F485568
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 914 | 482 | 883 | 125 |
Family's Representative Sequence
| Representative Sequence | 3300013104|Ga0157370_11322111|Ga0157370_113221112 |
| Length | 137 |
| Sequence | MPKMKTHRGAAKRFKVTGTGKITKRKVTLERASGYRGQRSRLYRKAKEQVTHSLGYAYRDRRARKGDFRRLWIQWINAGARANGMTYNRFIQGLKASGVEVDRKILADLAVTDAAAFTALVEIARANVPAAGASDAA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2515154155 | Actinopolymorpha alba DSM 45243 | Isolate | Rhizosphere |
| 2 | 2515154202 | Salinispora pacifica CNT084 | Isolate | Rhizosphere |
| 3 | 2585427649 | Amycolatopsis japonica MG417-CF17, DSM 44213 | Isolate | Unclassified |
| 4 | 2643221567 | Phycicoccus sp. Root563 | Isolate | Unclassified |
| 5 | 2643221576 | Nocardioides sp. Root614 | Isolate | Unclassified |
| 6 | 2643221590 | Nocardioides sp. Root682 | Isolate | Unclassified |
| 7 | 2643221624 | Phycicoccus sp. Root101 | Isolate | Unclassified |
| 8 | 2643221679 | Angustibacter sp. Root456 | Isolate | Unclassified |
| 9 | 2643221711 | Terrabacter sp. Root85 | Isolate | Unclassified |
| 10 | 2675902999 | Frankia asymbiotica NRRL B-16386 | Isolate | Nodule |
| 11 | 2687453737 | Frankia sp. BMG5.36 | Isolate | Nodule |
| 12 | 2773857921 | Frankia asymbiotica NRRL B-16386 | Isolate | Nodule |
| 13 | 2773857933 | Frankia sp. BMG5.30 | Isolate | Nodule |
| 14 | 2791355222 | Paenibacillus oryzae 1DrF-4 | Isolate | Unclassified |
| 15 | 2808606365 | Phycicoccus sp. SLBN-51 | Isolate | Unclassified |
| 16 | 2808606522 | Amycolatopsis sp. BJA-103 | Isolate | Unclassified |
| 17 | 2811994882 | Terrabacter sp. SLBN-196 | Isolate | Unclassified |
| 18 | 2818991318 | Humibacillus xanthopallidus SLBN-155 | Isolate | Unclassified |
| 19 | 2818991458 | Terrabacter sp. 3211 | Isolate | Rhizosphere |
| 20 | 2818991462 | Terrabacter sp. 3264 | Isolate | Rhizosphere |
| 21 | 2818991469 | Terrabacter lapilli 3265 | Isolate | Rhizosphere |
| 22 | 2867302475 | Micromonospora globbae WPS1-2 | Isolate | Unclassified |
| 23 | 2870622029 | Conyzicola lurida DSM 105784 | Isolate | Unclassified |
| 24 | 2887443736 | Ruania rhizosphaerae LNNU 22110 | Isolate | Rhizosphere |
| 25 | 2891968417 | Nocardioides luteus SAI-037 | Isolate | Unclassified |
| 26 | 2899359706 | Amycolatopsis anabasis EGI 650086 | Isolate | Unclassified |
| 27 | 2915768154 | Amycolatopsis pittospori PIP199 | Isolate | Unclassified |
| 28 | 2919446982 | Phycicoccus sp. 3266 | Isolate | Rhizosphere |
| 29 | 2928121344 | Plantibacter flavus 1756 | Isolate | Rhizosphere |
| 30 | 2939657138 | Conyzicola nivalis 2857 | Isolate | Rhizosphere |
| 31 | 3001889506 | Janibacter sp. YIM B02568 | Isolate | Unclassified |
| 32 | 3300000305 | Blue grama grass rhizosphere microbial communities from Sevilleta, New Mexico, USA - Combined Assembly | Metatranscriptome | Rhizosphere |
| 33 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 34 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 35 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 36 | 3300003308 | Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 37 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 38 | 3300003574 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 39 | 3300003577 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 40 | 3300003579 | Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 41 | 3300003611 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_27 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 42 | 3300003693 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 43 | 3300004785 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-1 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 44 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 45 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 46 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 47 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 48 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 53 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 55 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 58 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 59 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 60 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 68 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 70 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 72 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 73 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 78 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 79 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 80 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 81 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 82 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 84 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 85 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 86 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 88 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 91 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 92 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 93 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 94 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 95 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 96 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 97 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 98 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 99 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 100 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 101 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 102 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 103 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 104 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 105 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 106 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 107 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 108 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 109 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 110 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 111 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 113 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 114 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 115 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 116 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 117 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 118 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 119 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 120 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 121 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 122 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 124 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 137 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 138 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 139 | 3300012485 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.7.old.040610 | Metagenome | Rhizosphere |
| 140 | 3300012497 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 | Metagenome | Rhizosphere |
| 141 | 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Metagenome | Rhizosphere |
| 142 | 3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Metagenome | Rhizosphere |
| 143 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 144 | 3300013045 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 145 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 153 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 155 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 156 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 157 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 158 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 159 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 160 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 161 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 162 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 163 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 164 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 165 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 166 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 167 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 219 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 220 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 224 | 3300029277 | Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.ctcc.R1 | Metatranscriptome | Rhizosphere |
| 225 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 226 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 227 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 228 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 229 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 230 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 231 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 232 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 233 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 234 | 3300031592 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRA4 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 235 | 3300031614 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRI4 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 236 | 3300031633 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU4 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 237 | 3300031667 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 238 | 3300031686 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRA6 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 239 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 240 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 241 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 242 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 243 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 244 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 245 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 246 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 247 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 248 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 249 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 250 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 251 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 252 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 253 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 254 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 255 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 256 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 257 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 258 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 259 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 260 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 261 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 262 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 263 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 264 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 265 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 266 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 267 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 268 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 269 | 3300036458 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 270 | 3300036459 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 271 | 3300036534 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 272 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 273 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 274 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 275 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 276 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 277 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 278 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 279 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 280 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 281 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 282 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 283 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 284 | 3300041445 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaT | Metatranscriptome | Rhizoplane |
| 285 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 286 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 287 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 288 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 289 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 290 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 291 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 292 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 293 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 294 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 295 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 296 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 297 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 298 | 3300042533 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 | Metagenome | Rhizosphere |
| 299 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 300 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 301 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 302 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 303 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 304 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 305 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 306 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 307 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 308 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 309 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 350 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 351 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 352 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 353 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 354 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 355 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 356 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 357 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 358 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 359 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 360 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 361 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 362 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 363 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 364 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 365 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 366 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 367 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 368 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 369 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 370 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 371 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 372 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 373 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 374 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 375 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 376 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 377 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 378 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 379 | 3300049131 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 380 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 381 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 382 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 383 | 3300049518 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control | Metagenome | Rhizosphere |
| 384 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 385 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 386 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 387 | 3300049532 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 388 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 389 | 3300049534 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 390 | 3300049535 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 391 | 3300049536 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 392 | 3300049537 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 393 | 3300049540 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 394 | 3300049541 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 395 | 3300049549 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 396 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 397 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 398 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 399 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 400 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 401 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 402 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 403 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 404 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 405 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 406 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 407 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 408 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 409 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 410 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 411 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 412 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 413 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 414 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 415 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 416 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 417 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 418 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 419 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 420 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 421 | 3300049683 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control | Metagenome | Rhizosphere |
| 422 | 3300049685 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control | Metagenome | Rhizosphere |
| 423 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 424 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 425 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 426 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 427 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 428 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 429 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 430 | 3300049851 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought | Metagenome | Rhizosphere |
| 431 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 432 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 433 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 434 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 435 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 436 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 437 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 438 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 439 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 440 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 441 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 442 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 443 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 444 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 445 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 446 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 447 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 448 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 449 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 450 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 451 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 452 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 453 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 454 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 455 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 456 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 457 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 458 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 459 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 460 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 461 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 462 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 463 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 464 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 465 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 466 | 3300059512 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 467 | 3300059605 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 468 | 3300059622 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 469 | 3300059625 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 151R_CD_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 470 | 3300059630 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 471 | 3300059639 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 472 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 473 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 474 | 3300059642 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 475 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 476 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 477 | 3300059655 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 478 | 3300059660 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 161R_SW_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 479 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 480 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 481 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 482 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 80.96 |
| Metatranscriptomes | 15.65 |
| Isolates | 3.39 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.19 |
| Nodule | 0.44 |
| Rhizoplane | 8.53 |
| Rhizosphere | 82.71 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.13 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | bgg_mtDRAFT_1034183 | 3300000305 | Bacteria | 873 |
| 2 | JGI24739J22299_10107071 | 3300001989 | Bacteria | 841 |
| 3 | JGI24737J22298_10100500 | 3300001990 | Bacteria | 857 |
| 4 | JGI24744J21845_10078740 | 3300002077 | Bacteria | 602 |
| 5 | Ga0006777J48905_1010862 | 3300003308 | Bacteria | 1786 |
| 6 | JGI25407J50210_10038405 | 3300003373 | Bacteria | 1229 |
| 7 | Ga0007410J51695_1013837 | 3300003574 | Bacteria | 881 |
| 8 | Ga0007416J51690_1010708 | 3300003577 | Bacteria | 1730 |
| 9 | Ga0007429J51699_1006245 | 3300003579 | Bacteria | 1787 |
| 10 | Ga0007411J51799_111023 | 3300003611 | Bacteria | 638 |
| 11 | Ga0032354_1024637 | 3300003693 | Bacteria | 689 |
| 12 | Ga0058858_1321591 | 3300004785 | Bacteria | 539 |
| 13 | Ga0058859_11606581 | 3300004798 | Bacteria | 1507 |
| 14 | Ga0058861_10039264 | 3300004800 | Bacteria | 819 |
| 15 | Ga0058861_12049027 | 3300004800 | Bacteria | 504 |
| 16 | Ga0058860_10075105 | 3300004801 | Bacteria | 1485 |
| 17 | Ga0065712_10480791 | 3300005290 | Bacteria | 663 |
| 18 | Ga0070658_10016077 | 3300005327 | Bacteria | 5984 |
| 19 | Ga0070683_100138044 | 3300005329 | Bacteria | 2309 |
| 20 | Ga0070683_100162734 | 3300005329 | Bacteria | 2117 |
| 21 | Ga0070683_100265558 | 3300005329 | Bacteria | 1633 |
| 22 | Ga0070683_101755533 | 3300005329 | Bacteria | 597 |
| 23 | Ga0070670_100176307 | 3300005331 | Bacteria | 1855 |
| 24 | Ga0070670_100488816 | 3300005331 | Bacteria | 1094 |
| 25 | Ga0070677_10048185 | 3300005333 | Bacteria | 1711 |
| 26 | Ga0068869_100292375 | 3300005334 | Bacteria | 1313 |
| 27 | Ga0068869_100456541 | 3300005334 | Bacteria | 1060 |
| 28 | Ga0070666_10896382 | 3300005335 | Bacteria | 655 |
| 29 | Ga0070680_100076550 | 3300005336 | Bacteria | 2754 |
| 30 | Ga0070680_100532122 | 3300005336 | Bacteria | 1007 |
| 31 | Ga0070682_100064333 | 3300005337 | Bacteria | 2328 |
| 32 | Ga0070682_100108363 | 3300005337 | Bacteria | 1846 |
| 33 | Ga0070660_100039249 | 3300005339 | Bacteria | 3598 |
| 34 | Ga0070660_100397556 | 3300005339 | Bacteria | 1139 |
| 35 | Ga0070660_100469885 | 3300005339 | Bacteria | 1044 |
| 36 | Ga0070689_100245523 | 3300005340 | Bacteria | 1476 |
| 37 | Ga0070691_10218203 | 3300005341 | Bacteria | 1009 |
| 38 | Ga0070687_100637907 | 3300005343 | Bacteria | 737 |
| 39 | Ga0070661_100053746 | 3300005344 | Bacteria | 2949 |
| 40 | Ga0070661_100406666 | 3300005344 | Bacteria | 1077 |
| 41 | Ga0070668_100276250 | 3300005347 | Bacteria | 1402 |
| 42 | Ga0070668_100520658 | 3300005347 | Bacteria | 1032 |
| 43 | Ga0070668_102198086 | 3300005347 | Bacteria | 510 |
| 44 | Ga0070669_100261576 | 3300005353 | Bacteria | 1381 |
| 45 | Ga0070675_100140226 | 3300005354 | Bacteria | 2066 |
| 46 | Ga0070675_101052595 | 3300005354 | Bacteria | 748 |
| 47 | Ga0070671_100157807 | 3300005355 | Bacteria | 1917 |
| 48 | Ga0070671_100560391 | 3300005355 | Bacteria | 986 |
| 49 | Ga0070674_100055900 | 3300005356 | Bacteria | 2735 |
| 50 | Ga0070674_100082938 | 3300005356 | Bacteria | 2294 |
| 51 | Ga0070673_100133823 | 3300005364 | Bacteria | 2084 |
| 52 | Ga0070688_100246409 | 3300005365 | Bacteria | 1271 |
| 53 | Ga0070659_100035645 | 3300005366 | Bacteria | 3875 |
| 54 | Ga0070659_100264206 | 3300005366 | Bacteria | 1428 |
| 55 | Ga0070659_100603077 | 3300005366 | Bacteria | 944 |
| 56 | Ga0070709_10005108 | 3300005434 | Bacteria | 7096 |
| 57 | Ga0070709_10076141 | 3300005434 | Bacteria | 2178 |
| 58 | Ga0070714_100707000 | 3300005435 | Bacteria | 972 |
| 59 | Ga0070713_100096655 | 3300005436 | Bacteria | 2550 |
| 60 | Ga0070713_100417463 | 3300005436 | Bacteria | 1255 |
| 61 | Ga0070713_100884813 | 3300005436 | Bacteria | 858 |
| 62 | Ga0070701_10178204 | 3300005438 | Bacteria | 1242 |
| 63 | Ga0070711_100317625 | 3300005439 | Bacteria | 1243 |
| 64 | Ga0070705_100130886 | 3300005440 | Bacteria | 1636 |
| 65 | Ga0070663_100258932 | 3300005455 | Bacteria | 1379 |
| 66 | Ga0070678_100070555 | 3300005456 | Bacteria | 2613 |
| 67 | Ga0070678_100445304 | 3300005456 | Bacteria | 1133 |
| 68 | Ga0070678_101464625 | 3300005456 | Bacteria | 639 |
| 69 | Ga0070681_10754852 | 3300005458 | Bacteria | 889 |
| 70 | Ga0070681_11005459 | 3300005458 | Bacteria | 754 |
| 71 | Ga0070685_10063525 | 3300005466 | Bacteria | 2168 |
| 72 | Ga0070706_101167390 | 3300005467 | Bacteria | 708 |
| 73 | Ga0070706_102016214 | 3300005467 | Bacteria | 523 |
| 74 | Ga0070707_100051210 | 3300005468 | Bacteria | 3958 |
| 75 | Ga0070698_100005507 | 3300005471 | Bacteria | 13825 |
| 76 | Ga0070699_100400017 | 3300005518 | Bacteria | 1242 |
| 77 | Ga0070679_100135552 | 3300005530 | Bacteria | 2443 |
| 78 | Ga0070684_100079301 | 3300005535 | Bacteria | 2902 |
| 79 | Ga0070684_100540774 | 3300005535 | Bacteria | 1081 |
| 80 | Ga0070684_101512930 | 3300005535 | Bacteria | 633 |
| 81 | Ga0068853_101127575 | 3300005539 | Bacteria | 757 |
| 82 | Ga0070672_100029670 | 3300005543 | Bacteria | 4104 |
| 83 | Ga0070672_100782766 | 3300005543 | Bacteria | 839 |
| 84 | Ga0070686_100368128 | 3300005544 | Bacteria | 1084 |
| 85 | Ga0070693_100071853 | 3300005547 | Bacteria | 2040 |
| 86 | Ga0070665_100245542 | 3300005548 | Bacteria | 1791 |
| 87 | Ga0070665_100862216 | 3300005548 | Bacteria | 919 |
| 88 | Ga0068855_101015168 | 3300005563 | Bacteria | 871 |
| 89 | Ga0068857_100039495 | 3300005577 | Bacteria | 4180 |
| 90 | Ga0068857_100496736 | 3300005577 | Bacteria | 1145 |
| 91 | Ga0068857_101381444 | 3300005577 | Bacteria | 685 |
| 92 | Ga0068854_101003959 | 3300005578 | Bacteria | 739 |
| 93 | Ga0068854_101245438 | 3300005578 | Bacteria | 668 |
| 94 | Ga0068856_100429789 | 3300005614 | Bacteria | 1341 |
| 95 | Ga0070702_100000907 | 3300005615 | Bacteria | 11562 |
| 96 | Ga0070702_100268791 | 3300005615 | Bacteria | 1165 |
| 97 | Ga0070702_100269722 | 3300005615 | Bacteria | 1163 |
| 98 | Ga0068852_100196995 | 3300005616 | Bacteria | 1904 |
| 99 | Ga0068852_100350854 | 3300005616 | Bacteria | 1441 |
| 100 | Ga0068852_100452985 | 3300005616 | Bacteria | 1271 |
| 101 | Ga0068864_100348249 | 3300005618 | Bacteria | 1397 |
| 102 | Ga0068861_100042273 | 3300005719 | Bacteria | 3415 |
| 103 | Ga0068861_100166143 | 3300005719 | Bacteria | 1825 |
| 104 | Ga0068870_10773424 | 3300005840 | Bacteria | 669 |
| 105 | Ga0068863_100000454 | 3300005841 | Bacteria | 41713 |
| 106 | Ga0068863_100249306 | 3300005841 | Bacteria | 1715 |
| 107 | Ga0068860_101818840 | 3300005843 | Bacteria | 631 |
| 108 | Ga0068862_100000021 | 3300005844 | Bacteria | 218035 |
| 109 | Ga0068862_100152764 | 3300005844 | Bacteria | 2056 |
| 110 | Ga0081455_10014667 | 3300005937 | Bacteria | 7659 |
| 111 | Ga0081455_10056135 | 3300005937 | Bacteria | 3346 |
| 112 | Ga0081455_10230695 | 3300005937 | Bacteria | 1366 |
| 113 | Ga0081455_10288833 | 3300005937 | Bacteria | 1182 |
| 114 | Ga0081538_10002518 | 3300005981 | Bacteria | 17845 |
| 115 | Ga0070717_10309524 | 3300006028 | Bacteria | 1405 |
| 116 | Ga0075363_100355524 | 3300006048 | Bacteria | 856 |
| 117 | Ga0075432_10001180 | 3300006058 | Bacteria | 8368 |
| 118 | Ga0075432_10001981 | 3300006058 | Bacteria | 6810 |
| 119 | Ga0070716_100228081 | 3300006173 | Bacteria | 1255 |
| 120 | Ga0070712_100328567 | 3300006175 | Bacteria | 1245 |
| 121 | Ga0075427_10006958 | 3300006194 | Bacteria | 1654 |
| 122 | Ga0075366_10216500 | 3300006195 | Bacteria | 1166 |
| 123 | Ga0097621_100161859 | 3300006237 | Bacteria | 1924 |
| 124 | Ga0097621_101129317 | 3300006237 | Bacteria | 736 |
| 125 | Ga0075370_10188764 | 3300006353 | Bacteria | 1214 |
| 126 | Ga0075370_10381386 | 3300006353 | Bacteria | 845 |
| 127 | Ga0068871_100103154 | 3300006358 | Bacteria | 2391 |
| 128 | Ga0075428_100000040 | 3300006844 | Bacteria | 102788 |
| 129 | Ga0075428_100100897 | 3300006844 | Bacteria | 3147 |
| 130 | Ga0075428_100355768 | 3300006844 | Bacteria | 1571 |
| 131 | Ga0075428_100576073 | 3300006844 | Bacteria | 1203 |
| 132 | Ga0075428_101221817 | 3300006844 | Bacteria | 792 |
| 133 | Ga0075430_100138383 | 3300006846 | Bacteria | 2028 |
| 134 | Ga0075430_100157070 | 3300006846 | Bacteria | 1893 |
| 135 | Ga0075431_100105764 | 3300006847 | Bacteria | 2903 |
| 136 | Ga0075433_10004850 | 3300006852 | Bacteria | 10519 |
| 137 | Ga0075433_10029068 | 3300006852 | Bacteria | 4706 |
| 138 | Ga0075434_100003049 | 3300006871 | Bacteria | 14905 |
| 139 | Ga0075429_100072200 | 3300006880 | Bacteria | 3005 |
| 140 | Ga0075429_100159841 | 3300006880 | Bacteria | 1973 |
| 141 | Ga0068865_100126898 | 3300006881 | Bacteria | 1906 |
| 142 | Ga0068865_100128479 | 3300006881 | Bacteria | 1895 |
| 143 | Ga0075436_100008198 | 3300006914 | Bacteria | 7150 |
| 144 | Ga0097620_100002262 | 3300006931 | Bacteria | 19531 |
| 145 | Ga0075435_100005162 | 3300007076 | Bacteria | 9080 |
| 146 | Ga0075435_100018949 | 3300007076 | Bacteria | 5245 |
| 147 | Ga0105244_10043572 | 3300009036 | Bacteria | 2315 |
| 148 | Ga0105240_10245419 | 3300009093 | Bacteria | 2074 |
| 149 | Ga0105240_10900637 | 3300009093 | Bacteria | 952 |
| 150 | Ga0111539_10000158 | 3300009094 | Bacteria | 76916 |
| 151 | Ga0111539_10006978 | 3300009094 | Bacteria | 14495 |
| 152 | Ga0111539_10642916 | 3300009094 | Bacteria | 1235 |
| 153 | Ga0105245_10075454 | 3300009098 | Bacteria | 3070 |
| 154 | Ga0105245_10149576 | 3300009098 | Bacteria | 2206 |
| 155 | Ga0105245_10184993 | 3300009098 | Bacteria | 1993 |
| 156 | Ga0105247_10154969 | 3300009101 | Bacteria | 1513 |
| 157 | Ga0114129_10003880 | 3300009147 | Bacteria | 21096 |
| 158 | Ga0114129_10501662 | 3300009147 | Bacteria | 1585 |
| 159 | Ga0105243_10287583 | 3300009148 | Bacteria | 1484 |
| 160 | Ga0105243_10346250 | 3300009148 | Bacteria | 1363 |
| 161 | Ga0105241_11365860 | 3300009174 | Bacteria | 677 |
| 162 | Ga0105242_10077206 | 3300009176 | Bacteria | 2778 |
| 163 | Ga0105242_10226239 | 3300009176 | Bacteria | 1674 |
| 164 | Ga0105242_11030276 | 3300009176 | Bacteria | 833 |
| 165 | Ga0105248_10132883 | 3300009177 | Bacteria | 2808 |
| 166 | Ga0105248_11220244 | 3300009177 | Bacteria | 850 |
| 167 | Ga0105237_10342779 | 3300009545 | Bacteria | 1498 |
| 168 | Ga0105237_10711945 | 3300009545 | Bacteria | 1010 |
| 169 | Ga0105238_10064212 | 3300009551 | Bacteria | 3672 |
| 170 | Ga0105238_10090480 | 3300009551 | Bacteria | 3047 |
| 171 | Ga0105238_10286796 | 3300009551 | Bacteria | 1628 |
| 172 | Ga0105238_10355131 | 3300009551 | Bacteria | 1455 |
| 173 | Ga0105238_10787131 | 3300009551 | Bacteria | 966 |
| 174 | Ga0105238_12042347 | 3300009551 | Bacteria | 607 |
| 175 | Ga0105249_10030399 | 3300009553 | Bacteria | 4882 |
| 176 | Ga0105249_10055105 | 3300009553 | Bacteria | 3636 |
| 177 | Ga0105249_10121062 | 3300009553 | Bacteria | 2487 |
| 178 | Ga0105249_10255352 | 3300009553 | Bacteria | 1739 |
| 179 | Ga0105249_10795882 | 3300009553 | Bacteria | 1009 |
| 180 | Ga0105249_13426761 | 3300009553 | Bacteria | 510 |
| 181 | Ga0105239_10122430 | 3300010375 | Bacteria | 2890 |
| 182 | Ga0105239_10513745 | 3300010375 | Bacteria | 1362 |
| 183 | Ga0105239_12627641 | 3300010375 | Bacteria | 587 |
| 184 | Ga0105246_10052545 | 3300011119 | Bacteria | 2801 |
| 185 | Ga0157325_1002978 | 3300012485 | Bacteria | 904 |
| 186 | Ga0157319_1027569 | 3300012497 | Bacteria | 594 |
| 187 | Ga0157319_1027913 | 3300012497 | Bacteria | 592 |
| 188 | Ga0157345_1009711 | 3300012498 | Bacteria | 826 |
| 189 | Ga0157345_1046666 | 3300012498 | Bacteria | 539 |
| 190 | Ga0157342_1002723 | 3300012507 | Bacteria | 1459 |
| 191 | Ga0157326_1024626 | 3300012513 | Bacteria | 764 |
| 192 | Ga0154016_120491 | 3300013045 | Bacteria | 502 |
| 193 | Ga0157370_10086887 | 3300013104 | Bacteria | 2937 |
| 194 | Ga0157370_11322111 | 3300013104 | Bacteria | 649 |
| 195 | Ga0157369_10468414 | 3300013105 | Bacteria | 1304 |
| 196 | Ga0157369_10761392 | 3300013105 | Bacteria | 996 |
| 197 | Ga0157374_10397847 | 3300013296 | Bacteria | 1374 |
| 198 | Ga0163162_10070044 | 3300013306 | Bacteria | 3559 |
| 199 | Ga0163162_10107812 | 3300013306 | Bacteria | 2881 |
| 200 | Ga0163162_10260383 | 3300013306 | Bacteria | 1866 |
| 201 | Ga0163162_11116454 | 3300013306 | Bacteria | 893 |
| 202 | Ga0157372_10014531 | 3300013307 | Bacteria | 8425 |
| 203 | Ga0157372_10022090 | 3300013307 | Bacteria | 6882 |
| 204 | Ga0157372_10299596 | 3300013307 | Bacteria | 1870 |
| 205 | Ga0157372_10391438 | 3300013307 | Bacteria | 1619 |
| 206 | Ga0157372_11395815 | 3300013307 | Bacteria | 807 |
| 207 | Ga0157372_11942601 | 3300013307 | Bacteria | 676 |
| 208 | Ga0157375_10126072 | 3300013308 | Bacteria | 2675 |
| 209 | Ga0157375_10221685 | 3300013308 | Bacteria | 2049 |
| 210 | Ga0157375_10683629 | 3300013308 | Bacteria | 1181 |
| 211 | Ga0157375_11638960 | 3300013308 | Bacteria | 761 |
| 212 | Ga0163163_10038653 | 3300014325 | Bacteria | 4652 |
| 213 | Ga0163163_10050064 | 3300014325 | Bacteria | 4113 |
| 214 | Ga0163163_10211338 | 3300014325 | Bacteria | 1989 |
| 215 | Ga0163163_10749520 | 3300014325 | Bacteria | 1040 |
| 216 | Ga0163163_11073078 | 3300014325 | Bacteria | 868 |
| 217 | Ga0163163_11130466 | 3300014325 | Bacteria | 846 |
| 218 | Ga0163163_12145644 | 3300014325 | Bacteria | 618 |
| 219 | Ga0157380_10197669 | 3300014326 | Bacteria | 1781 |
| 220 | Ga0157380_10326842 | 3300014326 | Bacteria | 1424 |
| 221 | Ga0157380_10999637 | 3300014326 | Bacteria | 870 |
| 222 | Ga0157377_10166507 | 3300014745 | Bacteria | 1375 |
| 223 | Ga0157377_11319933 | 3300014745 | Bacteria | 565 |
| 224 | Ga0157379_10969577 | 3300014968 | Bacteria | 809 |
| 225 | Ga0157379_11024236 | 3300014968 | Bacteria | 788 |
| 226 | Ga0157376_10506599 | 3300014969 | Bacteria | 1187 |
| 227 | Ga0157376_11910279 | 3300014969 | Bacteria | 631 |
| 228 | Ga0163161_10017982 | 3300017792 | Bacteria | 4955 |
| 229 | Ga0163161_10667106 | 3300017792 | Bacteria | 863 |
| 230 | Ga0163161_11589849 | 3300017792 | Bacteria | 576 |
| 231 | Ga0197907_11084971 | 3300020069 | Bacteria | 1053 |
| 232 | Ga0197907_11163051 | 3300020069 | Bacteria | 745 |
| 233 | Ga0197907_11402576 | 3300020069 | Bacteria | 1027 |
| 234 | Ga0197907_11507371 | 3300020069 | Bacteria | 1158 |
| 235 | Ga0206356_10235624 | 3300020070 | Bacteria | 529 |
| 236 | Ga0206356_10342838 | 3300020070 | Bacteria | 2469 |
| 237 | Ga0206356_11663862 | 3300020070 | Bacteria | 865 |
| 238 | Ga0206349_1119767 | 3300020075 | Bacteria | 1130 |
| 239 | Ga0206349_1227335 | 3300020075 | Bacteria | 820 |
| 240 | Ga0206349_1295472 | 3300020075 | Bacteria | 725 |
| 241 | Ga0206355_1018285 | 3300020076 | Bacteria | 1011 |
| 242 | Ga0206355_1157355 | 3300020076 | Bacteria | 865 |
| 243 | Ga0206355_1196559 | 3300020076 | Bacteria | 1173 |
| 244 | Ga0206355_1290850 | 3300020076 | Bacteria | 616 |
| 245 | Ga0206355_1436410 | 3300020076 | Bacteria | 796 |
| 246 | Ga0206355_1678641 | 3300020076 | Bacteria | 534 |
| 247 | Ga0206351_10242066 | 3300020077 | Bacteria | 741 |
| 248 | Ga0206351_10349906 | 3300020077 | Bacteria | 1858 |
| 249 | Ga0206351_10925769 | 3300020077 | Bacteria | 738 |
| 250 | Ga0206352_10728115 | 3300020078 | Bacteria | 1780 |
| 251 | Ga0206352_11090449 | 3300020078 | Bacteria | 859 |
| 252 | Ga0206352_11355473 | 3300020078 | Bacteria | 1932 |
| 253 | Ga0206350_10685797 | 3300020080 | Bacteria | 1131 |
| 254 | Ga0206354_10144092 | 3300020081 | Bacteria | 802 |
| 255 | Ga0206354_10201171 | 3300020081 | Bacteria | 1641 |
| 256 | Ga0206354_10406115 | 3300020081 | Bacteria | 1265 |
| 257 | Ga0206354_10479002 | 3300020081 | Bacteria | 1500 |
| 258 | Ga0206354_10770711 | 3300020081 | Bacteria | 1110 |
| 259 | Ga0206354_11652329 | 3300020081 | Bacteria | 1264 |
| 260 | Ga0206353_10223354 | 3300020082 | Bacteria | 4430 |
| 261 | Ga0206353_10268640 | 3300020082 | Bacteria | 580 |
| 262 | Ga0206353_10515275 | 3300020082 | Bacteria | 510 |
| 263 | Ga0206353_10609952 | 3300020082 | Bacteria | 582 |
| 264 | Ga0206353_10743311 | 3300020082 | Bacteria | 1463 |
| 265 | Ga0206353_10835504 | 3300020082 | Bacteria | 3910 |
| 266 | Ga0206353_10856742 | 3300020082 | Bacteria | 1540 |
| 267 | Ga0206353_11166848 | 3300020082 | Bacteria | 661 |
| 268 | Ga0154015_1121433 | 3300020610 | Bacteria | 1599 |
| 269 | Ga0154015_1313599 | 3300020610 | Bacteria | 929 |
| 270 | Ga0154015_1611020 | 3300020610 | Bacteria | 762 |
| 271 | Ga0154015_1670310 | 3300020610 | Bacteria | 1575 |
| 272 | Ga0207682_10234516 | 3300025893 | Bacteria | 851 |
| 273 | Ga0207642_10501364 | 3300025899 | Bacteria | 743 |
| 274 | Ga0207688_10196028 | 3300025901 | Bacteria | 1210 |
| 275 | Ga0207688_10228263 | 3300025901 | Bacteria | 1123 |
| 276 | Ga0207688_10257878 | 3300025901 | Bacteria | 1058 |
| 277 | Ga0207680_10160003 | 3300025903 | Bacteria | 1509 |
| 278 | Ga0207647_10206425 | 3300025904 | Bacteria | 1136 |
| 279 | Ga0207685_10012727 | 3300025905 | Bacteria | 2578 |
| 280 | Ga0207699_10093442 | 3300025906 | Bacteria | 1893 |
| 281 | Ga0207699_10301989 | 3300025906 | Bacteria | 1118 |
| 282 | Ga0207643_10855511 | 3300025908 | Bacteria | 589 |
| 283 | Ga0207705_11093888 | 3300025909 | Bacteria | 614 |
| 284 | Ga0207707_10002485 | 3300025912 | Bacteria | 16588 |
| 285 | Ga0207707_10430211 | 3300025912 | Bacteria | 1131 |
| 286 | Ga0207660_10035116 | 3300025917 | Bacteria | 3478 |
| 287 | Ga0207660_10363262 | 3300025917 | Bacteria | 1162 |
| 288 | Ga0207662_10190591 | 3300025918 | Bacteria | 1323 |
| 289 | Ga0207657_10015478 | 3300025919 | Bacteria | 7389 |
| 290 | Ga0207657_10782258 | 3300025919 | Bacteria | 738 |
| 291 | Ga0207649_10818135 | 3300025920 | Bacteria | 728 |
| 292 | Ga0207652_10125908 | 3300025921 | Bacteria | 2282 |
| 293 | Ga0207652_10196152 | 3300025921 | Bacteria | 1816 |
| 294 | Ga0207652_10489013 | 3300025921 | Bacteria | 1108 |
| 295 | Ga0207652_11350694 | 3300025921 | Bacteria | 616 |
| 296 | Ga0207646_10068183 | 3300025922 | Bacteria | 3177 |
| 297 | Ga0207681_10365729 | 3300025923 | Bacteria | 1158 |
| 298 | Ga0207694_10063730 | 3300025924 | Bacteria | 2872 |
| 299 | Ga0207694_10664129 | 3300025924 | Bacteria | 878 |
| 300 | Ga0207694_10911313 | 3300025924 | Bacteria | 743 |
| 301 | Ga0207650_10200313 | 3300025925 | Bacteria | 1599 |
| 302 | Ga0207650_10374309 | 3300025925 | Bacteria | 1175 |
| 303 | Ga0207650_11029933 | 3300025925 | Bacteria | 700 |
| 304 | Ga0207659_10158333 | 3300025926 | Bacteria | 1775 |
| 305 | Ga0207659_10222556 | 3300025926 | Bacteria | 1518 |
| 306 | Ga0207687_10159895 | 3300025927 | Bacteria | 1728 |
| 307 | Ga0207687_10402656 | 3300025927 | Bacteria | 1126 |
| 308 | Ga0207700_10159457 | 3300025928 | Bacteria | 1872 |
| 309 | Ga0207700_10176622 | 3300025928 | Bacteria | 1785 |
| 310 | Ga0207700_10377374 | 3300025928 | Bacteria | 1239 |
| 311 | Ga0207664_10114979 | 3300025929 | Bacteria | 2243 |
| 312 | Ga0207664_10337414 | 3300025929 | Bacteria | 1332 |
| 313 | Ga0207664_10460888 | 3300025929 | Bacteria | 1135 |
| 314 | Ga0207644_11276549 | 3300025931 | Bacteria | 617 |
| 315 | Ga0207690_10540821 | 3300025932 | Bacteria | 946 |
| 316 | Ga0207690_11464286 | 3300025932 | Bacteria | 571 |
| 317 | Ga0207706_10475953 | 3300025933 | Bacteria | 1079 |
| 318 | Ga0207706_10784118 | 3300025933 | Bacteria | 810 |
| 319 | Ga0207686_10131812 | 3300025934 | Bacteria | 1715 |
| 320 | Ga0207686_11719904 | 3300025934 | Bacteria | 519 |
| 321 | Ga0207709_10010363 | 3300025935 | Bacteria | 5132 |
| 322 | Ga0207709_10021535 | 3300025935 | Bacteria | 3651 |
| 323 | Ga0207709_10395892 | 3300025935 | Bacteria | 1055 |
| 324 | Ga0207709_10531216 | 3300025935 | Bacteria | 922 |
| 325 | Ga0207669_10087605 | 3300025937 | Bacteria | 2017 |
| 326 | Ga0207669_10101646 | 3300025937 | Bacteria | 1902 |
| 327 | Ga0207704_10228747 | 3300025938 | Bacteria | 1381 |
| 328 | Ga0207691_10314884 | 3300025940 | Bacteria | 1342 |
| 329 | Ga0207691_10844915 | 3300025940 | Bacteria | 768 |
| 330 | Ga0207711_10152956 | 3300025941 | Bacteria | 2083 |
| 331 | Ga0207689_10146104 | 3300025942 | Bacteria | 1948 |
| 332 | Ga0207689_10159920 | 3300025942 | Bacteria | 1856 |
| 333 | Ga0207661_10052660 | 3300025944 | Bacteria | 3253 |
| 334 | Ga0207661_10432291 | 3300025944 | Bacteria | 1197 |
| 335 | Ga0207661_10760121 | 3300025944 | Bacteria | 892 |
| 336 | Ga0207679_11058376 | 3300025945 | Bacteria | 744 |
| 337 | Ga0207667_10816517 | 3300025949 | Bacteria | 928 |
| 338 | Ga0207651_10229927 | 3300025960 | Bacteria | 1505 |
| 339 | Ga0207712_10061090 | 3300025961 | Bacteria | 2673 |
| 340 | Ga0207712_10157879 | 3300025961 | Bacteria | 1759 |
| 341 | Ga0207712_10186765 | 3300025961 | Bacteria | 1633 |
| 342 | Ga0207712_10806069 | 3300025961 | Bacteria | 826 |
| 343 | Ga0207668_10086951 | 3300025972 | Bacteria | 2285 |
| 344 | Ga0207668_10240624 | 3300025972 | Bacteria | 1464 |
| 345 | Ga0207668_10647785 | 3300025972 | Bacteria | 924 |
| 346 | Ga0207640_10552062 | 3300025981 | Bacteria | 968 |
| 347 | Ga0207640_11497903 | 3300025981 | Bacteria | 606 |
| 348 | Ga0207658_10306074 | 3300025986 | Bacteria | 1371 |
| 349 | Ga0207703_10018834 | 3300026035 | Bacteria | 5392 |
| 350 | Ga0207703_11214405 | 3300026035 | Bacteria | 725 |
| 351 | Ga0207678_10041027 | 3300026067 | Bacteria | 4012 |
| 352 | Ga0207678_10490055 | 3300026067 | Bacteria | 1071 |
| 353 | Ga0207708_10063816 | 3300026075 | Bacteria | 2814 |
| 354 | Ga0207708_10223277 | 3300026075 | Bacteria | 1510 |
| 355 | Ga0207702_11610480 | 3300026078 | Bacteria | 642 |
| 356 | Ga0207641_10142869 | 3300026088 | Bacteria | 2162 |
| 357 | Ga0207676_10159232 | 3300026095 | Bacteria | 1954 |
| 358 | Ga0207674_10032541 | 3300026116 | Bacteria | 5469 |
| 359 | Ga0207674_10379395 | 3300026116 | Bacteria | 1367 |
| 360 | Ga0207674_11243936 | 3300026116 | Bacteria | 714 |
| 361 | Ga0207675_100078604 | 3300026118 | Bacteria | 3091 |
| 362 | Ga0207675_100158617 | 3300026118 | Bacteria | 2157 |
| 363 | Ga0207683_10135451 | 3300026121 | Bacteria | 2217 |
| 364 | Ga0207698_11113946 | 3300026142 | Bacteria | 802 |
| 365 | Ga0209813_10377924 | 3300027866 | Bacteria | 566 |
| 366 | Ga0207428_10002308 | 3300027907 | Bacteria | 19098 |
| 367 | Ga0207428_10010072 | 3300027907 | Bacteria | 8461 |
| 368 | Ga0268266_10146171 | 3300028379 | Bacteria | 2126 |
| 369 | Ga0268265_10000034 | 3300028380 | Bacteria | 218695 |
| 370 | Ga0268265_10131451 | 3300028380 | Bacteria | 2081 |
| 371 | Ga0268264_10248854 | 3300028381 | Bacteria | 1650 |
| 372 | Ga0265338_10006730 | 3300028800 | Bacteria | 14513 |
| 373 | Ga0265338_10008525 | 3300028800 | Bacteria | 12418 |
| 374 | Ga0311001_1011636 | 3300029277 | Bacteria | 750 |
| 375 | Ga0265324_10019023 | 3300029957 | Bacteria | 2476 |
| 376 | Ga0307512_10227811 | 3300030522 | Bacteria | 963 |
| 377 | Ga0316181_1015560 | 3300030744 | Bacteria | 810 |
| 378 | Ga0265328_10182671 | 3300031239 | Bacteria | 793 |
| 379 | Ga0265331_10000024 | 3300031250 | Bacteria | 235118 |
| 380 | Ga0265327_10000079 | 3300031251 | Bacteria | 206892 |
| 381 | Ga0265327_10000809 | 3300031251 | Bacteria | 47572 |
| 382 | Ga0265316_10557545 | 3300031344 | Bacteria | 815 |
| 383 | Ga0307509_10339485 | 3300031507 | Bacteria | 1230 |
| 384 | Ga0307408_100004069 | 3300031548 | Bacteria | 9974 |
| 385 | Ga0307408_100015031 | 3300031548 | Bacteria | 5150 |
| 386 | Ga0307408_100089661 | 3300031548 | Bacteria | 2319 |
| 387 | Ga0307408_101458443 | 3300031548 | Bacteria | 646 |
| 388 | Ga0310117_101992 | 3300031592 | Bacteria | 2009 |
| 389 | Ga0310117_109033 | 3300031592 | Bacteria | 1061 |
| 390 | Ga0310103_103486 | 3300031614 | Bacteria | 1989 |
| 391 | Ga0310108_106062 | 3300031633 | Bacteria | 1365 |
| 392 | Ga0310111_121340 | 3300031667 | Bacteria | 786 |
| 393 | Ga0310119_115941 | 3300031686 | Bacteria | 850 |
| 394 | Ga0316579_10027372 | 3300031691 | Bacteria | 2589 |
| 395 | Ga0316576_10002632 | 3300031727 | Bacteria | 10251 |
| 396 | Ga0316576_10005103 | 3300031727 | Bacteria | 7967 |
| 397 | Ga0316576_10137429 | 3300031727 | Bacteria | 1839 |
| 398 | Ga0316576_10285713 | 3300031727 | Bacteria | 1235 |
| 399 | Ga0316578_10041347 | 3300031728 | Bacteria | 2669 |
| 400 | Ga0316578_10222265 | 3300031728 | Bacteria | 1135 |
| 401 | Ga0316578_10291459 | 3300031728 | Bacteria | 976 |
| 402 | Ga0307405_10001230 | 3300031731 | Bacteria | 10654 |
| 403 | Ga0307405_10039301 | 3300031731 | Bacteria | 2858 |
| 404 | Ga0307405_10404843 | 3300031731 | Bacteria | 1069 |
| 405 | Ga0307405_11039857 | 3300031731 | Bacteria | 701 |
| 406 | Ga0316577_10073785 | 3300031733 | Bacteria | 1905 |
| 407 | Ga0307413_10002256 | 3300031824 | Bacteria | 7785 |
| 408 | Ga0307413_10016216 | 3300031824 | Bacteria | 3841 |
| 409 | Ga0307413_10018584 | 3300031824 | Bacteria | 3652 |
| 410 | Ga0307413_10096108 | 3300031824 | Bacteria | 1944 |
| 411 | Ga0307413_10324346 | 3300031824 | Bacteria | 1178 |
| 412 | Ga0307413_10370763 | 3300031824 | Bacteria | 1112 |
| 413 | Ga0307518_10001053 | 3300031838 | Bacteria | 20666 |
| 414 | Ga0307410_10000140 | 3300031852 | Bacteria | 25566 |
| 415 | Ga0307410_10009228 | 3300031852 | Bacteria | 5520 |
| 416 | Ga0307410_10013939 | 3300031852 | Bacteria | 4709 |
| 417 | Ga0307410_10763663 | 3300031852 | Bacteria | 819 |
| 418 | Ga0307410_11739119 | 3300031852 | Bacteria | 553 |
| 419 | Ga0307406_10000083 | 3300031901 | Bacteria | 52941 |
| 420 | Ga0307406_10013901 | 3300031901 | Bacteria | 4621 |
| 421 | Ga0307406_10017422 | 3300031901 | Bacteria | 4181 |
| 422 | Ga0307406_10026226 | 3300031901 | Bacteria | 3497 |
| 423 | Ga0307406_10549167 | 3300031901 | Bacteria | 945 |
| 424 | Ga0307407_10000354 | 3300031903 | Bacteria | 13805 |
| 425 | Ga0307407_10010126 | 3300031903 | Bacteria | 4431 |
| 426 | Ga0307407_10011756 | 3300031903 | Bacteria | 4182 |
| 427 | Ga0307407_10014812 | 3300031903 | Bacteria | 3830 |
| 428 | Ga0307407_10017034 | 3300031903 | Bacteria | 3634 |
| 429 | Ga0307412_10065993 | 3300031911 | Bacteria | 2451 |
| 430 | Ga0307412_10229969 | 3300031911 | Bacteria | 1427 |
| 431 | Ga0307409_100000915 | 3300031995 | Bacteria | 13685 |
| 432 | Ga0307409_100001294 | 3300031995 | Bacteria | 12130 |
| 433 | Ga0307409_100002255 | 3300031995 | Bacteria | 9972 |
| 434 | Ga0307409_100395561 | 3300031995 | Bacteria | 1318 |
| 435 | Ga0307409_100413056 | 3300031995 | Bacteria | 1292 |
| 436 | Ga0307409_102821537 | 3300031995 | Bacteria | 513 |
| 437 | Ga0307416_100000105 | 3300032002 | Bacteria | 51970 |
| 438 | Ga0307416_100124593 | 3300032002 | Bacteria | 2305 |
| 439 | Ga0307416_100233955 | 3300032002 | Bacteria | 1774 |
| 440 | Ga0307416_100418303 | 3300032002 | Bacteria | 1383 |
| 441 | Ga0307416_101400895 | 3300032002 | Bacteria | 805 |
| 442 | Ga0307416_101588766 | 3300032002 | Bacteria | 759 |
| 443 | Ga0307414_10062118 | 3300032004 | Bacteria | 2649 |
| 444 | Ga0307414_10064685 | 3300032004 | Bacteria | 2605 |
| 445 | Ga0307414_10175029 | 3300032004 | Bacteria | 1720 |
| 446 | Ga0307411_10000440 | 3300032005 | Bacteria | 14243 |
| 447 | Ga0307411_10371610 | 3300032005 | Bacteria | 1173 |
| 448 | Ga0307415_100060966 | 3300032126 | Bacteria | 2609 |
| 449 | Ga0307415_100069969 | 3300032126 | Bacteria | 2462 |
| 450 | Ga0316580_10021174 | 3300032139 | Bacteria | 2003 |
| 451 | Ga0316593_10023162 | 3300032168 | Bacteria | 1958 |
| 452 | Ga0316593_10138446 | 3300032168 | Bacteria | 881 |
| 453 | Ga0316592_1018302 | 3300033524 | Bacteria | 1475 |
| 454 | Ga0316588_1055751 | 3300033528 | Bacteria | 961 |
| 455 | Ga0316596_1024805 | 3300033541 | Bacteria | 1541 |
| 456 | Ga0373959_0080415 | 3300034820 | Bacteria | 750 |
| 457 | Ga0373959_0209763 | 3300034820 | Bacteria | 518 |
| 458 | Ga0373952_0195135 | 3300035092 | Bacteria | 590 |
| 459 | Ga0373939_0223712 | 3300035114 | Bacteria | 722 |
| 460 | Ga0373960_0098492 | 3300035121 | Bacteria | 945 |
| 461 | Ga0373960_0225759 | 3300035121 | Bacteria | 672 |
| 462 | Ga0373946_0582352 | 3300035171 | Bacteria | 579 |
| 463 | Ga0316574_0057919 | 3300035398 | Bacteria | 2426 |
| 464 | Ga0316574_0070325 | 3300035398 | Bacteria | 2210 |
| 465 | Ga0373931_0081714 | 3300035691 | Bacteria | 1785 |
| 466 | Ga0373931_0517022 | 3300035691 | Bacteria | 772 |
| 467 | Ga0373935_0839745 | 3300035692 | Bacteria | 679 |
| 468 | Ga0373933_0057797 | 3300035724 | Bacteria | 2332 |
| 469 | Ga0310112_028666 | 3300036458 | Bacteria | 767 |
| 470 | Ga0372808_007578 | 3300036459 | Bacteria | 1488 |
| 471 | Ga0310109_002515 | 3300036534 | Bacteria | 2068 |
| 472 | Ga0316582_0028367 | 3300036647 | Bacteria | 3391 |
| 473 | Ga0316582_0177530 | 3300036647 | Bacteria | 1448 |
| 474 | Ga0316582_0447062 | 3300036647 | Bacteria | 891 |
| 475 | Ga0316584_0020659 | 3300036712 | Bacteria | 4778 |
| 476 | Ga0316584_0077317 | 3300036712 | Bacteria | 2493 |
| 477 | Ga0316584_0168076 | 3300036712 | Bacteria | 1628 |
| 478 | Ga0316584_0702136 | 3300036712 | Bacteria | 693 |
| 479 | Ga0373925_0000030 | 3300037068 | Bacteria | 146196 |
| 480 | Ga0373925_1686850 | 3300037068 | Bacteria | 517 |
| 481 | Ga0395899_0147893 | 3300037312 | Bacteria | 1667 |
| 482 | Ga0395900_0064278 | 3300037418 | Bacteria | 3772 |
| 483 | Ga0395900_0327705 | 3300037418 | Bacteria | 1510 |
| 484 | Ga0395898_0010483 | 3300037466 | Bacteria | 9687 |
| 485 | Ga0395898_0925617 | 3300037466 | Bacteria | 809 |
| 486 | Ga0395905_0844856 | 3300037471 | Bacteria | 819 |
| 487 | Ga0395901_0092735 | 3300038443 | Bacteria | 3161 |
| 488 | Ga0395901_0504819 | 3300038443 | Bacteria | 1231 |
| 489 | Ga0395901_0554238 | 3300038443 | Bacteria | 1165 |
| 490 | Ga0395901_0864788 | 3300038443 | Bacteria | 888 |
| 491 | Ga0436360_0655317 | 3300039438 | Bacteria | 765 |
| 492 | Ga0436361_0429175 | 3300039447 | Bacteria | 810 |
| 493 | Ga0436361_0461818 | 3300039447 | Bacteria | 521 |
| 494 | Ga0436363_0226958 | 3300039450 | Bacteria | 1557 |
| 495 | Ga0439465_0106889 | 3300041413 | Bacteria | 971 |
| 496 | Ga0451792_00917 | 3300041445 | Bacteria | 611 |
| 497 | Ga0451791_0268782 | 3300041451 | Bacteria | 541 |
| 498 | Ga0451791_0481282 | 3300041451 | Bacteria | 723 |
| 499 | Ga0451793_0067162 | 3300041452 | Bacteria | 4335 |
| 500 | Ga0451797_0289670 | 3300041453 | Bacteria | 1251 |
| 501 | Ga0451841_1179883 | 3300041498 | Bacteria | 916 |
| 502 | Ga0451849_0375908 | 3300041505 | Bacteria | 1143 |
| 503 | Ga0451843_0190972 | 3300041509 | Bacteria | 1640 |
| 504 | Ga0451853_2063332 | 3300041512 | Bacteria | 664 |
| 505 | Ga0451853_2978480 | 3300041512 | Bacteria | 1075 |
| 506 | Ga0439442_071082 | 3300042002 | Bacteria | 741 |
| 507 | Ga0439448_0165847 | 3300042005 | Bacteria | 770 |
| 508 | Ga0439448_0189147 | 3300042005 | Bacteria | 720 |
| 509 | Ga0439448_0292498 | 3300042005 | Bacteria | 578 |
| 510 | Ga0439450_002148 | 3300042008 | Bacteria | 3043 |
| 511 | Ga0439450_215208 | 3300042008 | Bacteria | 516 |
| 512 | Ga0439463_028178 | 3300042016 | Bacteria | 1414 |
| 513 | Ga0439463_039450 | 3300042016 | Bacteria | 1199 |
| 514 | Ga0439463_069799 | 3300042016 | Bacteria | 900 |
| 515 | Ga0439458_0117229 | 3300042157 | Bacteria | 699 |
| 516 | Ga0439435_0004240 | 3300042436 | Bacteria | 3068 |
| 517 | Ga0450901_034233 | 3300042533 | Bacteria | 566 |
| 518 | Ga0439440_0020429 | 3300042993 | Bacteria | 1485 |
| 519 | Ga0439440_0173739 | 3300042993 | Bacteria | 628 |
| 520 | Ga0466969_0230832 | 3300044656 | Bacteria | 841 |
| 521 | Ga0466972_0009895 | 3300044658 | Bacteria | 4785 |
| 522 | Ga0466972_0179414 | 3300044658 | Bacteria | 993 |
| 523 | Ga0466961_0145095 | 3300044693 | Bacteria | 1484 |
| 524 | Ga0466963_0010740 | 3300044694 | Bacteria | 5558 |
| 525 | Ga0466964_0099289 | 3300044706 | Bacteria | 1281 |
| 526 | Ga0466968_0207093 | 3300044735 | Bacteria | 920 |
| 527 | Ga0466968_0292792 | 3300044735 | Bacteria | 781 |
| 528 | Ga0466970_0418659 | 3300044765 | Bacteria | 766 |
| 529 | Ga0466970_0460429 | 3300044765 | Bacteria | 730 |
| 530 | Ga0466970_0558398 | 3300044765 | Bacteria | 662 |
| 531 | Ga0466960_0222009 | 3300044901 | Bacteria | 1040 |
| 532 | Ga0466967_0623253 | 3300045976 | Bacteria | 1065 |
| 533 | Ga0495603_0093149 | 3300046455 | Bacteria | 1761 |
| 534 | Ga0495603_0303455 | 3300046455 | Bacteria | 917 |
| 535 | Ga0495591_108979 | 3300046458 | Bacteria | 681 |
| 536 | Ga0495629_0514530 | 3300046459 | Bacteria | 806 |
| 537 | Ga0495629_1034284 | 3300046459 | Bacteria | 533 |
| 538 | Ga0495641_0168331 | 3300046461 | Bacteria | 980 |
| 539 | Ga0495641_0243895 | 3300046461 | Bacteria | 807 |
| 540 | Ga0495653_0077303 | 3300046463 | Bacteria | 2472 |
| 541 | Ga0495653_0085165 | 3300046463 | Bacteria | 2326 |
| 542 | Ga0495582_0506150 | 3300046473 | Bacteria | 698 |
| 543 | Ga0495639_0453772 | 3300046475 | Bacteria | 651 |
| 544 | Ga0495584_0139992 | 3300046491 | Bacteria | 1229 |
| 545 | Ga0495584_0514673 | 3300046491 | Bacteria | 610 |
| 546 | Ga0495616_0086476 | 3300046513 | Bacteria | 1491 |
| 547 | Ga0495620_0080177 | 3300046515 | Bacteria | 1321 |
| 548 | Ga0495631_0211919 | 3300046518 | Bacteria | 828 |
| 549 | Ga0495643_0367837 | 3300046522 | Bacteria | 640 |
| 550 | Ga0495644_0383101 | 3300046523 | Bacteria | 556 |
| 551 | Ga0495663_0358683 | 3300046525 | Bacteria | 532 |
| 552 | Ga0495586_0073166 | 3300046535 | Bacteria | 1875 |
| 553 | Ga0495587_0440186 | 3300046536 | Bacteria | 722 |
| 554 | Ga0495597_0137940 | 3300046542 | Bacteria | 1008 |
| 555 | Ga0495633_0413595 | 3300046558 | Bacteria | 610 |
| 556 | Ga0495667_0263861 | 3300046559 | Bacteria | 1095 |
| 557 | Ga0495667_0358388 | 3300046559 | Bacteria | 921 |
| 558 | Ga0495656_0440684 | 3300046615 | Bacteria | 685 |
| 559 | Ga0495668_0326107 | 3300046616 | Bacteria | 842 |
| 560 | Ga0495668_0484265 | 3300046616 | Bacteria | 682 |
| 561 | Ga0495635_0409138 | 3300046663 | Bacteria | 900 |
| 562 | Ga0495661_0357940 | 3300046665 | Bacteria | 717 |
| 563 | Ga0495599_0837542 | 3300046678 | Bacteria | 524 |
| 564 | Ga0495647_0335915 | 3300046681 | Bacteria | 686 |
| 565 | Ga0495658_0987534 | 3300046683 | Bacteria | 538 |
| 566 | Ga0495669_0603203 | 3300046684 | Bacteria | 534 |
| 567 | Ga0495613_0273364 | 3300046689 | Bacteria | 1175 |
| 568 | Ga0495670_0157041 | 3300046691 | Bacteria | 1194 |
| 569 | Ga0495670_0270954 | 3300046691 | Bacteria | 907 |
| 570 | Ga0495670_0527014 | 3300046691 | Bacteria | 642 |
| 571 | Ga0495649_0256083 | 3300046694 | Bacteria | 898 |
| 572 | Ga0495589_0082995 | 3300046794 | Bacteria | 1558 |
| 573 | Ga0495589_0526336 | 3300046794 | Bacteria | 539 |
| 574 | Ga0495600_0327751 | 3300046809 | Bacteria | 962 |
| 575 | Ga0495581_0140462 | 3300047315 | Bacteria | 1409 |
| 576 | Ga0495674_0313331 | 3300047319 | Bacteria | 1280 |
| 577 | Ga0495674_1074190 | 3300047319 | Bacteria | 614 |
| 578 | Ga0495676_0345889 | 3300047321 | Bacteria | 995 |
| 579 | Ga0495680_0155040 | 3300047322 | Bacteria | 1667 |
| 580 | Ga0495680_0216510 | 3300047322 | Bacteria | 1369 |
| 581 | Ga0495680_0514356 | 3300047322 | Bacteria | 811 |
| 582 | Ga0495675_0412514 | 3300047444 | Bacteria | 786 |
| 583 | Ga0495677_0294625 | 3300047445 | Bacteria | 638 |
| 584 | Ga0495686_0240812 | 3300047472 | Bacteria | 1020 |
| 585 | Ga0495615_0028206 | 3300048090 | Bacteria | 1324 |
| 586 | Ga0496100_0119030 | 3300048903 | Bacteria | 1845 |
| 587 | Ga0496100_0238461 | 3300048903 | Bacteria | 1341 |
| 588 | Ga0496101_0019994 | 3300048904 | Bacteria | 4579 |
| 589 | Ga0496101_0061151 | 3300048904 | Bacteria | 2734 |
| 590 | Ga0496101_0257440 | 3300048904 | Bacteria | 1360 |
| 591 | Ga0496101_0986381 | 3300048904 | Bacteria | 663 |
| 592 | Ga0496102_0001262 | 3300048905 | Bacteria | 22825 |
| 593 | Ga0496102_0053791 | 3300048905 | Bacteria | 3669 |
| 594 | Ga0496102_0161323 | 3300048905 | Bacteria | 2109 |
| 595 | Ga0496102_1758799 | 3300048905 | Bacteria | 537 |
| 596 | Ga0496102_1874164 | 3300048905 | Bacteria | 516 |
| 597 | Ga0496103_0031078 | 3300048906 | Bacteria | 3252 |
| 598 | Ga0496104_0006711 | 3300048907 | Bacteria | 10131 |
| 599 | Ga0496104_0049816 | 3300048907 | Bacteria | 3950 |
| 600 | Ga0496104_0321250 | 3300048907 | Bacteria | 1461 |
| 601 | Ga0496104_0472516 | 3300048907 | Bacteria | 1165 |
| 602 | Ga0496104_0484103 | 3300048907 | Bacteria | 1149 |
| 603 | Ga0496104_0540184 | 3300048907 | Bacteria | 1076 |
| 604 | Ga0496104_0715566 | 3300048907 | Bacteria | 909 |
| 605 | Ga0496104_1771473 | 3300048907 | Bacteria | 520 |
| 606 | Ga0496105_0001730 | 3300048908 | Bacteria | 15611 |
| 607 | Ga0496105_0050059 | 3300048908 | Bacteria | 3451 |
| 608 | Ga0496105_0079671 | 3300048908 | Bacteria | 2705 |
| 609 | Ga0496105_0083523 | 3300048908 | Bacteria | 2637 |
| 610 | Ga0496105_0294706 | 3300048908 | Bacteria | 1305 |
| 611 | Ga0496105_0819611 | 3300048908 | Bacteria | 706 |
| 612 | Ga0496106_0052764 | 3300048909 | Bacteria | 3069 |
| 613 | Ga0496106_0271673 | 3300048909 | Bacteria | 1357 |
| 614 | Ga0496106_0620689 | 3300048909 | Bacteria | 865 |
| 615 | Ga0496106_1526738 | 3300048909 | Bacteria | 513 |
| 616 | Ga0496107_0304076 | 3300048910 | Bacteria | 1187 |
| 617 | Ga0496107_0960406 | 3300048910 | Bacteria | 621 |
| 618 | Ga0496108_0012599 | 3300048911 | Bacteria | 6888 |
| 619 | Ga0496108_0171867 | 3300048911 | Bacteria | 1875 |
| 620 | Ga0496108_0316607 | 3300048911 | Bacteria | 1360 |
| 621 | Ga0496108_0333229 | 3300048911 | Bacteria | 1323 |
| 622 | Ga0496108_0592332 | 3300048911 | Bacteria | 966 |
| 623 | Ga0496108_0756814 | 3300048911 | Bacteria | 840 |
| 624 | Ga0496109_0049566 | 3300048912 | Bacteria | 3823 |
| 625 | Ga0496109_0110250 | 3300048912 | Bacteria | 2559 |
| 626 | Ga0496109_0157817 | 3300048912 | Bacteria | 2125 |
| 627 | Ga0496109_0408337 | 3300048912 | Bacteria | 1283 |
| 628 | Ga0496109_0440015 | 3300048912 | Bacteria | 1231 |
| 629 | Ga0496109_0458680 | 3300048912 | Bacteria | 1204 |
| 630 | Ga0496109_0469672 | 3300048912 | Bacteria | 1188 |
| 631 | Ga0496109_0708639 | 3300048912 | Bacteria | 944 |
| 632 | Ga0496109_0797667 | 3300048912 | Bacteria | 882 |
| 633 | Ga0496109_1431051 | 3300048912 | Bacteria | 627 |
| 634 | Ga0496110_0118663 | 3300048913 | Bacteria | 2382 |
| 635 | Ga0496110_0135103 | 3300048913 | Bacteria | 2228 |
| 636 | Ga0496110_0352561 | 3300048913 | Bacteria | 1340 |
| 637 | Ga0496110_0483052 | 3300048913 | Bacteria | 1128 |
| 638 | Ga0496111_0096042 | 3300048914 | Bacteria | 2175 |
| 639 | Ga0496111_0173930 | 3300048914 | Bacteria | 1600 |
| 640 | Ga0496111_0248776 | 3300048914 | Bacteria | 1320 |
| 641 | Ga0496111_0566069 | 3300048914 | Bacteria | 833 |
| 642 | Ga0496111_0619529 | 3300048914 | Bacteria | 791 |
| 643 | Ga0496112_0081356 | 3300048915 | Bacteria | 3203 |
| 644 | Ga0496112_0442853 | 3300048915 | Bacteria | 1237 |
| 645 | Ga0496112_0690699 | 3300048915 | Bacteria | 949 |
| 646 | Ga0496113_0233780 | 3300048916 | Bacteria | 1466 |
| 647 | Ga0496113_0703859 | 3300048916 | Bacteria | 806 |
| 648 | Ga0496113_0870679 | 3300048916 | Bacteria | 713 |
| 649 | Ga0496113_1396552 | 3300048916 | Bacteria | 542 |
| 650 | Ga0496114_0001926 | 3300048917 | Bacteria | 15798 |
| 651 | Ga0496114_0038344 | 3300048917 | Bacteria | 3964 |
| 652 | Ga0496114_0138996 | 3300048917 | Bacteria | 2102 |
| 653 | Ga0496114_0166808 | 3300048917 | Bacteria | 1917 |
| 654 | Ga0496114_0256493 | 3300048917 | Bacteria | 1539 |
| 655 | Ga0496114_0393476 | 3300048917 | Bacteria | 1227 |
| 656 | Ga0496114_1273358 | 3300048917 | Bacteria | 622 |
| 657 | Ga0496115_1280397 | 3300048918 | Bacteria | 547 |
| 658 | Ga0496115_1382985 | 3300048918 | Bacteria | 520 |
| 659 | Ga0496116_0002373 | 3300048919 | Bacteria | 19885 |
| 660 | Ga0496117_0237112 | 3300048920 | Bacteria | 1004 |
| 661 | Ga0496118_0520045 | 3300048921 | Bacteria | 587 |
| 662 | Ga0496119_0044088 | 3300048922 | Bacteria | 2812 |
| 663 | Ga0496119_0198133 | 3300048922 | Bacteria | 1041 |
| 664 | Ga0496119_0216693 | 3300048922 | Bacteria | 982 |
| 665 | Ga0496120_0195228 | 3300048923 | Bacteria | 984 |
| 666 | Ga0496120_0402015 | 3300048923 | Bacteria | 605 |
| 667 | Ga0496122_0058387 | 3300048925 | Bacteria | 2856 |
| 668 | Ga0496123_0010979 | 3300048926 | Bacteria | 7922 |
| 669 | Ga0496124_0002213 | 3300048927 | Bacteria | 25889 |
| 670 | Ga0496124_0679787 | 3300048927 | Bacteria | 656 |
| 671 | Ga0496125_0001581 | 3300048928 | Bacteria | 32367 |
| 672 | Ga0496126_0075067 | 3300048929 | Bacteria | 3001 |
| 673 | Ga0496126_0194489 | 3300048929 | Bacteria | 1716 |
| 674 | Ga0496126_0523820 | 3300048929 | Bacteria | 944 |
| 675 | Ga0496126_0588942 | 3300048929 | Bacteria | 878 |
| 676 | Ga0501306_009589 | 3300049127 | Bacteria | 1203 |
| 677 | Ga0501306_015346 | 3300049127 | Bacteria | 1019 |
| 678 | Ga0501306_026797 | 3300049127 | Bacteria | 836 |
| 679 | Ga0501308_022009 | 3300049128 | Bacteria | 804 |
| 680 | Ga0501308_036095 | 3300049128 | Bacteria | 681 |
| 681 | Ga0501309_016165 | 3300049129 | Bacteria | 1015 |
| 682 | Ga0501310_025832 | 3300049130 | Bacteria | 758 |
| 683 | Ga0501310_035609 | 3300049130 | Bacteria | 676 |
| 684 | Ga0501310_055199 | 3300049130 | Bacteria | 582 |
| 685 | Ga0501341_05137 | 3300049131 | Bacteria | 778 |
| 686 | Ga0501305_008961 | 3300049161 | Bacteria | 1306 |
| 687 | Ga0501305_055512 | 3300049161 | Bacteria | 673 |
| 688 | Ga0501305_067339 | 3300049161 | Bacteria | 625 |
| 689 | Ga0501305_083280 | 3300049161 | Bacteria | 577 |
| 690 | Ga0501307_001156 | 3300049162 | Bacteria | 2137 |
| 691 | Ga0501307_043731 | 3300049162 | Bacteria | 657 |
| 692 | Ga0501290_063714 | 3300049513 | Bacteria | 599 |
| 693 | Ga0501295_028005 | 3300049518 | Bacteria | 1091 |
| 694 | Ga0501298_122577 | 3300049521 | Bacteria | 614 |
| 695 | Ga0501312_065297 | 3300049528 | Bacteria | 637 |
| 696 | Ga0501315_008928 | 3300049531 | Bacteria | 1176 |
| 697 | Ga0501315_041240 | 3300049531 | Bacteria | 699 |
| 698 | Ga0501316_000725 | 3300049532 | Bacteria | 2475 |
| 699 | Ga0501316_010434 | 3300049532 | Bacteria | 1058 |
| 700 | Ga0501316_016903 | 3300049532 | Bacteria | 891 |
| 701 | Ga0501316_026652 | 3300049532 | Bacteria | 757 |
| 702 | Ga0501316_030352 | 3300049532 | Bacteria | 721 |
| 703 | Ga0501317_017269 | 3300049533 | Bacteria | 945 |
| 704 | Ga0501317_020615 | 3300049533 | Bacteria | 889 |
| 705 | Ga0501317_035452 | 3300049533 | Bacteria | 742 |
| 706 | Ga0501317_072586 | 3300049533 | Bacteria | 583 |
| 707 | Ga0501318_002229 | 3300049534 | Bacteria | 1652 |
| 708 | Ga0501318_004185 | 3300049534 | Bacteria | 1371 |
| 709 | Ga0501318_011409 | 3300049534 | Bacteria | 1004 |
| 710 | Ga0501318_017173 | 3300049534 | Bacteria | 882 |
| 711 | Ga0501318_046129 | 3300049534 | Bacteria | 636 |
| 712 | Ga0501319_003460 | 3300049535 | Bacteria | 1056 |
| 713 | Ga0501319_005368 | 3300049535 | Bacteria | 918 |
| 714 | Ga0501320_001386 | 3300049536 | Bacteria | 1767 |
| 715 | Ga0501321_015716 | 3300049537 | Bacteria | 894 |
| 716 | Ga0501324_015603 | 3300049540 | Bacteria | 738 |
| 717 | Ga0501325_002533 | 3300049541 | Bacteria | 1258 |
| 718 | Ga0501333_017845 | 3300049549 | Bacteria | 551 |
| 719 | Ga0501031_0011378 | 3300049568 | Bacteria | 5795 |
| 720 | Ga0501031_0207457 | 3300049568 | Bacteria | 1277 |
| 721 | Ga0501032_0148338 | 3300049569 | Bacteria | 1543 |
| 722 | Ga0501032_0249983 | 3300049569 | Bacteria | 1151 |
| 723 | Ga0501032_0671920 | 3300049569 | Bacteria | 657 |
| 724 | Ga0501033_0097181 | 3300049570 | Bacteria | 2152 |
| 725 | Ga0501033_0196799 | 3300049570 | Bacteria | 1441 |
| 726 | Ga0501036_0079114 | 3300049572 | Bacteria | 2781 |
| 727 | Ga0501036_0129089 | 3300049572 | Bacteria | 2134 |
| 728 | Ga0501037_0023372 | 3300049573 | Bacteria | 4572 |
| 729 | Ga0501037_0059277 | 3300049573 | Bacteria | 2793 |
| 730 | Ga0501038_0006886 | 3300049574 | Bacteria | 10499 |
| 731 | Ga0501038_0070271 | 3300049574 | Bacteria | 2973 |
| 732 | Ga0501038_0503190 | 3300049574 | Bacteria | 926 |
| 733 | Ga0501039_0011085 | 3300049575 | Bacteria | 6869 |
| 734 | Ga0501039_0023822 | 3300049575 | Bacteria | 4700 |
| 735 | Ga0501039_0408176 | 3300049575 | Bacteria | 1067 |
| 736 | Ga0501039_1176406 | 3300049575 | Bacteria | 593 |
| 737 | Ga0501040_0002385 | 3300049576 | Bacteria | 12078 |
| 738 | Ga0501041_0017741 | 3300049577 | Bacteria | 4236 |
| 739 | Ga0501041_0085818 | 3300049577 | Bacteria | 1941 |
| 740 | Ga0501041_0439915 | 3300049577 | Bacteria | 827 |
| 741 | Ga0501041_0951147 | 3300049577 | Bacteria | 552 |
| 742 | Ga0501042_0011641 | 3300049578 | Bacteria | 5944 |
| 743 | Ga0501042_0045484 | 3300049578 | Bacteria | 3128 |
| 744 | Ga0501042_0637019 | 3300049578 | Bacteria | 775 |
| 745 | Ga0501042_0673419 | 3300049578 | Bacteria | 752 |
| 746 | Ga0501042_1191029 | 3300049578 | Bacteria | 555 |
| 747 | Ga0501043_0512958 | 3300049579 | Bacteria | 894 |
| 748 | Ga0501046_0038067 | 3300049580 | Bacteria | 3862 |
| 749 | Ga0501046_0047532 | 3300049580 | Bacteria | 3402 |
| 750 | Ga0501046_0112221 | 3300049580 | Bacteria | 2081 |
| 751 | Ga0501048_0043352 | 3300049582 | Bacteria | 3220 |
| 752 | Ga0501048_0089830 | 3300049582 | Bacteria | 2167 |
| 753 | Ga0501067_0062551 | 3300049583 | Bacteria | 2060 |
| 754 | Ga0501067_0197385 | 3300049583 | Bacteria | 1121 |
| 755 | Ga0501068_0193008 | 3300049584 | Bacteria | 1290 |
| 756 | Ga0501068_0509466 | 3300049584 | Bacteria | 781 |
| 757 | Ga0501069_0195392 | 3300049585 | Bacteria | 1171 |
| 758 | Ga0501069_0223491 | 3300049585 | Bacteria | 1095 |
| 759 | Ga0501070_0119834 | 3300049586 | Bacteria | 2175 |
| 760 | Ga0501071_0038797 | 3300049587 | Bacteria | 3404 |
| 761 | Ga0501071_0064107 | 3300049587 | Bacteria | 2665 |
| 762 | Ga0501071_0464948 | 3300049587 | Bacteria | 969 |
| 763 | Ga0501072_0034644 | 3300049588 | Bacteria | 3957 |
| 764 | Ga0501072_0056145 | 3300049588 | Bacteria | 3103 |
| 765 | Ga0501073_0750530 | 3300049589 | Bacteria | 673 |
| 766 | Ga0501074_0135977 | 3300049590 | Bacteria | 1758 |
| 767 | Ga0501074_0283885 | 3300049590 | Bacteria | 1177 |
| 768 | Ga0501075_0007351 | 3300049591 | Bacteria | 7640 |
| 769 | Ga0501075_0082274 | 3300049591 | Bacteria | 2438 |
| 770 | Ga0501075_0425808 | 3300049591 | Bacteria | 1012 |
| 771 | Ga0501075_0935444 | 3300049591 | Bacteria | 659 |
| 772 | Ga0501076_0058641 | 3300049592 | Bacteria | 3060 |
| 773 | Ga0501076_0199285 | 3300049592 | Bacteria | 1634 |
| 774 | Ga0501076_0806502 | 3300049592 | Bacteria | 774 |
| 775 | Ga0501077_0034675 | 3300049593 | Bacteria | 3212 |
| 776 | Ga0501077_0117008 | 3300049593 | Bacteria | 1689 |
| 777 | Ga0501243_097585 | 3300049675 | Bacteria | 590 |
| 778 | Ga0501253_045474 | 3300049683 | Bacteria | 902 |
| 779 | Ga0501256_026448 | 3300049685 | Bacteria | 635 |
| 780 | Ga0501257_181763 | 3300049686 | Bacteria | 596 |
| 781 | Ga0501079_0013169 | 3300049741 | Bacteria | 6304 |
| 782 | Ga0501079_0073812 | 3300049741 | Bacteria | 2637 |
| 783 | Ga0501079_1007559 | 3300049741 | Bacteria | 656 |
| 784 | Ga0501080_0282848 | 3300049742 | Bacteria | 1507 |
| 785 | Ga0501080_0350384 | 3300049742 | Bacteria | 1333 |
| 786 | Ga0501081_0029715 | 3300049743 | Bacteria | 3695 |
| 787 | Ga0501081_0062905 | 3300049743 | Bacteria | 2575 |
| 788 | Ga0501081_1094561 | 3300049743 | Bacteria | 603 |
| 789 | Ga0501035_0051480 | 3300049822 | Bacteria | 3687 |
| 790 | Ga0501035_0213964 | 3300049822 | Bacteria | 1648 |
| 791 | Ga0501044_0424722 | 3300049823 | Bacteria | 1239 |
| 792 | Ga0501045_0000468 | 3300049824 | Bacteria | 25084 |
| 793 | Ga0501045_0096329 | 3300049824 | Bacteria | 2189 |
| 794 | Ga0501045_0344378 | 3300049824 | Bacteria | 1109 |
| 795 | Ga0501045_0570771 | 3300049824 | Bacteria | 838 |
| 796 | Ga0501045_0656008 | 3300049824 | Bacteria | 775 |
| 797 | Ga0501212_001768 | 3300049851 | Bacteria | 2497 |
| 798 | nmdc:mga0k408_198574_c1 | 3300050493 | Bacteria | 1197 |
| 799 | nmdc:mga04h51_414796_c1 | 3300050495 | Bacteria | 565 |
| 800 | nmdc:mga07m45_228409_c1 | 3300050496 | Bacteria | 1083 |
| 801 | nmdc:mga05p37_15070_c1 | 3300050507 | Bacteria | 9282 |
| 802 | nmdc:mga09592_453860_c1 | 3300050508 | Bacteria | 1106 |
| 803 | nmdc:mga09592_905622_c1 | 3300050508 | Bacteria | 741 |
| 804 | nmdc:mga0qj67_79191_c1 | 3300050509 | Bacteria | 2631 |
| 805 | nmdc:mga06r32_18393_c2 | 3300050510 | Bacteria | 3443 |
| 806 | nmdc:mga08y16_1256243_c1 | 3300050511 | Bacteria | 709 |
| 807 | nmdc:mga08y16_4667_c1 | 3300050511 | Bacteria | 14273 |
| 808 | nmdc:mga08y16_9850_c1 | 3300050511 | Bacteria | 10034 |
| 809 | nmdc:mga0n895_43468_c1 | 3300050512 | Bacteria | 4378 |
| 810 | nmdc:mga0n895_53926_c1 | 3300050512 | Bacteria | 3953 |
| 811 | nmdc:mga0rr50_24480_c1 | 3300050513 | Bacteria | 4181 |
| 812 | nmdc:mga0rr50_3052_c1 | 3300050513 | Bacteria | 9585 |
| 813 | nmdc:mga08x19_6548_c1 | 3300050514 | Bacteria | 6899 |
| 814 | nmdc:mga0a205_1359_c1 | 3300050515 | Bacteria | 20623 |
| 815 | nmdc:mga0a205_20778_c1 | 3300050515 | Bacteria | 6202 |
| 816 | Ga0495601_0201140 | 3300053077 | Bacteria | 1302 |
| 817 | Ga0495601_0226132 | 3300053077 | Bacteria | 1222 |
| 818 | Ga0495655_0107662 | 3300053083 | Bacteria | 834 |
| 819 | Ga0495595_0050945 | 3300053084 | Bacteria | 1918 |
| 820 | Ga0495595_0365789 | 3300053084 | Bacteria | 729 |
| 821 | Ga0495595_0537953 | 3300053084 | Bacteria | 596 |
| 822 | Ga0495619_0058114 | 3300053085 | Bacteria | 2567 |
| 823 | Ga0495619_0119445 | 3300053085 | Bacteria | 1807 |
| 824 | Ga0495619_0732120 | 3300053085 | Bacteria | 671 |
| 825 | Ga0500643_000189 | 3300053087 | Bacteria | 58813 |
| 826 | Ga0500642_0456771 | 3300053130 | Bacteria | 547 |
| 827 | Ga0500658_0357276 | 3300053134 | Bacteria | 670 |
| 828 | Ga0500559_0001158 | 3300053136 | Bacteria | 15884 |
| 829 | Ga0500559_0019522 | 3300053136 | Bacteria | 2863 |
| 830 | Ga0500559_0346151 | 3300053136 | Bacteria | 695 |
| 831 | Ga0500568_0000060 | 3300053139 | Bacteria | 107901 |
| 832 | Ga0500573_0000007 | 3300053140 | Bacteria | 272970 |
| 833 | Ga0500573_0008741 | 3300053140 | Bacteria | 5590 |
| 834 | Ga0500573_0149065 | 3300053140 | Bacteria | 1282 |
| 835 | Ga0500577_0229805 | 3300053142 | Bacteria | 804 |
| 836 | Ga0500604_0031742 | 3300053151 | Bacteria | 1553 |
| 837 | Ga0501084_0004201 | 3300054114 | Bacteria | 11745 |
| 838 | Ga0501084_0066146 | 3300054114 | Bacteria | 3024 |
| 839 | Ga0590071_067204 | 3300059421 | Bacteria | 881 |
| 840 | Ga0590074_018119 | 3300059423 | Bacteria | 1204 |
| 841 | Ga0590074_067245 | 3300059423 | Bacteria | 672 |
| 842 | Ga0590077_061581 | 3300059426 | Bacteria | 851 |
| 843 | Ga0587084_071805 | 3300059477 | Bacteria | 655 |
| 844 | Ga0587066_035592 | 3300059490 | Bacteria | 912 |
| 845 | Ga0587066_190003 | 3300059490 | Bacteria | 534 |
| 846 | Ga0587080_040117 | 3300059503 | Bacteria | 850 |
| 847 | Ga0587083_0048155 | 3300059505 | Bacteria | 920 |
| 848 | Ga0587083_0060159 | 3300059505 | Bacteria | 854 |
| 849 | Ga0587083_0074798 | 3300059505 | Bacteria | 794 |
| 850 | Ga0587083_0092910 | 3300059505 | Bacteria | 739 |
| 851 | Ga0587083_0220556 | 3300059505 | Bacteria | 551 |
| 852 | Ga0587085_185473 | 3300059506 | Bacteria | 501 |
| 853 | Ga0587090_036297 | 3300059510 | Bacteria | 848 |
| 854 | Ga0587091_026119 | 3300059511 | Bacteria | 1061 |
| 855 | Ga0587091_136190 | 3300059511 | Bacteria | 611 |
| 856 | Ga0587092_024855 | 3300059512 | Bacteria | 953 |
| 857 | Ga0587092_067437 | 3300059512 | Bacteria | 682 |
| 858 | Ga0587092_163329 | 3300059512 | Bacteria | 505 |
| 859 | Ga0587106_038726 | 3300059605 | Bacteria | 800 |
| 860 | Ga0587106_108487 | 3300059605 | Bacteria | 575 |
| 861 | Ga0587099_013927 | 3300059622 | Bacteria | 843 |
| 862 | Ga0587099_051894 | 3300059622 | Bacteria | 549 |
| 863 | Ga0587113_014730 | 3300059625 | Bacteria | 768 |
| 864 | Ga0587113_038819 | 3300059625 | Bacteria | 564 |
| 865 | Ga0587128_002154 | 3300059630 | Bacteria | 2007 |
| 866 | Ga0587062_034423 | 3300059639 | Bacteria | 792 |
| 867 | Ga0587067_136760 | 3300059640 | Bacteria | 603 |
| 868 | Ga0587068_047030 | 3300059641 | Bacteria | 797 |
| 869 | Ga0587069_034929 | 3300059642 | Bacteria | 832 |
| 870 | Ga0587076_033932 | 3300059645 | Bacteria | 920 |
| 871 | Ga0587079_060860 | 3300059647 | Bacteria | 818 |
| 872 | Ga0587079_138740 | 3300059647 | Bacteria | 618 |
| 873 | Ga0587114_118604 | 3300059655 | Bacteria | 533 |
| 874 | Ga0587124_015948 | 3300059660 | Bacteria | 727 |
| 875 | Ga0587111_0040840 | 3300060346 | Bacteria | 988 |
| 876 | Ga0501082_0099795 | 3300060353 | Bacteria | 2510 |
| 877 | Ga0501082_0343707 | 3300060353 | Bacteria | 1300 |
| 878 | Ga0501082_1924828 | 3300060353 | Bacteria | 516 |
| 879 | Ga0466962_0204286 | 3300061719 | Bacteria | 966 |
| 880 | Ga0530510_0077998 | 3300061734 | Bacteria | 2407 |
| 881 | Ga0530510_0144490 | 3300061734 | Bacteria | 1754 |
| 882 | Ga0530510_0324334 | 3300061734 | Bacteria | 1155 |
| 883 | Ga0530510_0841647 | 3300061734 | Bacteria | 700 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300014745 | Ga0157377_11319933 | Ga0157377_113199331 | 110 |
| 2 | iso_pu_bacteria | 2791355222 | 2793183530 | 113 |
| 3 | 3300048090 | Ga0495615_0028206 | Ga0495615_0028206_109_456 | 115 |
| 4 | 3300004785 | Ga0058858_1321591 | Ga0058858_13215911 | 116 |
| 5 | 3300004798 | Ga0058859_11606581 | Ga0058859_116065811 | 116 |
| 6 | 3300004801 | Ga0058860_10075105 | Ga0058860_100751051 | 116 |
| 7 | 3300005290 | Ga0065712_10480791 | Ga0065712_104807912 | 116 |
| 8 | 3300005331 | Ga0070670_100176307 | Ga0070670_1001763072 | 116 |
| 9 | 3300005347 | Ga0070668_100520658 | Ga0070668_1005206582 | 116 |
| 10 | 3300005354 | Ga0070675_100140226 | Ga0070675_1001402264 | 116 |
| 11 | 3300005355 | Ga0070671_100157807 | Ga0070671_1001578073 | 116 |
| 12 | 3300005356 | Ga0070674_100055900 | Ga0070674_1000559002 | 116 |
| 13 | 3300005364 | Ga0070673_100133823 | Ga0070673_1001338234 | 116 |
| 14 | 3300005365 | Ga0070688_100246409 | Ga0070688_1002464092 | 116 |
| 15 | 3300005438 | Ga0070701_10178204 | Ga0070701_101782042 | 116 |
| 16 | 3300005466 | Ga0070685_10063525 | Ga0070685_100635252 | 116 |
| 17 | 3300005543 | Ga0070672_100029670 | Ga0070672_1000296707 | 116 |
| 18 | 3300005544 | Ga0070686_100368128 | Ga0070686_1003681281 | 116 |
| 19 | 3300005615 | Ga0070702_100269722 | Ga0070702_1002697223 | 116 |
| 20 | 3300005618 | Ga0068864_100348249 | Ga0068864_1003482493 | 116 |
| 21 | 3300005841 | Ga0068863_100249306 | Ga0068863_1002493062 | 116 |
| 22 | 3300006237 | Ga0097621_100161859 | Ga0097621_1001618591 | 116 |
| 23 | 3300006358 | Ga0068871_100103154 | Ga0068871_1001031542 | 116 |
| 24 | 3300006881 | Ga0068865_100126898 | Ga0068865_1001268984 | 116 |
| 25 | 3300009176 | Ga0105242_11030276 | Ga0105242_110302761 | 116 |
| 26 | 3300009177 | Ga0105248_10132883 | Ga0105248_101328832 | 116 |
| 27 | 3300009553 | Ga0105249_10255352 | Ga0105249_102553524 | 116 |
| 28 | 3300013308 | Ga0157375_10126072 | Ga0157375_101260723 | 116 |
| 29 | 3300014325 | Ga0163163_10050064 | Ga0163163_100500645 | 116 |
| 30 | 3300014326 | Ga0157380_10197669 | Ga0157380_101976693 | 116 |
| 31 | 3300014969 | Ga0157376_10506599 | Ga0157376_105065992 | 116 |
| 32 | 3300017792 | Ga0163161_10017982 | Ga0163161_100179827 | 116 |
| 33 | 3300025918 | Ga0207662_10190591 | Ga0207662_101905913 | 116 |
| 34 | 3300025923 | Ga0207681_10365729 | Ga0207681_103657293 | 116 |
| 35 | 3300025925 | Ga0207650_10374309 | Ga0207650_103743092 | 116 |
| 36 | 3300025926 | Ga0207659_10222556 | Ga0207659_102225563 | 116 |
| 37 | 3300025931 | Ga0207644_11276549 | Ga0207644_112765492 | 116 |
| 38 | 3300025937 | Ga0207669_10087605 | Ga0207669_100876052 | 116 |
| 39 | 3300025940 | Ga0207691_10314884 | Ga0207691_103148841 | 116 |
| 40 | 3300025941 | Ga0207711_10152956 | Ga0207711_101529564 | 116 |
| 41 | 3300025960 | Ga0207651_10229927 | Ga0207651_102299274 | 116 |
| 42 | 3300025961 | Ga0207712_10186765 | Ga0207712_101867653 | 116 |
| 43 | 3300025972 | Ga0207668_10647785 | Ga0207668_106477852 | 116 |
| 44 | 3300025986 | Ga0207658_10306074 | Ga0207658_103060743 | 116 |
| 45 | 3300026075 | Ga0207708_10223277 | Ga0207708_102232772 | 116 |
| 46 | 3300026088 | Ga0207641_10142869 | Ga0207641_101428693 | 116 |
| 47 | 3300026095 | Ga0207676_10159232 | Ga0207676_101592323 | 116 |
| 48 | 3300031691 | Ga0316579_10027372 | Ga0316579_100273725 | 116 |
| 49 | 3300031727 | Ga0316576_10002632 | Ga0316576_100026329 | 116 |
| 50 | 3300031727 | Ga0316576_10005103 | Ga0316576_100051032 | 116 |
| 51 | 3300031727 | Ga0316576_10137429 | Ga0316576_101374293 | 116 |
| 52 | 3300031728 | Ga0316578_10041347 | Ga0316578_100413472 | 116 |
| 53 | 3300031728 | Ga0316578_10222265 | Ga0316578_102222652 | 116 |
| 54 | 3300031728 | Ga0316578_10291459 | Ga0316578_102914592 | 116 |
| 55 | 3300031733 | Ga0316577_10073785 | Ga0316577_100737853 | 116 |
| 56 | 3300031901 | Ga0307406_10549167 | Ga0307406_105491672 | 116 |
| 57 | 3300031903 | Ga0307407_10011756 | Ga0307407_100117567 | 116 |
| 58 | 3300031995 | Ga0307409_100413056 | Ga0307409_1004130562 | 116 |
| 59 | 3300032139 | Ga0316580_10021174 | Ga0316580_100211744 | 116 |
| 60 | 3300032168 | Ga0316593_10023162 | Ga0316593_100231623 | 116 |
| 61 | 3300033524 | Ga0316592_1018302 | Ga0316592_10183023 | 116 |
| 62 | 3300033528 | Ga0316588_1055751 | Ga0316588_10557513 | 116 |
| 63 | 3300033541 | Ga0316596_1024805 | Ga0316596_10248051 | 116 |
| 64 | 3300035398 | Ga0316574_0057919 | Ga0316574_0057919_631_987 | 116 |
| 65 | 3300035398 | Ga0316574_0070325 | Ga0316574_0070325_607_963 | 116 |
| 66 | 3300036647 | Ga0316582_0028367 | Ga0316582_0028367_644_1000 | 116 |
| 67 | 3300036647 | Ga0316582_0177530 | Ga0316582_0177530_324_680 | 116 |
| 68 | 3300036647 | Ga0316582_0447062 | Ga0316582_0447062_26_382 | 116 |
| 69 | 3300036712 | Ga0316584_0020659 | Ga0316584_0020659_612_968 | 116 |
| 70 | 3300036712 | Ga0316584_0077317 | Ga0316584_0077317_1003_1359 | 116 |
| 71 | 3300036712 | Ga0316584_0168076 | Ga0316584_0168076_591_947 | 116 |
| 72 | 3300046455 | Ga0495603_0093149 | Ga0495603_0093149_38_391 | 116 |
| 73 | 3300046681 | Ga0495647_0335915 | Ga0495647_0335915_176_529 | 116 |
| 74 | 3300048917 | Ga0496114_0138996 | Ga0496114_0138996_1688_2041 | 116 |
| 75 | 3300049127 | Ga0501306_009589 | Ga0501306_009589_211_612 | 116 |
| 76 | 3300049131 | Ga0501341_05137 | Ga0501341_05137_262_642 | 116 |
| 77 | 3300049161 | Ga0501305_008961 | Ga0501305_008961_86_487 | 116 |
| 78 | 3300050508 | nmdc:mga09592_905622_c1 | nmdc:mga09592_905622_c1_161_514 | 116 |
| 79 | 3300005467 | Ga0070706_101167390 | Ga0070706_1011673902 | 117 |
| 80 | 3300026075 | Ga0207708_10063816 | Ga0207708_100638162 | 117 |
| 81 | 3300039450 | Ga0436363_0226958 | Ga0436363_0226958_1180_1533 | 117 |
| 82 | 3300048919 | Ga0496116_0002373 | Ga0496116_0002373_13755_14114 | 117 |
| 83 | 3300048922 | Ga0496119_0216693 | Ga0496119_0216693_291_650 | 117 |
| 84 | 3300048923 | Ga0496120_0195228 | Ga0496120_0195228_405_764 | 117 |
| 85 | 3300048925 | Ga0496122_0058387 | Ga0496122_0058387_685_1044 | 117 |
| 86 | 3300048926 | Ga0496123_0010979 | Ga0496123_0010979_4495_4854 | 117 |
| 87 | 3300048927 | Ga0496124_0002213 | Ga0496124_0002213_14896_15255 | 117 |
| 88 | 3300048928 | Ga0496125_0001581 | Ga0496125_0001581_1403_1762 | 117 |
| 89 | 3300049532 | Ga0501316_030352 | Ga0501316_030352_21_380 | 117 |
| 90 | 3300059640 | Ga0587067_136760 | Ga0587067_136760_233_592 | 117 |
| 91 | iso_pu_bacteria | 2515154202 | 2516083118 | 117 |
| 92 | iso_pu_bacteria | 2867302475 | 2867307789 | 117 |
| 93 | 3300026078 | Ga0207702_11610480 | Ga0207702_116104802 | 118 |
| 94 | 3300031852 | Ga0307410_11739119 | Ga0307410_117391191 | 118 |
| 95 | 3300048912 | Ga0496109_0408337 | Ga0496109_0408337_235_639 | 118 |
| 96 | 3300048914 | Ga0496111_0619529 | Ga0496111_0619529_227_631 | 118 |
| 97 | 3300061734 | Ga0530510_0841647 | Ga0530510_0841647_170_526 | 118 |
| 98 | iso_pu_bacteria | 2585427649 | 2586060158 | 118 |
| 99 | iso_pu_bacteria | 2808606522 | 2809590855 | 118 |
| 100 | iso_pu_bacteria | 2899359706 | 2899368021 | 118 |
| 101 | iso_pu_bacteria | 2915768154 | 2915771875 | 118 |
| 102 | 3300006195 | Ga0075366_10216500 | Ga0075366_102165001 | 119 |
| 103 | 3300006353 | Ga0075370_10381386 | Ga0075370_103813861 | 119 |
| 104 | 3300006844 | Ga0075428_100000040 | Ga0075428_10000004019 | 119 |
| 105 | 3300009098 | Ga0105245_10149576 | Ga0105245_101495763 | 119 |
| 106 | 3300009148 | Ga0105243_10287583 | Ga0105243_102875832 | 119 |
| 107 | 3300009176 | Ga0105242_10077206 | Ga0105242_100772063 | 119 |
| 108 | 3300009545 | Ga0105237_10711945 | Ga0105237_107119452 | 119 |
| 109 | 3300009551 | Ga0105238_10090480 | Ga0105238_100904801 | 119 |
| 110 | 3300009553 | Ga0105249_10055105 | Ga0105249_100551053 | 119 |
| 111 | 3300010375 | Ga0105239_12627641 | Ga0105239_126276411 | 119 |
| 112 | 3300011119 | Ga0105246_10052545 | Ga0105246_100525453 | 119 |
| 113 | 3300013296 | Ga0157374_10397847 | Ga0157374_103978472 | 119 |
| 114 | 3300013306 | Ga0163162_10070044 | Ga0163162_100700443 | 119 |
| 115 | 3300013306 | Ga0163162_11116454 | Ga0163162_111164542 | 119 |
| 116 | 3300013307 | Ga0157372_10022090 | Ga0157372_100220909 | 119 |
| 117 | 3300013307 | Ga0157372_10391438 | Ga0157372_103914382 | 119 |
| 118 | 3300013307 | Ga0157372_11942601 | Ga0157372_119426012 | 119 |
| 119 | 3300013308 | Ga0157375_10221685 | Ga0157375_102216853 | 119 |
| 120 | 3300013308 | Ga0157375_10683629 | Ga0157375_106836292 | 119 |
| 121 | 3300014325 | Ga0163163_12145644 | Ga0163163_121456442 | 119 |
| 122 | 3300014326 | Ga0157380_10326842 | Ga0157380_103268422 | 119 |
| 123 | 3300014745 | Ga0157377_10166507 | Ga0157377_101665072 | 119 |
| 124 | 3300014968 | Ga0157379_10969577 | Ga0157379_109695771 | 119 |
| 125 | 3300029957 | Ga0265324_10019023 | Ga0265324_100190232 | 119 |
| 126 | 3300031239 | Ga0265328_10182671 | Ga0265328_101826711 | 119 |
| 127 | 3300031250 | Ga0265331_10000024 | Ga0265331_10000024185 | 119 |
| 128 | 3300031251 | Ga0265327_10000079 | Ga0265327_1000007960 | 119 |
| 129 | 3300034820 | Ga0373959_0209763 | Ga0373959_0209763_68_439 | 119 |
| 130 | 3300035121 | Ga0373960_0098492 | Ga0373960_0098492_227_598 | 119 |
| 131 | 3300035691 | Ga0373931_0517022 | Ga0373931_0517022_139_528 | 119 |
| 132 | 3300035724 | Ga0373933_0057797 | Ga0373933_0057797_753_1112 | 119 |
| 133 | 3300041451 | Ga0451791_0481282 | Ga0451791_0481282_218_583 | 119 |
| 134 | 3300041512 | Ga0451853_2063332 | Ga0451853_2063332_128_487 | 119 |
| 135 | 3300042002 | Ga0439442_071082 | Ga0439442_071082_30_410 | 119 |
| 136 | 3300044706 | Ga0466964_0099289 | Ga0466964_0099289_305_676 | 119 |
| 137 | 3300046455 | Ga0495603_0303455 | Ga0495603_0303455_332_721 | 119 |
| 138 | 3300048903 | Ga0496100_0238461 | Ga0496100_0238461_292_663 | 119 |
| 139 | 3300048904 | Ga0496101_0061151 | Ga0496101_0061151_1251_1619 | 119 |
| 140 | 3300048908 | Ga0496105_0819611 | Ga0496105_0819611_61_432 | 119 |
| 141 | 3300048911 | Ga0496108_0592332 | Ga0496108_0592332_113_484 | 119 |
| 142 | 3300048912 | Ga0496109_0797667 | Ga0496109_0797667_313_684 | 119 |
| 143 | 3300048916 | Ga0496113_0703859 | Ga0496113_0703859_368_739 | 119 |
| 144 | 3300049531 | Ga0501315_008928 | Ga0501315_008928_21_401 | 119 |
| 145 | 3300049534 | Ga0501318_046129 | Ga0501318_046129_217_597 | 119 |
| 146 | 3300049585 | Ga0501069_0223491 | Ga0501069_0223491_466_846 | 119 |
| 147 | 3300050496 | nmdc:mga07m45_228409_c1 | nmdc:mga07m45_228409_c1_590_949 | 119 |
| 148 | 3300053085 | Ga0495619_0732120 | Ga0495619_0732120_189_560 | 119 |
| 149 | iso_pu_bacteria | 2643221567 | 2643853149 | 119 |
| 150 | iso_pu_bacteria | 2643221624 | 2644137132 | 119 |
| 151 | iso_pu_bacteria | 2808606365 | 2808874556 | 119 |
| 152 | iso_pu_bacteria | 2811994882 | 2812375216 | 119 |
| 153 | iso_pu_bacteria | 2818991318 | 2819427971 | 119 |
| 154 | iso_pu_bacteria | 2818991458 | 2819668490 | 119 |
| 155 | iso_pu_bacteria | 2818991462 | 2819692318 | 119 |
| 156 | iso_pu_bacteria | 2818991469 | 2819730074 | 119 |
| 157 | iso_pu_bacteria | 2919446982 | 2919450776 | 119 |
| 158 | iso_pu_bacteria | 3001889506 | 3001891671 | 119 |
| 159 | 3300009094 | Ga0111539_10642916 | Ga0111539_106429163 | 120 |
| 160 | 3300012497 | Ga0157319_1027913 | Ga0157319_10279132 | 120 |
| 161 | 3300013105 | Ga0157369_10761392 | Ga0157369_107613923 | 120 |
| 162 | 3300025899 | Ga0207642_10501364 | Ga0207642_105013642 | 120 |
| 163 | 3300025933 | Ga0207706_10784118 | Ga0207706_107841182 | 120 |
| 164 | 3300031251 | Ga0265327_10000809 | Ga0265327_1000080915 | 120 |
| 165 | 3300031344 | Ga0265316_10557545 | Ga0265316_105575451 | 120 |
| 166 | 3300037312 | Ga0395899_0147893 | Ga0395899_0147893_441_809 | 120 |
| 167 | 3300037418 | Ga0395900_0064278 | Ga0395900_0064278_322_690 | 120 |
| 168 | 3300037466 | Ga0395898_0010483 | Ga0395898_0010483_9259_9627 | 120 |
| 169 | 3300037466 | Ga0395898_0925617 | Ga0395898_0925617_245_613 | 120 |
| 170 | 3300038443 | Ga0395901_0092735 | Ga0395901_0092735_2495_2863 | 120 |
| 171 | 3300038443 | Ga0395901_0554238 | Ga0395901_0554238_155_523 | 120 |
| 172 | 3300044658 | Ga0466972_0179414 | Ga0466972_0179414_228_608 | 120 |
| 173 | 3300044765 | Ga0466970_0418659 | Ga0466970_0418659_287_703 | 120 |
| 174 | 3300044765 | Ga0466970_0460429 | Ga0466970_0460429_311_691 | 120 |
| 175 | 3300044901 | Ga0466960_0222009 | Ga0466960_0222009_71_451 | 120 |
| 176 | 3300046459 | Ga0495629_1034284 | Ga0495629_1034284_143_511 | 120 |
| 177 | 3300046461 | Ga0495641_0168331 | Ga0495641_0168331_312_680 | 120 |
| 178 | 3300046461 | Ga0495641_0243895 | Ga0495641_0243895_231_599 | 120 |
| 179 | 3300046535 | Ga0495586_0073166 | Ga0495586_0073166_1085_1468 | 120 |
| 180 | 3300046536 | Ga0495587_0440186 | Ga0495587_0440186_209_583 | 120 |
| 181 | 3300046559 | Ga0495667_0358388 | Ga0495667_0358388_332_715 | 120 |
| 182 | 3300046678 | Ga0495599_0837542 | Ga0495599_0837542_28_411 | 120 |
| 183 | 3300048903 | Ga0496100_0119030 | Ga0496100_0119030_388_762 | 120 |
| 184 | 3300048905 | Ga0496102_0001262 | Ga0496102_0001262_8244_8612 | 120 |
| 185 | 3300048905 | Ga0496102_1758799 | Ga0496102_1758799_56_430 | 120 |
| 186 | 3300048907 | Ga0496104_0321250 | Ga0496104_0321250_701_1075 | 120 |
| 187 | 3300048909 | Ga0496106_0052764 | Ga0496106_0052764_758_1132 | 120 |
| 188 | 3300048909 | Ga0496106_1526738 | Ga0496106_1526738_99_482 | 120 |
| 189 | 3300048910 | Ga0496107_0304076 | Ga0496107_0304076_131_499 | 120 |
| 190 | 3300048910 | Ga0496107_0960406 | Ga0496107_0960406_189_572 | 120 |
| 191 | 3300048912 | Ga0496109_0110250 | Ga0496109_0110250_1930_2304 | 120 |
| 192 | 3300048912 | Ga0496109_1431051 | Ga0496109_1431051_157_525 | 120 |
| 193 | 3300048915 | Ga0496112_0081356 | Ga0496112_0081356_2067_2450 | 120 |
| 194 | 3300048916 | Ga0496113_0870679 | Ga0496113_0870679_210_593 | 120 |
| 195 | 3300048917 | Ga0496114_0001926 | Ga0496114_0001926_11683_12051 | 120 |
| 196 | 3300048917 | Ga0496114_0393476 | Ga0496114_0393476_183_566 | 120 |
| 197 | 3300048918 | Ga0496115_1382985 | Ga0496115_1382985_29_397 | 120 |
| 198 | 3300049161 | Ga0501305_083280 | Ga0501305_083280_185_556 | 120 |
| 199 | 3300049532 | Ga0501316_016903 | Ga0501316_016903_43_411 | 120 |
| 200 | 3300049533 | Ga0501317_017269 | Ga0501317_017269_35_403 | 120 |
| 201 | 3300049533 | Ga0501317_035452 | Ga0501317_035452_29_397 | 120 |
| 202 | 3300049535 | Ga0501319_003460 | Ga0501319_003460_678_1046 | 120 |
| 203 | 3300049540 | Ga0501324_015603 | Ga0501324_015603_349_720 | 120 |
| 204 | 3300049549 | Ga0501333_017845 | Ga0501333_017845_22_414 | 120 |
| 205 | 3300049568 | Ga0501031_0011378 | Ga0501031_0011378_594_962 | 120 |
| 206 | 3300049569 | Ga0501032_0148338 | Ga0501032_0148338_523_891 | 120 |
| 207 | 3300049570 | Ga0501033_0097181 | Ga0501033_0097181_795_1163 | 120 |
| 208 | 3300049572 | Ga0501036_0129089 | Ga0501036_0129089_654_1022 | 120 |
| 209 | 3300049573 | Ga0501037_0023372 | Ga0501037_0023372_1731_2099 | 120 |
| 210 | 3300049574 | Ga0501038_0006886 | Ga0501038_0006886_6269_6637 | 120 |
| 211 | 3300049574 | Ga0501038_0503190 | Ga0501038_0503190_251_619 | 120 |
| 212 | 3300049575 | Ga0501039_0011085 | Ga0501039_0011085_569_937 | 120 |
| 213 | 3300049575 | Ga0501039_0408176 | Ga0501039_0408176_602_970 | 120 |
| 214 | 3300049576 | Ga0501040_0002385 | Ga0501040_0002385_4841_5209 | 120 |
| 215 | 3300049577 | Ga0501041_0017741 | Ga0501041_0017741_1971_2339 | 120 |
| 216 | 3300049577 | Ga0501041_0951147 | Ga0501041_0951147_87_458 | 120 |
| 217 | 3300049578 | Ga0501042_0045484 | Ga0501042_0045484_1027_1395 | 120 |
| 218 | 3300049578 | Ga0501042_0673419 | Ga0501042_0673419_13_399 | 120 |
| 219 | 3300049578 | Ga0501042_1191029 | Ga0501042_1191029_96_464 | 120 |
| 220 | 3300049579 | Ga0501043_0512958 | Ga0501043_0512958_338_706 | 120 |
| 221 | 3300049580 | Ga0501046_0038067 | Ga0501046_0038067_3324_3692 | 120 |
| 222 | 3300049580 | Ga0501046_0112221 | Ga0501046_0112221_152_520 | 120 |
| 223 | 3300049582 | Ga0501048_0043352 | Ga0501048_0043352_2206_2574 | 120 |
| 224 | 3300049583 | Ga0501067_0197385 | Ga0501067_0197385_444_812 | 120 |
| 225 | 3300049584 | Ga0501068_0193008 | Ga0501068_0193008_730_1098 | 120 |
| 226 | 3300049584 | Ga0501068_0509466 | Ga0501068_0509466_363_734 | 120 |
| 227 | 3300049586 | Ga0501070_0119834 | Ga0501070_0119834_1779_2147 | 120 |
| 228 | 3300049587 | Ga0501071_0038797 | Ga0501071_0038797_2225_2593 | 120 |
| 229 | 3300049587 | Ga0501071_0464948 | Ga0501071_0464948_160_546 | 120 |
| 230 | 3300049588 | Ga0501072_0056145 | Ga0501072_0056145_788_1156 | 120 |
| 231 | 3300049589 | Ga0501073_0750530 | Ga0501073_0750530_274_645 | 120 |
| 232 | 3300049590 | Ga0501074_0135977 | Ga0501074_0135977_630_998 | 120 |
| 233 | 3300049591 | Ga0501075_0007351 | Ga0501075_0007351_2670_3038 | 120 |
| 234 | 3300049592 | Ga0501076_0058641 | Ga0501076_0058641_200_568 | 120 |
| 235 | 3300049592 | Ga0501076_0806502 | Ga0501076_0806502_156_527 | 120 |
| 236 | 3300049593 | Ga0501077_0034675 | Ga0501077_0034675_2507_2875 | 120 |
| 237 | 3300049741 | Ga0501079_0013169 | Ga0501079_0013169_2145_2513 | 120 |
| 238 | 3300049741 | Ga0501079_1007559 | Ga0501079_1007559_130_507 | 120 |
| 239 | 3300049742 | Ga0501080_0282848 | Ga0501080_0282848_720_1088 | 120 |
| 240 | 3300049743 | Ga0501081_0062905 | Ga0501081_0062905_1904_2272 | 120 |
| 241 | 3300049822 | Ga0501035_0213964 | Ga0501035_0213964_1106_1474 | 120 |
| 242 | 3300049823 | Ga0501044_0424722 | Ga0501044_0424722_679_1047 | 120 |
| 243 | 3300049824 | Ga0501045_0000468 | Ga0501045_0000468_22501_22869 | 120 |
| 244 | 3300049824 | Ga0501045_0570771 | Ga0501045_0570771_142_510 | 120 |
| 245 | 3300049824 | Ga0501045_0656008 | Ga0501045_0656008_78_446 | 120 |
| 246 | 3300050493 | nmdc:mga0k408_198574_c1 | nmdc:mga0k408_198574_c1_164_526 | 120 |
| 247 | 3300050495 | nmdc:mga04h51_414796_c1 | nmdc:mga04h51_414796_c1_69_437 | 120 |
| 248 | 3300050511 | nmdc:mga08y16_1256243_c1 | nmdc:mga08y16_1256243_c1_193_567 | 120 |
| 249 | 3300054114 | Ga0501084_0004201 | Ga0501084_0004201_3405_3773 | 120 |
| 250 | 3300059505 | Ga0587083_0074798 | Ga0587083_0074798_13_375 | 120 |
| 251 | 3300059506 | Ga0587085_185473 | Ga0587085_185473_124_486 | 120 |
| 252 | 3300059639 | Ga0587062_034423 | Ga0587062_034423_349_738 | 120 |
| 253 | 3300059660 | Ga0587124_015948 | Ga0587124_015948_23_385 | 120 |
| 254 | 3300060353 | Ga0501082_0099795 | Ga0501082_0099795_1399_1767 | 120 |
| 255 | 3300061734 | Ga0530510_0077998 | Ga0530510_0077998_344_712 | 120 |
| 256 | iso_pu_bacteria | 2643221679 | 2644446365 | 120 |
| 257 | 3300012498 | Ga0157345_1046666 | Ga0157345_10466662 | 121 |
| 258 | 3300030522 | Ga0307512_10227811 | Ga0307512_102278112 | 121 |
| 259 | 3300031507 | Ga0307509_10339485 | Ga0307509_103394853 | 121 |
| 260 | 3300031824 | Ga0307413_10096108 | Ga0307413_100961082 | 121 |
| 261 | 3300038443 | Ga0395901_0864788 | Ga0395901_0864788_202_573 | 121 |
| 262 | 3300039447 | Ga0436361_0429175 | Ga0436361_0429175_211_576 | 121 |
| 263 | 3300044656 | Ga0466969_0230832 | Ga0466969_0230832_342_716 | 121 |
| 264 | 3300044658 | Ga0466972_0009895 | Ga0466972_0009895_1706_2080 | 121 |
| 265 | 3300046683 | Ga0495658_0987534 | Ga0495658_0987534_116_490 | 121 |
| 266 | 3300047319 | Ga0495674_0313331 | Ga0495674_0313331_190_555 | 121 |
| 267 | 3300048912 | Ga0496109_0458680 | Ga0496109_0458680_776_1174 | 121 |
| 268 | 3300048918 | Ga0496115_1280397 | Ga0496115_1280397_56_442 | 121 |
| 269 | 3300053130 | Ga0500642_0456771 | Ga0500642_0456771_122_496 | 121 |
| 270 | 3300053134 | Ga0500658_0357276 | Ga0500658_0357276_272_646 | 121 |
| 271 | 3300059477 | Ga0587084_071805 | Ga0587084_071805_232_612 | 121 |
| 272 | 3300059625 | Ga0587113_014730 | Ga0587113_014730_308_682 | 121 |
| 273 | 3300059625 | Ga0587113_038819 | Ga0587113_038819_104_478 | 121 |
| 274 | 3300060353 | Ga0501082_0343707 | Ga0501082_0343707_327_704 | 121 |
| 275 | iso_pu_bacteria | 2515154155 | 2515851924 | 121 |
| 276 | 3300002077 | JGI24744J21845_10078740 | JGI24744J21845_100787401 | 122 |
| 277 | 3300005331 | Ga0070670_100488816 | Ga0070670_1004888162 | 122 |
| 278 | 3300005333 | Ga0070677_10048185 | Ga0070677_100481853 | 122 |
| 279 | 3300005335 | Ga0070666_10896382 | Ga0070666_108963822 | 122 |
| 280 | 3300005337 | Ga0070682_100108363 | Ga0070682_1001083632 | 122 |
| 281 | 3300005340 | Ga0070689_100245523 | Ga0070689_1002455232 | 122 |
| 282 | 3300005343 | Ga0070687_100637907 | Ga0070687_1006379071 | 122 |
| 283 | 3300005347 | Ga0070668_100276250 | Ga0070668_1002762502 | 122 |
| 284 | 3300005353 | Ga0070669_100261576 | Ga0070669_1002615762 | 122 |
| 285 | 3300005354 | Ga0070675_101052595 | Ga0070675_1010525951 | 122 |
| 286 | 3300005356 | Ga0070674_100082938 | Ga0070674_1000829382 | 122 |
| 287 | 3300005366 | Ga0070659_100603077 | Ga0070659_1006030772 | 122 |
| 288 | 3300005440 | Ga0070705_100130886 | Ga0070705_1001308862 | 122 |
| 289 | 3300005456 | Ga0070678_100070555 | Ga0070678_1000705552 | 122 |
| 290 | 3300005456 | Ga0070678_100445304 | Ga0070678_1004453043 | 122 |
| 291 | 3300005535 | Ga0070684_101512930 | Ga0070684_1015129302 | 122 |
| 292 | 3300005543 | Ga0070672_100782766 | Ga0070672_1007827661 | 122 |
| 293 | 3300005547 | Ga0070693_100071853 | Ga0070693_1000718531 | 122 |
| 294 | 3300005548 | Ga0070665_100862216 | Ga0070665_1008622162 | 122 |
| 295 | 3300005578 | Ga0068854_101245438 | Ga0068854_1012454381 | 122 |
| 296 | 3300005614 | Ga0068856_100429789 | Ga0068856_1004297892 | 122 |
| 297 | 3300005615 | Ga0070702_100000907 | Ga0070702_1000009072 | 122 |
| 298 | 3300005615 | Ga0070702_100268791 | Ga0070702_1002687912 | 122 |
| 299 | 3300005616 | Ga0068852_100350854 | Ga0068852_1003508543 | 122 |
| 300 | 3300005616 | Ga0068852_100452985 | Ga0068852_1004529852 | 122 |
| 301 | 3300005719 | Ga0068861_100166143 | Ga0068861_1001661433 | 122 |
| 302 | 3300005840 | Ga0068870_10773424 | Ga0068870_107734242 | 122 |
| 303 | 3300005843 | Ga0068860_101818840 | Ga0068860_1018188402 | 122 |
| 304 | 3300006237 | Ga0097621_101129317 | Ga0097621_1011293172 | 122 |
| 305 | 3300009036 | Ga0105244_10043572 | Ga0105244_100435724 | 122 |
| 306 | 3300009551 | Ga0105238_12042347 | Ga0105238_120423471 | 122 |
| 307 | 3300013104 | Ga0157370_11322111 | Ga0157370_113221112 | 122 |
| 308 | 3300013307 | Ga0157372_10299596 | Ga0157372_102995962 | 122 |
| 309 | 3300014325 | Ga0163163_11073078 | Ga0163163_110730782 | 122 |
| 310 | 3300017792 | Ga0163161_11589849 | Ga0163161_115898492 | 122 |
| 311 | 3300020075 | Ga0206349_1119767 | Ga0206349_11197671 | 122 |
| 312 | 3300025893 | Ga0207682_10234516 | Ga0207682_102345162 | 122 |
| 313 | 3300025901 | Ga0207688_10196028 | Ga0207688_101960282 | 122 |
| 314 | 3300025903 | Ga0207680_10160003 | Ga0207680_101600032 | 122 |
| 315 | 3300025908 | Ga0207643_10855511 | Ga0207643_108555112 | 122 |
| 316 | 3300025924 | Ga0207694_10063730 | Ga0207694_100637301 | 122 |
| 317 | 3300025925 | Ga0207650_11029933 | Ga0207650_110299332 | 122 |
| 318 | 3300025926 | Ga0207659_10158333 | Ga0207659_101583331 | 122 |
| 319 | 3300025934 | Ga0207686_10131812 | Ga0207686_101318122 | 122 |
| 320 | 3300025935 | Ga0207709_10010363 | Ga0207709_100103636 | 122 |
| 321 | 3300025935 | Ga0207709_10021535 | Ga0207709_100215353 | 122 |
| 322 | 3300025937 | Ga0207669_10101646 | Ga0207669_101016463 | 122 |
| 323 | 3300025938 | Ga0207704_10228747 | Ga0207704_102287471 | 122 |
| 324 | 3300025940 | Ga0207691_10844915 | Ga0207691_108449152 | 122 |
| 325 | 3300025942 | Ga0207689_10159920 | Ga0207689_101599201 | 122 |
| 326 | 3300025944 | Ga0207661_10760121 | Ga0207661_107601212 | 122 |
| 327 | 3300025945 | Ga0207679_11058376 | Ga0207679_110583762 | 122 |
| 328 | 3300025961 | Ga0207712_10157879 | Ga0207712_101578792 | 122 |
| 329 | 3300025972 | Ga0207668_10086951 | Ga0207668_100869511 | 122 |
| 330 | 3300025972 | Ga0207668_10240624 | Ga0207668_102406242 | 122 |
| 331 | 3300026118 | Ga0207675_100158617 | Ga0207675_1001586173 | 122 |
| 332 | 3300026121 | Ga0207683_10135451 | Ga0207683_101354512 | 122 |
| 333 | 3300028381 | Ga0268264_10248854 | Ga0268264_102488541 | 122 |
| 334 | 3300031548 | Ga0307408_101458443 | Ga0307408_1014584431 | 122 |
| 335 | 3300031838 | Ga0307518_10001053 | Ga0307518_1000105317 | 122 |
| 336 | 3300035171 | Ga0373946_0582352 | Ga0373946_0582352_72_452 | 122 |
| 337 | 3300038443 | Ga0395901_0504819 | Ga0395901_0504819_819_1196 | 122 |
| 338 | 3300046463 | Ga0495653_0077303 | Ga0495653_0077303_461_835 | 122 |
| 339 | 3300046463 | Ga0495653_0085165 | Ga0495653_0085165_24_404 | 122 |
| 340 | 3300046663 | Ga0495635_0409138 | Ga0495635_0409138_416_796 | 122 |
| 341 | 3300046689 | Ga0495613_0273364 | Ga0495613_0273364_493_873 | 122 |
| 342 | 3300047321 | Ga0495676_0345889 | Ga0495676_0345889_584_964 | 122 |
| 343 | 3300047322 | Ga0495680_0155040 | Ga0495680_0155040_373_753 | 122 |
| 344 | 3300048904 | Ga0496101_0986381 | Ga0496101_0986381_140_532 | 122 |
| 345 | 3300048907 | Ga0496104_0540184 | Ga0496104_0540184_324_704 | 122 |
| 346 | 3300048908 | Ga0496105_0294706 | Ga0496105_0294706_110_490 | 122 |
| 347 | 3300048909 | Ga0496106_0620689 | Ga0496106_0620689_362_754 | 122 |
| 348 | 3300049127 | Ga0501306_026797 | Ga0501306_026797_412_795 | 122 |
| 349 | 3300049161 | Ga0501305_067339 | Ga0501305_067339_207_593 | 122 |
| 350 | 3300049531 | Ga0501315_041240 | Ga0501315_041240_255_638 | 122 |
| 351 | 3300049568 | Ga0501031_0207457 | Ga0501031_0207457_595_975 | 122 |
| 352 | 3300049569 | Ga0501032_0249983 | Ga0501032_0249983_746_1126 | 122 |
| 353 | 3300049570 | Ga0501033_0196799 | Ga0501033_0196799_985_1365 | 122 |
| 354 | 3300049572 | Ga0501036_0079114 | Ga0501036_0079114_2164_2544 | 122 |
| 355 | 3300049573 | Ga0501037_0059277 | Ga0501037_0059277_2008_2388 | 122 |
| 356 | 3300049574 | Ga0501038_0070271 | Ga0501038_0070271_257_637 | 122 |
| 357 | 3300049575 | Ga0501039_0023822 | Ga0501039_0023822_3474_3854 | 122 |
| 358 | 3300049577 | Ga0501041_0085818 | Ga0501041_0085818_415_795 | 122 |
| 359 | 3300049578 | Ga0501042_0011641 | Ga0501042_0011641_4570_4950 | 122 |
| 360 | 3300049580 | Ga0501046_0047532 | Ga0501046_0047532_1941_2321 | 122 |
| 361 | 3300049582 | Ga0501048_0089830 | Ga0501048_0089830_786_1166 | 122 |
| 362 | 3300049587 | Ga0501071_0064107 | Ga0501071_0064107_1163_1543 | 122 |
| 363 | 3300049588 | Ga0501072_0034644 | Ga0501072_0034644_3255_3635 | 122 |
| 364 | 3300049590 | Ga0501074_0283885 | Ga0501074_0283885_769_1149 | 122 |
| 365 | 3300049591 | Ga0501075_0082274 | Ga0501075_0082274_634_1014 | 122 |
| 366 | 3300049592 | Ga0501076_0199285 | Ga0501076_0199285_526_906 | 122 |
| 367 | 3300049593 | Ga0501077_0117008 | Ga0501077_0117008_483_863 | 122 |
| 368 | 3300049741 | Ga0501079_0073812 | Ga0501079_0073812_1785_2165 | 122 |
| 369 | 3300049742 | Ga0501080_0350384 | Ga0501080_0350384_638_1018 | 122 |
| 370 | 3300049743 | Ga0501081_0029715 | Ga0501081_0029715_1904_2284 | 122 |
| 371 | 3300049822 | Ga0501035_0051480 | Ga0501035_0051480_2860_3240 | 122 |
| 372 | 3300049824 | Ga0501045_0096329 | Ga0501045_0096329_569_949 | 122 |
| 373 | 3300053084 | Ga0495595_0050945 | Ga0495595_0050945_1171_1551 | 122 |
| 374 | 3300053084 | Ga0495595_0365789 | Ga0495595_0365789_111_491 | 122 |
| 375 | 3300053085 | Ga0495619_0058114 | Ga0495619_0058114_2156_2536 | 122 |
| 376 | 3300054114 | Ga0501084_0066146 | Ga0501084_0066146_1317_1697 | 122 |
| 377 | 3300059505 | Ga0587083_0092910 | Ga0587083_0092910_220_597 | 122 |
| 378 | 3300059512 | Ga0587092_024855 | Ga0587092_024855_100_480 | 122 |
| 379 | 3300059622 | Ga0587099_051894 | Ga0587099_051894_15_392 | 122 |
| 380 | 3300061734 | Ga0530510_0144490 | Ga0530510_0144490_412_792 | 122 |
| 381 | iso_pu_bacteria | 2643221576 | 2643888780 | 122 |
| 382 | iso_pu_bacteria | 2643221590 | 2643957835 | 122 |
| 383 | iso_pu_bacteria | 2643221711 | 2644611646 | 122 |
| 384 | iso_pu_bacteria | 2675902999 | 2676201695 | 122 |
| 385 | iso_pu_bacteria | 2687453737 | 2689956237 | 122 |
| 386 | iso_pu_bacteria | 2773857921 | 2774846271 | 122 |
| 387 | iso_pu_bacteria | 2773857933 | 2774904274 | 122 |
| 388 | iso_pu_bacteria | 2870622029 | 2870622722 | 122 |
| 389 | iso_pu_bacteria | 2887443736 | 2887447578 | 122 |
| 390 | iso_pu_bacteria | 2891968417 | 2891971194 | 122 |
| 391 | iso_pu_bacteria | 2928121344 | 2928124623 | 122 |
| 392 | iso_pu_bacteria | 2939657138 | 2939658898 | 122 |
| 393 | 3300001989 | JGI24739J22299_10107071 | JGI24739J22299_101070712 | 123 |
| 394 | 3300001990 | JGI24737J22298_10100500 | JGI24737J22298_101005001 | 123 |
| 395 | 3300004800 | Ga0058861_10039264 | Ga0058861_100392642 | 123 |
| 396 | 3300004800 | Ga0058861_12049027 | Ga0058861_120490271 | 123 |
| 397 | 3300005334 | Ga0068869_100292375 | Ga0068869_1002923753 | 123 |
| 398 | 3300005434 | Ga0070709_10005108 | Ga0070709_100051083 | 123 |
| 399 | 3300005439 | Ga0070711_100317625 | Ga0070711_1003176253 | 123 |
| 400 | 3300005467 | Ga0070706_102016214 | Ga0070706_1020162141 | 123 |
| 401 | 3300005468 | Ga0070707_100051210 | Ga0070707_1000512104 | 123 |
| 402 | 3300005471 | Ga0070698_100005507 | Ga0070698_10000550711 | 123 |
| 403 | 3300005518 | Ga0070699_100400017 | Ga0070699_1004000172 | 123 |
| 404 | 3300005577 | Ga0068857_101381444 | Ga0068857_1013814442 | 123 |
| 405 | 3300006028 | Ga0070717_10309524 | Ga0070717_103095242 | 123 |
| 406 | 3300006048 | Ga0075363_100355524 | Ga0075363_1003555242 | 123 |
| 407 | 3300006173 | Ga0070716_100228081 | Ga0070716_1002280813 | 123 |
| 408 | 3300006175 | Ga0070712_100328567 | Ga0070712_1003285673 | 123 |
| 409 | 3300006353 | Ga0075370_10188764 | Ga0075370_101887643 | 123 |
| 410 | 3300009551 | Ga0105238_10286796 | Ga0105238_102867963 | 123 |
| 411 | 3300009553 | Ga0105249_10795882 | Ga0105249_107958822 | 123 |
| 412 | 3300009553 | Ga0105249_13426761 | Ga0105249_134267611 | 123 |
| 413 | 3300012497 | Ga0157319_1027569 | Ga0157319_10275692 | 123 |
| 414 | 3300013105 | Ga0157369_10468414 | Ga0157369_104684143 | 123 |
| 415 | 3300013306 | Ga0163162_10260383 | Ga0163162_102603833 | 123 |
| 416 | 3300013308 | Ga0157375_11638960 | Ga0157375_116389603 | 123 |
| 417 | 3300014326 | Ga0157380_10999637 | Ga0157380_109996372 | 123 |
| 418 | 3300020070 | Ga0206356_11663862 | Ga0206356_116638622 | 123 |
| 419 | 3300020075 | Ga0206349_1227335 | Ga0206349_12273351 | 123 |
| 420 | 3300020076 | Ga0206355_1290850 | Ga0206355_12908501 | 123 |
| 421 | 3300020076 | Ga0206355_1678641 | Ga0206355_16786411 | 123 |
| 422 | 3300020078 | Ga0206352_11355473 | Ga0206352_113554733 | 123 |
| 423 | 3300020080 | Ga0206350_10685797 | Ga0206350_106857971 | 123 |
| 424 | 3300020081 | Ga0206354_10406115 | Ga0206354_104061153 | 123 |
| 425 | 3300020082 | Ga0206353_10268640 | Ga0206353_102686401 | 123 |
| 426 | 3300020082 | Ga0206353_10856742 | Ga0206353_108567423 | 123 |
| 427 | 3300025905 | Ga0207685_10012727 | Ga0207685_100127271 | 123 |
| 428 | 3300025906 | Ga0207699_10093442 | Ga0207699_100934423 | 123 |
| 429 | 3300025909 | Ga0207705_11093888 | Ga0207705_110938881 | 123 |
| 430 | 3300025922 | Ga0207646_10068183 | Ga0207646_100681831 | 123 |
| 431 | 3300025925 | Ga0207650_10200313 | Ga0207650_102003131 | 123 |
| 432 | 3300025928 | Ga0207700_10377374 | Ga0207700_103773743 | 123 |
| 433 | 3300025929 | Ga0207664_10337414 | Ga0207664_103374142 | 123 |
| 434 | 3300025929 | Ga0207664_10460888 | Ga0207664_104608882 | 123 |
| 435 | 3300025933 | Ga0207706_10475953 | Ga0207706_104759532 | 123 |
| 436 | 3300025944 | Ga0207661_10052660 | Ga0207661_100526603 | 123 |
| 437 | 3300026067 | Ga0207678_10490055 | Ga0207678_104900551 | 123 |
| 438 | 3300026116 | Ga0207674_11243936 | Ga0207674_112439362 | 123 |
| 439 | 3300027866 | Ga0209813_10377924 | Ga0209813_103779241 | 123 |
| 440 | 3300031731 | Ga0307405_10404843 | Ga0307405_104048432 | 123 |
| 441 | 3300031824 | Ga0307413_10324346 | Ga0307413_103243462 | 123 |
| 442 | 3300031824 | Ga0307413_10370763 | Ga0307413_103707631 | 123 |
| 443 | 3300031852 | Ga0307410_10009228 | Ga0307410_100092285 | 123 |
| 444 | 3300031903 | Ga0307407_10017034 | Ga0307407_100170344 | 123 |
| 445 | 3300031995 | Ga0307409_100002255 | Ga0307409_1000022555 | 123 |
| 446 | 3300031995 | Ga0307409_102821537 | Ga0307409_1028215371 | 123 |
| 447 | 3300032002 | Ga0307416_100233955 | Ga0307416_1002339552 | 123 |
| 448 | 3300032002 | Ga0307416_101400895 | Ga0307416_1014008952 | 123 |
| 449 | 3300036712 | Ga0316584_0702136 | Ga0316584_0702136_93_464 | 123 |
| 450 | 3300037471 | Ga0395905_0844856 | Ga0395905_0844856_14_391 | 123 |
| 451 | 3300039438 | Ga0436360_0655317 | Ga0436360_0655317_350_721 | 123 |
| 452 | 3300041452 | Ga0451793_0067162 | Ga0451793_0067162_2369_2740 | 123 |
| 453 | 3300041453 | Ga0451797_0289670 | Ga0451797_0289670_402_779 | 123 |
| 454 | 3300041498 | Ga0451841_1179883 | Ga0451841_1179883_78_455 | 123 |
| 455 | 3300041505 | Ga0451849_0375908 | Ga0451849_0375908_283_660 | 123 |
| 456 | 3300041509 | Ga0451843_0190972 | Ga0451843_0190972_1194_1565 | 123 |
| 457 | 3300041512 | Ga0451853_2978480 | Ga0451853_2978480_437_808 | 123 |
| 458 | 3300046459 | Ga0495629_0514530 | Ga0495629_0514530_210_602 | 123 |
| 459 | 3300046473 | Ga0495582_0506150 | Ga0495582_0506150_261_653 | 123 |
| 460 | 3300046475 | Ga0495639_0453772 | Ga0495639_0453772_101_493 | 123 |
| 461 | 3300047322 | Ga0495680_0216510 | Ga0495680_0216510_868_1245 | 123 |
| 462 | 3300048904 | Ga0496101_0019994 | Ga0496101_0019994_1987_2379 | 123 |
| 463 | 3300048907 | Ga0496104_0006711 | Ga0496104_0006711_3315_3707 | 123 |
| 464 | 3300048907 | Ga0496104_0049816 | Ga0496104_0049816_451_843 | 123 |
| 465 | 3300048907 | Ga0496104_0472516 | Ga0496104_0472516_605_997 | 123 |
| 466 | 3300048908 | Ga0496105_0050059 | Ga0496105_0050059_345_737 | 123 |
| 467 | 3300048908 | Ga0496105_0083523 | Ga0496105_0083523_2186_2578 | 123 |
| 468 | 3300048909 | Ga0496106_0271673 | Ga0496106_0271673_32_424 | 123 |
| 469 | 3300048911 | Ga0496108_0316607 | Ga0496108_0316607_528_920 | 123 |
| 470 | 3300048911 | Ga0496108_0756814 | Ga0496108_0756814_278_670 | 123 |
| 471 | 3300048912 | Ga0496109_0049566 | Ga0496109_0049566_1937_2329 | 123 |
| 472 | 3300048912 | Ga0496109_0708639 | Ga0496109_0708639_335_727 | 123 |
| 473 | 3300048913 | Ga0496110_0118663 | Ga0496110_0118663_1208_1600 | 123 |
| 474 | 3300048913 | Ga0496110_0483052 | Ga0496110_0483052_371_763 | 123 |
| 475 | 3300048914 | Ga0496111_0173930 | Ga0496111_0173930_168_560 | 123 |
| 476 | 3300048917 | Ga0496114_0038344 | Ga0496114_0038344_3110_3502 | 123 |
| 477 | 3300048917 | Ga0496114_0256493 | Ga0496114_0256493_465_836 | 123 |
| 478 | 3300049127 | Ga0501306_015346 | Ga0501306_015346_334_711 | 123 |
| 479 | 3300049130 | Ga0501310_025832 | Ga0501310_025832_20_400 | 123 |
| 480 | 3300049130 | Ga0501310_055199 | Ga0501310_055199_128_520 | 123 |
| 481 | 3300049528 | Ga0501312_065297 | Ga0501312_065297_216_608 | 123 |
| 482 | 3300049532 | Ga0501316_010434 | Ga0501316_010434_25_417 | 123 |
| 483 | 3300049533 | Ga0501317_020615 | Ga0501317_020615_147_539 | 123 |
| 484 | 3300049535 | Ga0501319_005368 | Ga0501319_005368_58_450 | 123 |
| 485 | 3300049536 | Ga0501320_001386 | Ga0501320_001386_1309_1701 | 123 |
| 486 | 3300053084 | Ga0495595_0537953 | Ga0495595_0537953_85_462 | 123 |
| 487 | 3300059490 | Ga0587066_190003 | Ga0587066_190003_14_391 | 123 |
| 488 | 3300059503 | Ga0587080_040117 | Ga0587080_040117_52_432 | 123 |
| 489 | 3300059505 | Ga0587083_0060159 | Ga0587083_0060159_456_836 | 123 |
| 490 | 3300059510 | Ga0587090_036297 | Ga0587090_036297_450_830 | 123 |
| 491 | 3300059511 | Ga0587091_026119 | Ga0587091_026119_458_844 | 123 |
| 492 | 3300059512 | Ga0587092_163329 | Ga0587092_163329_111_488 | 123 |
| 493 | 3300059605 | Ga0587106_038726 | Ga0587106_038726_366_746 | 123 |
| 494 | 3300059605 | Ga0587106_108487 | Ga0587106_108487_11_397 | 123 |
| 495 | 3300059630 | Ga0587128_002154 | Ga0587128_002154_1272_1649 | 123 |
| 496 | 3300059641 | Ga0587068_047030 | Ga0587068_047030_404_784 | 123 |
| 497 | 3300059642 | Ga0587069_034929 | Ga0587069_034929_419_799 | 123 |
| 498 | 3300060346 | Ga0587111_0040840 | Ga0587111_0040840_399_785 | 123 |
| 499 | 3300060353 | Ga0501082_1924828 | Ga0501082_1924828_17_406 | 123 |
| 500 | 3300061719 | Ga0466962_0204286 | Ga0466962_0204286_298_675 | 123 |
| 501 | 3300005841 | Ga0068863_100000454 | Ga0068863_10000045436 | 124 |
| 502 | 3300009101 | Ga0105247_10154969 | Ga0105247_101549693 | 124 |
| 503 | 3300014968 | Ga0157379_11024236 | Ga0157379_110242362 | 124 |
| 504 | 3300026035 | Ga0207703_10018834 | Ga0207703_100188345 | 124 |
| 505 | 3300048920 | Ga0496117_0237112 | Ga0496117_0237112_428_811 | 124 |
| 506 | 3300048921 | Ga0496118_0520045 | Ga0496118_0520045_66_449 | 124 |
| 507 | 3300048927 | Ga0496124_0679787 | Ga0496124_0679787_173_556 | 124 |
| 508 | 3300003373 | JGI25407J50210_10038405 | JGI25407J50210_100384052 | 125 |
| 509 | 3300005327 | Ga0070658_10016077 | Ga0070658_100160775 | 125 |
| 510 | 3300005329 | Ga0070683_100138044 | Ga0070683_1001380443 | 125 |
| 511 | 3300005329 | Ga0070683_100162734 | Ga0070683_1001627343 | 125 |
| 512 | 3300005329 | Ga0070683_101755533 | Ga0070683_1017555331 | 125 |
| 513 | 3300005334 | Ga0068869_100456541 | Ga0068869_1004565412 | 125 |
| 514 | 3300005336 | Ga0070680_100076550 | Ga0070680_1000765504 | 125 |
| 515 | 3300005337 | Ga0070682_100064333 | Ga0070682_1000643333 | 125 |
| 516 | 3300005339 | Ga0070660_100039249 | Ga0070660_1000392493 | 125 |
| 517 | 3300005339 | Ga0070660_100397556 | Ga0070660_1003975563 | 125 |
| 518 | 3300005341 | Ga0070691_10218203 | Ga0070691_102182031 | 125 |
| 519 | 3300005344 | Ga0070661_100053746 | Ga0070661_1000537463 | 125 |
| 520 | 3300005366 | Ga0070659_100035645 | Ga0070659_1000356452 | 125 |
| 521 | 3300005366 | Ga0070659_100264206 | Ga0070659_1002642061 | 125 |
| 522 | 3300005434 | Ga0070709_10076141 | Ga0070709_100761412 | 125 |
| 523 | 3300005435 | Ga0070714_100707000 | Ga0070714_1007070002 | 125 |
| 524 | 3300005436 | Ga0070713_100096655 | Ga0070713_1000966551 | 125 |
| 525 | 3300005436 | Ga0070713_100417463 | Ga0070713_1004174632 | 125 |
| 526 | 3300005436 | Ga0070713_100884813 | Ga0070713_1008848132 | 125 |
| 527 | 3300005455 | Ga0070663_100258932 | Ga0070663_1002589323 | 125 |
| 528 | 3300005458 | Ga0070681_10754852 | Ga0070681_107548521 | 125 |
| 529 | 3300005535 | Ga0070684_100079301 | Ga0070684_1000793013 | 125 |
| 530 | 3300005548 | Ga0070665_100245542 | Ga0070665_1002455422 | 125 |
| 531 | 3300005563 | Ga0068855_101015168 | Ga0068855_1010151682 | 125 |
| 532 | 3300005577 | Ga0068857_100496736 | Ga0068857_1004967363 | 125 |
| 533 | 3300005578 | Ga0068854_101003959 | Ga0068854_1010039592 | 125 |
| 534 | 3300005616 | Ga0068852_100196995 | Ga0068852_1001969954 | 125 |
| 535 | 3300005719 | Ga0068861_100042273 | Ga0068861_1000422733 | 125 |
| 536 | 3300005844 | Ga0068862_100152764 | Ga0068862_1001527642 | 125 |
| 537 | 3300005937 | Ga0081455_10014667 | Ga0081455_100146674 | 125 |
| 538 | 3300005937 | Ga0081455_10056135 | Ga0081455_100561353 | 125 |
| 539 | 3300005937 | Ga0081455_10230695 | Ga0081455_102306952 | 125 |
| 540 | 3300005937 | Ga0081455_10288833 | Ga0081455_102888332 | 125 |
| 541 | 3300005981 | Ga0081538_10002518 | Ga0081538_1000251812 | 125 |
| 542 | 3300006058 | Ga0075432_10001180 | Ga0075432_100011809 | 125 |
| 543 | 3300006058 | Ga0075432_10001981 | Ga0075432_1000198110 | 125 |
| 544 | 3300006194 | Ga0075427_10006958 | Ga0075427_100069583 | 125 |
| 545 | 3300006844 | Ga0075428_100100897 | Ga0075428_1001008974 | 125 |
| 546 | 3300006844 | Ga0075428_100355768 | Ga0075428_1003557683 | 125 |
| 547 | 3300006844 | Ga0075428_100576073 | Ga0075428_1005760733 | 125 |
| 548 | 3300006844 | Ga0075428_101221817 | Ga0075428_1012218171 | 125 |
| 549 | 3300006846 | Ga0075430_100138383 | Ga0075430_1001383832 | 125 |
| 550 | 3300006846 | Ga0075430_100157070 | Ga0075430_1001570703 | 125 |
| 551 | 3300006847 | Ga0075431_100105764 | Ga0075431_1001057644 | 125 |
| 552 | 3300006852 | Ga0075433_10004850 | Ga0075433_100048505 | 125 |
| 553 | 3300006852 | Ga0075433_10029068 | Ga0075433_100290683 | 125 |
| 554 | 3300006871 | Ga0075434_100003049 | Ga0075434_1000030493 | 125 |
| 555 | 3300006880 | Ga0075429_100072200 | Ga0075429_1000722001 | 125 |
| 556 | 3300006880 | Ga0075429_100159841 | Ga0075429_1001598413 | 125 |
| 557 | 3300006881 | Ga0068865_100128479 | Ga0068865_1001284793 | 125 |
| 558 | 3300006914 | Ga0075436_100008198 | Ga0075436_1000081984 | 125 |
| 559 | 3300007076 | Ga0075435_100005162 | Ga0075435_1000051627 | 125 |
| 560 | 3300007076 | Ga0075435_100018949 | Ga0075435_1000189497 | 125 |
| 561 | 3300009093 | Ga0105240_10245419 | Ga0105240_102454192 | 125 |
| 562 | 3300009093 | Ga0105240_10900637 | Ga0105240_109006371 | 125 |
| 563 | 3300009094 | Ga0111539_10000158 | Ga0111539_1000015816 | 125 |
| 564 | 3300009094 | Ga0111539_10006978 | Ga0111539_1000697817 | 125 |
| 565 | 3300009098 | Ga0105245_10075454 | Ga0105245_100754543 | 125 |
| 566 | 3300009098 | Ga0105245_10184993 | Ga0105245_101849933 | 125 |
| 567 | 3300009147 | Ga0114129_10003880 | Ga0114129_100038808 | 125 |
| 568 | 3300009147 | Ga0114129_10501662 | Ga0114129_105016621 | 125 |
| 569 | 3300009148 | Ga0105243_10346250 | Ga0105243_103462503 | 125 |
| 570 | 3300009174 | Ga0105241_11365860 | Ga0105241_113658602 | 125 |
| 571 | 3300009176 | Ga0105242_10226239 | Ga0105242_102262393 | 125 |
| 572 | 3300009545 | Ga0105237_10342779 | Ga0105237_103427792 | 125 |
| 573 | 3300009551 | Ga0105238_10064212 | Ga0105238_100642122 | 125 |
| 574 | 3300009551 | Ga0105238_10355131 | Ga0105238_103551311 | 125 |
| 575 | 3300009551 | Ga0105238_10787131 | Ga0105238_107871313 | 125 |
| 576 | 3300009553 | Ga0105249_10121062 | Ga0105249_101210623 | 125 |
| 577 | 3300010375 | Ga0105239_10122430 | Ga0105239_101224304 | 125 |
| 578 | 3300012485 | Ga0157325_1002978 | Ga0157325_10029782 | 125 |
| 579 | 3300012498 | Ga0157345_1009711 | Ga0157345_10097111 | 125 |
| 580 | 3300012507 | Ga0157342_1002723 | Ga0157342_10027232 | 125 |
| 581 | 3300012513 | Ga0157326_1024626 | Ga0157326_10246262 | 125 |
| 582 | 3300013045 | Ga0154016_120491 | Ga0154016_1204911 | 125 |
| 583 | 3300013104 | Ga0157370_10086887 | Ga0157370_100868874 | 125 |
| 584 | 3300013306 | Ga0163162_10107812 | Ga0163162_101078123 | 125 |
| 585 | 3300013307 | Ga0157372_10014531 | Ga0157372_100145313 | 125 |
| 586 | 3300013307 | Ga0157372_11395815 | Ga0157372_113958151 | 125 |
| 587 | 3300014325 | Ga0163163_10211338 | Ga0163163_102113381 | 125 |
| 588 | 3300014325 | Ga0163163_11130466 | Ga0163163_111304662 | 125 |
| 589 | 3300014969 | Ga0157376_11910279 | Ga0157376_119102791 | 125 |
| 590 | 3300020069 | Ga0197907_11084971 | Ga0197907_110849712 | 125 |
| 591 | 3300020069 | Ga0197907_11163051 | Ga0197907_111630512 | 125 |
| 592 | 3300020070 | Ga0206356_10235624 | Ga0206356_102356241 | 125 |
| 593 | 3300020076 | Ga0206355_1018285 | Ga0206355_10182852 | 125 |
| 594 | 3300020076 | Ga0206355_1157355 | Ga0206355_11573553 | 125 |
| 595 | 3300020076 | Ga0206355_1436410 | Ga0206355_14364103 | 125 |
| 596 | 3300020077 | Ga0206351_10242066 | Ga0206351_102420662 | 125 |
| 597 | 3300020077 | Ga0206351_10349906 | Ga0206351_103499062 | 125 |
| 598 | 3300020077 | Ga0206351_10925769 | Ga0206351_109257692 | 125 |
| 599 | 3300020078 | Ga0206352_10728115 | Ga0206352_107281152 | 125 |
| 600 | 3300020081 | Ga0206354_10201171 | Ga0206354_102011712 | 125 |
| 601 | 3300020081 | Ga0206354_10479002 | Ga0206354_104790023 | 125 |
| 602 | 3300020081 | Ga0206354_10770711 | Ga0206354_107707112 | 125 |
| 603 | 3300020081 | Ga0206354_11652329 | Ga0206354_116523292 | 125 |
| 604 | 3300020082 | Ga0206353_10223354 | Ga0206353_102233544 | 125 |
| 605 | 3300020082 | Ga0206353_10743311 | Ga0206353_107433111 | 125 |
| 606 | 3300020082 | Ga0206353_10835504 | Ga0206353_108355044 | 125 |
| 607 | 3300020610 | Ga0154015_1121433 | Ga0154015_11214333 | 125 |
| 608 | 3300020610 | Ga0154015_1313599 | Ga0154015_13135991 | 125 |
| 609 | 3300020610 | Ga0154015_1611020 | Ga0154015_16110201 | 125 |
| 610 | 3300020610 | Ga0154015_1670310 | Ga0154015_16703102 | 125 |
| 611 | 3300025901 | Ga0207688_10228263 | Ga0207688_102282632 | 125 |
| 612 | 3300025901 | Ga0207688_10257878 | Ga0207688_102578782 | 125 |
| 613 | 3300025904 | Ga0207647_10206425 | Ga0207647_102064252 | 125 |
| 614 | 3300025906 | Ga0207699_10301989 | Ga0207699_103019891 | 125 |
| 615 | 3300025912 | Ga0207707_10002485 | Ga0207707_100024859 | 125 |
| 616 | 3300025917 | Ga0207660_10035116 | Ga0207660_100351163 | 125 |
| 617 | 3300025919 | Ga0207657_10015478 | Ga0207657_100154783 | 125 |
| 618 | 3300025919 | Ga0207657_10782258 | Ga0207657_107822582 | 125 |
| 619 | 3300025921 | Ga0207652_10125908 | Ga0207652_101259083 | 125 |
| 620 | 3300025921 | Ga0207652_10196152 | Ga0207652_101961522 | 125 |
| 621 | 3300025921 | Ga0207652_11350694 | Ga0207652_113506942 | 125 |
| 622 | 3300025924 | Ga0207694_10664129 | Ga0207694_106641292 | 125 |
| 623 | 3300025924 | Ga0207694_10911313 | Ga0207694_109113132 | 125 |
| 624 | 3300025927 | Ga0207687_10159895 | Ga0207687_101598953 | 125 |
| 625 | 3300025927 | Ga0207687_10402656 | Ga0207687_104026562 | 125 |
| 626 | 3300025928 | Ga0207700_10159457 | Ga0207700_101594573 | 125 |
| 627 | 3300025928 | Ga0207700_10176622 | Ga0207700_101766222 | 125 |
| 628 | 3300025929 | Ga0207664_10114979 | Ga0207664_101149793 | 125 |
| 629 | 3300025932 | Ga0207690_10540821 | Ga0207690_105408211 | 125 |
| 630 | 3300025932 | Ga0207690_11464286 | Ga0207690_114642861 | 125 |
| 631 | 3300025934 | Ga0207686_11719904 | Ga0207686_117199041 | 125 |
| 632 | 3300025935 | Ga0207709_10395892 | Ga0207709_103958922 | 125 |
| 633 | 3300025935 | Ga0207709_10531216 | Ga0207709_105312162 | 125 |
| 634 | 3300025942 | Ga0207689_10146104 | Ga0207689_101461043 | 125 |
| 635 | 3300025944 | Ga0207661_10432291 | Ga0207661_104322912 | 125 |
| 636 | 3300025949 | Ga0207667_10816517 | Ga0207667_108165172 | 125 |
| 637 | 3300025961 | Ga0207712_10806069 | Ga0207712_108060692 | 125 |
| 638 | 3300025981 | Ga0207640_10552062 | Ga0207640_105520622 | 125 |
| 639 | 3300025981 | Ga0207640_11497903 | Ga0207640_114979031 | 125 |
| 640 | 3300026067 | Ga0207678_10041027 | Ga0207678_100410273 | 125 |
| 641 | 3300026116 | Ga0207674_10379395 | Ga0207674_103793951 | 125 |
| 642 | 3300026118 | Ga0207675_100078604 | Ga0207675_1000786043 | 125 |
| 643 | 3300026142 | Ga0207698_11113946 | Ga0207698_111139462 | 125 |
| 644 | 3300027907 | Ga0207428_10002308 | Ga0207428_1000230823 | 125 |
| 645 | 3300027907 | Ga0207428_10010072 | Ga0207428_100100727 | 125 |
| 646 | 3300028379 | Ga0268266_10146171 | Ga0268266_101461713 | 125 |
| 647 | 3300028380 | Ga0268265_10131451 | Ga0268265_101314513 | 125 |
| 648 | 3300028800 | Ga0265338_10006730 | Ga0265338_1000673011 | 125 |
| 649 | 3300028800 | Ga0265338_10008525 | Ga0265338_100085253 | 125 |
| 650 | 3300029277 | Ga0311001_1011636 | Ga0311001_10116361 | 125 |
| 651 | 3300031548 | Ga0307408_100004069 | Ga0307408_1000040694 | 125 |
| 652 | 3300031548 | Ga0307408_100015031 | Ga0307408_1000150314 | 125 |
| 653 | 3300031548 | Ga0307408_100089661 | Ga0307408_1000896612 | 125 |
| 654 | 3300031592 | Ga0310117_101992 | Ga0310117_1019923 | 125 |
| 655 | 3300031592 | Ga0310117_109033 | Ga0310117_1090331 | 125 |
| 656 | 3300031614 | Ga0310103_103486 | Ga0310103_1034861 | 125 |
| 657 | 3300031633 | Ga0310108_106062 | Ga0310108_1060621 | 125 |
| 658 | 3300031667 | Ga0310111_121340 | Ga0310111_1213401 | 125 |
| 659 | 3300031686 | Ga0310119_115941 | Ga0310119_1159411 | 125 |
| 660 | 3300031731 | Ga0307405_10001230 | Ga0307405_100012308 | 125 |
| 661 | 3300031731 | Ga0307405_10039301 | Ga0307405_100393012 | 125 |
| 662 | 3300031824 | Ga0307413_10002256 | Ga0307413_100022565 | 125 |
| 663 | 3300031824 | Ga0307413_10016216 | Ga0307413_100162163 | 125 |
| 664 | 3300031824 | Ga0307413_10018584 | Ga0307413_100185845 | 125 |
| 665 | 3300031852 | Ga0307410_10000140 | Ga0307410_1000014014 | 125 |
| 666 | 3300031852 | Ga0307410_10013939 | Ga0307410_100139398 | 125 |
| 667 | 3300031852 | Ga0307410_10763663 | Ga0307410_107636632 | 125 |
| 668 | 3300031901 | Ga0307406_10000083 | Ga0307406_1000008317 | 125 |
| 669 | 3300031901 | Ga0307406_10013901 | Ga0307406_100139014 | 125 |
| 670 | 3300031901 | Ga0307406_10017422 | Ga0307406_100174222 | 125 |
| 671 | 3300031901 | Ga0307406_10026226 | Ga0307406_100262262 | 125 |
| 672 | 3300031903 | Ga0307407_10000354 | Ga0307407_100003547 | 125 |
| 673 | 3300031903 | Ga0307407_10010126 | Ga0307407_100101264 | 125 |
| 674 | 3300031903 | Ga0307407_10014812 | Ga0307407_100148123 | 125 |
| 675 | 3300031911 | Ga0307412_10065993 | Ga0307412_100659932 | 125 |
| 676 | 3300031911 | Ga0307412_10229969 | Ga0307412_102299693 | 125 |
| 677 | 3300031995 | Ga0307409_100000915 | Ga0307409_1000009157 | 125 |
| 678 | 3300031995 | Ga0307409_100001294 | Ga0307409_10000129411 | 125 |
| 679 | 3300031995 | Ga0307409_100395561 | Ga0307409_1003955612 | 125 |
| 680 | 3300032002 | Ga0307416_100000105 | Ga0307416_10000010543 | 125 |
| 681 | 3300032002 | Ga0307416_100124593 | Ga0307416_1001245933 | 125 |
| 682 | 3300032002 | Ga0307416_100418303 | Ga0307416_1004183031 | 125 |
| 683 | 3300032004 | Ga0307414_10062118 | Ga0307414_100621184 | 125 |
| 684 | 3300032004 | Ga0307414_10064685 | Ga0307414_100646852 | 125 |
| 685 | 3300032004 | Ga0307414_10175029 | Ga0307414_101750292 | 125 |
| 686 | 3300032005 | Ga0307411_10000440 | Ga0307411_1000044012 | 125 |
| 687 | 3300032005 | Ga0307411_10371610 | Ga0307411_103716103 | 125 |
| 688 | 3300032126 | Ga0307415_100060966 | Ga0307415_1000609665 | 125 |
| 689 | 3300032126 | Ga0307415_100069969 | Ga0307415_1000699693 | 125 |
| 690 | 3300034820 | Ga0373959_0080415 | Ga0373959_0080415_354_731 | 125 |
| 691 | 3300035092 | Ga0373952_0195135 | Ga0373952_0195135_83_460 | 125 |
| 692 | 3300035114 | Ga0373939_0223712 | Ga0373939_0223712_245_622 | 125 |
| 693 | 3300035121 | Ga0373960_0225759 | Ga0373960_0225759_40_417 | 125 |
| 694 | 3300035691 | Ga0373931_0081714 | Ga0373931_0081714_1126_1503 | 125 |
| 695 | 3300035692 | Ga0373935_0839745 | Ga0373935_0839745_98_475 | 125 |
| 696 | 3300036458 | Ga0310112_028666 | Ga0310112_028666_68_445 | 125 |
| 697 | 3300036459 | Ga0372808_007578 | Ga0372808_007578_1039_1416 | 125 |
| 698 | 3300036534 | Ga0310109_002515 | Ga0310109_002515_221_598 | 125 |
| 699 | 3300037068 | Ga0373925_0000030 | Ga0373925_0000030_121744_122121 | 125 |
| 700 | 3300037068 | Ga0373925_1686850 | Ga0373925_1686850_116_493 | 125 |
| 701 | 3300037418 | Ga0395900_0327705 | Ga0395900_0327705_251_628 | 125 |
| 702 | 3300039447 | Ga0436361_0461818 | Ga0436361_0461818_68_445 | 125 |
| 703 | 3300041413 | Ga0439465_0106889 | Ga0439465_0106889_200_580 | 125 |
| 704 | 3300042005 | Ga0439448_0165847 | Ga0439448_0165847_313_690 | 125 |
| 705 | 3300042005 | Ga0439448_0189147 | Ga0439448_0189147_159_536 | 125 |
| 706 | 3300042005 | Ga0439448_0292498 | Ga0439448_0292498_182_559 | 125 |
| 707 | 3300042008 | Ga0439450_002148 | Ga0439450_002148_2399_2776 | 125 |
| 708 | 3300042008 | Ga0439450_215208 | Ga0439450_215208_115_492 | 125 |
| 709 | 3300042016 | Ga0439463_028178 | Ga0439463_028178_271_648 | 125 |
| 710 | 3300042016 | Ga0439463_039450 | Ga0439463_039450_563_940 | 125 |
| 711 | 3300042016 | Ga0439463_069799 | Ga0439463_069799_306_683 | 125 |
| 712 | 3300042436 | Ga0439435_0004240 | Ga0439435_0004240_53_430 | 125 |
| 713 | 3300042533 | Ga0450901_034233 | Ga0450901_034233_86_463 | 125 |
| 714 | 3300042993 | Ga0439440_0020429 | Ga0439440_0020429_1047_1424 | 125 |
| 715 | 3300042993 | Ga0439440_0173739 | Ga0439440_0173739_25_402 | 125 |
| 716 | 3300044693 | Ga0466961_0145095 | Ga0466961_0145095_267_656 | 125 |
| 717 | 3300044694 | Ga0466963_0010740 | Ga0466963_0010740_1465_1842 | 125 |
| 718 | 3300044735 | Ga0466968_0207093 | Ga0466968_0207093_290_667 | 125 |
| 719 | 3300044765 | Ga0466970_0558398 | Ga0466970_0558398_204_581 | 125 |
| 720 | 3300045976 | Ga0466967_0623253 | Ga0466967_0623253_431_808 | 125 |
| 721 | 3300046458 | Ga0495591_108979 | Ga0495591_108979_100_477 | 125 |
| 722 | 3300046491 | Ga0495584_0139992 | Ga0495584_0139992_219_596 | 125 |
| 723 | 3300046491 | Ga0495584_0514673 | Ga0495584_0514673_59_436 | 125 |
| 724 | 3300046513 | Ga0495616_0086476 | Ga0495616_0086476_748_1125 | 125 |
| 725 | 3300046515 | Ga0495620_0080177 | Ga0495620_0080177_364_741 | 125 |
| 726 | 3300046518 | Ga0495631_0211919 | Ga0495631_0211919_365_742 | 125 |
| 727 | 3300046522 | Ga0495643_0367837 | Ga0495643_0367837_112_489 | 125 |
| 728 | 3300046523 | Ga0495644_0383101 | Ga0495644_0383101_28_405 | 125 |
| 729 | 3300046525 | Ga0495663_0358683 | Ga0495663_0358683_93_470 | 125 |
| 730 | 3300046542 | Ga0495597_0137940 | Ga0495597_0137940_310_687 | 125 |
| 731 | 3300046558 | Ga0495633_0413595 | Ga0495633_0413595_27_404 | 125 |
| 732 | 3300046559 | Ga0495667_0263861 | Ga0495667_0263861_206_598 | 125 |
| 733 | 3300046615 | Ga0495656_0440684 | Ga0495656_0440684_278_655 | 125 |
| 734 | 3300046616 | Ga0495668_0326107 | Ga0495668_0326107_373_750 | 125 |
| 735 | 3300046616 | Ga0495668_0484265 | Ga0495668_0484265_33_410 | 125 |
| 736 | 3300046665 | Ga0495661_0357940 | Ga0495661_0357940_209_586 | 125 |
| 737 | 3300046684 | Ga0495669_0603203 | Ga0495669_0603203_114_491 | 125 |
| 738 | 3300046691 | Ga0495670_0157041 | Ga0495670_0157041_91_468 | 125 |
| 739 | 3300046691 | Ga0495670_0270954 | Ga0495670_0270954_149_526 | 125 |
| 740 | 3300046691 | Ga0495670_0527014 | Ga0495670_0527014_216_593 | 125 |
| 741 | 3300046694 | Ga0495649_0256083 | Ga0495649_0256083_478_855 | 125 |
| 742 | 3300046794 | Ga0495589_0082995 | Ga0495589_0082995_897_1274 | 125 |
| 743 | 3300046794 | Ga0495589_0526336 | Ga0495589_0526336_72_449 | 125 |
| 744 | 3300047319 | Ga0495674_1074190 | Ga0495674_1074190_116_493 | 125 |
| 745 | 3300047322 | Ga0495680_0514356 | Ga0495680_0514356_10_393 | 125 |
| 746 | 3300047444 | Ga0495675_0412514 | Ga0495675_0412514_211_603 | 125 |
| 747 | 3300047445 | Ga0495677_0294625 | Ga0495677_0294625_240_617 | 125 |
| 748 | 3300047472 | Ga0495686_0240812 | Ga0495686_0240812_393_776 | 125 |
| 749 | 3300048905 | Ga0496102_1874164 | Ga0496102_1874164_100_477 | 125 |
| 750 | 3300048907 | Ga0496104_0484103 | Ga0496104_0484103_724_1107 | 125 |
| 751 | 3300048907 | Ga0496104_1771473 | Ga0496104_1771473_115_492 | 125 |
| 752 | 3300048908 | Ga0496105_0079671 | Ga0496105_0079671_1375_1758 | 125 |
| 753 | 3300048911 | Ga0496108_0012599 | Ga0496108_0012599_5150_5527 | 125 |
| 754 | 3300048911 | Ga0496108_0171867 | Ga0496108_0171867_1002_1385 | 125 |
| 755 | 3300048911 | Ga0496108_0333229 | Ga0496108_0333229_91_468 | 125 |
| 756 | 3300048912 | Ga0496109_0157817 | Ga0496109_0157817_780_1163 | 125 |
| 757 | 3300048912 | Ga0496109_0440015 | Ga0496109_0440015_497_874 | 125 |
| 758 | 3300048912 | Ga0496109_0469672 | Ga0496109_0469672_500_877 | 125 |
| 759 | 3300048913 | Ga0496110_0135103 | Ga0496110_0135103_429_812 | 125 |
| 760 | 3300048913 | Ga0496110_0352561 | Ga0496110_0352561_776_1153 | 125 |
| 761 | 3300048914 | Ga0496111_0248776 | Ga0496111_0248776_742_1119 | 125 |
| 762 | 3300048914 | Ga0496111_0566069 | Ga0496111_0566069_39_422 | 125 |
| 763 | 3300048915 | Ga0496112_0442853 | Ga0496112_0442853_415_792 | 125 |
| 764 | 3300048915 | Ga0496112_0690699 | Ga0496112_0690699_219_596 | 125 |
| 765 | 3300048916 | Ga0496113_1396552 | Ga0496113_1396552_67_444 | 125 |
| 766 | 3300048917 | Ga0496114_0166808 | Ga0496114_0166808_1141_1524 | 125 |
| 767 | 3300048922 | Ga0496119_0044088 | Ga0496119_0044088_2344_2721 | 125 |
| 768 | 3300048922 | Ga0496119_0198133 | Ga0496119_0198133_354_731 | 125 |
| 769 | 3300048923 | Ga0496120_0402015 | Ga0496120_0402015_132_509 | 125 |
| 770 | 3300048929 | Ga0496126_0075067 | Ga0496126_0075067_107_484 | 125 |
| 771 | 3300048929 | Ga0496126_0588942 | Ga0496126_0588942_377_754 | 125 |
| 772 | 3300049128 | Ga0501308_022009 | Ga0501308_022009_393_782 | 125 |
| 773 | 3300049128 | Ga0501308_036095 | Ga0501308_036095_263_658 | 125 |
| 774 | 3300049129 | Ga0501309_016165 | Ga0501309_016165_603_992 | 125 |
| 775 | 3300049130 | Ga0501310_035609 | Ga0501310_035609_89_478 | 125 |
| 776 | 3300049162 | Ga0501307_001156 | Ga0501307_001156_455_832 | 125 |
| 777 | 3300049162 | Ga0501307_043731 | Ga0501307_043731_236_631 | 125 |
| 778 | 3300049513 | Ga0501290_063714 | Ga0501290_063714_70_447 | 125 |
| 779 | 3300049518 | Ga0501295_028005 | Ga0501295_028005_664_1041 | 125 |
| 780 | 3300049521 | Ga0501298_122577 | Ga0501298_122577_23_400 | 125 |
| 781 | 3300049532 | Ga0501316_000725 | Ga0501316_000725_1394_1783 | 125 |
| 782 | 3300049532 | Ga0501316_026652 | Ga0501316_026652_144_533 | 125 |
| 783 | 3300049533 | Ga0501317_072586 | Ga0501317_072586_50_439 | 125 |
| 784 | 3300049534 | Ga0501318_002229 | Ga0501318_002229_223_600 | 125 |
| 785 | 3300049534 | Ga0501318_011409 | Ga0501318_011409_471_860 | 125 |
| 786 | 3300049534 | Ga0501318_017173 | Ga0501318_017173_251_628 | 125 |
| 787 | 3300049537 | Ga0501321_015716 | Ga0501321_015716_470_859 | 125 |
| 788 | 3300049541 | Ga0501325_002533 | Ga0501325_002533_443_820 | 125 |
| 789 | 3300049591 | Ga0501075_0935444 | Ga0501075_0935444_56_433 | 125 |
| 790 | 3300049675 | Ga0501243_097585 | Ga0501243_097585_20_397 | 125 |
| 791 | 3300049683 | Ga0501253_045474 | Ga0501253_045474_19_396 | 125 |
| 792 | 3300049685 | Ga0501256_026448 | Ga0501256_026448_24_401 | 125 |
| 793 | 3300049686 | Ga0501257_181763 | Ga0501257_181763_137_514 | 125 |
| 794 | 3300049851 | Ga0501212_001768 | Ga0501212_001768_804_1181 | 125 |
| 795 | 3300050507 | nmdc:mga05p37_15070_c1 | nmdc:mga05p37_15070_c1_6550_6927 | 125 |
| 796 | 3300050508 | nmdc:mga09592_453860_c1 | nmdc:mga09592_453860_c1_172_549 | 125 |
| 797 | 3300050509 | nmdc:mga0qj67_79191_c1 | nmdc:mga0qj67_79191_c1_395_772 | 125 |
| 798 | 3300050510 | nmdc:mga06r32_18393_c2 | nmdc:mga06r32_18393_c2_2190_2567 | 125 |
| 799 | 3300050511 | nmdc:mga08y16_4667_c1 | nmdc:mga08y16_4667_c1_2858_3235 | 125 |
| 800 | 3300050511 | nmdc:mga08y16_9850_c1 | nmdc:mga08y16_9850_c1_9621_9998 | 125 |
| 801 | 3300050512 | nmdc:mga0n895_43468_c1 | nmdc:mga0n895_43468_c1_756_1133 | 125 |
| 802 | 3300050512 | nmdc:mga0n895_53926_c1 | nmdc:mga0n895_53926_c1_3196_3573 | 125 |
| 803 | 3300050513 | nmdc:mga0rr50_24480_c1 | nmdc:mga0rr50_24480_c1_3196_3573 | 125 |
| 804 | 3300050513 | nmdc:mga0rr50_3052_c1 | nmdc:mga0rr50_3052_c1_4194_4571 | 125 |
| 805 | 3300050514 | nmdc:mga08x19_6548_c1 | nmdc:mga08x19_6548_c1_1922_2299 | 125 |
| 806 | 3300050515 | nmdc:mga0a205_1359_c1 | nmdc:mga0a205_1359_c1_4805_5182 | 125 |
| 807 | 3300050515 | nmdc:mga0a205_20778_c1 | nmdc:mga0a205_20778_c1_732_1109 | 125 |
| 808 | 3300053077 | Ga0495601_0226132 | Ga0495601_0226132_22_405 | 125 |
| 809 | 3300053083 | Ga0495655_0107662 | Ga0495655_0107662_47_424 | 125 |
| 810 | 3300053087 | Ga0500643_000189 | Ga0500643_000189_41471_41854 | 125 |
| 811 | 3300053136 | Ga0500559_0001158 | Ga0500559_0001158_10_393 | 125 |
| 812 | 3300053136 | Ga0500559_0019522 | Ga0500559_0019522_2048_2431 | 125 |
| 813 | 3300053136 | Ga0500559_0346151 | Ga0500559_0346151_238_621 | 125 |
| 814 | 3300053139 | Ga0500568_0000060 | Ga0500568_0000060_88303_88686 | 125 |
| 815 | 3300053140 | Ga0500573_0000007 | Ga0500573_0000007_249891_250274 | 125 |
| 816 | 3300053140 | Ga0500573_0008741 | Ga0500573_0008741_1819_2202 | 125 |
| 817 | 3300053140 | Ga0500573_0149065 | Ga0500573_0149065_372_755 | 125 |
| 818 | 3300053142 | Ga0500577_0229805 | Ga0500577_0229805_31_414 | 125 |
| 819 | 3300053151 | Ga0500604_0031742 | Ga0500604_0031742_919_1302 | 125 |
| 820 | 3300059421 | Ga0590071_067204 | Ga0590071_067204_145_534 | 125 |
| 821 | 3300059423 | Ga0590074_018119 | Ga0590074_018119_705_1094 | 125 |
| 822 | 3300059423 | Ga0590074_067245 | Ga0590074_067245_48_425 | 125 |
| 823 | 3300059426 | Ga0590077_061581 | Ga0590077_061581_85_474 | 125 |
| 824 | 3300059490 | Ga0587066_035592 | Ga0587066_035592_511_900 | 125 |
| 825 | 3300059505 | Ga0587083_0220556 | Ga0587083_0220556_99_476 | 125 |
| 826 | 3300059511 | Ga0587091_136190 | Ga0587091_136190_108_485 | 125 |
| 827 | 3300059512 | Ga0587092_067437 | Ga0587092_067437_69_446 | 125 |
| 828 | 3300059622 | Ga0587099_013927 | Ga0587099_013927_448_831 | 125 |
| 829 | 3300059645 | Ga0587076_033932 | Ga0587076_033932_493_876 | 125 |
| 830 | 3300059647 | Ga0587079_060860 | Ga0587079_060860_396_773 | 125 |
| 831 | 3300059647 | Ga0587079_138740 | Ga0587079_138740_57_446 | 125 |
| 832 | 3300059655 | Ga0587114_118604 | Ga0587114_118604_62_451 | 125 |
| 833 | 3300000305 | bgg_mtDRAFT_1034183 | bgg_mtDRAFT_10341833 | 126 |
| 834 | 3300003308 | Ga0006777J48905_1010862 | Ga0006777J48905_10108623 | 126 |
| 835 | 3300003574 | Ga0007410J51695_1013837 | Ga0007410J51695_10138372 | 126 |
| 836 | 3300003577 | Ga0007416J51690_1010708 | Ga0007416J51690_10107083 | 126 |
| 837 | 3300003579 | Ga0007429J51699_1006245 | Ga0007429J51699_10062453 | 126 |
| 838 | 3300003611 | Ga0007411J51799_111023 | Ga0007411J51799_1110232 | 126 |
| 839 | 3300003693 | Ga0032354_1024637 | Ga0032354_10246372 | 126 |
| 840 | 3300005329 | Ga0070683_100265558 | Ga0070683_1002655583 | 126 |
| 841 | 3300005336 | Ga0070680_100532122 | Ga0070680_1005321222 | 126 |
| 842 | 3300005339 | Ga0070660_100469885 | Ga0070660_1004698852 | 126 |
| 843 | 3300005344 | Ga0070661_100406666 | Ga0070661_1004066662 | 126 |
| 844 | 3300005347 | Ga0070668_102198086 | Ga0070668_1021980861 | 126 |
| 845 | 3300005355 | Ga0070671_100560391 | Ga0070671_1005603912 | 126 |
| 846 | 3300005456 | Ga0070678_101464625 | Ga0070678_1014646251 | 126 |
| 847 | 3300005458 | Ga0070681_11005459 | Ga0070681_110054591 | 126 |
| 848 | 3300005530 | Ga0070679_100135552 | Ga0070679_1001355522 | 126 |
| 849 | 3300005535 | Ga0070684_100540774 | Ga0070684_1005407742 | 126 |
| 850 | 3300005539 | Ga0068853_101127575 | Ga0068853_1011275752 | 126 |
| 851 | 3300005577 | Ga0068857_100039495 | Ga0068857_1000394955 | 126 |
| 852 | 3300005844 | Ga0068862_100000021 | Ga0068862_100000021184 | 126 |
| 853 | 3300006931 | Ga0097620_100002262 | Ga0097620_1000022623 | 126 |
| 854 | 3300009177 | Ga0105248_11220244 | Ga0105248_112202442 | 126 |
| 855 | 3300009553 | Ga0105249_10030399 | Ga0105249_100303993 | 126 |
| 856 | 3300010375 | Ga0105239_10513745 | Ga0105239_105137452 | 126 |
| 857 | 3300014325 | Ga0163163_10038653 | Ga0163163_100386533 | 126 |
| 858 | 3300014325 | Ga0163163_10749520 | Ga0163163_107495202 | 126 |
| 859 | 3300017792 | Ga0163161_10667106 | Ga0163161_106671062 | 126 |
| 860 | 3300020069 | Ga0197907_11402576 | Ga0197907_114025763 | 126 |
| 861 | 3300020069 | Ga0197907_11507371 | Ga0197907_115073713 | 126 |
| 862 | 3300020070 | Ga0206356_10342838 | Ga0206356_103428382 | 126 |
| 863 | 3300020075 | Ga0206349_1295472 | Ga0206349_12954722 | 126 |
| 864 | 3300020076 | Ga0206355_1196559 | Ga0206355_11965591 | 126 |
| 865 | 3300020078 | Ga0206352_11090449 | Ga0206352_110904492 | 126 |
| 866 | 3300020081 | Ga0206354_10144092 | Ga0206354_101440921 | 126 |
| 867 | 3300020082 | Ga0206353_10515275 | Ga0206353_105152751 | 126 |
| 868 | 3300020082 | Ga0206353_10609952 | Ga0206353_106099521 | 126 |
| 869 | 3300020082 | Ga0206353_11166848 | Ga0206353_111668482 | 126 |
| 870 | 3300025912 | Ga0207707_10430211 | Ga0207707_104302112 | 126 |
| 871 | 3300025917 | Ga0207660_10363262 | Ga0207660_103632623 | 126 |
| 872 | 3300025920 | Ga0207649_10818135 | Ga0207649_108181352 | 126 |
| 873 | 3300025921 | Ga0207652_10489013 | Ga0207652_104890132 | 126 |
| 874 | 3300025961 | Ga0207712_10061090 | Ga0207712_100610903 | 126 |
| 875 | 3300026035 | Ga0207703_11214405 | Ga0207703_112144052 | 126 |
| 876 | 3300026116 | Ga0207674_10032541 | Ga0207674_100325414 | 126 |
| 877 | 3300028380 | Ga0268265_10000034 | Ga0268265_1000003417 | 126 |
| 878 | 3300030744 | Ga0316181_1015560 | Ga0316181_10155602 | 126 |
| 879 | 3300031727 | Ga0316576_10285713 | Ga0316576_102857132 | 126 |
| 880 | 3300031731 | Ga0307405_11039857 | Ga0307405_110398572 | 126 |
| 881 | 3300032002 | Ga0307416_101588766 | Ga0307416_1015887661 | 126 |
| 882 | 3300032168 | Ga0316593_10138446 | Ga0316593_101384461 | 126 |
| 883 | 3300041445 | Ga0451792_00917 | Ga0451792_00917_29_412 | 126 |
| 884 | 3300041451 | Ga0451791_0268782 | Ga0451791_0268782_111_491 | 126 |
| 885 | 3300042157 | Ga0439458_0117229 | Ga0439458_0117229_45_428 | 126 |
| 886 | 3300044735 | Ga0466968_0292792 | Ga0466968_0292792_98_481 | 126 |
| 887 | 3300046809 | Ga0495600_0327751 | Ga0495600_0327751_273_674 | 126 |
| 888 | 3300047315 | Ga0495581_0140462 | Ga0495581_0140462_358_759 | 126 |
| 889 | 3300048904 | Ga0496101_0257440 | Ga0496101_0257440_914_1315 | 126 |
| 890 | 3300048905 | Ga0496102_0053791 | Ga0496102_0053791_912_1313 | 126 |
| 891 | 3300048905 | Ga0496102_0161323 | Ga0496102_0161323_190_588 | 126 |
| 892 | 3300048906 | Ga0496103_0031078 | Ga0496103_0031078_2260_2661 | 126 |
| 893 | 3300048907 | Ga0496104_0715566 | Ga0496104_0715566_155_553 | 126 |
| 894 | 3300048908 | Ga0496105_0001730 | Ga0496105_0001730_51_452 | 126 |
| 895 | 3300048914 | Ga0496111_0096042 | Ga0496111_0096042_1298_1696 | 126 |
| 896 | 3300048916 | Ga0496113_0233780 | Ga0496113_0233780_1029_1430 | 126 |
| 897 | 3300048917 | Ga0496114_1273358 | Ga0496114_1273358_159_557 | 126 |
| 898 | 3300048929 | Ga0496126_0194489 | Ga0496126_0194489_502_900 | 126 |
| 899 | 3300048929 | Ga0496126_0523820 | Ga0496126_0523820_67_450 | 126 |
| 900 | 3300049161 | Ga0501305_055512 | Ga0501305_055512_150_554 | 126 |
| 901 | 3300049534 | Ga0501318_004185 | Ga0501318_004185_278_682 | 126 |
| 902 | 3300049569 | Ga0501032_0671920 | Ga0501032_0671920_44_424 | 126 |
| 903 | 3300049575 | Ga0501039_1176406 | Ga0501039_1176406_84_464 | 126 |
| 904 | 3300049577 | Ga0501041_0439915 | Ga0501041_0439915_266_646 | 126 |
| 905 | 3300049578 | Ga0501042_0637019 | Ga0501042_0637019_310_690 | 126 |
| 906 | 3300049583 | Ga0501067_0062551 | Ga0501067_0062551_1056_1454 | 126 |
| 907 | 3300049585 | Ga0501069_0195392 | Ga0501069_0195392_718_1116 | 126 |
| 908 | 3300049591 | Ga0501075_0425808 | Ga0501075_0425808_583_963 | 126 |
| 909 | 3300049743 | Ga0501081_1094561 | Ga0501081_1094561_15_395 | 126 |
| 910 | 3300049824 | Ga0501045_0344378 | Ga0501045_0344378_513_893 | 126 |
| 911 | 3300053077 | Ga0495601_0201140 | Ga0495601_0201140_880_1281 | 126 |
| 912 | 3300053085 | Ga0495619_0119445 | Ga0495619_0119445_1263_1664 | 126 |
| 913 | 3300059505 | Ga0587083_0048155 | Ga0587083_0048155_507_908 | 126 |
| 914 | 3300061734 | Ga0530510_0324334 | Ga0530510_0324334_450_848 | 126 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7pkt-assembly1.cif.gz_o | large subunit of the chlamydomonas reinhardtii mitoribosome | 0.9064 | 14 | 114 |
| 8apo-assembly1.cif.gz_Ao | structure of the mitochondrial ribosome from polytomella magna with trnas bound to the a and p sites | 0.9035 | 14 | 114 |
| 6o8z-assembly1.cif.gz_R | cryo-em image reconstruction of the 70s ribosome enterococcus faecalis class04 | 0.8977 | 11 | 116 |
| 6xyw-assembly1.cif.gz_Aq | structure of the plant mitochondrial ribosome | 0.894 | 13 | 115 |
| 6o8x-assembly1.cif.gz_R | cryo-em image reconstruction of the 70s ribosome enterococcus faecalis class02 | 0.8905 | 15 | 116 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2ghjD02 | Mainly Alpha;Orthogonal Bundle;c-terminal domain of poly(a) binding protein;Ribosomal protein L20, C-terminal domain | 0.9443 | 53 | 116 | 1.10.1900.20 |
| 2ghjB02 | Mainly Alpha;Orthogonal Bundle;c-terminal domain of poly(a) binding protein;Ribosomal protein L20, C-terminal domain | 0.8771 | 58 | 119 | 1.10.1900.20 |
| 2ghjD02 | Mainly Alpha;Orthogonal Bundle;c-terminal domain of poly(a) binding protein;Ribosomal protein L20, C-terminal domain | 0.8662 | 53 | 116 | 1.10.1900.20 |
| 1gyzA00 | Mainly Alpha;Orthogonal Bundle;c-terminal domain of poly(a) binding protein;Ribosomal protein L20, C-terminal domain | 0.83 | 61 | 119 | 1.10.1900.20 |
| 2ghjB02 | Mainly Alpha;Orthogonal Bundle;c-terminal domain of poly(a) binding protein;Ribosomal protein L20, C-terminal domain | 0.8158 | 58 | 119 | 1.10.1900.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-J9FK27-F1-model_v4 | Ribosomal protein L20 | 0.9985 | 60 | 116 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-G6EM08-F1-model_v4 | deleted | 0.9971 | 57 | 116 |
|
| AF-A0A2D8YKH1-F1-model_v4 | deleted | 0.9946 | 58 | 116 |
|
| AF-A0A354QTS7-F1-model_v4 | Large ribosomal subunit protein bL20 (50S ribosomal protein L20) | 0.9945 | 53 | 116 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-A0A7K7GJZ7-F1-model_v4 | RM20 protein | 0.9943 | 61 | 114 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar