3300049130 Bacteria 582
685 Ga0501341_05137 3300049131 Bacteria 778
686 Ga0501305_008961 3300049161 Bacteria 1306
687 Ga0501305_055512 3300049161 Bacteria 673
688 Ga0501305_067339 3300049161 Bacteria 625
689 Ga0501305_083280 3300049161 Bacteria 577
690 Ga0501307_001156 3300049162 Bacteria 2137
691 Ga0501307_043731 3300049162 Bacteria 657
692 Ga0501290_063714 3300049513 Bacteria 599
693 Ga0501295_028005 3300049518 Bacteria 1091
694 Ga0501298_122577 3300049521 Bacteria 614
695 Ga0501312_065297 3300049528 Bacteria 637
696 Ga0501315_008928 3300049531 Bacteria 1176
697 Ga0501315_041240 3300049531 Bacteria 699
698 Ga0501316_000725 3300049532 Bacteria 2475
699 Ga0501316_010434 3300049532 Bacteria 1058
700 Ga0501316_016903 3300049532 Bacteria 891
701 Ga0501316_026652 3300049532 Bacteria 757
702 Ga0501316_030352 3300049532 Bacteria 721
703 Ga0501317_017269 3300049533 Bacteria 945
704 Ga0501317_020615 3300049533 Bacteria 889
705 Ga0501317_035452 3300049533 Bacteria 742
706 Ga0501317_072586 3300049533 Bacteria 583
707 Ga0501318_002229 3300049534 Bacteria 1652
708 Ga0501318_004185 3300049534 Bacteria 1371
709 Ga0501318_011409 3300049534 Bacteria 1004
710 Ga0501318_017173 3300049534 Bacteria 882
711 Ga0501318_046129 3300049534 Bacteria 636
712 Ga0501319_003460 3300049535 Bacteria 1056
713 Ga0501319_005368 3300049535 Bacteria 918
714 Ga0501320_001386 3300049536 Bacteria 1767
715 Ga0501321_015716 3300049537 Bacteria 894
716 Ga0501324_015603 3300049540 Bacteria 738
717 Ga0501325_002533 3300049541 Bacteria 1258
718 Ga0501333_017845 3300049549 Bacteria 551
719 Ga0501031_0011378 3300049568 Bacteria 5795
720 Ga0501031_0207457 3300049568 Bacteria 1277
721 Ga0501032_0148338 3300049569 Bacteria 1543
722 Ga0501032_0249983 3300049569 Bacteria 1151
723 Ga0501032_0671920 3300049569 Bacteria 657
724 Ga0501033_0097181 3300049570 Bacteria 2152
725 Ga0501033_0196799 3300049570 Bacteria 1441
726 Ga0501036_0079114 3300049572 Bacteria 2781
727 Ga0501036_0129089 3300049572 Bacteria 2134
728 Ga0501037_0023372 3300049573 Bacteria 4572
729 Ga0501037_0059277 3300049573 Bacteria 2793
730 Ga0501038_0006886 3300049574 Bacteria 10499
731 Ga0501038_0070271 3300049574 Bacteria 2973
732 Ga0501038_0503190 3300049574 Bacteria 926
733 Ga0501039_0011085 3300049575 Bacteria 6869
734 Ga0501039_0023822 3300049575 Bacteria 4700
735 Ga0501039_0408176 3300049575 Bacteria 1067
736 Ga0501039_1176406 3300049575 Bacteria 593
737 Ga0501040_0002385 3300049576 Bacteria 12078
738 Ga0501041_0017741 3300049577 Bacteria 4236
739 Ga0501041_0085818 3300049577 Bacteria 1941
740 Ga0501041_0439915 3300049577 Bacteria 827
741 Ga0501041_0951147 3300049577 Bacteria 552
742 Ga0501042_0011641 3300049578 Bacteria 5944
743 Ga0501042_0045484 3300049578 Bacteria 3128
744 Ga0501042_0637019 3300049578 Bacteria 775
745 Ga0501042_0673419 3300049578 Bacteria 752
746 Ga0501042_1191029 3300049578 Bacteria 555
747 Ga0501043_0512958 3300049579 Bacteria 894
748 Ga0501046_0038067 3300049580 Bacteria 3862
749 Ga0501046_0047532 3300049580 Bacteria 3402
750 Ga0501046_0112221 3300049580 Bacteria 2081
751 Ga0501048_0043352 3300049582 Bacteria 3220
752 Ga0501048_0089830 3300049582 Bacteria 2167
753 Ga0501067_0062551 3300049583 Bacteria 2060
754 Ga0501067_0197385 3300049583 Bacteria 1121
755 Ga0501068_0193008 3300049584 Bacteria 1290
756 Ga0501068_0509466 3300049584 Bacteria 781
757 Ga0501069_0195392 3300049585 Bacteria 1171
758 Ga0501069_0223491 3300049585 Bacteria 1095
759 Ga0501070_0119834 3300049586 Bacteria 2175
760 Ga0501071_0038797 3300049587 Bacteria 3404
761 Ga0501071_0064107 3300049587 Bacteria 2665
762 Ga0501071_0464948 3300049587 Bacteria 969
763 Ga0501072_0034644 3300049588 Bacteria 3957
764 Ga0501072_0056145 3300049588 Bacteria 3103
765 Ga0501073_0750530 3300049589 Bacteria 673
766 Ga0501074_0135977 3300049590 Bacteria 1758
767 Ga0501074_0283885 3300049590 Bacteria 1177
768 Ga0501075_0007351 3300049591 Bacteria 7640
769 Ga0501075_0082274 3300049591 Bacteria 2438
770 Ga0501075_0425808 3300049591 Bacteria 1012
771 Ga0501075_0935444 3300049591 Bacteria 659
772 Ga0501076_0058641 3300049592 Bacteria 3060
773 Ga0501076_0199285 3300049592 Bacteria 1634
774 Ga0501076_0806502 3300049592 Bacteria 774
775 Ga0501077_0034675 3300049593 Bacteria 3212
776 Ga0501077_0117008 3300049593 Bacteria 1689
777 Ga0501243_097585 3300049675 Bacteria 590
778 Ga0501253_045474 3300049683 Bacteria 902
779 Ga0501256_026448 3300049685 Bacteria 635
780 Ga0501257_181763 3300049686 Bacteria 596
781 Ga0501079_0013169 3300049741 Bacteria 6304
782 Ga0501079_0073812 3300049741 Bacteria 2637
783 Ga0501079_1007559 3300049741 Bacteria 656
784 Ga0501080_0282848 3300049742 Bacteria 1507
785 Ga0501080_0350384 3300049742 Bacteria 1333
786 Ga0501081_0029715 3300049743 Bacteria 3695
787 Ga0501081_0062905 3300049743 Bacteria 2575
788 Ga0501081_1094561 3300049743 Bacteria 603
789 Ga0501035_0051480 3300049822 Bacteria 3687
790 Ga0501035_0213964 3300049822 Bacteria 1648
791 Ga0501044_0424722 3300049823 Bacteria 1239
792 Ga0501045_0000468 3300049824 Bacteria 25084
793 Ga0501045_0096329 3300049824 Bacteria 2189
794 Ga0501045_0344378 3300049824 Bacteria 1109
795 Ga0501045_0570771 3300049824 Bacteria 838
796 Ga0501045_0656008 3300049824 Bacteria 775
797 Ga0501212_001768 3300049851 Bacteria 2497
798 nmdc:mga0k408_198574_c1 3300050493 Bacteria 1197
799 nmdc:mga04h51_414796_c1 3300050495 Bacteria 565
800 nmdc:mga07m45_228409_c1 3300050496 Bacteria 1083
801 nmdc:mga05p37_15070_c1 3300050507 Bacteria 9282
802 nmdc:mga09592_453860_c1 3300050508 Bacteria 1106
803 nmdc:mga09592_905622_c1 3300050508 Bacteria 741
804 nmdc:mga0qj67_79191_c1 3300050509 Bacteria 2631
805 nmdc:mga06r32_18393_c2 3300050510 Bacteria 3443
806 nmdc:mga08y16_1256243_c1 3300050511 Bacteria 709
807 nmdc:mga08y16_4667_c1 3300050511 Bacteria 14273
808 nmdc:mga08y16_9850_c1 3300050511 Bacteria 10034
809 nmdc:mga0n895_43468_c1 3300050512 Bacteria 4378
810 nmdc:mga0n895_53926_c1 3300050512 Bacteria 3953
811 nmdc:mga0rr50_24480_c1 3300050513 Bacteria 4181
812 nmdc:mga0rr50_3052_c1 3300050513 Bacteria 9585
813 nmdc:mga08x19_6548_c1 3300050514 Bacteria 6899
814 nmdc:mga0a205_1359_c1 3300050515 Bacteria 20623
815 nmdc:mga0a205_20778_c1 3300050515 Bacteria 6202
816 Ga0495601_0201140 3300053077 Bacteria 1302
817 Ga0495601_0226132 3300053077 Bacteria 1222
818 Ga0495655_0107662 3300053083 Bacteria 834
819 Ga0495595_0050945 3300053084 Bacteria 1918
820 Ga0495595_0365789 3300053084 Bacteria 729
821 Ga0495595_0537953 3300053084 Bacteria 596
822 Ga0495619_0058114 3300053085 Bacteria 2567
823 Ga0495619_0119445 3300053085 Bacteria 1807
824 Ga0495619_0732120 3300053085 Bacteria 671
825 Ga0500643_000189 3300053087 Bacteria 58813
826 Ga0500642_0456771 3300053130 Bacteria 547
827 Ga0500658_0357276 3300053134 Bacteria 670
828 Ga0500559_0001158 3300053136 Bacteria 15884
829 Ga0500559_0019522 3300053136 Bacteria 2863
830 Ga0500559_0346151 3300053136 Bacteria 695
831 Ga0500568_0000060 3300053139 Bacteria 107901
832 Ga0500573_0000007 3300053140 Bacteria 272970
833 Ga0500573_0008741 3300053140 Bacteria 5590
834 Ga0500573_0149065 3300053140 Bacteria 1282
835 Ga0500577_0229805 3300053142 Bacteria 804
836 Ga0500604_0031742 3300053151 Bacteria 1553
837 Ga0501084_0004201 3300054114 Bacteria 11745
838 Ga0501084_0066146 3300054114 Bacteria 3024
839 Ga0590071_067204 3300059421 Bacteria 881
840 Ga0590074_018119 3300059423 Bacteria 1204
841 Ga0590074_067245 3300059423 Bacteria 672
842 Ga0590077_061581 3300059426 Bacteria 851
843 Ga0587084_071805 3300059477 Bacteria 655
844 Ga0587066_035592 3300059490 Bacteria 912
845 Ga0587066_190003 3300059490 Bacteria 534
846 Ga0587080_040117 3300059503 Bacteria 850
847 Ga0587083_0048155 3300059505 Bacteria 920
848 Ga0587083_0060159 3300059505 Bacteria 854
849 Ga0587083_0074798 3300059505 Bacteria 794
850 Ga0587083_0092910 3300059505 Bacteria 739
851 Ga0587083_0220556 3300059505 Bacteria 551
852 Ga0587085_185473 3300059506 Bacteria 501
853 Ga0587090_036297 3300059510 Bacteria 848
854 Ga0587091_026119 3300059511 Bacteria 1061
855 Ga0587091_136190 3300059511 Bacteria 611
856 Ga0587092_024855 3300059512 Bacteria 953
857 Ga0587092_067437 3300059512 Bacteria 682
858 Ga0587092_163329 3300059512 Bacteria 505
859 Ga0587106_038726 3300059605 Bacteria 800
860 Ga0587106_108487 3300059605 Bacteria 575
861 Ga0587099_013927 3300059622 Bacteria 843
862 Ga0587099_051894 3300059622 Bacteria 549
863 Ga0587113_014730 3300059625 Bacteria 768
864 Ga0587113_038819 3300059625 Bacteria 564
865 Ga0587128_002154 3300059630 Bacteria 2007
866 Ga0587062_034423 3300059639 Bacteria 792
867 Ga0587067_136760 3300059640 Bacteria 603
868 Ga0587068_047030 3300059641 Bacteria 797
869 Ga0587069_034929 3300059642 Bacteria 832
870 Ga0587076_033932 3300059645 Bacteria 920
871 Ga0587079_060860 3300059647 Bacteria 818
872 Ga0587079_138740 3300059647 Bacteria 618
873 Ga0587114_118604 3300059655 Bacteria 533
874 Ga0587124_015948 3300059660 Bacteria 727
875 Ga0587111_0040840 3300060346 Bacteria 988
876 Ga0501082_0099795 3300060353 Bacteria 2510
877 Ga0501082_0343707 3300060353 Bacteria 1300
878 Ga0501082_1924828 3300060353 Bacteria 516
879 Ga0466962_0204286 3300061719 Bacteria 966
880 Ga0530510_0077998 3300061734 Bacteria 2407
881 Ga0530510_0144490 3300061734 Bacteria 1754
882 Ga0530510_0324334 3300061734 Bacteria 1155
883 Ga0530510_0841647 3300061734 Bacteria 700

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300014745 Ga0157377_11319933 Ga0157377_113199331 110
2 iso_pu_bacteria 2791355222 2793183530 113
3 3300048090 Ga0495615_0028206 Ga0495615_0028206_109_456 115
4 3300004785 Ga0058858_1321591 Ga0058858_13215911 116
5 3300004798 Ga0058859_11606581 Ga0058859_116065811 116
6 3300004801 Ga0058860_10075105 Ga0058860_100751051 116
7 3300005290 Ga0065712_10480791 Ga0065712_104807912 116
8 3300005331 Ga0070670_100176307 Ga0070670_1001763072 116
9 3300005347 Ga0070668_100520658 Ga0070668_1005206582 116
10 3300005354 Ga0070675_100140226 Ga0070675_1001402264 116
11 3300005355 Ga0070671_100157807 Ga0070671_1001578073 116
12 3300005356 Ga0070674_100055900 Ga0070674_1000559002 116
13 3300005364 Ga0070673_100133823 Ga0070673_1001338234 116
14 3300005365 Ga0070688_100246409 Ga0070688_1002464092 116
15 3300005438 Ga0070701_10178204 Ga0070701_101782042 116
16 3300005466 Ga0070685_10063525 Ga0070685_100635252 116
17 3300005543 Ga0070672_100029670 Ga0070672_1000296707 116
18 3300005544 Ga0070686_100368128 Ga0070686_1003681281 116
19 3300005615 Ga0070702_100269722 Ga0070702_1002697223 116
20 3300005618 Ga0068864_100348249 Ga0068864_1003482493 116
21 3300005841 Ga0068863_100249306 Ga0068863_1002493062 116
22 3300006237 Ga0097621_100161859 Ga0097621_1001618591 116
23 3300006358 Ga0068871_100103154 Ga0068871_1001031542 116
24 3300006881 Ga0068865_100126898 Ga0068865_1001268984 116
25 3300009176 Ga0105242_11030276 Ga0105242_110302761 116
26 3300009177 Ga0105248_10132883 Ga0105248_101328832 116
27 3300009553 Ga0105249_10255352 Ga0105249_102553524 116
28 3300013308 Ga0157375_10126072 Ga0157375_101260723 116
29 3300014325 Ga0163163_10050064 Ga0163163_100500645 116
30 3300014326 Ga0157380_10197669 Ga0157380_101976693 116
31 3300014969 Ga0157376_10506599 Ga0157376_105065992 116
32 3300017792 Ga0163161_10017982 Ga0163161_100179827 116
33 3300025918 Ga0207662_10190591 Ga0207662_101905913 116
34 3300025923 Ga0207681_10365729 Ga0207681_103657293 116
35 3300025925 Ga0207650_10374309 Ga0207650_103743092 116
36 3300025926 Ga0207659_10222556 Ga0207659_102225563 116
37 3300025931 Ga0207644_11276549 Ga0207644_112765492 116
38 3300025937 Ga0207669_10087605 Ga0207669_100876052 116
39 3300025940 Ga0207691_10314884 Ga0207691_103148841 116
40 3300025941 Ga0207711_10152956 Ga0207711_101529564 116
41 3300025960 Ga0207651_10229927 Ga0207651_102299274 116
42 3300025961 Ga0207712_10186765 Ga0207712_101867653 116
43 3300025972 Ga0207668_10647785 Ga0207668_106477852 116
44 3300025986 Ga0207658_10306074 Ga0207658_103060743 116
45 3300026075 Ga0207708_10223277 Ga0207708_102232772 116
46 3300026088 Ga0207641_10142869 Ga0207641_101428693 116
47 3300026095 Ga0207676_10159232 Ga0207676_101592323 116
48 3300031691 Ga0316579_10027372 Ga0316579_100273725 116
49 3300031727 Ga0316576_10002632 Ga0316576_100026329 116
50 3300031727 Ga0316576_10005103 Ga0316576_100051032 116
51 3300031727 Ga0316576_10137429 Ga0316576_101374293 116
52 3300031728 Ga0316578_10041347 Ga0316578_100413472 116
53 3300031728 Ga0316578_10222265 Ga0316578_102222652 116
54 3300031728 Ga0316578_10291459 Ga0316578_102914592 116
55 3300031733 Ga0316577_10073785 Ga0316577_100737853 116
56 3300031901 Ga0307406_10549167 Ga0307406_105491672 116
57 3300031903 Ga0307407_10011756 Ga0307407_100117567 116
58 3300031995 Ga0307409_100413056 Ga0307409_1004130562 116
59 3300032139 Ga0316580_10021174 Ga0316580_100211744 116
60 3300032168 Ga0316593_10023162 Ga0316593_100231623 116
61 3300033524 Ga0316592_1018302 Ga0316592_10183023 116
62 3300033528 Ga0316588_1055751 Ga0316588_10557513 116
63 3300033541 Ga0316596_1024805 Ga0316596_10248051 116
64 3300035398 Ga0316574_0057919 Ga0316574_0057919_631_987 116
65 3300035398 Ga0316574_0070325 Ga0316574_0070325_607_963 116
66 3300036647 Ga0316582_0028367 Ga0316582_0028367_644_1000 116
67 3300036647 Ga0316582_0177530 Ga0316582_0177530_324_680 116
68 3300036647 Ga0316582_0447062 Ga0316582_0447062_26_382 116
69 3300036712 Ga0316584_0020659 Ga0316584_0020659_612_968 116
70 3300036712 Ga0316584_0077317 Ga0316584_0077317_1003_1359 116
71 3300036712 Ga0316584_0168076 Ga0316584_0168076_591_947 116
72 3300046455 Ga0495603_0093149 Ga0495603_0093149_38_391 116
73 3300046681 Ga0495647_0335915 Ga0495647_0335915_176_529 116
74 3300048917 Ga0496114_0138996 Ga0496114_0138996_1688_2041 116
75 3300049127 Ga0501306_009589 Ga0501306_009589_211_612 116
76 3300049131 Ga0501341_05137 Ga0501341_05137_262_642 116
77 3300049161 Ga0501305_008961 Ga0501305_008961_86_487 116
78 3300050508 nmdc:mga09592_905622_c1 nmdc:mga09592_905622_c1_161_514 116
79 3300005467 Ga0070706_101167390 Ga0070706_1011673902 117
80 3300026075 Ga0207708_10063816 Ga0207708_100638162 117
81 3300039450 Ga0436363_0226958 Ga0436363_0226958_1180_1533 117
82 3300048919 Ga0496116_0002373 Ga0496116_0002373_13755_14114 117
83 3300048922 Ga0496119_0216693 Ga0496119_0216693_291_650 117
84 3300048923 Ga0496120_0195228 Ga0496120_0195228_405_764 117
85 3300048925 Ga0496122_0058387 Ga0496122_0058387_685_1044 117
86 3300048926 Ga0496123_0010979 Ga0496123_0010979_4495_4854 117
87 3300048927 Ga0496124_0002213 Ga0496124_0002213_14896_15255 117
88 3300048928 Ga0496125_0001581 Ga0496125_0001581_1403_1762 117
89 3300049532 Ga0501316_030352 Ga0501316_030352_21_380 117
90 3300059640 Ga0587067_136760 Ga0587067_136760_233_592 117
91 iso_pu_bacteria 2515154202 2516083118 117
92 iso_pu_bacteria 2867302475 2867307789 117
93 3300026078 Ga0207702_11610480 Ga0207702_116104802 118
94 3300031852 Ga0307410_11739119 Ga0307410_117391191 118
95 3300048912 Ga0496109_0408337 Ga0496109_0408337_235_639 118
96 3300048914 Ga0496111_0619529 Ga0496111_0619529_227_631 118
97 3300061734 Ga0530510_0841647 Ga0530510_0841647_170_526 118
98 iso_pu_bacteria 2585427649 2586060158 118
99 iso_pu_bacteria 2808606522 2809590855 118
100 iso_pu_bacteria 2899359706 2899368021 118
101 iso_pu_bacteria 2915768154 2915771875 118
102 3300006195 Ga0075366_10216500 Ga0075366_102165001 119
103 3300006353 Ga0075370_10381386 Ga0075370_103813861 119
104 3300006844 Ga0075428_100000040 Ga0075428_10000004019 119
105 3300009098 Ga0105245_10149576 Ga0105245_101495763 119
106 3300009148 Ga0105243_10287583 Ga0105243_102875832 119
107 3300009176 Ga0105242_10077206 Ga0105242_100772063 119
108 3300009545 Ga0105237_10711945 Ga0105237_107119452 119
109 3300009551 Ga0105238_10090480 Ga0105238_100904801 119
110 3300009553 Ga0105249_10055105 Ga0105249_100551053 119
111 3300010375 Ga0105239_12627641 Ga0105239_126276411 119
112 3300011119 Ga0105246_10052545 Ga0105246_100525453 119
113 3300013296 Ga0157374_10397847 Ga0157374_103978472 119
114 3300013306 Ga0163162_10070044 Ga0163162_100700443 119
115 3300013306 Ga0163162_11116454 Ga0163162_111164542 119
116 3300013307 Ga0157372_10022090 Ga0157372_100220909 119
117 3300013307 Ga0157372_10391438 Ga0157372_103914382 119
118 3300013307 Ga0157372_11942601 Ga0157372_119426012 119
119 3300013308 Ga0157375_10221685 Ga0157375_102216853 119
120 3300013308 Ga0157375_10683629 Ga0157375_106836292 119
121 3300014325 Ga0163163_12145644 Ga0163163_121456442 119
122 3300014326 Ga0157380_10326842 Ga0157380_103268422 119
123 3300014745 Ga0157377_10166507 Ga0157377_101665072 119
124 3300014968 Ga0157379_10969577 Ga0157379_109695771 119
125 3300029957 Ga0265324_10019023 Ga0265324_100190232 119
126 3300031239 Ga0265328_10182671 Ga0265328_101826711 119
127 3300031250 Ga0265331_10000024 Ga0265331_10000024185 119
128 3300031251 Ga0265327_10000079 Ga0265327_1000007960 119
129 3300034820 Ga0373959_0209763 Ga0373959_0209763_68_439 119
130 3300035121 Ga0373960_0098492 Ga0373960_0098492_227_598 119
131 3300035691 Ga0373931_0517022 Ga0373931_0517022_139_528 119
132 3300035724 Ga0373933_0057797 Ga0373933_0057797_753_1112 119
133 3300041451 Ga0451791_0481282 Ga0451791_0481282_218_583 119
134 3300041512 Ga0451853_2063332 Ga0451853_2063332_128_487 119
135 3300042002 Ga0439442_071082 Ga0439442_071082_30_410 119
136 3300044706 Ga0466964_0099289 Ga0466964_0099289_305_676 119
137 3300046455 Ga0495603_0303455 Ga0495603_0303455_332_721 119
138 3300048903 Ga0496100_0238461 Ga0496100_0238461_292_663 119
139 3300048904 Ga0496101_0061151 Ga0496101_0061151_1251_1619 119
140 3300048908 Ga0496105_0819611 Ga0496105_0819611_61_432 119
141 3300048911 Ga0496108_0592332 Ga0496108_0592332_113_484 119
142 3300048912 Ga0496109_0797667 Ga0496109_0797667_313_684 119
143 3300048916 Ga0496113_0703859 Ga0496113_0703859_368_739 119
144 3300049531 Ga0501315_008928 Ga0501315_008928_21_401 119
145 3300049534 Ga0501318_046129 Ga0501318_046129_217_597 119
146 3300049585 Ga0501069_0223491 Ga0501069_0223491_466_846 119
147 3300050496 nmdc:mga07m45_228409_c1 nmdc:mga07m45_228409_c1_590_949 119
148 3300053085 Ga0495619_0732120 Ga0495619_0732120_189_560 119
149 iso_pu_bacteria 2643221567 2643853149 119
150 iso_pu_bacteria 2643221624 2644137132 119
151 iso_pu_bacteria 2808606365 2808874556 119
152 iso_pu_bacteria 2811994882 2812375216 119
153 iso_pu_bacteria 2818991318 2819427971 119
154 iso_pu_bacteria 2818991458 2819668490 119
155 iso_pu_bacteria 2818991462 2819692318 119
156 iso_pu_bacteria 2818991469 2819730074 119
157 iso_pu_bacteria 2919446982 2919450776 119
158 iso_pu_bacteria 3001889506 3001891671 119
159 3300009094 Ga0111539_10642916 Ga0111539_106429163 120
160 3300012497 Ga0157319_1027913 Ga0157319_10279132 120
161 3300013105 Ga0157369_10761392 Ga0157369_107613923 120
162 3300025899 Ga0207642_10501364 Ga0207642_105013642 120
163 3300025933 Ga0207706_10784118 Ga0207706_107841182 120
164 3300031251 Ga0265327_10000809 Ga0265327_1000080915 120
165 3300031344 Ga0265316_10557545 Ga0265316_105575451 120
166 3300037312 Ga0395899_0147893 Ga0395899_0147893_441_809 120
167 3300037418 Ga0395900_0064278 Ga0395900_0064278_322_690 120
168 3300037466 Ga0395898_0010483 Ga0395898_0010483_9259_9627 120
169 3300037466 Ga0395898_0925617 Ga0395898_0925617_245_613 120
170 3300038443 Ga0395901_0092735 Ga0395901_0092735_2495_2863 120
171 3300038443 Ga0395901_0554238 Ga0395901_0554238_155_523 120
172 3300044658 Ga0466972_0179414 Ga0466972_0179414_228_608 120
173 3300044765 Ga0466970_0418659 Ga0466970_0418659_287_703 120
174 3300044765 Ga0466970_0460429 Ga0466970_0460429_311_691 120
175 3300044901 Ga0466960_0222009 Ga0466960_0222009_71_451 120
176 3300046459 Ga0495629_1034284 Ga0495629_1034284_143_511 120
177 3300046461 Ga0495641_0168331 Ga0495641_0168331_312_680 120
178 3300046461 Ga0495641_0243895 Ga0495641_0243895_231_599 120
179 3300046535 Ga0495586_0073166 Ga0495586_0073166_1085_1468 120
180 3300046536 Ga0495587_0440186 Ga0495587_0440186_209_583 120
181 3300046559 Ga0495667_0358388 Ga0495667_0358388_332_715 120
182 3300046678 Ga0495599_0837542 Ga0495599_0837542_28_411 120
183 3300048903 Ga0496100_0119030 Ga0496100_0119030_388_762 120
184 3300048905 Ga0496102_0001262 Ga0496102_0001262_8244_8612 120
185 3300048905 Ga0496102_1758799 Ga0496102_1758799_56_430 120
186 3300048907 Ga0496104_0321250 Ga0496104_0321250_701_1075 120
187 3300048909 Ga0496106_0052764 Ga0496106_0052764_758_1132 120
188 3300048909 Ga0496106_1526738 Ga0496106_1526738_99_482 120
189 3300048910 Ga0496107_0304076 Ga0496107_0304076_131_499 120
190 3300048910 Ga0496107_0960406 Ga0496107_0960406_189_572 120
191 3300048912 Ga0496109_0110250 Ga0496109_0110250_1930_2304 120
192 3300048912 Ga0496109_1431051 Ga0496109_1431051_157_525 120
193 3300048915 Ga0496112_0081356 Ga0496112_0081356_2067_2450 120
194 3300048916 Ga0496113_0870679 Ga0496113_0870679_210_593 120
195 3300048917 Ga0496114_0001926 Ga0496114_0001926_11683_12051 120
196 3300048917 Ga0496114_0393476 Ga0496114_0393476_183_566 120
197 3300048918 Ga0496115_1382985 Ga0496115_1382985_29_397 120
198 3300049161 Ga0501305_083280 Ga0501305_083280_185_556 120
199 3300049532 Ga0501316_016903 Ga0501316_016903_43_411 120
200 3300049533 Ga0501317_017269 Ga0501317_017269_35_403 120
201 3300049533 Ga0501317_035452 Ga0501317_035452_29_397 120
202 3300049535 Ga0501319_003460 Ga0501319_003460_678_1046 120
203 3300049540 Ga0501324_015603 Ga0501324_015603_349_720 120
204 3300049549 Ga0501333_017845 Ga0501333_017845_22_414 120
205 3300049568 Ga0501031_0011378 Ga0501031_0011378_594_962 120
206 3300049569 Ga0501032_0148338 Ga0501032_0148338_523_891 120
207 3300049570 Ga0501033_0097181 Ga0501033_0097181_795_1163 120
208 3300049572 Ga0501036_0129089 Ga0501036_0129089_654_1022 120
209 3300049573 Ga0501037_0023372 Ga0501037_0023372_1731_2099 120
210 3300049574 Ga0501038_0006886 Ga0501038_0006886_6269_6637 120
211 3300049574 Ga0501038_0503190 Ga0501038_0503190_251_619 120
212 3300049575 Ga0501039_0011085 Ga0501039_0011085_569_937 120
213 3300049575 Ga0501039_0408176 Ga0501039_0408176_602_970 120
214 3300049576 Ga0501040_0002385 Ga0501040_0002385_4841_5209 120
215 3300049577 Ga0501041_0017741 Ga0501041_0017741_1971_2339 120
216 3300049577 Ga0501041_0951147 Ga0501041_0951147_87_458 120
217 3300049578 Ga0501042_0045484 Ga0501042_0045484_1027_1395 120
218 3300049578 Ga0501042_0673419 Ga0501042_0673419_13_399 120
219 3300049578 Ga0501042_1191029 Ga0501042_1191029_96_464 120
220 3300049579 Ga0501043_0512958 Ga0501043_0512958_338_706 120
221 3300049580 Ga0501046_0038067 Ga0501046_0038067_3324_3692 120
222 3300049580 Ga0501046_0112221 Ga0501046_0112221_152_520 120
223 3300049582 Ga0501048_0043352 Ga0501048_0043352_2206_2574 120
224 3300049583 Ga0501067_0197385 Ga0501067_0197385_444_812 120
225 3300049584 Ga0501068_0193008 Ga0501068_0193008_730_1098 120
226 3300049584 Ga0501068_0509466 Ga0501068_0509466_363_734 120
227 3300049586 Ga0501070_0119834 Ga0501070_0119834_1779_2147 120
228 3300049587 Ga0501071_0038797 Ga0501071_0038797_2225_2593 120
229 3300049587 Ga0501071_0464948 Ga0501071_0464948_160_546 120
230 3300049588 Ga0501072_0056145 Ga0501072_0056145_788_1156 120
231 3300049589 Ga0501073_0750530 Ga0501073_0750530_274_645 120
232 3300049590 Ga0501074_0135977 Ga0501074_0135977_630_998 120
233 3300049591 Ga0501075_0007351 Ga0501075_0007351_2670_3038 120
234 3300049592 Ga0501076_0058641 Ga0501076_0058641_200_568 120
235 3300049592 Ga0501076_0806502 Ga0501076_0806502_156_527 120
236 3300049593 Ga0501077_0034675 Ga0501077_0034675_2507_2875 120
237 3300049741 Ga0501079_0013169 Ga0501079_0013169_2145_2513 120
238 3300049741 Ga0501079_1007559 Ga0501079_1007559_130_507 120
239 3300049742 Ga0501080_0282848 Ga0501080_0282848_720_1088 120
240 3300049743 Ga0501081_0062905 Ga0501081_0062905_1904_2272 120
241 3300049822 Ga0501035_0213964 Ga0501035_0213964_1106_1474 120
242 3300049823 Ga0501044_0424722 Ga0501044_0424722_679_1047 120
243 3300049824 Ga0501045_0000468 Ga0501045_0000468_22501_22869 120
244 3300049824 Ga0501045_0570771 Ga0501045_0570771_142_510 120
245 3300049824 Ga0501045_0656008 Ga0501045_0656008_78_446 120
246 3300050493 nmdc:mga0k408_198574_c1 nmdc:mga0k408_198574_c1_164_526 120
247 3300050495 nmdc:mga04h51_414796_c1 nmdc:mga04h51_414796_c1_69_437 120
248 3300050511 nmdc:mga08y16_1256243_c1 nmdc:mga08y16_1256243_c1_193_567 120
249 3300054114 Ga0501084_0004201 Ga0501084_0004201_3405_3773 120
250 3300059505 Ga0587083_0074798 Ga0587083_0074798_13_375 120
251 3300059506 Ga0587085_185473 Ga0587085_185473_124_486 120
252 3300059639 Ga0587062_034423 Ga0587062_034423_349_738 120
253 3300059660 Ga0587124_015948 Ga0587124_015948_23_385 120
254 3300060353 Ga0501082_0099795 Ga0501082_0099795_1399_1767 120
255 3300061734 Ga0530510_0077998 Ga0530510_0077998_344_712 120
256 iso_pu_bacteria 2643221679 2644446365 120
257 3300012498 Ga0157345_1046666 Ga0157345_10466662 121
258 3300030522 Ga0307512_10227811 Ga0307512_102278112 121
259 3300031507 Ga0307509_10339485 Ga0307509_103394853 121
260 3300031824 Ga0307413_10096108 Ga0307413_100961082 121
261 3300038443 Ga0395901_0864788 Ga0395901_0864788_202_573 121
262 3300039447 Ga0436361_0429175 Ga0436361_0429175_211_576 121
263 3300044656 Ga0466969_0230832 Ga0466969_0230832_342_716 121
264 3300044658 Ga0466972_0009895 Ga0466972_0009895_1706_2080 121
265 3300046683 Ga0495658_0987534 Ga0495658_0987534_116_490 121
266 3300047319 Ga0495674_0313331 Ga0495674_0313331_190_555 121
267 3300048912 Ga0496109_0458680 Ga0496109_0458680_776_1174 121
268 3300048918 Ga0496115_1280397 Ga0496115_1280397_56_442 121
269 3300053130 Ga0500642_0456771 Ga0500642_0456771_122_496 121
270 3300053134 Ga0500658_0357276 Ga0500658_0357276_272_646 121
271 3300059477 Ga0587084_071805 Ga0587084_071805_232_612 121
272 3300059625 Ga0587113_014730 Ga0587113_014730_308_682 121
273 3300059625 Ga0587113_038819 Ga0587113_038819_104_478 121
274 3300060353 Ga0501082_0343707 Ga0501082_0343707_327_704 121
275 iso_pu_bacteria 2515154155 2515851924 121
276 3300002077 JGI24744J21845_10078740 JGI24744J21845_100787401 122
277 3300005331 Ga0070670_100488816 Ga0070670_1004888162 122
278 3300005333 Ga0070677_10048185 Ga0070677_100481853 122
279 3300005335 Ga0070666_10896382 Ga0070666_108963822 122
280 3300005337 Ga0070682_100108363 Ga0070682_1001083632 122
281 3300005340 Ga0070689_100245523 Ga0070689_1002455232 122
282 3300005343 Ga0070687_100637907 Ga0070687_1006379071 122
283 3300005347 Ga0070668_100276250 Ga0070668_1002762502 122
284 3300005353 Ga0070669_100261576 Ga0070669_1002615762 122
285 3300005354 Ga0070675_101052595 Ga0070675_1010525951 122
286 3300005356 Ga0070674_100082938 Ga0070674_1000829382 122
287 3300005366 Ga0070659_100603077 Ga0070659_1006030772 122
288 3300005440 Ga0070705_100130886 Ga0070705_1001308862 122
289 3300005456 Ga0070678_100070555 Ga0070678_1000705552 122
290 3300005456 Ga0070678_100445304 Ga0070678_1004453043 122
291 3300005535 Ga0070684_101512930 Ga0070684_1015129302 122
292 3300005543 Ga0070672_100782766 Ga0070672_1007827661 122
293 3300005547 Ga0070693_100071853 Ga0070693_1000718531 122
294 3300005548 Ga0070665_100862216 Ga0070665_1008622162 122
295 3300005578 Ga0068854_101245438 Ga0068854_1012454381 122
296 3300005614 Ga0068856_100429789 Ga0068856_1004297892 122
297 3300005615 Ga0070702_100000907 Ga0070702_1000009072 122
298 3300005615 Ga0070702_100268791 Ga0070702_1002687912 122
299 3300005616 Ga0068852_100350854 Ga0068852_1003508543 122
300 3300005616 Ga0068852_100452985 Ga0068852_1004529852 122
301 3300005719 Ga0068861_100166143 Ga0068861_1001661433 122
302 3300005840 Ga0068870_10773424 Ga0068870_107734242 122
303 3300005843 Ga0068860_101818840 Ga0068860_1018188402 122
304 3300006237 Ga0097621_101129317 Ga0097621_1011293172 122
305 3300009036 Ga0105244_10043572 Ga0105244_100435724 122
306 3300009551 Ga0105238_12042347 Ga0105238_120423471 122
307 3300013104 Ga0157370_11322111 Ga0157370_113221112 122
308 3300013307 Ga0157372_10299596 Ga0157372_102995962 122
309 3300014325 Ga0163163_11073078 Ga0163163_110730782 122
310 3300017792 Ga0163161_11589849 Ga0163161_115898492 122
311 3300020075 Ga0206349_1119767 Ga0206349_11197671 122
312 3300025893 Ga0207682_10234516 Ga0207682_102345162 122
313 3300025901 Ga0207688_10196028 Ga0207688_101960282 122
314 3300025903 Ga0207680_10160003 Ga0207680_101600032 122
315 3300025908 Ga0207643_10855511 Ga0207643_108555112 122
316 3300025924 Ga0207694_10063730 Ga0207694_100637301 122
317 3300025925 Ga0207650_11029933 Ga0207650_110299332 122
318 3300025926 Ga0207659_10158333 Ga0207659_101583331 122
319 3300025934 Ga0207686_10131812 Ga0207686_101318122 122
320 3300025935 Ga0207709_10010363 Ga0207709_100103636 122
321 3300025935 Ga0207709_10021535 Ga0207709_100215353 122
322 3300025937 Ga0207669_10101646 Ga0207669_101016463 122
323 3300025938 Ga0207704_10228747 Ga0207704_102287471 122
324 3300025940 Ga0207691_10844915 Ga0207691_108449152 122
325 3300025942 Ga0207689_10159920 Ga0207689_101599201 122
326 3300025944 Ga0207661_10760121 Ga0207661_107601212 122
327 3300025945 Ga0207679_11058376 Ga0207679_110583762 122
328 3300025961 Ga0207712_10157879 Ga0207712_101578792 122
329 3300025972 Ga0207668_10086951 Ga0207668_100869511 122
330 3300025972 Ga0207668_10240624 Ga0207668_102406242 122
331 3300026118 Ga0207675_100158617 Ga0207675_1001586173 122
332 3300026121 Ga0207683_10135451 Ga0207683_101354512 122
333 3300028381 Ga0268264_10248854 Ga0268264_102488541 122
334 3300031548 Ga0307408_101458443 Ga0307408_1014584431 122
335 3300031838 Ga0307518_10001053 Ga0307518_1000105317 122
336 3300035171 Ga0373946_0582352 Ga0373946_0582352_72_452 122
337 3300038443 Ga0395901_0504819 Ga0395901_0504819_819_1196 122
338 3300046463 Ga0495653_0077303 Ga0495653_0077303_461_835 122
339 3300046463 Ga0495653_0085165 Ga0495653_0085165_24_404 122
340 3300046663 Ga0495635_0409138 Ga0495635_0409138_416_796 122
341 3300046689 Ga0495613_0273364 Ga0495613_0273364_493_873 122
342 3300047321 Ga0495676_0345889 Ga0495676_0345889_584_964 122
343 3300047322 Ga0495680_0155040 Ga0495680_0155040_373_753 122
344 3300048904 Ga0496101_0986381 Ga0496101_0986381_140_532 122
345 3300048907 Ga0496104_0540184 Ga0496104_0540184_324_704 122
346 3300048908 Ga0496105_0294706 Ga0496105_0294706_110_490 122
347 3300048909 Ga0496106_0620689 Ga0496106_0620689_362_754 122
348 3300049127 Ga0501306_026797 Ga0501306_026797_412_795 122
349 3300049161 Ga0501305_067339 Ga0501305_067339_207_593 122
350 3300049531 Ga0501315_041240 Ga0501315_041240_255_638 122
351 3300049568 Ga0501031_0207457 Ga0501031_0207457_595_975 122
352 3300049569 Ga0501032_0249983 Ga0501032_0249983_746_1126 122
353 3300049570 Ga0501033_0196799 Ga0501033_0196799_985_1365 122
354 3300049572 Ga0501036_0079114 Ga0501036_0079114_2164_2544 122
355 3300049573 Ga0501037_0059277 Ga0501037_0059277_2008_2388 122
356 3300049574 Ga0501038_0070271 Ga0501038_0070271_257_637 122
357 3300049575 Ga0501039_0023822 Ga0501039_0023822_3474_3854 122
358 3300049577 Ga0501041_0085818 Ga0501041_0085818_415_795 122
359 3300049578 Ga0501042_0011641 Ga0501042_0011641_4570_4950 122
360 3300049580 Ga0501046_0047532 Ga0501046_0047532_1941_2321 122
361 3300049582 Ga0501048_0089830 Ga0501048_0089830_786_1166 122
362 3300049587 Ga0501071_0064107 Ga0501071_0064107_1163_1543 122
363 3300049588 Ga0501072_0034644 Ga0501072_0034644_3255_3635 122
364 3300049590 Ga0501074_0283885 Ga0501074_0283885_769_1149 122
365 3300049591 Ga0501075_0082274 Ga0501075_0082274_634_1014 122
366 3300049592 Ga0501076_0199285 Ga0501076_0199285_526_906 122
367 3300049593 Ga0501077_0117008 Ga0501077_0117008_483_863 122
368 3300049741 Ga0501079_0073812 Ga0501079_0073812_1785_2165 122
369 3300049742 Ga0501080_0350384 Ga0501080_0350384_638_1018 122
370 3300049743 Ga0501081_0029715 Ga0501081_0029715_1904_2284 122
371 3300049822 Ga0501035_0051480 Ga0501035_0051480_2860_3240 122
372 3300049824 Ga0501045_0096329 Ga0501045_0096329_569_949 122
373 3300053084 Ga0495595_0050945 Ga0495595_0050945_1171_1551 122
374 3300053084 Ga0495595_0365789 Ga0495595_0365789_111_491 122
375 3300053085 Ga0495619_0058114 Ga0495619_0058114_2156_2536 122
376 3300054114 Ga0501084_0066146 Ga0501084_0066146_1317_1697 122
377 3300059505 Ga0587083_0092910 Ga0587083_0092910_220_597 122
378 3300059512 Ga0587092_024855 Ga0587092_024855_100_480 122
379 3300059622 Ga0587099_051894 Ga0587099_051894_15_392 122
380 3300061734 Ga0530510_0144490 Ga0530510_0144490_412_792 122
381 iso_pu_bacteria 2643221576 2643888780 122
382 iso_pu_bacteria 2643221590 2643957835 122
383 iso_pu_bacteria 2643221711 2644611646 122
384 iso_pu_bacteria 2675902999 2676201695 122
385 iso_pu_bacteria 2687453737 2689956237 122
386 iso_pu_bacteria 2773857921 2774846271 122
387 iso_pu_bacteria 2773857933 2774904274 122
388 iso_pu_bacteria 2870622029 2870622722 122
389 iso_pu_bacteria 2887443736 2887447578 122
390 iso_pu_bacteria 2891968417 2891971194 122
391 iso_pu_bacteria 2928121344 2928124623 122
392 iso_pu_bacteria 2939657138 2939658898 122
393 3300001989 JGI24739J22299_10107071 JGI24739J22299_101070712 123
394 3300001990 JGI24737J22298_10100500 JGI24737J22298_101005001 123
395 3300004800 Ga0058861_10039264 Ga0058861_100392642 123
396 3300004800 Ga0058861_12049027 Ga0058861_120490271 123
397 3300005334 Ga0068869_100292375 Ga0068869_1002923753 123
398 3300005434 Ga0070709_10005108 Ga0070709_100051083 123
399 3300005439 Ga0070711_100317625 Ga0070711_1003176253 123
400 3300005467 Ga0070706_102016214 Ga0070706_1020162141 123
401 3300005468 Ga0070707_100051210 Ga0070707_1000512104 123
402 3300005471 Ga0070698_100005507 Ga0070698_10000550711 123
403 3300005518 Ga0070699_100400017 Ga0070699_1004000172 123
404 3300005577 Ga0068857_101381444 Ga0068857_1013814442 123
405 3300006028 Ga0070717_10309524 Ga0070717_103095242 123
406 3300006048 Ga0075363_100355524 Ga0075363_1003555242 123
407 3300006173 Ga0070716_100228081 Ga0070716_1002280813 123
408 3300006175 Ga0070712_100328567 Ga0070712_1003285673 123
409 3300006353 Ga0075370_10188764 Ga0075370_101887643 123
410 3300009551 Ga0105238_10286796 Ga0105238_102867963 123
411 3300009553 Ga0105249_10795882 Ga0105249_107958822 123
412 3300009553 Ga0105249_13426761 Ga0105249_134267611 123
413 3300012497 Ga0157319_1027569 Ga0157319_10275692 123
414 3300013105 Ga0157369_10468414 Ga0157369_104684143 123
415 3300013306 Ga0163162_10260383 Ga0163162_102603833 123
416 3300013308 Ga0157375_11638960 Ga0157375_116389603 123
417 3300014326 Ga0157380_10999637 Ga0157380_109996372 123
418 3300020070 Ga0206356_11663862 Ga0206356_116638622 123
419 3300020075 Ga0206349_1227335 Ga0206349_12273351 123
420 3300020076 Ga0206355_1290850 Ga0206355_12908501 123
421 3300020076 Ga0206355_1678641 Ga0206355_16786411 123
422 3300020078 Ga0206352_11355473 Ga0206352_113554733 123
423 3300020080 Ga0206350_10685797 Ga0206350_106857971 123
424 3300020081 Ga0206354_10406115 Ga0206354_104061153 123
425 3300020082 Ga0206353_10268640 Ga0206353_102686401 123
426 3300020082 Ga0206353_10856742 Ga0206353_108567423 123
427 3300025905 Ga0207685_10012727 Ga0207685_100127271 123
428 3300025906 Ga0207699_10093442 Ga0207699_100934423 123
429 3300025909 Ga0207705_11093888 Ga0207705_110938881 123
430 3300025922 Ga0207646_10068183 Ga0207646_100681831 123
431 3300025925 Ga0207650_10200313 Ga0207650_102003131 123
432 3300025928 Ga0207700_10377374 Ga0207700_103773743 123
433 3300025929 Ga0207664_10337414 Ga0207664_103374142 123
434 3300025929 Ga0207664_10460888 Ga0207664_104608882 123
435 3300025933 Ga0207706_10475953 Ga0207706_104759532 123
436 3300025944 Ga0207661_10052660 Ga0207661_100526603 123
437 3300026067 Ga0207678_10490055 Ga0207678_104900551 123
438 3300026116 Ga0207674_11243936 Ga0207674_112439362 123
439 3300027866 Ga0209813_10377924 Ga0209813_103779241 123
440 3300031731 Ga0307405_10404843 Ga0307405_104048432 123
441 3300031824 Ga0307413_10324346 Ga0307413_103243462 123
442 3300031824 Ga0307413_10370763 Ga0307413_103707631 123
443 3300031852 Ga0307410_10009228 Ga0307410_100092285 123
444 3300031903 Ga0307407_10017034 Ga0307407_100170344 123
445 3300031995 Ga0307409_100002255 Ga0307409_1000022555 123
446 3300031995 Ga0307409_102821537 Ga0307409_1028215371 123
447 3300032002 Ga0307416_100233955 Ga0307416_1002339552 123
448 3300032002 Ga0307416_101400895 Ga0307416_1014008952 123
449 3300036712 Ga0316584_0702136 Ga0316584_0702136_93_464 123
450 3300037471 Ga0395905_0844856 Ga0395905_0844856_14_391 123
451 3300039438 Ga0436360_0655317 Ga0436360_0655317_350_721 123
452 3300041452 Ga0451793_0067162 Ga0451793_0067162_2369_2740 123
453 3300041453 Ga0451797_0289670 Ga0451797_0289670_402_779 123
454 3300041498 Ga0451841_1179883 Ga0451841_1179883_78_455 123
455 3300041505 Ga0451849_0375908 Ga0451849_0375908_283_660 123
456 3300041509 Ga0451843_0190972 Ga0451843_0190972_1194_1565 123
457 3300041512 Ga0451853_2978480 Ga0451853_2978480_437_808 123
458 3300046459 Ga0495629_0514530 Ga0495629_0514530_210_602 123
459 3300046473 Ga0495582_0506150 Ga0495582_0506150_261_653 123
460 3300046475 Ga0495639_0453772 Ga0495639_0453772_101_493 123
461 3300047322 Ga0495680_0216510 Ga0495680_0216510_868_1245 123
462 3300048904 Ga0496101_0019994 Ga0496101_0019994_1987_2379 123
463 3300048907 Ga0496104_0006711 Ga0496104_0006711_3315_3707 123
464 3300048907 Ga0496104_0049816 Ga0496104_0049816_451_843 123
465 3300048907 Ga0496104_0472516 Ga0496104_0472516_605_997 123
466 3300048908 Ga0496105_0050059 Ga0496105_0050059_345_737 123
467 3300048908 Ga0496105_0083523 Ga0496105_0083523_2186_2578 123
468 3300048909 Ga0496106_0271673 Ga0496106_0271673_32_424 123
469 3300048911 Ga0496108_0316607 Ga0496108_0316607_528_920 123
470 3300048911 Ga0496108_0756814 Ga0496108_0756814_278_670 123
471 3300048912 Ga0496109_0049566 Ga0496109_0049566_1937_2329 123
472 3300048912 Ga0496109_0708639 Ga0496109_0708639_335_727 123
473 3300048913 Ga0496110_0118663 Ga0496110_0118663_1208_1600 123
474 3300048913 Ga0496110_0483052 Ga0496110_0483052_371_763 123
475 3300048914 Ga0496111_0173930 Ga0496111_0173930_168_560 123
476 3300048917 Ga0496114_0038344 Ga0496114_0038344_3110_3502 123
477 3300048917 Ga0496114_0256493 Ga0496114_0256493_465_836 123
478 3300049127 Ga0501306_015346 Ga0501306_015346_334_711 123
479 3300049130 Ga0501310_025832 Ga0501310_025832_20_400 123
480 3300049130 Ga0501310_055199 Ga0501310_055199_128_520 123
481 3300049528 Ga0501312_065297 Ga0501312_065297_216_608 123
482 3300049532 Ga0501316_010434 Ga0501316_010434_25_417 123
483 3300049533 Ga0501317_020615 Ga0501317_020615_147_539 123
484 3300049535 Ga0501319_005368 Ga0501319_005368_58_450 123
485 3300049536 Ga0501320_001386 Ga0501320_001386_1309_1701 123
486 3300053084 Ga0495595_0537953 Ga0495595_0537953_85_462 123
487 3300059490 Ga0587066_190003 Ga0587066_190003_14_391 123
488 3300059503 Ga0587080_040117 Ga0587080_040117_52_432 123
489 3300059505 Ga0587083_0060159 Ga0587083_0060159_456_836 123
490 3300059510 Ga0587090_036297 Ga0587090_036297_450_830 123
491 3300059511 Ga0587091_026119 Ga0587091_026119_458_844 123
492 3300059512 Ga0587092_163329 Ga0587092_163329_111_488 123
493 3300059605 Ga0587106_038726 Ga0587106_038726_366_746 123
494 3300059605 Ga0587106_108487 Ga0587106_108487_11_397 123
495 3300059630 Ga0587128_002154 Ga0587128_002154_1272_1649 123
496 3300059641 Ga0587068_047030 Ga0587068_047030_404_784 123
497 3300059642 Ga0587069_034929 Ga0587069_034929_419_799 123
498 3300060346 Ga0587111_0040840 Ga0587111_0040840_399_785 123
499 3300060353 Ga0501082_1924828 Ga0501082_1924828_17_406 123
500 3300061719 Ga0466962_0204286 Ga0466962_0204286_298_675 123
501 3300005841 Ga0068863_100000454 Ga0068863_10000045436 124
502 3300009101 Ga0105247_10154969 Ga0105247_101549693 124
503 3300014968 Ga0157379_11024236 Ga0157379_110242362 124
504 3300026035 Ga0207703_10018834 Ga0207703_100188345 124
505 3300048920 Ga0496117_0237112 Ga0496117_0237112_428_811 124
506 3300048921 Ga0496118_0520045 Ga0496118_0520045_66_449 124
507 3300048927 Ga0496124_0679787 Ga0496124_0679787_173_556 124
508 3300003373 JGI25407J50210_10038405 JGI25407J50210_100384052 125
509 3300005327 Ga0070658_10016077 Ga0070658_100160775 125
510 3300005329 Ga0070683_100138044 Ga0070683_1001380443 125
511 3300005329 Ga0070683_100162734 Ga0070683_1001627343 125
512 3300005329 Ga0070683_101755533 Ga0070683_1017555331 125
513 3300005334 Ga0068869_100456541 Ga0068869_1004565412 125
514 3300005336 Ga0070680_100076550 Ga0070680_1000765504 125
515 3300005337 Ga0070682_100064333 Ga0070682_1000643333 125
516 3300005339 Ga0070660_100039249 Ga0070660_1000392493 125
517 3300005339 Ga0070660_100397556 Ga0070660_1003975563 125
518 3300005341 Ga0070691_10218203 Ga0070691_102182031 125
519 3300005344 Ga0070661_100053746 Ga0070661_1000537463 125
520 3300005366 Ga0070659_100035645 Ga0070659_1000356452 125
521 3300005366 Ga0070659_100264206 Ga0070659_1002642061 125
522 3300005434 Ga0070709_10076141 Ga0070709_100761412 125
523 3300005435 Ga0070714_100707000 Ga0070714_1007070002 125
524 3300005436 Ga0070713_100096655 Ga0070713_1000966551 125
525 3300005436 Ga0070713_100417463 Ga0070713_1004174632 125
526 3300005436 Ga0070713_100884813 Ga0070713_1008848132 125
527 3300005455 Ga0070663_100258932 Ga0070663_1002589323 125
528 3300005458 Ga0070681_10754852 Ga0070681_107548521 125
529 3300005535 Ga0070684_100079301 Ga0070684_1000793013 125
530 3300005548 Ga0070665_100245542 Ga0070665_1002455422 125
531 3300005563 Ga0068855_101015168 Ga0068855_1010151682 125
532 3300005577 Ga0068857_100496736 Ga0068857_1004967363 125
533 3300005578 Ga0068854_101003959 Ga0068854_1010039592 125
534 3300005616 Ga0068852_100196995 Ga0068852_1001969954 125
535 3300005719 Ga0068861_100042273 Ga0068861_1000422733 125
536 3300005844 Ga0068862_100152764 Ga0068862_1001527642 125
537 3300005937 Ga0081455_10014667 Ga0081455_100146674 125
538 3300005937 Ga0081455_10056135 Ga0081455_100561353 125
539 3300005937 Ga0081455_10230695 Ga0081455_102306952 125
540 3300005937 Ga0081455_10288833 Ga0081455_102888332 125
541 3300005981 Ga0081538_10002518 Ga0081538_1000251812 125
542 3300006058 Ga0075432_10001180 Ga0075432_100011809 125
543 3300006058 Ga0075432_10001981 Ga0075432_1000198110 125
544 3300006194 Ga0075427_10006958 Ga0075427_100069583 125
545 3300006844 Ga0075428_100100897 Ga0075428_1001008974 125
546 3300006844 Ga0075428_100355768 Ga0075428_1003557683 125
547 3300006844 Ga0075428_100576073 Ga0075428_1005760733 125
548 3300006844 Ga0075428_101221817 Ga0075428_1012218171 125
549 3300006846 Ga0075430_100138383 Ga0075430_1001383832 125
550 3300006846 Ga0075430_100157070 Ga0075430_1001570703 125
551 3300006847 Ga0075431_100105764 Ga0075431_1001057644 125
552 3300006852 Ga0075433_10004850 Ga0075433_100048505 125
553 3300006852 Ga0075433_10029068 Ga0075433_100290683 125
554 3300006871 Ga0075434_100003049 Ga0075434_1000030493 125
555 3300006880 Ga0075429_100072200 Ga0075429_1000722001 125
556 3300006880 Ga0075429_100159841 Ga0075429_1001598413 125
557 3300006881 Ga0068865_100128479 Ga0068865_1001284793 125
558 3300006914 Ga0075436_100008198 Ga0075436_1000081984 125
559 3300007076 Ga0075435_100005162 Ga0075435_1000051627 125
560 3300007076 Ga0075435_100018949 Ga0075435_1000189497 125
561 3300009093 Ga0105240_10245419 Ga0105240_102454192 125
562 3300009093 Ga0105240_10900637 Ga0105240_109006371 125
563 3300009094 Ga0111539_10000158 Ga0111539_1000015816 125
564 3300009094 Ga0111539_10006978 Ga0111539_1000697817 125
565 3300009098 Ga0105245_10075454 Ga0105245_100754543 125
566 3300009098 Ga0105245_10184993 Ga0105245_101849933 125
567 3300009147 Ga0114129_10003880 Ga0114129_100038808 125
568 3300009147 Ga0114129_10501662 Ga0114129_105016621 125
569 3300009148 Ga0105243_10346250 Ga0105243_103462503 125
570 3300009174 Ga0105241_11365860 Ga0105241_113658602 125
571 3300009176 Ga0105242_10226239 Ga0105242_102262393 125
572 3300009545 Ga0105237_10342779 Ga0105237_103427792 125
573 3300009551 Ga0105238_10064212 Ga0105238_100642122 125
574 3300009551 Ga0105238_10355131 Ga0105238_103551311 125
575 3300009551 Ga0105238_10787131 Ga0105238_107871313 125
576 3300009553 Ga0105249_10121062 Ga0105249_101210623 125
577 3300010375 Ga0105239_10122430 Ga0105239_101224304 125
578 3300012485 Ga0157325_1002978 Ga0157325_10029782 125
579 3300012498 Ga0157345_1009711 Ga0157345_10097111 125
580 3300012507 Ga0157342_1002723 Ga0157342_10027232 125
581 3300012513 Ga0157326_1024626 Ga0157326_10246262 125
582 3300013045 Ga0154016_120491 Ga0154016_1204911 125
583 3300013104 Ga0157370_10086887 Ga0157370_100868874 125
584 3300013306 Ga0163162_10107812 Ga0163162_101078123 125
585 3300013307 Ga0157372_10014531 Ga0157372_100145313 125
586 3300013307 Ga0157372_11395815 Ga0157372_113958151 125
587 3300014325 Ga0163163_10211338 Ga0163163_102113381 125
588 3300014325 Ga0163163_11130466 Ga0163163_111304662 125
589 3300014969 Ga0157376_11910279 Ga0157376_119102791 125
590 3300020069 Ga0197907_11084971 Ga0197907_110849712 125
591 3300020069 Ga0197907_11163051 Ga0197907_111630512 125
592 3300020070 Ga0206356_10235624 Ga0206356_102356241 125
593 3300020076 Ga0206355_1018285 Ga0206355_10182852 125
594 3300020076 Ga0206355_1157355 Ga0206355_11573553 125
595 3300020076 Ga0206355_1436410 Ga0206355_14364103 125
596 3300020077 Ga0206351_10242066 Ga0206351_102420662 125
597 3300020077 Ga0206351_10349906 Ga0206351_103499062 125
598 3300020077 Ga0206351_10925769 Ga0206351_109257692 125
599 3300020078 Ga0206352_10728115 Ga0206352_107281152 125
600 3300020081 Ga0206354_10201171 Ga0206354_102011712 125
601 3300020081 Ga0206354_10479002 Ga0206354_104790023 125
602 3300020081 Ga0206354_10770711 Ga0206354_107707112 125
603 3300020081 Ga0206354_11652329 Ga0206354_116523292 125
604 3300020082 Ga0206353_10223354 Ga0206353_102233544 125
605 3300020082 Ga0206353_10743311 Ga0206353_107433111 125
606 3300020082 Ga0206353_10835504 Ga0206353_108355044 125
607 3300020610 Ga0154015_1121433 Ga0154015_11214333 125
608 3300020610 Ga0154015_1313599 Ga0154015_13135991 125
609 3300020610 Ga0154015_1611020 Ga0154015_16110201 125
610 3300020610 Ga0154015_1670310 Ga0154015_16703102 125
611 3300025901 Ga0207688_10228263 Ga0207688_102282632 125
612 3300025901 Ga0207688_10257878 Ga0207688_102578782 125
613 3300025904 Ga0207647_10206425 Ga0207647_102064252 125
614 3300025906 Ga0207699_10301989 Ga0207699_103019891 125
615 3300025912 Ga0207707_10002485 Ga0207707_100024859 125
616 3300025917 Ga0207660_10035116 Ga0207660_100351163 125
617 3300025919 Ga0207657_10015478 Ga0207657_100154783 125
618 3300025919 Ga0207657_10782258 Ga0207657_107822582 125
619 3300025921 Ga0207652_10125908 Ga0207652_101259083 125
620 3300025921 Ga0207652_10196152 Ga0207652_101961522 125
621 3300025921 Ga0207652_11350694 Ga0207652_113506942 125
622 3300025924 Ga0207694_10664129 Ga0207694_106641292 125
623 3300025924 Ga0207694_10911313 Ga0207694_109113132 125
624 3300025927 Ga0207687_10159895 Ga0207687_101598953 125
625 3300025927 Ga0207687_10402656 Ga0207687_104026562 125
626 3300025928 Ga0207700_10159457 Ga0207700_101594573 125
627 3300025928 Ga0207700_10176622 Ga0207700_101766222 125
628 3300025929 Ga0207664_10114979 Ga0207664_101149793 125
629 3300025932 Ga0207690_10540821 Ga0207690_105408211 125
630 3300025932 Ga0207690_11464286 Ga0207690_114642861 125
631 3300025934 Ga0207686_11719904 Ga0207686_117199041 125
632 3300025935 Ga0207709_10395892 Ga0207709_103958922 125
633 3300025935 Ga0207709_10531216 Ga0207709_105312162 125
634 3300025942 Ga0207689_10146104 Ga0207689_101461043 125
635 3300025944 Ga0207661_10432291 Ga0207661_104322912 125
636 3300025949 Ga0207667_10816517 Ga0207667_108165172 125
637 3300025961 Ga0207712_10806069 Ga0207712_108060692 125
638 3300025981 Ga0207640_10552062 Ga0207640_105520622 125
639 3300025981 Ga0207640_11497903 Ga0207640_114979031 125
640 3300026067 Ga0207678_10041027 Ga0207678_100410273 125
641 3300026116 Ga0207674_10379395 Ga0207674_103793951 125
642 3300026118 Ga0207675_100078604 Ga0207675_1000786043 125
643 3300026142 Ga0207698_11113946 Ga0207698_111139462 125
644 3300027907 Ga0207428_10002308 Ga0207428_1000230823 125
645 3300027907 Ga0207428_10010072 Ga0207428_100100727 125
646 3300028379 Ga0268266_10146171 Ga0268266_101461713 125
647 3300028380 Ga0268265_10131451 Ga0268265_101314513 125
648 3300028800 Ga0265338_10006730 Ga0265338_1000673011 125
649 3300028800 Ga0265338_10008525 Ga0265338_100085253 125
650 3300029277 Ga0311001_1011636 Ga0311001_10116361 125
651 3300031548 Ga0307408_100004069 Ga0307408_1000040694 125
652 3300031548 Ga0307408_100015031 Ga0307408_1000150314 125
653 3300031548 Ga0307408_100089661 Ga0307408_1000896612 125
654 3300031592 Ga0310117_101992 Ga0310117_1019923 125
655 3300031592 Ga0310117_109033 Ga0310117_1090331 125
656 3300031614 Ga0310103_103486 Ga0310103_1034861 125
657 3300031633 Ga0310108_106062 Ga0310108_1060621 125
658 3300031667 Ga0310111_121340 Ga0310111_1213401 125
659 3300031686 Ga0310119_115941 Ga0310119_1159411 125
660 3300031731 Ga0307405_10001230 Ga0307405_100012308 125
661 3300031731 Ga0307405_10039301 Ga0307405_100393012 125
662 3300031824 Ga0307413_10002256 Ga0307413_100022565 125
663 3300031824 Ga0307413_10016216 Ga0307413_100162163 125
664 3300031824 Ga0307413_10018584 Ga0307413_100185845 125
665 3300031852 Ga0307410_10000140 Ga0307410_1000014014 125
666 3300031852 Ga0307410_10013939 Ga0307410_100139398 125
667 3300031852 Ga0307410_10763663 Ga0307410_107636632 125
668 3300031901 Ga0307406_10000083 Ga0307406_1000008317 125
669 3300031901 Ga0307406_10013901 Ga0307406_100139014 125
670 3300031901 Ga0307406_10017422 Ga0307406_100174222 125
671 3300031901 Ga0307406_10026226 Ga0307406_100262262 125
672 3300031903 Ga0307407_10000354 Ga0307407_100003547 125
673 3300031903 Ga0307407_10010126 Ga0307407_100101264 125
674 3300031903 Ga0307407_10014812 Ga0307407_100148123 125
675 3300031911 Ga0307412_10065993 Ga0307412_100659932 125
676 3300031911 Ga0307412_10229969 Ga0307412_102299693 125
677 3300031995 Ga0307409_100000915 Ga0307409_1000009157 125
678 3300031995 Ga0307409_100001294 Ga0307409_10000129411 125
679 3300031995 Ga0307409_100395561 Ga0307409_1003955612 125
680 3300032002 Ga0307416_100000105 Ga0307416_10000010543 125
681 3300032002 Ga0307416_100124593 Ga0307416_1001245933 125
682 3300032002 Ga0307416_100418303 Ga0307416_1004183031 125
683 3300032004 Ga0307414_10062118 Ga0307414_100621184 125
684 3300032004 Ga0307414_10064685 Ga0307414_100646852 125
685 3300032004 Ga0307414_10175029 Ga0307414_101750292 125
686 3300032005 Ga0307411_10000440 Ga0307411_1000044012 125
687 3300032005 Ga0307411_10371610 Ga0307411_103716103 125
688 3300032126 Ga0307415_100060966 Ga0307415_1000609665 125
689 3300032126 Ga0307415_100069969 Ga0307415_1000699693 125
690 3300034820 Ga0373959_0080415 Ga0373959_0080415_354_731 125
691 3300035092 Ga0373952_0195135 Ga0373952_0195135_83_460 125
692 3300035114 Ga0373939_0223712 Ga0373939_0223712_245_622 125
693 3300035121 Ga0373960_0225759 Ga0373960_0225759_40_417 125
694 3300035691 Ga0373931_0081714 Ga0373931_0081714_1126_1503 125
695 3300035692 Ga0373935_0839745 Ga0373935_0839745_98_475 125
696 3300036458 Ga0310112_028666 Ga0310112_028666_68_445 125
697 3300036459 Ga0372808_007578 Ga0372808_007578_1039_1416 125
698 3300036534 Ga0310109_002515 Ga0310109_002515_221_598 125
699 3300037068 Ga0373925_0000030 Ga0373925_0000030_121744_122121 125
700 3300037068 Ga0373925_1686850 Ga0373925_1686850_116_493 125
701 3300037418 Ga0395900_0327705 Ga0395900_0327705_251_628 125
702 3300039447 Ga0436361_0461818 Ga0436361_0461818_68_445 125
703 3300041413 Ga0439465_0106889 Ga0439465_0106889_200_580 125
704 3300042005 Ga0439448_0165847 Ga0439448_0165847_313_690 125
705 3300042005 Ga0439448_0189147 Ga0439448_0189147_159_536 125
706 3300042005 Ga0439448_0292498 Ga0439448_0292498_182_559 125
707 3300042008 Ga0439450_002148 Ga0439450_002148_2399_2776 125
708 3300042008 Ga0439450_215208 Ga0439450_215208_115_492 125
709 3300042016 Ga0439463_028178 Ga0439463_028178_271_648 125
710 3300042016 Ga0439463_039450 Ga0439463_039450_563_940 125
711 3300042016 Ga0439463_069799 Ga0439463_069799_306_683 125
712 3300042436 Ga0439435_0004240 Ga0439435_0004240_53_430 125
713 3300042533 Ga0450901_034233 Ga0450901_034233_86_463 125
714 3300042993 Ga0439440_0020429 Ga0439440_0020429_1047_1424 125
715 3300042993 Ga0439440_0173739 Ga0439440_0173739_25_402 125
716 3300044693 Ga0466961_0145095 Ga0466961_0145095_267_656 125
717 3300044694 Ga0466963_0010740 Ga0466963_0010740_1465_1842 125
718 3300044735 Ga0466968_0207093 Ga0466968_0207093_290_667 125
719 3300044765 Ga0466970_0558398 Ga0466970_0558398_204_581 125
720 3300045976 Ga0466967_0623253 Ga0466967_0623253_431_808 125
721 3300046458 Ga0495591_108979 Ga0495591_108979_100_477 125
722 3300046491 Ga0495584_0139992 Ga0495584_0139992_219_596 125
723 3300046491 Ga0495584_0514673 Ga0495584_0514673_59_436 125
724 3300046513 Ga0495616_0086476 Ga0495616_0086476_748_1125 125
725 3300046515 Ga0495620_0080177 Ga0495620_0080177_364_741 125
726 3300046518 Ga0495631_0211919 Ga0495631_0211919_365_742 125
727 3300046522 Ga0495643_0367837 Ga0495643_0367837_112_489 125
728 3300046523 Ga0495644_0383101 Ga0495644_0383101_28_405 125
729 3300046525 Ga0495663_0358683 Ga0495663_0358683_93_470 125
730 3300046542 Ga0495597_0137940 Ga0495597_0137940_310_687 125
731 3300046558 Ga0495633_0413595 Ga0495633_0413595_27_404 125
732 3300046559 Ga0495667_0263861 Ga0495667_0263861_206_598 125
733 3300046615 Ga0495656_0440684 Ga0495656_0440684_278_655 125
734 3300046616 Ga0495668_0326107 Ga0495668_0326107_373_750 125
735 3300046616 Ga0495668_0484265 Ga0495668_0484265_33_410 125
736 3300046665 Ga0495661_0357940 Ga0495661_0357940_209_586 125
737 3300046684 Ga0495669_0603203 Ga0495669_0603203_114_491 125
738 3300046691 Ga0495670_0157041 Ga0495670_0157041_91_468 125
739 3300046691 Ga0495670_0270954 Ga0495670_0270954_149_526 125
740 3300046691 Ga0495670_0527014 Ga0495670_0527014_216_593 125
741 3300046694 Ga0495649_0256083 Ga0495649_0256083_478_855 125
742 3300046794 Ga0495589_0082995 Ga0495589_0082995_897_1274 125
743 3300046794 Ga0495589_0526336 Ga0495589_0526336_72_449 125
744 3300047319 Ga0495674_1074190 Ga0495674_1074190_116_493 125
745 3300047322 Ga0495680_0514356 Ga0495680_0514356_10_393 125
746 3300047444 Ga0495675_0412514 Ga0495675_0412514_211_603 125
747 3300047445 Ga0495677_0294625 Ga0495677_0294625_240_617 125
748 3300047472 Ga0495686_0240812 Ga0495686_0240812_393_776 125
749 3300048905 Ga0496102_1874164 Ga0496102_1874164_100_477 125
750 3300048907 Ga0496104_0484103 Ga0496104_0484103_724_1107 125
751 3300048907 Ga0496104_1771473 Ga0496104_1771473_115_492 125
752 3300048908 Ga0496105_0079671 Ga0496105_0079671_1375_1758 125
753 3300048911 Ga0496108_0012599 Ga0496108_0012599_5150_5527 125
754 3300048911 Ga0496108_0171867 Ga0496108_0171867_1002_1385 125
755 3300048911 Ga0496108_0333229 Ga0496108_0333229_91_468 125
756 3300048912 Ga0496109_0157817 Ga0496109_0157817_780_1163 125
757 3300048912 Ga0496109_0440015 Ga0496109_0440015_497_874 125
758 3300048912 Ga0496109_0469672 Ga0496109_0469672_500_877 125
759 3300048913 Ga0496110_0135103 Ga0496110_0135103_429_812 125
760 3300048913 Ga0496110_0352561 Ga0496110_0352561_776_1153 125
761 3300048914 Ga0496111_0248776 Ga0496111_0248776_742_1119 125
762 3300048914 Ga0496111_0566069 Ga0496111_0566069_39_422 125
763 3300048915 Ga0496112_0442853 Ga0496112_0442853_415_792 125
764 3300048915 Ga0496112_0690699 Ga0496112_0690699_219_596 125
765 3300048916 Ga0496113_1396552 Ga0496113_1396552_67_444 125
766 3300048917 Ga0496114_0166808 Ga0496114_0166808_1141_1524 125
767 3300048922 Ga0496119_0044088 Ga0496119_0044088_2344_2721 125
768 3300048922 Ga0496119_0198133 Ga0496119_0198133_354_731 125
769 3300048923 Ga0496120_0402015 Ga0496120_0402015_132_509 125
770 3300048929 Ga0496126_0075067 Ga0496126_0075067_107_484 125
771 3300048929 Ga0496126_0588942 Ga0496126_0588942_377_754 125
772 3300049128 Ga0501308_022009 Ga0501308_022009_393_782 125
773 3300049128 Ga0501308_036095 Ga0501308_036095_263_658 125
774 3300049129 Ga0501309_016165 Ga0501309_016165_603_992 125
775 3300049130 Ga0501310_035609 Ga0501310_035609_89_478 125
776 3300049162 Ga0501307_001156 Ga0501307_001156_455_832 125
777 3300049162 Ga0501307_043731 Ga0501307_043731_236_631 125
778 3300049513 Ga0501290_063714 Ga0501290_063714_70_447 125
779 3300049518 Ga0501295_028005 Ga0501295_028005_664_1041 125
780 3300049521 Ga0501298_122577 Ga0501298_122577_23_400 125
781 3300049532 Ga0501316_000725 Ga0501316_000725_1394_1783 125
782 3300049532 Ga0501316_026652 Ga0501316_026652_144_533 125
783 3300049533 Ga0501317_072586 Ga0501317_072586_50_439 125
784 3300049534 Ga0501318_002229 Ga0501318_002229_223_600 125
785 3300049534 Ga0501318_011409 Ga0501318_011409_471_860 125
786 3300049534 Ga0501318_017173 Ga0501318_017173_251_628 125
787 3300049537 Ga0501321_015716 Ga0501321_015716_470_859 125
788 3300049541 Ga0501325_002533 Ga0501325_002533_443_820 125
789 3300049591 Ga0501075_0935444 Ga0501075_0935444_56_433 125
790 3300049675 Ga0501243_097585 Ga0501243_097585_20_397 125
791 3300049683 Ga0501253_045474 Ga0501253_045474_19_396 125
792 3300049685 Ga0501256_026448 Ga0501256_026448_24_401 125
793 3300049686 Ga0501257_181763 Ga0501257_181763_137_514 125
794 3300049851 Ga0501212_001768 Ga0501212_001768_804_1181 125
795 3300050507 nmdc:mga05p37_15070_c1 nmdc:mga05p37_15070_c1_6550_6927 125
796 3300050508 nmdc:mga09592_453860_c1 nmdc:mga09592_453860_c1_172_549 125
797 3300050509 nmdc:mga0qj67_79191_c1 nmdc:mga0qj67_79191_c1_395_772 125
798 3300050510 nmdc:mga06r32_18393_c2 nmdc:mga06r32_18393_c2_2190_2567 125
799 3300050511 nmdc:mga08y16_4667_c1 nmdc:mga08y16_4667_c1_2858_3235 125
800 3300050511 nmdc:mga08y16_9850_c1 nmdc:mga08y16_9850_c1_9621_9998 125
801 3300050512 nmdc:mga0n895_43468_c1 nmdc:mga0n895_43468_c1_756_1133 125
802 3300050512 nmdc:mga0n895_53926_c1 nmdc:mga0n895_53926_c1_3196_3573 125
803 3300050513 nmdc:mga0rr50_24480_c1 nmdc:mga0rr50_24480_c1_3196_3573 125
804 3300050513 nmdc:mga0rr50_3052_c1 nmdc:mga0rr50_3052_c1_4194_4571 125
805 3300050514 nmdc:mga08x19_6548_c1 nmdc:mga08x19_6548_c1_1922_2299 125
806 3300050515 nmdc:mga0a205_1359_c1 nmdc:mga0a205_1359_c1_4805_5182 125
807 3300050515 nmdc:mga0a205_20778_c1 nmdc:mga0a205_20778_c1_732_1109 125
808 3300053077 Ga0495601_0226132 Ga0495601_0226132_22_405 125
809 3300053083 Ga0495655_0107662 Ga0495655_0107662_47_424 125
810 3300053087 Ga0500643_000189 Ga0500643_000189_41471_41854 125
811 3300053136 Ga0500559_0001158 Ga0500559_0001158_10_393 125
812 3300053136 Ga0500559_0019522 Ga0500559_0019522_2048_2431 125
813 3300053136 Ga0500559_0346151 Ga0500559_0346151_238_621 125
814 3300053139 Ga0500568_0000060 Ga0500568_0000060_88303_88686 125
815 3300053140 Ga0500573_0000007 Ga0500573_0000007_249891_250274 125
816 3300053140 Ga0500573_0008741 Ga0500573_0008741_1819_2202 125
817 3300053140 Ga0500573_0149065 Ga0500573_0149065_372_755 125
818 3300053142 Ga0500577_0229805 Ga0500577_0229805_31_414 125
819 3300053151 Ga0500604_0031742 Ga0500604_0031742_919_1302 125
820 3300059421 Ga0590071_067204 Ga0590071_067204_145_534 125
821 3300059423 Ga0590074_018119 Ga0590074_018119_705_1094 125
822 3300059423 Ga0590074_067245 Ga0590074_067245_48_425 125
823 3300059426 Ga0590077_061581 Ga0590077_061581_85_474 125
824 3300059490 Ga0587066_035592 Ga0587066_035592_511_900 125
825 3300059505 Ga0587083_0220556 Ga0587083_0220556_99_476 125
826 3300059511 Ga0587091_136190 Ga0587091_136190_108_485 125
827 3300059512 Ga0587092_067437 Ga0587092_067437_69_446 125
828 3300059622 Ga0587099_013927 Ga0587099_013927_448_831 125
829 3300059645 Ga0587076_033932 Ga0587076_033932_493_876 125
830 3300059647 Ga0587079_060860 Ga0587079_060860_396_773 125
831 3300059647 Ga0587079_138740 Ga0587079_138740_57_446 125
832 3300059655 Ga0587114_118604 Ga0587114_118604_62_451 125
833 3300000305 bgg_mtDRAFT_1034183 bgg_mtDRAFT_10341833 126
834 3300003308 Ga0006777J48905_1010862 Ga0006777J48905_10108623 126
835 3300003574 Ga0007410J51695_1013837 Ga0007410J51695_10138372 126
836 3300003577 Ga0007416J51690_1010708 Ga0007416J51690_10107083 126
837 3300003579 Ga0007429J51699_1006245 Ga0007429J51699_10062453 126
838 3300003611 Ga0007411J51799_111023 Ga0007411J51799_1110232 126
839 3300003693 Ga0032354_1024637 Ga0032354_10246372 126
840 3300005329 Ga0070683_100265558 Ga0070683_1002655583 126
841 3300005336 Ga0070680_100532122 Ga0070680_1005321222 126
842 3300005339 Ga0070660_100469885 Ga0070660_1004698852 126
843 3300005344 Ga0070661_100406666 Ga0070661_1004066662 126
844 3300005347 Ga0070668_102198086 Ga0070668_1021980861 126
845 3300005355 Ga0070671_100560391 Ga0070671_1005603912 126
846 3300005456 Ga0070678_101464625 Ga0070678_1014646251 126
847 3300005458 Ga0070681_11005459 Ga0070681_110054591 126
848 3300005530 Ga0070679_100135552 Ga0070679_1001355522 126
849 3300005535 Ga0070684_100540774 Ga0070684_1005407742 126
850 3300005539 Ga0068853_101127575 Ga0068853_1011275752 126
851 3300005577 Ga0068857_100039495 Ga0068857_1000394955 126
852 3300005844 Ga0068862_100000021 Ga0068862_100000021184 126
853 3300006931 Ga0097620_100002262 Ga0097620_1000022623 126
854 3300009177 Ga0105248_11220244 Ga0105248_112202442 126
855 3300009553 Ga0105249_10030399 Ga0105249_100303993 126
856 3300010375 Ga0105239_10513745 Ga0105239_105137452 126
857 3300014325 Ga0163163_10038653 Ga0163163_100386533 126
858 3300014325 Ga0163163_10749520 Ga0163163_107495202 126
859 3300017792 Ga0163161_10667106 Ga0163161_106671062 126
860 3300020069 Ga0197907_11402576 Ga0197907_114025763 126
861 3300020069 Ga0197907_11507371 Ga0197907_115073713 126
862 3300020070 Ga0206356_10342838 Ga0206356_103428382 126
863 3300020075 Ga0206349_1295472 Ga0206349_12954722 126
864 3300020076 Ga0206355_1196559 Ga0206355_11965591 126
865 3300020078 Ga0206352_11090449 Ga0206352_110904492 126
866 3300020081 Ga0206354_10144092 Ga0206354_101440921 126
867 3300020082 Ga0206353_10515275 Ga0206353_105152751 126
868 3300020082 Ga0206353_10609952 Ga0206353_106099521 126
869 3300020082 Ga0206353_11166848 Ga0206353_111668482 126
870 3300025912 Ga0207707_10430211 Ga0207707_104302112 126
871 3300025917 Ga0207660_10363262 Ga0207660_103632623 126
872 3300025920 Ga0207649_10818135 Ga0207649_108181352 126
873 3300025921 Ga0207652_10489013 Ga0207652_104890132 126
874 3300025961 Ga0207712_10061090 Ga0207712_100610903 126
875 3300026035 Ga0207703_11214405 Ga0207703_112144052 126
876 3300026116 Ga0207674_10032541 Ga0207674_100325414 126
877 3300028380 Ga0268265_10000034 Ga0268265_1000003417 126
878 3300030744 Ga0316181_1015560 Ga0316181_10155602 126
879 3300031727 Ga0316576_10285713 Ga0316576_102857132 126
880 3300031731 Ga0307405_11039857 Ga0307405_110398572 126
881 3300032002 Ga0307416_101588766 Ga0307416_1015887661 126
882 3300032168 Ga0316593_10138446 Ga0316593_101384461 126
883 3300041445 Ga0451792_00917 Ga0451792_00917_29_412 126
884 3300041451 Ga0451791_0268782 Ga0451791_0268782_111_491 126
885 3300042157 Ga0439458_0117229 Ga0439458_0117229_45_428 126
886 3300044735 Ga0466968_0292792 Ga0466968_0292792_98_481 126
887 3300046809 Ga0495600_0327751 Ga0495600_0327751_273_674 126
888 3300047315 Ga0495581_0140462 Ga0495581_0140462_358_759 126
889 3300048904 Ga0496101_0257440 Ga0496101_0257440_914_1315 126
890 3300048905 Ga0496102_0053791 Ga0496102_0053791_912_1313 126
891 3300048905 Ga0496102_0161323 Ga0496102_0161323_190_588 126
892 3300048906 Ga0496103_0031078 Ga0496103_0031078_2260_2661 126
893 3300048907 Ga0496104_0715566 Ga0496104_0715566_155_553 126
894 3300048908 Ga0496105_0001730 Ga0496105_0001730_51_452 126
895 3300048914 Ga0496111_0096042 Ga0496111_0096042_1298_1696 126
896 3300048916 Ga0496113_0233780 Ga0496113_0233780_1029_1430 126
897 3300048917 Ga0496114_1273358 Ga0496114_1273358_159_557 126
898 3300048929 Ga0496126_0194489 Ga0496126_0194489_502_900 126
899 3300048929 Ga0496126_0523820 Ga0496126_0523820_67_450 126
900 3300049161 Ga0501305_055512 Ga0501305_055512_150_554 126
901 3300049534 Ga0501318_004185 Ga0501318_004185_278_682 126
902 3300049569 Ga0501032_0671920 Ga0501032_0671920_44_424 126
903 3300049575 Ga0501039_1176406 Ga0501039_1176406_84_464 126
904 3300049577 Ga0501041_0439915 Ga0501041_0439915_266_646 126
905 3300049578 Ga0501042_0637019 Ga0501042_0637019_310_690 126
906 3300049583 Ga0501067_0062551 Ga0501067_0062551_1056_1454 126
907 3300049585 Ga0501069_0195392 Ga0501069_0195392_718_1116 126
908 3300049591 Ga0501075_0425808 Ga0501075_0425808_583_963 126
909 3300049743 Ga0501081_1094561 Ga0501081_1094561_15_395 126
910 3300049824 Ga0501045_0344378 Ga0501045_0344378_513_893 126
911 3300053077 Ga0495601_0201140 Ga0495601_0201140_880_1281 126
912 3300053085 Ga0495619_0119445 Ga0495619_0119445_1263_1664 126
913 3300059505 Ga0587083_0048155 Ga0587083_0048155_507_908 126
914 3300061734 Ga0530510_0324334 Ga0530510_0324334_450_848 126

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00453

Ribosomal_L20

Ribosomal protein L20

14

120

0.97

PF01632

Ribosomal_L35p

Ribosomal protein L35

2

58

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
7pkt-assembly1.cif.gz_o large subunit of the chlamydomonas reinhardtii mitoribosome 0.9064 14 114
8apo-assembly1.cif.gz_Ao structure of the mitochondrial ribosome from polytomella magna with trnas bound to the a and p sites 0.9035 14 114
6o8z-assembly1.cif.gz_R cryo-em image reconstruction of the 70s ribosome enterococcus faecalis class04 0.8977 11 116
6xyw-assembly1.cif.gz_Aq structure of the plant mitochondrial ribosome 0.894 13 115
6o8x-assembly1.cif.gz_R cryo-em image reconstruction of the 70s ribosome enterococcus faecalis class02 0.8905 15 116
ID Description Score Start End Superfamily
2ghjD02 Mainly Alpha;Orthogonal Bundle;c-terminal domain of poly(a) binding protein;Ribosomal protein L20, C-terminal domain 0.9443 53 116 1.10.1900.20
2ghjB02 Mainly Alpha;Orthogonal Bundle;c-terminal domain of poly(a) binding protein;Ribosomal protein L20, C-terminal domain 0.8771 58 119 1.10.1900.20
2ghjD02 Mainly Alpha;Orthogonal Bundle;c-terminal domain of poly(a) binding protein;Ribosomal protein L20, C-terminal domain 0.8662 53 116 1.10.1900.20
1gyzA00 Mainly Alpha;Orthogonal Bundle;c-terminal domain of poly(a) binding protein;Ribosomal protein L20, C-terminal domain 0.83 61 119 1.10.1900.20
2ghjB02 Mainly Alpha;Orthogonal Bundle;c-terminal domain of poly(a) binding protein;Ribosomal protein L20, C-terminal domain 0.8158 58 119 1.10.1900.20
ID Description Score Start End GO Terms
AF-J9FK27-F1-model_v4 Ribosomal protein L20 0.9985 60 116 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-G6EM08-F1-model_v4 deleted 0.9971 57 116
AF-A0A2D8YKH1-F1-model_v4 deleted 0.9946 58 116
AF-A0A354QTS7-F1-model_v4 Large ribosomal subunit protein bL20 (50S ribosomal protein L20) 0.9945 53 116 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A7K7GJZ7-F1-model_v4 RM20 protein 0.9943 61 114 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904

Feature Viewer

pLDDT pTM Quality
85.95 0.57 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map