F484525

General Info

Members Datasets Scaffolds Average Seq Length
881 450 868 210

Family's Representative Sequence

Representative Sequence 3300014497|Ga0182008_10110336|Ga0182008_101103362
Length 250
Sequence MKEPPMAQTHDHGDHTHPAAPMVEEISDFEILEIAVRELAIEKGLFTAEDHRKFTEWAEQIGPAGGSRLVAKAWSDPAFKARVLTDAVAACREIGIDWAEPTGQGTPSDYMELRVLEDTPTLHHVIVCTLCSCYPRPLLGHSPYWYRSPNYRRRLVRWPRQVLAEFGLVLPPEVEIRVEDSNQKCRFMVLPMRPAGTESWAEEQLAEIVTRDCMIGVALPRPDRKADDVRPVHKASRPVGGEHREPGSGP

Samples

Sample ID Description Type Environment
1 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
2 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
3 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
4 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
5 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
6 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
7 2861691609 Methylorubrum thiocyanatum DSM 11490 Isolate Rhizosphere
8 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
9 2902405164 Methylobacterium sp. P1-11 Isolate Unclassified
10 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
11 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
12 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
13 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
14 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
15 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
16 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
17 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
18 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
19 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
20 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
21 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
22 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
23 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
24 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
25 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
26 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
27 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
28 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
29 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
30 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
31 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
32 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
33 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
34 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
35 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
36 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
37 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
38 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
39 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
40 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
41 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
42 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
43 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
44 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
45 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
46 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
47 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
48 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
49 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
50 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
51 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
52 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
53 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
54 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
55 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
56 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
57 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
58 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
59 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
60 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
61 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
62 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
63 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
64 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
65 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
66 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
67 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
68 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
69 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
70 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
71 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
72 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
73 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
74 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
75 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
76 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
77 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
78 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
79 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
80 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
81 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
82 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
83 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
84 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
85 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
86 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
87 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
88 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
89 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
90 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
91 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
92 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
93 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
94 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
95 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
96 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
97 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
98 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
99 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
100 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
101 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
102 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
103 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
104 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
105 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
106 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
107 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
108 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
109 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
110 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
111 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
112 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
113 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
114 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
115 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
116 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
117 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
118 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
119 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
120 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
121 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
122 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
123 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
124 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
125 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
126 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
127 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
128 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
129 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
130 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
131 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
132 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
133 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
134 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
135 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
136 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
137 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
138 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
139 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
140 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
141 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
142 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
143 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
144 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
145 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
146 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
147 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
148 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
149 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
150 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
151 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
152 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
153 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
154 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
155 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
156 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
157 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
158 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
202 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
203 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
204 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
206 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
207 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
208 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
212 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
213 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
214 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
215 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
216 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
217 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
218 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
219 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
220 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
221 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
222 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
223 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
224 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
225 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
226 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
227 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
228 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
229 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
230 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
231 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
232 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
233 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
234 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
235 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
236 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
237 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
238 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
239 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
240 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
241 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
242 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
243 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
244 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
245 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
246 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
247 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
248 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
249 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
250 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
251 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
252 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
253 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
254 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
255 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
256 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
257 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
258 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
259 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
260 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
261 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
262 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
263 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
264 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
265 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
266 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
267 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
268 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
269 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
270 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
271 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
272 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
273 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
274 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
275 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
276 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
277 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
278 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
279 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
280 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
281 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
282 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
283 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
284 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
285 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
286 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
287 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
288 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
289 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
290 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
291 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
292 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
293 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
294 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
295 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
296 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
297 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
298 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
299 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
300 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
301 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
302 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
303 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
304 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
305 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
306 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
307 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
308 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
309 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
310 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
311 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
312 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
313 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
314 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
315 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
316 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
317 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
318 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
319 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
320 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
321 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
322 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
323 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
324 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
325 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
326 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
327 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
328 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
329 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
330 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
331 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
332 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
333 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
334 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
335 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
336 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
337 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
338 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
339 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
340 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
341 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
342 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
343 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
344 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
345 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
346 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
347 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
348 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
349 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
350 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
351 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
352 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
353 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
354 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
355 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
356 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
357 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
358 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
359 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
360 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
361 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
362 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
363 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
364 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
365 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
366 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
367 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
368 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
369 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
370 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
371 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
372 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
373 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
374 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
375 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
376 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
377 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
378 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
379 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
380 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
381 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
382 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
383 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
384 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
385 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
386 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
387 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
388 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
389 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
390 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
391 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
392 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
393 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
394 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
395 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
396 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
397 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
398 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
399 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
400 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
401 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
402 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
403 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
404 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
405 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
406 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
407 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
408 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
409 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
410 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
411 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
412 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
413 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
414 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
415 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
416 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
417 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
418 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
419 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
420 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
421 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
422 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
423 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
424 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
425 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
426 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
427 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
428 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
429 3300053144 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 endosphere Metagenome Endosphere
430 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
431 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
432 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
433 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
434 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
435 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
436 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
437 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
438 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
439 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
440 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
441 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
442 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
443 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
444 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
445 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
446 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
447 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
448 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
449 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
450 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.89
Metatranscriptomes 3.63
Isolates 1.48

Biome Distribution

Category Percentage (%)
Aerial Root 0.11
Bulb 0
Endosphere 5.56
Nodule 0
Rhizoplane 6.47
Rhizosphere 83.2
Stem 0
Stem Tuber 0
Unclassified 4.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10001471 3300001979 Bacteria 10812
2 JGI24735J21928_10000853 3300002067 Bacteria 10859
3 JGI25162J39368_1000277 3300002737 Bacteria 48696
4 JGI25165J46597_1000688 3300003214 Bacteria 27066
5 rootH2_10006900 3300003320 Bacteria 4482
6 rootH1_10144639 3300003323 Bacteria 1051
7 Ga0055525_1000388 3300003759 Bacteria 28210
8 Ga0055542_1000060 3300003762 Bacteria 162275
9 Ga0055529_1000043 3300003763 Bacteria 221704
10 Ga0055526_1004486 3300003771 Bacteria 8362
11 Ga0055524_1002269 3300003775 Bacteria 10052
12 Ga0055524_1007126 3300003775 Bacteria 4789
13 Ga0055528_1000680 3300003790 Bacteria 24516
14 Ga0058859_10042072 3300004798 Unclassified 2097
15 Ga0058863_10089197 3300004799 Unclassified 2194
16 Ga0058861_10086667 3300004800 Unclassified 2224
17 Ga0058860_10046890 3300004801 Unclassified 1858
18 Ga0058862_10192943 3300004803 Unclassified 1655
19 Ga0065712_10146685 3300005290 Bacteria 1403
20 Ga0065715_10299140 3300005293 Unclassified 1005
21 Ga0070683_100140008 3300005329 Unclassified 2292
22 Ga0070690_100081269 3300005330 Unclassified 2120
23 Ga0070670_100006650 3300005331 Bacteria 9797
24 Ga0068869_100000518 3300005334 Bacteria 21579
25 Ga0070680_100251344 3300005336 Bacteria 1495
26 Ga0070680_100476832 3300005336 Unclassified 1066
27 Ga0070682_100026267 3300005337 Unclassified 3483
28 Ga0070682_100039367 3300005337 Bacteria 2905
29 Ga0068868_100097817 3300005338 Unclassified 2372
30 Ga0068868_100834577 3300005338 Bacteria 834
31 Ga0070660_100124200 3300005339 Bacteria 2062
32 Ga0070689_100090192 3300005340 Bacteria 2415
33 Ga0070691_10056432 3300005341 Archaea 1882
34 Ga0070687_100065273 3300005343 Bacteria 1936
35 Ga0070668_100870229 3300005347 Bacteria 804
36 Ga0070671_100179390 3300005355 Bacteria 1793
37 Ga0070671_100636184 3300005355 Bacteria 923
38 Ga0070674_100328111 3300005356 Bacteria 1229
39 Ga0070673_100009443 3300005364 Bacteria 6546
40 Ga0070659_100078713 3300005366 Bacteria 2630
41 Ga0070667_100131778 3300005367 Bacteria 2182
42 Ga0070709_10040822 3300005434 Bacteria 2855
43 Ga0070709_10042260 3300005434 Bacteria 2814
44 Ga0070714_100090193 3300005435 Bacteria 2684
45 Ga0070714_100173969 3300005435 Bacteria 1955
46 Ga0070713_100079441 3300005436 Bacteria 2794
47 Ga0070713_100090161 3300005436 Bacteria 2635
48 Ga0070713_100114720 3300005436 Unclassified 2354
49 Ga0070713_100385968 3300005436 Bacteria 1306
50 Ga0070713_100585871 3300005436 Bacteria 1058
51 Ga0070710_10019648 3300005437 Bacteria 3494
52 Ga0070710_10174003 3300005437 Bacteria 1343
53 Ga0070710_10224606 3300005437 Bacteria 1196
54 Ga0070711_100121836 3300005439 Bacteria 1930
55 Ga0070711_100356692 3300005439 Bacteria 1177
56 Ga0070694_100007379 3300005444 Bacteria 6704
57 Ga0070694_100224035 3300005444 Bacteria 1412
58 Ga0070708_100081752 3300005445 Bacteria 2925
59 Ga0070663_100057016 3300005455 Bacteria 2801
60 Ga0070678_100001861 3300005456 Bacteria 11375
61 Ga0070678_100167666 3300005456 Unclassified 1785
62 Ga0070681_10193364 3300005458 Bacteria 1954
63 Ga0068867_100001294 3300005459 Bacteria 17272
64 Ga0070706_100298072 3300005467 Bacteria 1504
65 Ga0070706_100549273 3300005467 Bacteria 1074
66 Ga0070706_100645321 3300005467 Bacteria 983
67 Ga0070707_100024932 3300005468 Bacteria 5670
68 Ga0070707_100130996 3300005468 Bacteria 2438
69 Ga0070707_100208537 3300005468 Bacteria 1905
70 Ga0070707_100288586 3300005468 Bacteria 1594
71 Ga0070698_100106932 3300005471 Bacteria 2766
72 Ga0070698_100201851 3300005471 Bacteria 1924
73 Ga0070698_100381059 3300005471 Bacteria 1343
74 Ga0070698_100659981 3300005471 Bacteria 987
75 Ga0070698_100763078 3300005471 Bacteria 910
76 Ga0070699_100049973 3300005518 Bacteria 3619
77 Ga0070699_100070104 3300005518 Bacteria 3047
78 Ga0070699_100216952 3300005518 Bacteria 1704
79 Ga0070699_100840544 3300005518 Bacteria 840
80 Ga0070679_100499598 3300005530 Bacteria 1160
81 Ga0070684_100274784 3300005535 Bacteria 1543
82 Ga0070697_100036169 3300005536 Bacteria 3987
83 Ga0070697_100143209 3300005536 Unclassified 2011
84 Ga0070697_100166793 3300005536 Bacteria 1862
85 Ga0070697_100930749 3300005536 Bacteria 771
86 Ga0068853_100036380 3300005539 Bacteria 4186
87 Ga0070672_100318333 3300005543 Bacteria 1322
88 Ga0070695_100101329 3300005545 Bacteria 1940
89 Ga0070695_100609462 3300005545 Bacteria 858
90 Ga0070696_100181143 3300005546 Bacteria 1563
91 Ga0070665_100000911 3300005548 Bacteria 37941
92 Ga0068855_100447028 3300005563 Bacteria 1411
93 Ga0068854_100127206 3300005578 Bacteria 1942
94 Ga0068856_100671704 3300005614 Bacteria 1056
95 Ga0068859_100030539 3300005617 Bacteria 5408
96 Ga0068864_100000394 3300005618 Bacteria 38005
97 Ga0068864_100080216 3300005618 Bacteria 2859
98 Ga0068866_10016696 3300005718 Bacteria 3287
99 Ga0068861_100003658 3300005719 Bacteria 10250
100 Ga0068863_100028085 3300005841 Bacteria 5370
101 Ga0068863_100097500 3300005841 Bacteria 2792
102 Ga0068858_100025720 3300005842 Bacteria 5475
103 Ga0068860_100046555 3300005843 Bacteria 4135
104 Ga0068860_100190436 3300005843 Bacteria 1985
105 Ga0068862_100007631 3300005844 Bacteria 8956
106 Ga0081455_10000567 3300005937 Bacteria 48149
107 Ga0081455_10000576 3300005937 Bacteria 47827
108 Ga0081455_10000759 3300005937 Bacteria 41962
109 Ga0081455_10007956 3300005937 Bacteria 11088
110 Ga0081455_10024833 3300005937 Bacteria 5540
111 Ga0081455_10173682 3300005937 Bacteria 1638
112 Ga0081455_10272684 3300005937 Bacteria 1226
113 Ga0081538_10005426 3300005981 Bacteria 11450
114 Ga0081538_10034097 3300005981 Bacteria 3373
115 Ga0081538_10049438 3300005981 Bacteria 2550
116 Ga0081540_1005852 3300005983 Bacteria 9093
117 Ga0081540_1039841 3300005983 Bacteria 2458
118 Ga0070717_10026307 3300006028 Bacteria 4641
119 Ga0070717_10235118 3300006028 Bacteria 1614
120 Ga0070717_10325927 3300006028 Unclassified 1369
121 Ga0070717_10406246 3300006028 Bacteria 1224
122 Ga0070717_10573812 3300006028 Bacteria 1022
123 Ga0070717_10811113 3300006028 Bacteria 851
124 Ga0075363_100061152 3300006048 Bacteria 2029
125 Ga0075432_10088120 3300006058 Bacteria 1133
126 Ga0070715_10078649 3300006163 Bacteria 1491
127 Ga0070715_10227383 3300006163 Bacteria 963
128 Ga0070716_100005361 3300006173 Bacteria 6203
129 Ga0070716_100035211 3300006173 Bacteria 2752
130 Ga0070716_100608327 3300006173 Bacteria 823
131 Ga0070712_100071523 3300006175 Unclassified 2482
132 Ga0070712_100742530 3300006175 Bacteria 839
133 Ga0075367_10060821 3300006178 Bacteria 2253
134 Ga0075369_10071146 3300006186 Bacteria 1531
135 Ga0075369_10103053 3300006186 Bacteria 1281
136 Ga0097621_100328786 3300006237 Bacteria 1355
137 Ga0075370_10149164 3300006353 Bacteria 1370
138 Ga0068871_100022845 3300006358 Bacteria 4828
139 Ga0068871_100073481 3300006358 Unclassified 2819
140 Ga0075428_100034872 3300006844 Bacteria 5548
141 Ga0075428_100049297 3300006844 Bacteria 4620
142 Ga0075428_100081343 3300006844 Bacteria 3535
143 Ga0075428_100268560 3300006844 Bacteria 1836
144 Ga0075428_101024465 3300006844 Bacteria 873
145 Ga0075430_100099668 3300006846 Bacteria 2426
146 Ga0075430_100108107 3300006846 Bacteria 2320
147 Ga0075430_100129196 3300006846 Bacteria 2106
148 Ga0075430_100249568 3300006846 Bacteria 1471
149 Ga0075431_100060694 3300006847 Bacteria 3901
150 Ga0075431_100105654 3300006847 Bacteria 2905
151 Ga0075431_100438309 3300006847 Bacteria 1304
152 Ga0075433_10034402 3300006852 Bacteria 4352
153 Ga0075433_10044634 3300006852 Bacteria 3852
154 Ga0075434_100018856 3300006871 Bacteria 6669
155 Ga0075434_100112903 3300006871 Bacteria 2729
156 Ga0075434_100183759 3300006871 Bacteria 2111
157 Ga0075434_100527712 3300006871 Bacteria 1201
158 Ga0075429_100017880 3300006880 Bacteria 6129
159 Ga0075429_100844309 3300006880 Unclassified 802
160 Ga0068865_100018974 3300006881 Bacteria 4445
161 Ga0097620_100030538 3300006931 Bacteria 5408
162 Ga0075435_100051318 3300007076 Bacteria 3322
163 Ga0075435_100072774 3300007076 Bacteria 2808
164 Ga0075435_100155526 3300007076 Bacteria 1924
165 Ga0075435_100425814 3300007076 Bacteria 1143
166 Ga0075435_100595407 3300007076 Bacteria 959
167 Ga0099794_10001551 3300007265 Bacteria 8096
168 Ga0099794_10023217 3300007265 Bacteria 2834
169 Ga0099794_10031658 3300007265 Bacteria 2478
170 Ga0099795_10001879 3300007788 Bacteria 4759
171 Ga0099795_10020732 3300007788 Unclassified 2145
172 Ga0105240_10008535 3300009093 Bacteria 14639
173 Ga0105240_10119821 3300009093 Bacteria 3169
174 Ga0105240_10437721 3300009093 Bacteria 1466
175 Ga0111539_10291181 3300009094 Bacteria 1900
176 Ga0111539_10358644 3300009094 Bacteria 1697
177 Ga0105245_10223690 3300009098 Bacteria 1817
178 Ga0105245_10392510 3300009098 Bacteria 1385
179 Ga0114129_10062387 3300009147 Bacteria 5207
180 Ga0114129_10067933 3300009147 Bacteria 4970
181 Ga0114129_10148400 3300009147 Bacteria 3211
182 Ga0114129_10252066 3300009147 Bacteria 2369
183 Ga0114129_10275304 3300009147 Bacteria 2251
184 Ga0114129_10523420 3300009147 Bacteria 1546
185 Ga0105243_10429824 3300009148 Bacteria 1234
186 Ga0105242_10054783 3300009176 Bacteria 3261
187 Ga0105248_10011661 3300009177 Bacteria 9684
188 Ga0105248_10183414 3300009177 Bacteria 2358
189 Ga0105248_11298418 3300009177 Bacteria 823
190 Ga0105237_10002242 3300009545 Bacteria 24086
191 Ga0105237_10069951 3300009545 Bacteria 3505
192 Ga0105237_10124272 3300009545 Bacteria 2575
193 Ga0105238_10233074 3300009551 Bacteria 1817
194 Ga0105249_10955967 3300009553 Bacteria 925
195 Ga0105028_103858 3300009993 Bacteria 1568
196 Ga0099796_10004830 3300010159 Bacteria 3304
197 Ga0099796_10012239 3300010159 Bacteria 2417
198 Ga0099796_10053613 3300010159 Bacteria 1407
199 Ga0105239_10005815 3300010375 Bacteria 14383
200 Ga0157373_10038839 3300013100 Bacteria 3410
201 Ga0157370_10007661 3300013104 Bacteria 11720
202 Ga0157370_10023883 3300013104 Bacteria 6063
203 Ga0157370_10249531 3300013104 Bacteria 1642
204 Ga0157370_10831278 3300013104 Bacteria 840
205 Ga0157369_10379039 3300013105 Bacteria 1468
206 Ga0157369_10931309 3300013105 Bacteria 891
207 Ga0157374_10225964 3300013296 Unclassified 1838
208 Ga0157378_10008927 3300013297 Bacteria 8726
209 Ga0157378_10018371 3300013297 Bacteria 6140
210 Ga0157378_10063574 3300013297 Bacteria 3298
211 Ga0157378_10376998 3300013297 Bacteria 1392
212 Ga0157372_10496740 3300013307 Unclassified 1423
213 Ga0157375_10606456 3300013308 Bacteria 1253
214 Ga0157380_10070577 3300014326 Bacteria 2823
215 Ga0182008_10110336 3300014497 Bacteria 1363
216 Ga0182008_10365711 3300014497 Bacteria 768
217 Ga0157379_10002992 3300014968 Bacteria 14252
218 Ga0157376_10791917 3300014969 Unclassified 960
219 Ga0182007_10000160 3300015262 Bacteria 46183
220 Ga0182005_1012818 3300015265 Bacteria 2362
221 Ga0197907_10778953 3300020069 Unclassified 2201
222 Ga0206356_10484009 3300020070 Archaea 1790
223 Ga0206349_1455224 3300020075 Unclassified 2254
224 Ga0206355_1420413 3300020076 Unclassified 2034
225 Ga0206351_10982550 3300020077 Unclassified 2146
226 Ga0206352_10093453 3300020078 Unclassified 2230
227 Ga0206350_11309462 3300020080 Unclassified 2053
228 Ga0206354_11227028 3300020081 Unclassified 2129
229 Ga0206353_11257201 3300020082 Unclassified 2120
230 Ga0154015_1016679 3300020610 Unclassified 1997
231 Ga0213873_10042582 3300021358 Bacteria 1175
232 Ga0213873_10047742 3300021358 Bacteria 1124
233 Ga0213872_10085182 3300021361 Bacteria 1417
234 Ga0213872_10115926 3300021361 Bacteria 1187
235 Ga0213876_10053268 3300021384 Bacteria 2138
236 Ga0213875_10000012 3300021388 Bacteria 312017
237 Ga0213875_10195428 3300021388 Bacteria 952
238 Ga0213871_10012123 3300021441 Bacteria 1994
239 Ga0213871_10014157 3300021441 Bacteria 1887
240 Ga0224712_10021149 3300022467 Unclassified 2222
241 Ga0209563_100106 3300025230 Bacteria 146256
242 Ga0207427_109633 3300025231 Bacteria 1031
243 Ga0209437_100078 3300025233 Bacteria 278088
244 Ga0209148_1000017 3300025254 Bacteria 787064
245 Ga0209233_1000163 3300025261 Bacteria 152912
246 Ga0209233_1000463 3300025261 Bacteria 25873
247 Ga0209455_1000005 3300025272 Bacteria 1416756
248 Ga0209673_1001165 3300025273 Bacteria 28659
249 Ga0209564_1001589 3300025295 Bacteria 22197
250 Ga0209256_1001586 3300025299 Bacteria 22257
251 Ga0207692_10005609 3300025898 Bacteria 5036
252 Ga0207692_10010022 3300025898 Bacteria 3976
253 Ga0207692_10124317 3300025898 Bacteria 1449
254 Ga0207710_10042272 3300025900 Bacteria 2024
255 Ga0207680_10044877 3300025903 Bacteria 2603
256 Ga0207680_10358733 3300025903 Bacteria 1025
257 Ga0207685_10067805 3300025905 Bacteria 1436
258 Ga0207685_10084150 3300025905 Bacteria 1324
259 Ga0207699_10023641 3300025906 Bacteria 3347
260 Ga0207699_10170550 3300025906 Bacteria 1455
261 Ga0207645_10041895 3300025907 Bacteria 2930
262 Ga0207643_10032438 3300025908 Bacteria 2917
263 Ga0207707_10171389 3300025912 Bacteria 1897
264 Ga0207671_10002514 3300025914 Bacteria 19571
265 Ga0207693_10032075 3300025915 Bacteria 4147
266 Ga0207693_10172970 3300025915 Unclassified 1700
267 Ga0207693_10191026 3300025915 Bacteria 1611
268 Ga0207663_10027466 3300025916 Bacteria 3318
269 Ga0207663_10199844 3300025916 Bacteria 1441
270 Ga0207663_10358616 3300025916 Bacteria 1105
271 Ga0207663_10465404 3300025916 Bacteria 977
272 Ga0207662_10177411 3300025918 Bacteria 1369
273 Ga0207646_10189678 3300025922 Unclassified 1856
274 Ga0207646_10397339 3300025922 Bacteria 1245
275 Ga0207681_10086980 3300025923 Bacteria 2222
276 Ga0207650_10715897 3300025925 Bacteria 846
277 Ga0207687_10662019 3300025927 Bacteria 884
278 Ga0207700_10064060 3300025928 Unclassified 2798
279 Ga0207700_10145858 3300025928 Bacteria 1950
280 Ga0207664_10002993 3300025929 Bacteria 11226
281 Ga0207664_10031526 3300025929 Bacteria 4056
282 Ga0207664_10086116 3300025929 Bacteria 2566
283 Ga0207664_10197837 3300025929 Bacteria 1733
284 Ga0207664_10284300 3300025929 Bacteria 1452
285 Ga0207664_10338989 3300025929 Bacteria 1329
286 Ga0207644_10368623 3300025931 Bacteria 1169
287 Ga0207706_10099286 3300025933 Bacteria 2561
288 Ga0207709_10048761 3300025935 Bacteria 2582
289 Ga0207709_10560847 3300025935 Bacteria 899
290 Ga0207670_10121115 3300025936 Bacteria 1902
291 Ga0207704_10005581 3300025938 Bacteria 5802
292 Ga0207665_10106406 3300025939 Bacteria 1965
293 Ga0207691_10169702 3300025940 Bacteria 1911
294 Ga0207711_10662996 3300025941 Bacteria 973
295 Ga0207711_11056212 3300025941 Bacteria 752
296 Ga0207689_10000215 3300025942 Bacteria 51175
297 Ga0207661_10488745 3300025944 Unclassified 1124
298 Ga0207667_10205285 3300025949 Bacteria 2021
299 Ga0207651_10018579 3300025960 Bacteria 4142
300 Ga0207640_10012155 3300025981 Bacteria 4896
301 Ga0207658_10166869 3300025986 Bacteria 1809
302 Ga0207677_10105217 3300026023 Unclassified 2088
303 Ga0207677_10503135 3300026023 Bacteria 1048
304 Ga0207703_10068215 3300026035 Bacteria 2930
305 Ga0207639_10030887 3300026041 Bacteria 3933
306 Ga0207678_10157997 3300026067 Bacteria 1936
307 Ga0207678_10230260 3300026067 Bacteria 1587
308 Ga0207702_10302054 3300026078 Bacteria 1519
309 Ga0207641_10106131 3300026088 Bacteria 2482
310 Ga0207648_10000620 3300026089 Bacteria 39786
311 Ga0207648_10237341 3300026089 Bacteria 1623
312 Ga0207674_10015306 3300026116 Bacteria 8431
313 Ga0207675_100001798 3300026118 Bacteria 21469
314 Ga0207683_10009395 3300026121 Bacteria 8331
315 Ga0207683_10196666 3300026121 Unclassified 1832
316 Ga0209179_1002907 3300027512 Bacteria 2391
317 Ga0209968_1004456 3300027526 Unclassified 2103
318 Ga0209982_1007401 3300027552 Bacteria 1604
319 Ga0209983_1011064 3300027665 Bacteria 1846
320 Ga0209588_1053116 3300027671 Bacteria 1311
321 Ga0209998_10021992 3300027717 Bacteria 1373
322 Ga0209974_10000995 3300027876 Bacteria 9973
323 Ga0209974_10046838 3300027876 Bacteria 1447
324 Ga0207428_10086085 3300027907 Bacteria 2446
325 Ga0207428_10197180 3300027907 Bacteria 1516
326 Ga0268266_10125643 3300028379 Bacteria 2288
327 Ga0268265_10151135 3300028380 Bacteria 1959
328 Ga0268264_10009612 3300028381 Bacteria 8011
329 Ga0268264_10229111 3300028381 Bacteria 1715
330 Ga0265337_1003286 3300028556 Bacteria 7064
331 Ga0307517_10045840 3300028786 Bacteria 4580
332 Ga0265338_10267897 3300028800 Bacteria 1253
333 Ga0265770_1006705 3300030878 Bacteria 1604
334 Ga0265332_10096917 3300031238 Bacteria 1245
335 Ga0265325_10045164 3300031241 Bacteria 2290
336 Ga0265340_10016673 3300031247 Bacteria 3802
337 Ga0265340_10029882 3300031247 Bacteria 2735
338 Ga0265339_10000052 3300031249 Bacteria 101603
339 Ga0265339_10000195 3300031249 Bacteria 50154
340 Ga0265339_10024316 3300031249 Bacteria 3492
341 Ga0265339_10218072 3300031249 Bacteria 934
342 Ga0265316_10000300 3300031344 Bacteria 55381
343 Ga0307509_10000177 3300031507 Bacteria 100248
344 Ga0307509_10104000 3300031507 Bacteria 2866
345 Ga0265313_10000318 3300031595 Bacteria 52390
346 Ga0265313_10047456 3300031595 Bacteria 2078
347 Ga0265313_10047995 3300031595 Bacteria 2063
348 Ga0316575_10064273 3300031665 Bacteria 1469
349 Ga0316579_10000907 3300031691 Bacteria 10272
350 Ga0316579_10001630 3300031691 Bacteria 8226
351 Ga0265314_10000002 3300031711 Bacteria 2092193
352 Ga0265314_10054403 3300031711 Bacteria 2770
353 Ga0316576_10002342 3300031727 Bacteria 10765
354 Ga0316576_10023850 3300031727 Bacteria 4267
355 Ga0316576_10266991 3300031727 Bacteria 1283
356 Ga0316578_10011663 3300031728 Bacteria 4609
357 Ga0316578_10013443 3300031728 Bacteria 4343
358 Ga0316578_10028349 3300031728 Bacteria 3170
359 Ga0307516_10051054 3300031730 Bacteria 4055
360 Ga0316577_10004132 3300031733 Bacteria 7451
361 Ga0316577_10020484 3300031733 Bacteria 3665
362 Ga0316577_10151068 3300031733 Bacteria 1309
363 Ga0307406_10096425 3300031901 Bacteria 2004
364 Ga0316583_10032531 3300032133 Bacteria 1854
365 Ga0316585_10020009 3300032137 Bacteria 2045
366 Ga0316588_1041902 3300033528 Bacteria 1096
367 Ga0316596_1012231 3300033541 Bacteria 2109
368 Ga0373934_0069808 3300035086 Bacteria 1404
369 Ga0373944_0089435 3300035089 Bacteria 1027
370 Ga0373949_0001647 3300035090 Bacteria 6229
371 Ga0373952_0000264 3300035092 Bacteria 8612
372 Ga0373923_0015498 3300035111 Bacteria 2879
373 Ga0373932_0110822 3300035112 Bacteria 904
374 Ga0373936_0000020 3300035113 Bacteria 142589
375 Ga0373936_0001304 3300035113 Bacteria 9034
376 Ga0373939_0092452 3300035114 Bacteria 1025
377 Ga0373941_0004708 3300035115 Bacteria 3172
378 Ga0373945_0025200 3300035116 Bacteria 2065
379 Ga0373953_0006486 3300035117 Bacteria 3857
380 Ga0373954_0003435 3300035118 Bacteria 6717
381 Ga0373954_0017819 3300035118 Bacteria 3193
382 Ga0373954_0221043 3300035118 Bacteria 932
383 Ga0373954_0285819 3300035118 Bacteria 813
384 Ga0373960_0001739 3300035121 Bacteria 4877
385 Ga0373960_0051947 3300035121 Bacteria 1219
386 Ga0373943_0103227 3300035170 Bacteria 1494
387 Ga0373943_0179917 3300035170 Bacteria 1162
388 Ga0373946_0000442 3300035171 Bacteria 13617
389 Ga0373946_0047787 3300035171 Bacteria 1778
390 Ga0373955_0005573 3300035172 Bacteria 5660
391 Ga0373942_0083265 3300035207 Bacteria 953
392 Ga0373961_0054789 3300035241 Unclassified 1193
393 Ga0316574_0018417 3300035398 Bacteria 4103
394 Ga0316574_0085714 3300035398 Bacteria 2004
395 Ga0373924_0000432 3300035410 Bacteria 12866
396 Ga0373924_0085533 3300035410 Bacteria 1345
397 Ga0373924_0214187 3300035410 Bacteria 850
398 Ga0373924_0231023 3300035410 Bacteria 818
399 Ga0373931_0224265 3300035691 Bacteria 1133
400 Ga0373935_0000370 3300035692 Bacteria 23018
401 Ga0373935_0077822 3300035692 Bacteria 2150
402 Ga0373935_0133751 3300035692 Bacteria 1669
403 Ga0373927_0277319 3300035695 Bacteria 1103
404 Ga0373933_0004813 3300035724 Bacteria 7379
405 Ga0373933_0026832 3300035724 Bacteria 3311
406 Ga0373933_0110412 3300035724 Bacteria 1715
407 Ga0373933_0118762 3300035724 Bacteria 1655
408 Ga0373947_0000476 3300035725 Bacteria 22980
409 Ga0373947_0194922 3300035725 Bacteria 1323
410 Ga0373937_0000009 3300036401 Bacteria 169521
411 Ga0373937_0005182 3300036401 Bacteria 11122
412 Ga0373937_0036036 3300036401 Bacteria 4507
413 Ga0373937_0235830 3300036401 Bacteria 1723
414 Ga0373937_0313292 3300036401 Bacteria 1484
415 Ga0373937_0820526 3300036401 Bacteria 878
416 Ga0316582_0000071 3300036647 Bacteria 25766
417 Ga0316582_0049554 3300036647 Bacteria 2657
418 Ga0316582_0150545 3300036647 Bacteria 1573
419 Ga0316584_0000431 3300036712 Bacteria 21725
420 Ga0316584_0003128 3300036712 Bacteria 10698
421 Ga0316584_0039055 3300036712 Bacteria 3533
422 Ga0316584_0049428 3300036712 Bacteria 3143
423 Ga0373925_0000194 3300037068 Bacteria 66124
424 Ga0373925_0181292 3300037068 Bacteria 1667
425 Ga0373925_0223044 3300037068 Bacteria 1505
426 Ga0395899_0000039 3300037312 Bacteria 269620
427 Ga0395900_0161766 3300037418 Bacteria 2283
428 Ga0395900_0695846 3300037418 Bacteria 950
429 Ga0395898_0000051 3300037466 Bacteria 281872
430 Ga0395898_0190092 3300037466 Bacteria 1962
431 Ga0395898_0582130 3300037466 Bacteria 1062
432 Ga0395905_0021914 3300037471 Bacteria 6043
433 Ga0395905_0285138 3300037471 Bacteria 1538
434 Ga0316581_0008892 3300037588 Bacteria 2747
435 Ga0436364_0005137 3300037853 Bacteria 1519
436 Ga0436364_0478958 3300037853 Bacteria 2468
437 Ga0436364_0719253 3300037853 Bacteria 1680
438 Ga0395901_0026797 3300038443 Bacteria 5918
439 Ga0400485_22206 3300038735 Bacteria 1467
440 Ga0242420_001000 3300038996 Unclassified 3580
441 Ga0400487_54806 3300039110 Bacteria 2264
442 Ga0436365_0147248 3300039437 Bacteria 3410
443 Ga0436365_0353660 3300039437 Bacteria 3442
444 Ga0436365_0509139 3300039437 Bacteria 998
445 Ga0436365_0922321 3300039437 Bacteria 2721
446 Ga0436365_1460405 3300039437 Bacteria 2566
447 Ga0436365_1838315 3300039437 Bacteria 8288
448 Ga0436360_1121536 3300039438 Bacteria 946
449 Ga0436360_1138920 3300039438 Bacteria 6564
450 Ga0436360_1198600 3300039438 Bacteria 938
451 Ga0436361_0090326 3300039447 Bacteria 1043
452 Ga0436361_0559050 3300039447 Bacteria 1447
453 Ga0436361_0926373 3300039447 Bacteria 19457
454 Ga0436361_0955955 3300039447 Bacteria 3659
455 Ga0436363_0506886 3300039450 Bacteria 958
456 Ga0436363_1720038 3300039450 Bacteria 946
457 Ga0436362_0261986 3300039453 Bacteria 1298
458 Ga0436362_0454622 3300039453 Bacteria 2360
459 Ga0436362_0578135 3300039453 Bacteria 1279
460 Ga0436362_0723249 3300039453 Bacteria 2034
461 Ga0436362_0899014 3300039453 Bacteria 870
462 Ga0439462_0021112 3300042015 Bacteria 1700
463 Ga0466965_0080054 3300044683 Bacteria 1651
464 Ga0466966_0163454 3300044684 Bacteria 1355
465 Ga0466963_0062019 3300044694 Bacteria 2501
466 Ga0466963_0138795 3300044694 Bacteria 1683
467 Ga0466963_0563093 3300044694 Bacteria 805
468 Ga0466971_0000088 3300044719 Bacteria 33636
469 Ga0466957_0046391 3300044842 Bacteria 2638
470 Ga0466959_0037942 3300045049 Bacteria 3561
471 Ga0451576_0000424 3300045051 Bacteria 97297
472 Ga0451576_0085164 3300045051 Bacteria 3288
473 Ga0451576_0498432 3300045051 Bacteria 1279
474 Ga0466967_0012356 3300045976 Bacteria 6527
475 Ga0466967_0073576 3300045976 Bacteria 3066
476 Ga0466967_0184790 3300045976 Bacteria 1968
477 Ga0466967_0925219 3300045976 Bacteria 867
478 Ga0495592_0000018 3300046454 Bacteria 140962
479 Ga0495603_0000898 3300046455 Bacteria 17131
480 Ga0495591_013627 3300046458 Bacteria 2962
481 Ga0495629_0000267 3300046459 Bacteria 45302
482 Ga0495629_0004511 3300046459 Bacteria 10415
483 Ga0495629_0275977 3300046459 Bacteria 1154
484 Ga0495638_0045888 3300046460 Bacteria 2747
485 Ga0495651_0001122 3300046462 Bacteria 20711
486 Ga0495653_0000032 3300046463 Bacteria 132763
487 Ga0495653_0132616 3300046463 Bacteria 1761
488 Ga0495650_0000523 3300046471 Bacteria 56288
489 Ga0495580_0006425 3300046472 Bacteria 9568
490 Ga0495580_0275798 3300046472 Bacteria 1148
491 Ga0495662_0023189 3300046476 Bacteria 2997
492 Ga0495664_0000010 3300046477 Bacteria 268381
493 Ga0495664_0025929 3300046477 Bacteria 3413
494 Ga0495584_0028056 3300046491 Bacteria 2851
495 Ga0495594_0378972 3300046499 Bacteria 805
496 Ga0495607_0298236 3300046501 Bacteria 759
497 Ga0495606_0067615 3300046507 Bacteria 2262
498 Ga0495606_0390781 3300046507 Bacteria 727
499 Ga0495608_0000008 3300046511 Bacteria 268629
500 Ga0495608_0247248 3300046511 Bacteria 1113
501 Ga0495618_0000002 3300046514 Bacteria 271353
502 Ga0495628_0000009 3300046516 Bacteria 237611
503 Ga0495630_0001850 3300046517 Bacteria 14780
504 Ga0495648_0005048 3300046524 Bacteria 11084
505 Ga0495642_0001548 3300046528 Bacteria 10151
506 Ga0495652_0000011 3300046529 Bacteria 255329
507 Ga0495654_0033722 3300046530 Bacteria 2589
508 Ga0495640_0000009 3300046533 Bacteria 217086
509 Ga0495640_0097433 3300046533 Bacteria 1934
510 Ga0495640_0153499 3300046533 Bacteria 1478
511 Ga0495587_0000006 3300046536 Bacteria 310070
512 Ga0495598_0064423 3300046537 Bacteria 1139
513 Ga0495598_0223097 3300046537 Bacteria 689
514 Ga0495621_0073283 3300046539 Bacteria 1265
515 Ga0495645_0000010 3300046543 Bacteria 238337
516 Ga0495645_0002332 3300046543 Bacteria 12884
517 Ga0495645_0128622 3300046543 Bacteria 1777
518 Ga0495667_0000005 3300046559 Bacteria 268252
519 Ga0495667_0023171 3300046559 Bacteria 4184
520 Ga0495634_0000223 3300046642 Bacteria 53103
521 Ga0495635_0000008 3300046663 Bacteria 268349
522 Ga0495635_0190932 3300046663 Bacteria 1391
523 Ga0495659_0043020 3300046664 Bacteria 1619
524 Ga0495657_0000058 3300046675 Bacteria 97827
525 Ga0495599_0000007 3300046678 Bacteria 236638
526 Ga0495599_0148253 3300046678 Bacteria 1454
527 Ga0495623_0005790 3300046679 Bacteria 8063
528 Ga0495623_0101578 3300046679 Bacteria 1752
529 Ga0495646_0000021 3300046680 Bacteria 115358
530 Ga0495647_0218731 3300046681 Bacteria 840
531 Ga0495658_0120777 3300046683 Bacteria 1585
532 Ga0495658_0263706 3300046683 Bacteria 1085
533 Ga0495669_0049667 3300046684 Bacteria 1879
534 Ga0495669_0114131 3300046684 Bacteria 1263
535 Ga0495669_0133609 3300046684 Bacteria 1169
536 Ga0495613_0292797 3300046689 Bacteria 1128
537 Ga0495624_0007573 3300046690 Bacteria 7619
538 Ga0495649_0051061 3300046694 Bacteria 2243
539 Ga0495649_0176326 3300046694 Bacteria 1117
540 Ga0495589_0091173 3300046794 Bacteria 1480
541 Ga0495600_0000001 3300046809 Bacteria 214870
542 Ga0495600_0267744 3300046809 Bacteria 1084
543 Ga0495581_0001676 3300047315 Bacteria 12341
544 Ga0495581_0005192 3300047315 Bacteria 7535
545 Ga0495581_0300992 3300047315 Bacteria 937
546 Ga0495604_0000012 3300047317 Bacteria 268341
547 Ga0495674_0000011 3300047319 Bacteria 270911
548 Ga0495674_0081998 3300047319 Bacteria 2766
549 Ga0495672_0174136 3300047320 Bacteria 1095
550 Ga0495676_0124674 3300047321 Bacteria 1868
551 Ga0495676_0709573 3300047321 Bacteria 650
552 Ga0495680_0001281 3300047322 Bacteria 27427
553 Ga0495680_0262945 3300047322 Bacteria 1220
554 Ga0495683_0028336 3300047323 Bacteria 2863
555 Ga0495687_004265 3300047443 Bacteria 9786
556 Ga0495675_0000096 3300047444 Bacteria 62617
557 Ga0495684_0000084 3300047471 Bacteria 65600
558 Ga0495686_0021343 3300047472 Bacteria 4303
559 Ga0495593_0000727 3300047673 Bacteria 19074
560 Ga0495593_0084241 3300047673 Bacteria 1641
561 Ga0495593_0271481 3300047673 Bacteria 849
562 Ga0495602_0000073 3300048088 Bacteria 98745
563 Ga0495602_0146322 3300048088 Bacteria 1864
564 Ga0495602_0251698 3300048088 Bacteria 1316
565 Ga0496100_0060233 3300048903 Bacteria 2498
566 Ga0496100_0066496 3300048903 Bacteria 2391
567 Ga0496100_0276526 3300048903 Bacteria 1250
568 Ga0496101_0004742 3300048904 Bacteria 8620
569 Ga0496101_0364872 3300048904 Bacteria 1136
570 Ga0496102_0015589 3300048905 Bacteria 6621
571 Ga0496102_0071229 3300048905 Bacteria 3192
572 Ga0496102_0607427 3300048905 Unclassified 1017
573 Ga0496103_0116176 3300048906 Bacteria 1702
574 Ga0496103_0366263 3300048906 Bacteria 926
575 Ga0496104_0070167 3300048907 Bacteria 3330
576 Ga0496104_0164835 3300048907 Unclassified 2125
577 Ga0496104_0241926 3300048907 Bacteria 1717
578 Ga0496104_0329160 3300048907 Unclassified 1441
579 Ga0496104_0504303 3300048907 Bacteria 1121
580 Ga0496105_0021445 3300048908 Bacteria 5227
581 Ga0496105_0094452 3300048908 Bacteria 2470
582 Ga0496105_0103494 3300048908 Bacteria 2351
583 Ga0496105_0122743 3300048908 Bacteria 2142
584 Ga0496105_0135221 3300048908 Bacteria 2031
585 Ga0496105_0167307 3300048908 Bacteria 1803
586 Ga0496105_0278486 3300048908 Bacteria 1349
587 Ga0496106_0088567 3300048909 Unclassified 2386
588 Ga0496106_0132600 3300048909 Bacteria 1954
589 Ga0496107_0022356 3300048910 Bacteria 4469
590 Ga0496107_0135397 3300048910 Bacteria 1820
591 Ga0496107_0138383 3300048910 Bacteria 1799
592 Ga0496107_0195253 3300048910 Bacteria 1504
593 Ga0496107_0279402 3300048910 Unclassified 1243
594 Ga0496108_0052495 3300048911 Unclassified 3417
595 Ga0496109_0071103 3300048912 Bacteria 3194
596 Ga0496109_0078965 3300048912 Bacteria 3031
597 Ga0496109_0152040 3300048912 Bacteria 2167
598 Ga0496109_0217645 3300048912 Unclassified 1796
599 Ga0496110_0039292 3300048913 Bacteria 4120
600 Ga0496110_0053471 3300048913 Bacteria 3550
601 Ga0496110_0124637 3300048913 Bacteria 2324
602 Ga0496110_0413320 3300048913 Bacteria 1230
603 Ga0496111_0070795 3300048914 Bacteria 2537
604 Ga0496112_0055415 3300048915 Bacteria 3898
605 Ga0496112_0074067 3300048915 Bacteria 3367
606 Ga0496112_0300527 3300048915 Bacteria 1550
607 Ga0496112_0328687 3300048915 Bacteria 1473
608 Ga0496112_0502964 3300048915 Bacteria 1147
609 Ga0496113_0019088 3300048916 Bacteria 4790
610 Ga0496113_0201809 3300048916 Unclassified 1581
611 Ga0496114_0000748 3300048917 Bacteria 24240
612 Ga0496114_0009701 3300048917 Bacteria 7647
613 Ga0496114_0021798 3300048917 Bacteria 5214
614 Ga0496114_1006043 3300048917 Bacteria 717
615 Ga0496115_0012871 3300048918 Bacteria 6308
616 Ga0496115_0050576 3300048918 Bacteria 3330
617 Ga0496115_0066506 3300048918 Bacteria 2913
618 Ga0496115_0070013 3300048918 Bacteria 2843
619 Ga0496115_0118606 3300048918 Bacteria 2176
620 Ga0496115_0522568 3300048918 Bacteria 951
621 Ga0496116_0011585 3300048919 Bacteria 7281
622 Ga0496116_0057432 3300048919 Bacteria 2544
623 Ga0496116_0089581 3300048919 Bacteria 1876
624 Ga0496117_0078347 3300048920 Bacteria 2182
625 Ga0496118_0027838 3300048921 Bacteria 4774
626 Ga0496119_0020352 3300048922 Bacteria 4845
627 Ga0496120_0056006 3300048923 Bacteria 2227
628 Ga0496124_0002688 3300048927 Bacteria 22761
629 Ga0496126_0036346 3300048929 Bacteria 4605
630 Ga0496126_0397263 3300048929 Bacteria 1119
631 Ga0501031_0001977 3300049568 Bacteria 12946
632 Ga0501032_0000037 3300049569 Bacteria 116729
633 Ga0501032_0103539 3300049569 Bacteria 1886
634 Ga0501032_0111022 3300049569 Bacteria 1814
635 Ga0501033_0000009 3300049570 Bacteria 272351
636 Ga0501033_0000033 3300049570 Bacteria 154380
637 Ga0501033_0000035 3300049570 Bacteria 150558
638 Ga0501033_0100386 3300049570 Bacteria 2112
639 Ga0501033_0291957 3300049570 Bacteria 1149
640 Ga0501036_0009934 3300049572 Bacteria 7836
641 Ga0501036_0022713 3300049572 Bacteria 5280
642 Ga0501036_0159439 3300049572 Bacteria 1902
643 Ga0501036_0425133 3300049572 Bacteria 1107
644 Ga0501037_0000010 3300049573 Bacteria 200115
645 Ga0501037_0246704 3300049573 Bacteria 1250
646 Ga0501038_0062993 3300049574 Bacteria 3167
647 Ga0501038_0078124 3300049574 Bacteria 2793
648 Ga0501038_0187359 3300049574 Bacteria 1667
649 Ga0501038_0317503 3300049574 Bacteria 1219
650 Ga0501039_0003180 3300049575 Bacteria 12285
651 Ga0501039_0007650 3300049575 Bacteria 8249
652 Ga0501039_0008462 3300049575 Bacteria 7842
653 Ga0501039_0008997 3300049575 Bacteria 7606
654 Ga0501040_0005873 3300049576 Bacteria 7947
655 Ga0501040_0021327 3300049576 Bacteria 4325
656 Ga0501040_0115411 3300049576 Bacteria 1880
657 Ga0501041_0047207 3300049577 Bacteria 2621
658 Ga0501041_0076877 3300049577 Bacteria 2053
659 Ga0501041_0086900 3300049577 Bacteria 1929
660 Ga0501041_0176310 3300049577 Bacteria 1338
661 Ga0501041_0243889 3300049577 Bacteria 1129
662 Ga0501041_0289474 3300049577 Bacteria 1031
663 Ga0501042_0011708 3300049578 Bacteria 5926
664 Ga0501042_0018160 3300049578 Bacteria 4867
665 Ga0501042_0030422 3300049578 Bacteria 3812
666 Ga0501042_0159446 3300049578 Bacteria 1627
667 Ga0501042_0244606 3300049578 Bacteria 1294
668 Ga0501043_0001434 3300049579 Bacteria 20831
669 Ga0501043_0019135 3300049579 Bacteria 5375
670 Ga0501043_0039313 3300049579 Bacteria 3718
671 Ga0501043_0151153 3300049579 Bacteria 1817
672 Ga0501046_0008688 3300049580 Bacteria 8830
673 Ga0501046_0020796 3300049580 Bacteria 5421
674 Ga0501046_0059045 3300049580 Bacteria 3006
675 Ga0501046_0075055 3300049580 Bacteria 2622
676 Ga0501046_0580858 3300049580 Bacteria 796
677 Ga0501047_0006514 3300049581 Bacteria 10993
678 Ga0501047_0017854 3300049581 Bacteria 6797
679 Ga0501047_0051345 3300049581 Bacteria 3984
680 Ga0501048_0018802 3300049582 Bacteria 5079
681 Ga0501048_0222972 3300049582 Bacteria 1337
682 Ga0501048_0318592 3300049582 Bacteria 1108
683 Ga0501048_0393826 3300049582 Bacteria 990
684 Ga0501048_0713230 3300049582 Bacteria 720
685 Ga0501067_0058219 3300049583 Bacteria 2140
686 Ga0501068_0030252 3300049584 Bacteria 3211
687 Ga0501068_0040092 3300049584 Bacteria 2810
688 Ga0501068_0073888 3300049584 Bacteria 2083
689 Ga0501069_0202191 3300049585 Bacteria 1151
690 Ga0501070_0003344 3300049586 Bacteria 13925
691 Ga0501070_0005558 3300049586 Bacteria 10748
692 Ga0501070_0139325 3300049586 Bacteria 2003
693 Ga0501071_0003846 3300049587 Bacteria 9449
694 Ga0501071_0017030 3300049587 Bacteria 5005
695 Ga0501071_0017383 3300049587 Bacteria 4959
696 Ga0501071_0086404 3300049587 Bacteria 2301
697 Ga0501071_0129942 3300049587 Bacteria 1870
698 Ga0501071_0157727 3300049587 Bacteria 1695
699 Ga0501071_0322941 3300049587 Bacteria 1172
700 Ga0501071_0731193 3300049587 Bacteria 762
701 Ga0501072_0004067 3300049588 Bacteria 11070
702 Ga0501072_0090378 3300049588 Bacteria 2431
703 Ga0501072_0115999 3300049588 Unclassified 2133
704 Ga0501072_0125644 3300049588 Bacteria 2044
705 Ga0501072_0362126 3300049588 Bacteria 1151
706 Ga0501072_0390172 3300049588 Bacteria 1105
707 Ga0501073_0101475 3300049589 Bacteria 1998
708 Ga0501073_0170652 3300049589 Bacteria 1506
709 Ga0501073_0255646 3300049589 Bacteria 1209
710 Ga0501073_0372046 3300049589 Bacteria 987
711 Ga0501073_0433137 3300049589 Bacteria 909
712 Ga0501074_0010115 3300049590 Bacteria 6849
713 Ga0501074_0017774 3300049590 Bacteria 5166
714 Ga0501074_0137400 3300049590 Bacteria 1748
715 Ga0501074_0169592 3300049590 Bacteria 1558
716 Ga0501074_0388222 3300049590 Bacteria 990
717 Ga0501075_0010712 3300049591 Bacteria 6454
718 Ga0501075_0014324 3300049591 Bacteria 5682
719 Ga0501075_0054465 3300049591 Bacteria 3009
720 Ga0501075_0236724 3300049591 Bacteria 1392
721 Ga0501075_0524695 3300049591 Bacteria 904
722 Ga0501075_1088318 3300049591 Bacteria 607
723 Ga0501076_0002360 3300049592 Bacteria 12914
724 Ga0501076_0021105 3300049592 Bacteria 4991
725 Ga0501076_0073873 3300049592 Bacteria 2730
726 Ga0501076_0152290 3300049592 Bacteria 1881
727 Ga0501076_0161597 3300049592 Bacteria 1825
728 Ga0501076_0182159 3300049592 Bacteria 1712
729 Ga0501076_0385911 3300049592 Bacteria 1151
730 Ga0501077_0007388 3300049593 Bacteria 6774
731 Ga0501077_0048340 3300049593 Bacteria 2702
732 Ga0501077_0075287 3300049593 Bacteria 2138
733 Ga0501077_0196569 3300049593 Bacteria 1281
734 Ga0501079_0000190 3300049741 Bacteria 35319
735 Ga0501079_0029206 3300049741 Bacteria 4232
736 Ga0501079_0067025 3300049741 Bacteria 2770
737 Ga0501079_0074440 3300049741 Bacteria 2625
738 Ga0501079_0183967 3300049741 Bacteria 1631
739 Ga0501079_0193116 3300049741 Bacteria 1589
740 Ga0501079_0936749 3300049741 Bacteria 682
741 Ga0501080_0009780 3300049742 Bacteria 8760
742 Ga0501080_0017029 3300049742 Bacteria 6711
743 Ga0501080_0025227 3300049742 Bacteria 5517
744 Ga0501080_0218814 3300049742 Bacteria 1743
745 Ga0501080_0223677 3300049742 Bacteria 1722
746 Ga0501080_0249725 3300049742 Bacteria 1618
747 Ga0501080_0544149 3300049742 Bacteria 1034
748 Ga0501080_0552407 3300049742 Bacteria 1026
749 Ga0501080_0601496 3300049742 Bacteria 976
750 Ga0501080_0628767 3300049742 Bacteria 951
751 Ga0501081_0005186 3300049743 Bacteria 8387
752 Ga0501081_0005502 3300049743 Bacteria 8178
753 Ga0501081_0029986 3300049743 Bacteria 3678
754 Ga0501081_0070752 3300049743 Bacteria 2431
755 Ga0501081_1176155 3300049743 Bacteria 581
756 Ga0501083_0063347 3300049744 Bacteria 2466
757 Ga0501083_0101988 3300049744 Bacteria 1892
758 Ga0501035_0000001 3300049822 Bacteria 1037138
759 Ga0501035_0000673 3300049822 Bacteria 37395
760 Ga0501035_0001302 3300049822 Bacteria 25776
761 Ga0501035_0033351 3300049822 Bacteria 4683
762 Ga0501035_0099657 3300049822 Bacteria 2550
763 Ga0501035_0107203 3300049822 Bacteria 2449
764 Ga0501035_0123607 3300049822 Bacteria 2260
765 Ga0501044_0000265 3300049823 Bacteria 66253
766 Ga0501044_0030532 3300049823 Bacteria 5679
767 Ga0501045_0005389 3300049824 Bacteria 8860
768 Ga0501045_0056113 3300049824 Bacteria 2880
769 Ga0501045_0067529 3300049824 Bacteria 2626
770 Ga0501045_0516795 3300049824 Bacteria 886
771 Ga0501045_0642655 3300049824 Bacteria 784
772 nmdc:mga03683_43481_c1 3300050489 Bacteria 1853
773 nmdc:mga0yw44_113804_c1 3300050492 Bacteria 1736
774 nmdc:mga06z11_83736_c1 3300050494 Bacteria 1717
775 nmdc:mga05p37_206978_c1 3300050507 Bacteria 2373
776 nmdc:mga05p37_213433_c1 3300050507 Bacteria 2332
777 nmdc:mga05p37_340096_c1 3300050507 Bacteria 1770
778 nmdc:mga05p37_548824_c1 3300050507 Bacteria 1316
779 nmdc:mga05p37_585247_c1 3300050507 Bacteria 1263
780 nmdc:mga05p37_99731_c1 3300050507 Bacteria 3577
781 nmdc:mga09592_117745_c1 3300050508 Unclassified 2280
782 nmdc:mga09592_238070_c2 3300050508 Bacteria 1162
783 nmdc:mga09592_359167_c1 3300050508 Bacteria 1261
784 nmdc:mga09592_43414_c1 3300050508 Bacteria 3785
785 nmdc:mga09592_559079_c1 3300050508 Bacteria 982
786 nmdc:mga0qj67_388795_c1 3300050509 Bacteria 1126
787 nmdc:mga0qj67_41272_c1 3300050509 Bacteria 3629
788 nmdc:mga0qj67_644565_c1 3300050509 Bacteria 845
789 nmdc:mga06r32_15205_c1 3300050510 Bacteria 6992
790 nmdc:mga06r32_234862_c1 3300050510 Bacteria 1821
791 nmdc:mga06r32_501012_c1 3300050510 Bacteria 1191
792 nmdc:mga06r32_704262_c1 3300050510 Bacteria 975
793 nmdc:mga06r32_73952_c1 3300050510 Bacteria 3302
794 nmdc:mga08y16_170731_c1 3300050511 Bacteria 2259
795 nmdc:mga08y16_294141_c1 3300050511 Bacteria 1674
796 nmdc:mga08y16_564519_c1 3300050511 Bacteria 1150
797 nmdc:mga0n895_248016_c1 3300050512 Bacteria 1807
798 nmdc:mga0n895_290751_c1 3300050512 Bacteria 1657
799 nmdc:mga0n895_51441_c1 3300050512 Unclassified 4041
800 nmdc:mga0n895_98971_c1 3300050512 Bacteria 2924
801 nmdc:mga0rr50_134203_c1 3300050513 Bacteria 1985
802 nmdc:mga0rr50_280737_c1 3300050513 Bacteria 1390
803 nmdc:mga0rr50_309136_c1 3300050513 Bacteria 1323
804 nmdc:mga08x19_364697_c1 3300050514 Bacteria 1010
805 nmdc:mga0a205_243391_c1 3300050515 Bacteria 1680
806 nmdc:mga0a205_391033_c1 3300050515 Bacteria 1255
807 nmdc:mga0a205_59905_c1 3300050515 Bacteria 3677
808 nmdc:mga0sz30_51245_c1 3300050516 Bacteria 1750
809 nmdc:mga0sz30_68008_c1 3300050516 Bacteria 1530
810 Ga0495601_0000009 3300053077 Bacteria 270622
811 Ga0495612_0000019 3300053078 Bacteria 137844
812 Ga0495595_0000015 3300053084 Bacteria 144946
813 Ga0495595_0115197 3300053084 Bacteria 1306
814 Ga0495619_0000012 3300053085 Bacteria 268349
815 Ga0500578_0362254 3300053086 Bacteria 845
816 Ga0500646_0014187 3300053090 Bacteria 2067
817 Ga0500647_0067774 3300053091 Bacteria 1716
818 Ga0500566_0004593 3300053094 Bacteria 8226
819 Ga0500566_0015609 3300053094 Bacteria 4457
820 Ga0500640_013143 3300053095 Bacteria 3417
821 Ga0500554_012328 3300053102 Bacteria 2146
822 Ga0500554_045955 3300053102 Bacteria 1358
823 Ga0500572_017152 3300053111 Bacteria 1857
824 Ga0500595_000342 3300053119 Bacteria 30337
825 Ga0500597_051077 3300053120 Bacteria 1762
826 Ga0500614_001237 3300053123 Bacteria 6218
827 Ga0500614_004035 3300053123 Bacteria 3124
828 Ga0500642_0033444 3300053130 Bacteria 2166
829 Ga0500559_0224523 3300053136 Bacteria 885
830 Ga0500568_0000017 3300053139 Bacteria 197578
831 Ga0500585_159549 3300053144 Bacteria 781
832 Ga0500637_0147845 3300053178 Bacteria 1358
833 Ga0500637_0163811 3300053178 Bacteria 1281
834 Ga0500601_003451 3300053737 Bacteria 1714
835 Ga0501084_0001245 3300054114 Bacteria 20042
836 Ga0501084_0054589 3300054114 Bacteria 3342
837 Ga0501084_0106430 3300054114 Bacteria 2356
838 Ga0501084_0111453 3300054114 Bacteria 2300
839 Ga0501084_0451798 3300054114 Bacteria 1086
840 Ga0590075_050800 3300059424 Unclassified 1064
841 Ga0587093_001174 3300059478 Bacteria 2132
842 Ga0587077_010762 3300059493 Bacteria 1423
843 Ga0587080_047620 3300059503 Bacteria 800
844 Ga0587082_003109 3300059504 Bacteria 1959
845 Ga0587085_001870 3300059506 Bacteria 2052
846 Ga0587094_004307 3300059513 Bacteria 1610
847 Ga0587101_007846 3300059623 Bacteria 1273
848 Ga0587109_014559 3300059624 Bacteria 1322
849 Ga0587128_008311 3300059630 Bacteria 1339
850 Ga0587068_031971 3300059641 Bacteria 917
851 Ga0587072_004675 3300059643 Bacteria 2006
852 Ga0587075_002440 3300059644 Bacteria 1962
853 Ga0587079_008668 3300059647 Bacteria 1561
854 Ga0501082_0002352 3300060353 Bacteria 16554
855 Ga0501082_0017960 3300060353 Bacteria 6092
856 Ga0501082_0022848 3300060353 Bacteria 5387
857 Ga0501082_0105590 3300060353 Bacteria 2437
858 Ga0501082_0686359 3300060353 Bacteria 896
859 Ga0501082_0715364 3300060353 Bacteria 876
860 Ga0501082_1320116 3300060353 Bacteria 630
861 Ga0466962_0000164 3300061719 Bacteria 28308
862 Ga0530510_0009460 3300061734 Bacteria 6832
863 Ga0530510_0012374 3300061734 Bacteria 5994
864 Ga0530510_0014900 3300061734 Bacteria 5490
865 Ga0530510_0034117 3300061734 Bacteria 3665
866 Ga0530510_0125742 3300061734 Bacteria 1884
867 Ga0530510_0268662 3300061734 Bacteria 1273
868 Ga0530510_0694547 3300061734 Bacteria 775

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300039450 Ga0436363_1720038 Ga0436363_1720038_11_616 172
2 3300005366 Ga0070659_100078713 Ga0070659_1000787133 177
3 3300049741 Ga0501079_0936749 Ga0501079_0936749_84_620 177
4 3300049743 Ga0501081_1176155 Ga0501081_1176155_11_547 177
5 3300049591 Ga0501075_1088318 Ga0501075_1088318_50_589 178
6 3300059424 Ga0590075_050800 Ga0590075_050800_279_860 179
7 3300049590 Ga0501074_0388222 Ga0501074_0388222_369_914 181
8 3300025949 Ga0207667_10205285 Ga0207667_102052853 184
9 3300009147 Ga0114129_10252066 Ga0114129_102520663 185
10 3300050507 nmdc:mga05p37_213433_c1 nmdc:mga05p37_213433_c1_1280_1840 185
11 3300050510 nmdc:mga06r32_15205_c1 nmdc:mga06r32_15205_c1_10_570 185
12 3300049744 Ga0501083_0101988 Ga0501083_0101988_780_1406 186
13 3300050508 nmdc:mga09592_559079_c1 nmdc:mga09592_559079_c1_71_730 186
14 3300005548 Ga0070665_100000911 Ga0070665_10000091131 187
15 3300005614 Ga0068856_100671704 Ga0068856_1006717042 187
16 3300007076 Ga0075435_100595407 Ga0075435_1005954071 187
17 3300013105 Ga0157369_10931309 Ga0157369_109313092 187
18 3300028379 Ga0268266_10125643 Ga0268266_101256435 187
19 3300039437 Ga0436365_0353660 Ga0436365_0353660_1458_2102 187
20 3300045049 Ga0466959_0037942 Ga0466959_0037942_21_650 187
21 3300045976 Ga0466967_0073576 Ga0466967_0073576_1845_2423 187
22 3300009093 Ga0105240_10008535 Ga0105240_100085356 188
23 3300009545 Ga0105237_10124272 Ga0105237_101242724 188
24 3300013104 Ga0157370_10249531 Ga0157370_102495312 188
25 3300026067 Ga0207678_10157997 Ga0207678_101579972 188
26 3300027552 Ga0209982_1007401 Ga0209982_10074012 188
27 3300035695 Ga0373927_0277319 Ga0373927_0277319_424_1089 188
28 3300035724 Ga0373933_0118762 Ga0373933_0118762_537_1202 188
29 3300049587 Ga0501071_0731193 Ga0501071_0731193_64_687 188
30 3300049742 Ga0501080_0552407 Ga0501080_0552407_59_682 188
31 3300053086 Ga0500578_0362254 Ga0500578_0362254_82_771 188
32 3300005329 Ga0070683_100140008 Ga0070683_1001400083 189
33 3300005535 Ga0070684_100274784 Ga0070684_1002747842 189
34 3300005937 Ga0081455_10000576 Ga0081455_1000057649 189
35 3300005937 Ga0081455_10007956 Ga0081455_100079564 189
36 3300005937 Ga0081455_10024833 Ga0081455_100248335 189
37 3300005937 Ga0081455_10272684 Ga0081455_102726842 189
38 3300005981 Ga0081538_10005426 Ga0081538_1000542610 189
39 3300006028 Ga0070717_10325927 Ga0070717_103259272 189
40 3300006058 Ga0075432_10088120 Ga0075432_100881202 189
41 3300006358 Ga0068871_100073481 Ga0068871_1000734815 189
42 3300006846 Ga0075430_100108107 Ga0075430_1001081073 189
43 3300006846 Ga0075430_100129196 Ga0075430_1001291962 189
44 3300007265 Ga0099794_10023217 Ga0099794_100232172 189
45 3300009094 Ga0111539_10358644 Ga0111539_103586442 189
46 3300013104 Ga0157370_10023883 Ga0157370_100238834 189
47 3300020075 Ga0206349_1455224 Ga0206349_14552243 189
48 3300020076 Ga0206355_1420413 Ga0206355_14204132 189
49 3300020080 Ga0206350_11309462 Ga0206350_113094623 189
50 3300020081 Ga0206354_11227028 Ga0206354_112270282 189
51 3300020082 Ga0206353_11257201 Ga0206353_112572012 189
52 3300020610 Ga0154015_1016679 Ga0154015_10166792 189
53 3300022467 Ga0224712_10021149 Ga0224712_100211492 189
54 3300026023 Ga0207677_10105217 Ga0207677_101052172 189
55 3300026121 Ga0207683_10196666 Ga0207683_101966662 189
56 3300027907 Ga0207428_10197180 Ga0207428_101971803 189
57 3300035207 Ga0373942_0083265 Ga0373942_0083265_270_899 189
58 3300035398 Ga0316574_0018417 Ga0316574_0018417_2565_3245 189
59 3300035410 Ga0373924_0231023 Ga0373924_0231023_49_708 189
60 3300036647 Ga0316582_0049554 Ga0316582_0049554_1400_2080 189
61 3300036712 Ga0316584_0049428 Ga0316584_0049428_1498_2178 189
62 3300050508 nmdc:mga09592_359167_c1 nmdc:mga09592_359167_c1_204_845 189
63 3300050509 nmdc:mga0qj67_41272_c1 nmdc:mga0qj67_41272_c1_2399_3040 189
64 3300050511 nmdc:mga08y16_294141_c1 nmdc:mga08y16_294141_c1_390_1019 189
65 3300005290 Ga0065712_10146685 Ga0065712_101466851 190
66 3300005330 Ga0070690_100081269 Ga0070690_1000812692 190
67 3300005337 Ga0070682_100039367 Ga0070682_1000393673 190
68 3300005347 Ga0070668_100870229 Ga0070668_1008702292 190
69 3300005356 Ga0070674_100328111 Ga0070674_1003281112 190
70 3300005436 Ga0070713_100090161 Ga0070713_1000901611 190
71 3300005436 Ga0070713_100585871 Ga0070713_1005858711 190
72 3300005437 Ga0070710_10019648 Ga0070710_100196482 190
73 3300005439 Ga0070711_100356692 Ga0070711_1003566922 190
74 3300005456 Ga0070678_100001861 Ga0070678_1000018619 190
75 3300005471 Ga0070698_100201851 Ga0070698_1002018513 190
76 3300005471 Ga0070698_100381059 Ga0070698_1003810591 190
77 3300005545 Ga0070695_100101329 Ga0070695_1001013292 190
78 3300005718 Ga0068866_10016696 Ga0068866_100166962 190
79 3300005843 Ga0068860_100190436 Ga0068860_1001904364 190
80 3300005983 Ga0081540_1039841 Ga0081540_10398412 190
81 3300006163 Ga0070715_10227383 Ga0070715_102273832 190
82 3300006173 Ga0070716_100035211 Ga0070716_1000352113 190
83 3300006237 Ga0097621_100328786 Ga0097621_1003287862 190
84 3300006358 Ga0068871_100022845 Ga0068871_1000228453 190
85 3300006846 Ga0075430_100099668 Ga0075430_1000996683 190
86 3300006871 Ga0075434_100112903 Ga0075434_1001129032 190
87 3300006881 Ga0068865_100018974 Ga0068865_1000189745 190
88 3300009098 Ga0105245_10223690 Ga0105245_102236903 190
89 3300009176 Ga0105242_10054783 Ga0105242_100547833 190
90 3300009177 Ga0105248_10183414 Ga0105248_101834142 190
91 3300013297 Ga0157378_10008927 Ga0157378_100089273 190
92 3300014326 Ga0157380_10070577 Ga0157380_100705773 190
93 3300021388 Ga0213875_10000012 Ga0213875_10000012245 190
94 3300021388 Ga0213875_10195428 Ga0213875_101954282 190
95 3300025898 Ga0207692_10010022 Ga0207692_100100224 190
96 3300025900 Ga0207710_10042272 Ga0207710_100422723 190
97 3300025903 Ga0207680_10044877 Ga0207680_100448773 190
98 3300025905 Ga0207685_10067805 Ga0207685_100678053 190
99 3300025929 Ga0207664_10002993 Ga0207664_100029939 190
100 3300025935 Ga0207709_10048761 Ga0207709_100487613 190
101 3300025938 Ga0207704_10005581 Ga0207704_100055818 190
102 3300026121 Ga0207683_10009395 Ga0207683_100093952 190
103 3300035121 Ga0373960_0001739 Ga0373960_0001739_51_665 190
104 3300035725 Ga0373947_0194922 Ga0373947_0194922_116_802 190
105 3300036401 Ga0373937_0005182 Ga0373937_0005182_93_671 190
106 3300037068 Ga0373925_0223044 Ga0373925_0223044_281_967 190
107 3300037466 Ga0395898_0582130 Ga0395898_0582130_109_714 190
108 3300037471 Ga0395905_0021914 Ga0395905_0021914_4000_4617 190
109 3300037471 Ga0395905_0285138 Ga0395905_0285138_225_842 190
110 3300039447 Ga0436361_0955955 Ga0436361_0955955_885_1475 190
111 3300039453 Ga0436362_0261986 Ga0436362_0261986_676_1251 190
112 3300044684 Ga0466966_0163454 Ga0466966_0163454_189_878 190
113 3300044694 Ga0466963_0138795 Ga0466963_0138795_469_1158 190
114 3300044842 Ga0466957_0046391 Ga0466957_0046391_329_1018 190
115 3300046528 Ga0495642_0001548 Ga0495642_0001548_4748_5377 190
116 3300046533 Ga0495640_0153499 Ga0495640_0153499_812_1390 190
117 3300046537 Ga0495598_0223097 Ga0495598_0223097_22_666 190
118 3300047321 Ga0495676_0709573 Ga0495676_0709573_37_615 190
119 3300048904 Ga0496101_0004742 Ga0496101_0004742_6631_7275 190
120 3300048905 Ga0496102_0015589 Ga0496102_0015589_1275_1919 190
121 3300048906 Ga0496103_0116176 Ga0496103_0116176_611_1255 190
122 3300048908 Ga0496105_0021445 Ga0496105_0021445_2842_3486 190
123 3300048908 Ga0496105_0122743 Ga0496105_0122743_13_711 190
124 3300048910 Ga0496107_0138383 Ga0496107_0138383_437_1081 190
125 3300048912 Ga0496109_0152040 Ga0496109_0152040_616_1266 190
126 3300048915 Ga0496112_0328687 Ga0496112_0328687_568_1185 190
127 3300048917 Ga0496114_0009701 Ga0496114_0009701_6388_7032 190
128 3300048918 Ga0496115_0070013 Ga0496115_0070013_37_681 190
129 3300048918 Ga0496115_0522568 Ga0496115_0522568_27_716 190
130 3300049569 Ga0501032_0111022 Ga0501032_0111022_42_725 190
131 3300049570 Ga0501033_0100386 Ga0501033_0100386_1447_2070 190
132 3300049572 Ga0501036_0159439 Ga0501036_0159439_176_799 190
133 3300049574 Ga0501038_0062993 Ga0501038_0062993_1011_1634 190
134 3300049575 Ga0501039_0008997 Ga0501039_0008997_1301_1924 190
135 3300049576 Ga0501040_0005873 Ga0501040_0005873_5665_6288 190
136 3300049577 Ga0501041_0076877 Ga0501041_0076877_197_820 190
137 3300049578 Ga0501042_0011708 Ga0501042_0011708_1522_2145 190
138 3300049579 Ga0501043_0019135 Ga0501043_0019135_3213_3836 190
139 3300049580 Ga0501046_0008688 Ga0501046_0008688_5272_5895 190
140 3300049584 Ga0501068_0040092 Ga0501068_0040092_775_1398 190
141 3300049585 Ga0501069_0202191 Ga0501069_0202191_27_602 190
142 3300049587 Ga0501071_0003846 Ga0501071_0003846_7407_8030 190
143 3300049588 Ga0501072_0004067 Ga0501072_0004067_5292_5915 190
144 3300049588 Ga0501072_0115999 Ga0501072_0115999_1240_1863 190
145 3300049589 Ga0501073_0101475 Ga0501073_0101475_125_748 190
146 3300049590 Ga0501074_0017774 Ga0501074_0017774_3627_4250 190
147 3300049592 Ga0501076_0002360 Ga0501076_0002360_3146_3769 190
148 3300049593 Ga0501077_0007388 Ga0501077_0007388_4812_5435 190
149 3300049741 Ga0501079_0000190 Ga0501079_0000190_33197_33820 190
150 3300049742 Ga0501080_0017029 Ga0501080_0017029_5145_5768 190
151 3300049743 Ga0501081_0005502 Ga0501081_0005502_3134_3757 190
152 3300049822 Ga0501035_0123607 Ga0501035_0123607_963_1586 190
153 3300049824 Ga0501045_0005389 Ga0501045_0005389_4835_5458 190
154 3300050508 nmdc:mga09592_238070_c2 nmdc:mga09592_238070_c2_573_1151 190
155 3300050510 nmdc:mga06r32_234862_c1 nmdc:mga06r32_234862_c1_657_1289 190
156 3300053139 Ga0500568_0000017 Ga0500568_0000017_1742_2485 190
157 3300054114 Ga0501084_0001245 Ga0501084_0001245_5229_5852 190
158 3300060353 Ga0501082_0017960 Ga0501082_0017960_198_821 190
159 3300060353 Ga0501082_1320116 Ga0501082_1320116_14_589 190
160 3300061734 Ga0530510_0014900 Ga0530510_0014900_1540_2163 190
161 3300004798 Ga0058859_10042072 Ga0058859_100420722 191
162 3300004799 Ga0058863_10089197 Ga0058863_100891972 191
163 3300004800 Ga0058861_10086667 Ga0058861_100866673 191
164 3300004801 Ga0058860_10046890 Ga0058860_100468902 191
165 3300004803 Ga0058862_10192943 Ga0058862_101929432 191
166 3300005337 Ga0070682_100026267 Ga0070682_1000262673 191
167 3300005338 Ga0068868_100097817 Ga0068868_1000978172 191
168 3300005341 Ga0070691_10056432 Ga0070691_100564322 191
169 3300005434 Ga0070709_10042260 Ga0070709_100422602 191
170 3300005444 Ga0070694_100224035 Ga0070694_1002240351 191
171 3300005456 Ga0070678_100167666 Ga0070678_1001676663 191
172 3300005536 Ga0070697_100036169 Ga0070697_1000361695 191
173 3300013104 Ga0157370_10007661 Ga0157370_100076618 191
174 3300013296 Ga0157374_10225964 Ga0157374_102259642 191
175 3300013307 Ga0157372_10496740 Ga0157372_104967402 191
176 3300014969 Ga0157376_10791917 Ga0157376_107919172 191
177 3300020069 Ga0197907_10778953 Ga0197907_107789533 191
178 3300020070 Ga0206356_10484009 Ga0206356_104840092 191
179 3300020077 Ga0206351_10982550 Ga0206351_109825502 191
180 3300020078 Ga0206352_10093453 Ga0206352_100934533 191
181 3300025906 Ga0207699_10170550 Ga0207699_101705502 191
182 3300025916 Ga0207663_10358616 Ga0207663_103586162 191
183 3300025916 Ga0207663_10465404 Ga0207663_104654042 191
184 3300025944 Ga0207661_10488745 Ga0207661_104887452 191
185 3300026089 Ga0207648_10237341 Ga0207648_102373412 191
186 3300028800 Ga0265338_10267897 Ga0265338_102678972 191
187 3300035112 Ga0373932_0110822 Ga0373932_0110822_177_803 191
188 3300036647 Ga0316582_0150545 Ga0316582_0150545_38_712 191
189 3300036712 Ga0316584_0039055 Ga0316584_0039055_1686_2360 191
190 3300038996 Ga0242420_001000 Ga0242420_001000_1263_1958 191
191 3300039110 Ga0400487_54806 Ga0400487_54806_65_736 191
192 3300039450 Ga0436363_0506886 Ga0436363_0506886_132_752 191
193 3300045051 Ga0451576_0085164 Ga0451576_0085164_1229_1819 191
194 3300046537 Ga0495598_0064423 Ga0495598_0064423_57_716 191
195 3300048905 Ga0496102_0607427 Ga0496102_0607427_31_726 191
196 3300048907 Ga0496104_0329160 Ga0496104_0329160_219_914 191
197 3300048909 Ga0496106_0088567 Ga0496106_0088567_236_931 191
198 3300048910 Ga0496107_0279402 Ga0496107_0279402_114_809 191
199 3300048911 Ga0496108_0052495 Ga0496108_0052495_226_921 191
200 3300048912 Ga0496109_0217645 Ga0496109_0217645_625_1320 191
201 3300048916 Ga0496113_0201809 Ga0496113_0201809_728_1423 191
202 3300049577 Ga0501041_0176310 Ga0501041_0176310_562_1179 191
203 3300049587 Ga0501071_0322941 Ga0501071_0322941_497_1114 191
204 3300049589 Ga0501073_0433137 Ga0501073_0433137_279_896 191
205 3300049742 Ga0501080_0223677 Ga0501080_0223677_967_1584 191
206 3300059478 Ga0587093_001174 Ga0587093_001174_831_1526 191
207 3300059493 Ga0587077_010762 Ga0587077_010762_71_766 191
208 3300059503 Ga0587080_047620 Ga0587080_047620_73_768 191
209 3300059504 Ga0587082_003109 Ga0587082_003109_360_1055 191
210 3300059506 Ga0587085_001870 Ga0587085_001870_636_1331 191
211 3300059513 Ga0587094_004307 Ga0587094_004307_755_1450 191
212 3300059623 Ga0587101_007846 Ga0587101_007846_28_723 191
213 3300059624 Ga0587109_014559 Ga0587109_014559_21_716 191
214 3300059630 Ga0587128_008311 Ga0587128_008311_89_784 191
215 3300059641 Ga0587068_031971 Ga0587068_031971_200_895 191
216 3300059643 Ga0587072_004675 Ga0587072_004675_407_1102 191
217 3300059644 Ga0587075_002440 Ga0587075_002440_363_1058 191
218 3300059647 Ga0587079_008668 Ga0587079_008668_276_971 191
219 3300005578 Ga0068854_100127206 Ga0068854_1001272063 192
220 3300006844 Ga0075428_100081343 Ga0075428_1000813433 192
221 3300009093 Ga0105240_10437721 Ga0105240_104377213 192
222 3300009147 Ga0114129_10275304 Ga0114129_102753042 192
223 3300009545 Ga0105237_10002242 Ga0105237_1000224213 192
224 3300021441 Ga0213871_10012123 Ga0213871_100121232 192
225 3300025914 Ga0207671_10002514 Ga0207671_100025144 192
226 3300025981 Ga0207640_10012155 Ga0207640_100121555 192
227 3300031727 Ga0316576_10023850 Ga0316576_100238504 192
228 3300031728 Ga0316578_10013443 Ga0316578_100134434 192
229 3300035171 Ga0373946_0047787 Ga0373946_0047787_414_1022 192
230 3300039438 Ga0436360_1138920 Ga0436360_1138920_3981_4715 192
231 3300039447 Ga0436361_0559050 Ga0436361_0559050_680_1432 192
232 3300045051 Ga0451576_0000424 Ga0451576_0000424_36280_37002 192
233 3300046663 Ga0495635_0190932 Ga0495635_0190932_442_1125 192
234 3300046684 Ga0495669_0049667 Ga0495669_0049667_206_886 192
235 3300047321 Ga0495676_0124674 Ga0495676_0124674_659_1267 192
236 3300049568 Ga0501031_0001977 Ga0501031_0001977_9746_10504 192
237 3300049569 Ga0501032_0000037 Ga0501032_0000037_113304_114068 192
238 3300049570 Ga0501033_0000009 Ga0501033_0000009_158571_159335 192
239 3300049570 Ga0501033_0000033 Ga0501033_0000033_123416_124180 192
240 3300049574 Ga0501038_0078124 Ga0501038_0078124_1811_2575 192
241 3300049575 Ga0501039_0003180 Ga0501039_0003180_5450_6208 192
242 3300049579 Ga0501043_0001434 Ga0501043_0001434_11380_12138 192
243 3300049581 Ga0501047_0006514 Ga0501047_0006514_3186_3944 192
244 3300049586 Ga0501070_0005558 Ga0501070_0005558_1350_2108 192
245 3300049587 Ga0501071_0157727 Ga0501071_0157727_684_1442 192
246 3300049822 Ga0501035_0000001 Ga0501035_0000001_724707_725465 192
247 3300050507 nmdc:mga05p37_340096_c1 nmdc:mga05p37_340096_c1_871_1512 192
248 3300050510 nmdc:mga06r32_704262_c1 nmdc:mga06r32_704262_c1_185_826 192
249 3300005293 Ga0065715_10299140 Ga0065715_102991402 193
250 3300005336 Ga0070680_100476832 Ga0070680_1004768322 193
251 3300005467 Ga0070706_100549273 Ga0070706_1005492731 193
252 3300005471 Ga0070698_100106932 Ga0070698_1001069322 193
253 3300006844 Ga0075428_100049297 Ga0075428_1000492974 193
254 3300006847 Ga0075431_100105654 Ga0075431_1001056543 193
255 3300006871 Ga0075434_100018856 Ga0075434_1000188563 193
256 3300006880 Ga0075429_100017880 Ga0075429_1000178805 193
257 3300009177 Ga0105248_11298418 Ga0105248_112984181 193
258 3300025922 Ga0207646_10189678 Ga0207646_101896782 193
259 3300025929 Ga0207664_10086116 Ga0207664_100861162 193
260 3300027665 Ga0209983_1011064 Ga0209983_10110643 193
261 3300027876 Ga0209974_10000995 Ga0209974_100009955 193
262 3300028556 Ga0265337_1003286 Ga0265337_10032863 193
263 3300030878 Ga0265770_1006705 Ga0265770_10067053 193
264 3300037068 Ga0373925_0181292 Ga0373925_0181292_1024_1653 193
265 3300044719 Ga0466971_0000088 Ga0466971_0000088_29513_30277 193
266 3300047315 Ga0495581_0300992 Ga0495581_0300992_100_729 193
267 3300048920 Ga0496117_0078347 Ga0496117_0078347_220_921 193
268 3300048921 Ga0496118_0027838 Ga0496118_0027838_3094_3795 193
269 3300050512 nmdc:mga0n895_51441_c1 nmdc:mga0n895_51441_c1_19_738 193
270 3300061719 Ga0466962_0000164 Ga0466962_0000164_22451_23215 193
271 3300061734 Ga0530510_0012374 Ga0530510_0012374_336_944 193
272 3300002067 JGI24735J21928_10000853 JGI24735J21928_100008536 194
273 3300005339 Ga0070660_100124200 Ga0070660_1001242003 194
274 3300005355 Ga0070671_100179390 Ga0070671_1001793902 194
275 3300005444 Ga0070694_100007379 Ga0070694_1000073792 194
276 3300005539 Ga0068853_100036380 Ga0068853_1000363801 194
277 3300005545 Ga0070695_100609462 Ga0070695_1006094622 194
278 3300005618 Ga0068864_100080216 Ga0068864_1000802163 194
279 3300005841 Ga0068863_100097500 Ga0068863_1000975004 194
280 3300005937 Ga0081455_10000567 Ga0081455_100005674 194
281 3300006186 Ga0075369_10103053 Ga0075369_101030531 194
282 3300009093 Ga0105240_10119821 Ga0105240_101198214 194
283 3300009147 Ga0114129_10523420 Ga0114129_105234202 194
284 3300009545 Ga0105237_10069951 Ga0105237_100699514 194
285 3300009551 Ga0105238_10233074 Ga0105238_102330743 194
286 3300009553 Ga0105249_10955967 Ga0105249_109559672 194
287 3300013105 Ga0157369_10379039 Ga0157369_103790392 194
288 3300025916 Ga0207663_10027466 Ga0207663_100274664 194
289 3300025931 Ga0207644_10368623 Ga0207644_103686232 194
290 3300026041 Ga0207639_10030887 Ga0207639_100308871 194
291 3300028786 Ga0307517_10045840 Ga0307517_100458404 194
292 3300031238 Ga0265332_10096917 Ga0265332_100969172 194
293 3300031249 Ga0265339_10000195 Ga0265339_1000019538 194
294 3300031344 Ga0265316_10000300 Ga0265316_1000030018 194
295 3300031711 Ga0265314_10000002 Ga0265314_10000002187 194
296 3300035092 Ga0373952_0000264 Ga0373952_0000264_4867_5595 194
297 3300035121 Ga0373960_0051947 Ga0373960_0051947_271_999 194
298 3300035170 Ga0373943_0179917 Ga0373943_0179917_288_950 194
299 3300035691 Ga0373931_0224265 Ga0373931_0224265_174_839 194
300 3300036401 Ga0373937_0820526 Ga0373937_0820526_197_832 194
301 3300037312 Ga0395899_0000039 Ga0395899_0000039_17080_17850 194
302 3300039437 Ga0436365_0147248 Ga0436365_0147248_789_1535 194
303 3300039437 Ga0436365_1838315 Ga0436365_1838315_6070_6831 194
304 3300044683 Ga0466965_0080054 Ga0466965_0080054_348_944 194
305 3300044694 Ga0466963_0563093 Ga0466963_0563093_42_638 194
306 3300045976 Ga0466967_0925219 Ga0466967_0925219_15_611 194
307 3300046459 Ga0495629_0275977 Ga0495629_0275977_390_1037 194
308 3300046472 Ga0495580_0275798 Ga0495580_0275798_66_728 194
309 3300046507 Ga0495606_0067615 Ga0495606_0067615_813_1466 194
310 3300046684 Ga0495669_0114131 Ga0495669_0114131_522_1175 194
311 3300046694 Ga0495649_0176326 Ga0495649_0176326_191_874 194
312 3300046794 Ga0495589_0091173 Ga0495589_0091173_690_1343 194
313 3300047443 Ga0495687_004265 Ga0495687_004265_3927_4580 194
314 3300047673 Ga0495593_0084241 Ga0495593_0084241_547_1194 194
315 3300047673 Ga0495593_0271481 Ga0495593_0271481_29_682 194
316 3300048088 Ga0495602_0251698 Ga0495602_0251698_324_1076 194
317 3300048903 Ga0496100_0060233 Ga0496100_0060233_1775_2437 194
318 3300048903 Ga0496100_0276526 Ga0496100_0276526_60_821 194
319 3300048907 Ga0496104_0070167 Ga0496104_0070167_314_976 194
320 3300048907 Ga0496104_0164835 Ga0496104_0164835_1028_1684 194
321 3300048908 Ga0496105_0135221 Ga0496105_0135221_801_1439 194
322 3300048908 Ga0496105_0167307 Ga0496105_0167307_803_1465 194
323 3300048910 Ga0496107_0195253 Ga0496107_0195253_502_1164 194
324 3300048912 Ga0496109_0071103 Ga0496109_0071103_2206_2844 194
325 3300048913 Ga0496110_0124637 Ga0496110_0124637_1279_2034 194
326 3300048915 Ga0496112_0300527 Ga0496112_0300527_588_1226 194
327 3300048916 Ga0496113_0019088 Ga0496113_0019088_3917_4567 194
328 3300048917 Ga0496114_0021798 Ga0496114_0021798_2820_3482 194
329 3300048918 Ga0496115_0012871 Ga0496115_0012871_1733_2395 194
330 3300049572 Ga0501036_0009934 Ga0501036_0009934_6979_7740 194
331 3300049573 Ga0501037_0000010 Ga0501037_0000010_141025_141786 194
332 3300049579 Ga0501043_0151153 Ga0501043_0151153_435_1091 194
333 3300049581 Ga0501047_0017854 Ga0501047_0017854_3089_3745 194
334 3300049581 Ga0501047_0051345 Ga0501047_0051345_2062_2715 194
335 3300049586 Ga0501070_0003344 Ga0501070_0003344_4300_4956 194
336 3300049589 Ga0501073_0170652 Ga0501073_0170652_446_1102 194
337 3300049590 Ga0501074_0010115 Ga0501074_0010115_4823_5479 194
338 3300049741 Ga0501079_0183967 Ga0501079_0183967_44_715 194
339 3300049742 Ga0501080_0009780 Ga0501080_0009780_2809_3465 194
340 3300049742 Ga0501080_0249725 Ga0501080_0249725_22_693 194
341 3300049822 Ga0501035_0001302 Ga0501035_0001302_1430_2086 194
342 3300049823 Ga0501044_0000265 Ga0501044_0000265_8987_9748 194
343 3300049823 Ga0501044_0030532 Ga0501044_0030532_1995_2651 194
344 3300050516 nmdc:mga0sz30_51245_c1 nmdc:mga0sz30_51245_c1_769_1452 194
345 3300053144 Ga0500585_159549 Ga0500585_159549_29_694 194
346 3300060353 Ga0501082_0686359 Ga0501082_0686359_31_657 194
347 3300003759 Ga0055525_1000388 Ga0055525_100038820 195
348 3300003762 Ga0055542_1000060 Ga0055542_1000060135 195
349 3300003763 Ga0055529_1000043 Ga0055529_100004333 195
350 3300005467 Ga0070706_100645321 Ga0070706_1006453211 195
351 3300005468 Ga0070707_100024932 Ga0070707_1000249322 195
352 3300005468 Ga0070707_100208537 Ga0070707_1002085373 195
353 3300005536 Ga0070697_100143209 Ga0070697_1001432091 195
354 3300006844 Ga0075428_100034872 Ga0075428_1000348728 195
355 3300006847 Ga0075431_100060694 Ga0075431_1000606944 195
356 3300007076 Ga0075435_100072774 Ga0075435_1000727742 195
357 3300009094 Ga0111539_10291181 Ga0111539_102911813 195
358 3300009147 Ga0114129_10067933 Ga0114129_100679333 195
359 3300009993 Ga0105028_103858 Ga0105028_1038581 195
360 3300010159 Ga0099796_10053613 Ga0099796_100536132 195
361 3300013297 Ga0157378_10376998 Ga0157378_103769982 195
362 3300025230 Ga0209563_100106 Ga0209563_100106112 195
363 3300025254 Ga0209148_1000017 Ga0209148_1000017282 195
364 3300025261 Ga0209233_1000463 Ga0209233_10004637 195
365 3300025272 Ga0209455_1000005 Ga0209455_1000005282 195
366 3300028380 Ga0268265_10151135 Ga0268265_101511351 195
367 3300031665 Ga0316575_10064273 Ga0316575_100642732 195
368 3300031691 Ga0316579_10000907 Ga0316579_1000090712 195
369 3300031691 Ga0316579_10001630 Ga0316579_100016305 195
370 3300031727 Ga0316576_10266991 Ga0316576_102669912 195
371 3300031728 Ga0316578_10028349 Ga0316578_100283494 195
372 3300031733 Ga0316577_10004132 Ga0316577_100041325 195
373 3300031733 Ga0316577_10020484 Ga0316577_100204843 195
374 3300032133 Ga0316583_10032531 Ga0316583_100325312 195
375 3300032137 Ga0316585_10020009 Ga0316585_100200092 195
376 3300033541 Ga0316596_1012231 Ga0316596_10122313 195
377 3300035118 Ga0373954_0017819 Ga0373954_0017819_1626_2369 195
378 3300035118 Ga0373954_0285819 Ga0373954_0285819_90_743 195
379 3300035172 Ga0373955_0005573 Ga0373955_0005573_533_1276 195
380 3300035241 Ga0373961_0054789 Ga0373961_0054789_20_670 195
381 3300035398 Ga0316574_0085714 Ga0316574_0085714_942_1637 195
382 3300035410 Ga0373924_0085533 Ga0373924_0085533_546_1289 195
383 3300035410 Ga0373924_0214187 Ga0373924_0214187_51_746 195
384 3300035692 Ga0373935_0077822 Ga0373935_0077822_775_1410 195
385 3300035724 Ga0373933_0026832 Ga0373933_0026832_549_1292 195
386 3300035724 Ga0373933_0110412 Ga0373933_0110412_680_1333 195
387 3300036401 Ga0373937_0313292 Ga0373937_0313292_179_922 195
388 3300036647 Ga0316582_0000071 Ga0316582_0000071_23246_23941 195
389 3300036712 Ga0316584_0000431 Ga0316584_0000431_9249_9944 195
390 3300036712 Ga0316584_0003128 Ga0316584_0003128_7929_8624 195
391 3300037588 Ga0316581_0008892 Ga0316581_0008892_1060_1755 195
392 3300037853 Ga0436364_0005137 Ga0436364_0005137_564_1184 195
393 3300038735 Ga0400485_22206 Ga0400485_22206_161_856 195
394 3300039437 Ga0436365_0509139 Ga0436365_0509139_232_852 195
395 3300045051 Ga0451576_0498432 Ga0451576_0498432_529_1203 195
396 3300046477 Ga0495664_0025929 Ga0495664_0025929_2542_3177 195
397 3300046524 Ga0495648_0005048 Ga0495648_0005048_6527_7159 195
398 3300046533 Ga0495640_0097433 Ga0495640_0097433_940_1683 195
399 3300046543 Ga0495645_0128622 Ga0495645_0128622_193_828 195
400 3300046664 Ga0495659_0043020 Ga0495659_0043020_142_786 195
401 3300046678 Ga0495599_0148253 Ga0495599_0148253_663_1298 195
402 3300046679 Ga0495623_0101578 Ga0495623_0101578_764_1399 195
403 3300046809 Ga0495600_0267744 Ga0495600_0267744_332_967 195
404 3300047322 Ga0495680_0262945 Ga0495680_0262945_52_795 195
405 3300047472 Ga0495686_0021343 Ga0495686_0021343_3496_4125 195
406 3300048910 Ga0496107_0135397 Ga0496107_0135397_679_1440 195
407 3300048919 Ga0496116_0057432 Ga0496116_0057432_1022_1759 195
408 3300048919 Ga0496116_0089581 Ga0496116_0089581_705_1448 195
409 3300049569 Ga0501032_0103539 Ga0501032_0103539_779_1417 195
410 3300049572 Ga0501036_0022713 Ga0501036_0022713_1100_1738 195
411 3300049575 Ga0501039_0008462 Ga0501039_0008462_6128_6766 195
412 3300049576 Ga0501040_0021327 Ga0501040_0021327_162_800 195
413 3300049577 Ga0501041_0086900 Ga0501041_0086900_50_688 195
414 3300049578 Ga0501042_0018160 Ga0501042_0018160_89_727 195
415 3300049578 Ga0501042_0030422 Ga0501042_0030422_2281_2919 195
416 3300049580 Ga0501046_0075055 Ga0501046_0075055_680_1318 195
417 3300049582 Ga0501048_0018802 Ga0501048_0018802_1012_1650 195
418 3300049584 Ga0501068_0073888 Ga0501068_0073888_1195_1833 195
419 3300049587 Ga0501071_0017030 Ga0501071_0017030_917_1555 195
420 3300049587 Ga0501071_0086404 Ga0501071_0086404_287_925 195
421 3300049589 Ga0501073_0255646 Ga0501073_0255646_95_733 195
422 3300049590 Ga0501074_0169592 Ga0501074_0169592_615_1253 195
423 3300049591 Ga0501075_0010712 Ga0501075_0010712_4498_5136 195
424 3300049591 Ga0501075_0014324 Ga0501075_0014324_2464_3102 195
425 3300049592 Ga0501076_0073873 Ga0501076_0073873_1152_1790 195
426 3300049592 Ga0501076_0152290 Ga0501076_0152290_122_763 195
427 3300049593 Ga0501077_0048340 Ga0501077_0048340_1068_1706 195
428 3300049741 Ga0501079_0067025 Ga0501079_0067025_990_1628 195
429 3300049741 Ga0501079_0074440 Ga0501079_0074440_275_913 195
430 3300049742 Ga0501080_0218814 Ga0501080_0218814_848_1486 195
431 3300049742 Ga0501080_0628767 Ga0501080_0628767_236_874 195
432 3300049743 Ga0501081_0070752 Ga0501081_0070752_841_1479 195
433 3300049744 Ga0501083_0063347 Ga0501083_0063347_820_1458 195
434 3300049822 Ga0501035_0033351 Ga0501035_0033351_3293_3931 195
435 3300049824 Ga0501045_0056113 Ga0501045_0056113_942_1580 195
436 3300050507 nmdc:mga05p37_206978_c1 nmdc:mga05p37_206978_c1_664_1290 195
437 3300050510 nmdc:mga06r32_73952_c1 nmdc:mga06r32_73952_c1_1997_2623 195
438 3300050511 nmdc:mga08y16_170731_c1 nmdc:mga08y16_170731_c1_1010_1633 195
439 3300053084 Ga0495595_0115197 Ga0495595_0115197_32_775 195
440 3300053094 Ga0500566_0004593 Ga0500566_0004593_2809_3474 195
441 3300053130 Ga0500642_0033444 Ga0500642_0033444_123_800 195
442 3300054114 Ga0501084_0106430 Ga0501084_0106430_876_1514 195
443 3300054114 Ga0501084_0451798 Ga0501084_0451798_383_1021 195
444 3300061734 Ga0530510_0009460 Ga0530510_0009460_1283_1921 195
445 iso_pu_bacteria 2888419890 2888427387 195
446 3300005331 Ga0070670_100006650 Ga0070670_1000066505 196
447 3300005334 Ga0068869_100000518 Ga0068869_1000005189 196
448 3300005336 Ga0070680_100251344 Ga0070680_1002513442 196
449 3300005338 Ga0068868_100834577 Ga0068868_1008345771 196
450 3300005340 Ga0070689_100090192 Ga0070689_1000901922 196
451 3300005343 Ga0070687_100065273 Ga0070687_1000652732 196
452 3300005355 Ga0070671_100636184 Ga0070671_1006361841 196
453 3300005364 Ga0070673_100009443 Ga0070673_1000094437 196
454 3300005367 Ga0070667_100131778 Ga0070667_1001317782 196
455 3300005435 Ga0070714_100173969 Ga0070714_1001739692 196
456 3300005436 Ga0070713_100114720 Ga0070713_1001147204 196
457 3300005437 Ga0070710_10224606 Ga0070710_102246062 196
458 3300005455 Ga0070663_100057016 Ga0070663_1000570162 196
459 3300005458 Ga0070681_10193364 Ga0070681_101933641 196
460 3300005459 Ga0068867_100001294 Ga0068867_1000012945 196
461 3300005471 Ga0070698_100659981 Ga0070698_1006599811 196
462 3300005518 Ga0070699_100070104 Ga0070699_1000701043 196
463 3300005530 Ga0070679_100499598 Ga0070679_1004995982 196
464 3300005543 Ga0070672_100318333 Ga0070672_1003183332 196
465 3300005563 Ga0068855_100447028 Ga0068855_1004470282 196
466 3300005617 Ga0068859_100030539 Ga0068859_1000305392 196
467 3300005618 Ga0068864_100000394 Ga0068864_10000039436 196
468 3300005719 Ga0068861_100003658 Ga0068861_10000365811 196
469 3300005841 Ga0068863_100028085 Ga0068863_1000280854 196
470 3300005842 Ga0068858_100025720 Ga0068858_1000257207 196
471 3300005843 Ga0068860_100046555 Ga0068860_1000465551 196
472 3300005844 Ga0068862_100007631 Ga0068862_1000076316 196
473 3300006175 Ga0070712_100071523 Ga0070712_1000715233 196
474 3300006178 Ga0075367_10060821 Ga0075367_100608214 196
475 3300006844 Ga0075428_101024465 Ga0075428_1010244651 196
476 3300006931 Ga0097620_100030538 Ga0097620_1000305382 196
477 3300007265 Ga0099794_10031658 Ga0099794_100316581 196
478 3300007788 Ga0099795_10001879 Ga0099795_100018794 196
479 3300009098 Ga0105245_10392510 Ga0105245_103925102 196
480 3300009177 Ga0105248_10011661 Ga0105248_1001166110 196
481 3300010159 Ga0099796_10004830 Ga0099796_100048305 196
482 3300013104 Ga0157370_10831278 Ga0157370_108312782 196
483 3300013297 Ga0157378_10018371 Ga0157378_100183718 196
484 3300013297 Ga0157378_10063574 Ga0157378_100635742 196
485 3300014497 Ga0182008_10110336 Ga0182008_101103362 196
486 3300014968 Ga0157379_10002992 Ga0157379_100029922 196
487 3300021358 Ga0213873_10042582 Ga0213873_100425822 196
488 3300021441 Ga0213871_10014157 Ga0213871_100141573 196
489 3300025898 Ga0207692_10124317 Ga0207692_101243172 196
490 3300025903 Ga0207680_10358733 Ga0207680_103587332 196
491 3300025907 Ga0207645_10041895 Ga0207645_100418953 196
492 3300025908 Ga0207643_10032438 Ga0207643_100324382 196
493 3300025912 Ga0207707_10171389 Ga0207707_101713892 196
494 3300025915 Ga0207693_10172970 Ga0207693_101729703 196
495 3300025918 Ga0207662_10177411 Ga0207662_101774112 196
496 3300025923 Ga0207681_10086980 Ga0207681_100869801 196
497 3300025925 Ga0207650_10715897 Ga0207650_107158972 196
498 3300025927 Ga0207687_10662019 Ga0207687_106620192 196
499 3300025928 Ga0207700_10064060 Ga0207700_100640604 196
500 3300025929 Ga0207664_10197837 Ga0207664_101978374 196
501 3300025936 Ga0207670_10121115 Ga0207670_101211152 196
502 3300025940 Ga0207691_10169702 Ga0207691_101697022 196
503 3300025941 Ga0207711_10662996 Ga0207711_106629962 196
504 3300025942 Ga0207689_10000215 Ga0207689_1000021537 196
505 3300025960 Ga0207651_10018579 Ga0207651_100185793 196
506 3300025986 Ga0207658_10166869 Ga0207658_101668691 196
507 3300026023 Ga0207677_10503135 Ga0207677_105031351 196
508 3300026035 Ga0207703_10068215 Ga0207703_100682153 196
509 3300026067 Ga0207678_10230260 Ga0207678_102302602 196
510 3300026088 Ga0207641_10106131 Ga0207641_101061311 196
511 3300026089 Ga0207648_10000620 Ga0207648_1000062022 196
512 3300026116 Ga0207674_10015306 Ga0207674_100153065 196
513 3300026118 Ga0207675_100001798 Ga0207675_10000179821 196
514 3300027526 Ga0209968_1004456 Ga0209968_10044562 196
515 3300028381 Ga0268264_10009612 Ga0268264_100096125 196
516 3300031247 Ga0265340_10029882 Ga0265340_100298822 196
517 3300031249 Ga0265339_10000052 Ga0265339_1000005286 196
518 3300031249 Ga0265339_10218072 Ga0265339_102180722 196
519 3300031595 Ga0265313_10000318 Ga0265313_1000031828 196
520 3300031595 Ga0265313_10047456 Ga0265313_100474563 196
521 3300031711 Ga0265314_10054403 Ga0265314_100544032 196
522 3300031727 Ga0316576_10002342 Ga0316576_100023425 196
523 3300031728 Ga0316578_10011663 Ga0316578_100116632 196
524 3300031733 Ga0316577_10151068 Ga0316577_101510682 196
525 3300033528 Ga0316588_1041902 Ga0316588_10419021 196
526 3300035089 Ga0373944_0089435 Ga0373944_0089435_179_916 196
527 3300035170 Ga0373943_0103227 Ga0373943_0103227_324_1061 196
528 3300037466 Ga0395898_0000051 Ga0395898_0000051_224086_224874 196
529 3300039438 Ga0436360_1121536 Ga0436360_1121536_27_650 196
530 3300039438 Ga0436360_1198600 Ga0436360_1198600_153_776 196
531 3300039447 Ga0436361_0090326 Ga0436361_0090326_377_1024 196
532 3300039453 Ga0436362_0454622 Ga0436362_0454622_1261_1884 196
533 3300044694 Ga0466963_0062019 Ga0466963_0062019_982_1617 196
534 3300045976 Ga0466967_0184790 Ga0466967_0184790_441_1076 196
535 3300046455 Ga0495603_0000898 Ga0495603_0000898_7329_7976 196
536 3300046458 Ga0495591_013627 Ga0495591_013627_595_1242 196
537 3300046459 Ga0495629_0000267 Ga0495629_0000267_19165_19812 196
538 3300046463 Ga0495653_0132616 Ga0495653_0132616_1016_1663 196
539 3300046471 Ga0495650_0000523 Ga0495650_0000523_43727_44374 196
540 3300046472 Ga0495580_0006425 Ga0495580_0006425_5540_6187 196
541 3300046501 Ga0495607_0298236 Ga0495607_0298236_68_715 196
542 3300046507 Ga0495606_0390781 Ga0495606_0390781_30_677 196
543 3300046511 Ga0495608_0247248 Ga0495608_0247248_337_984 196
544 3300046530 Ga0495654_0033722 Ga0495654_0033722_1513_2160 196
545 3300046543 Ga0495645_0002332 Ga0495645_0002332_4421_5068 196
546 3300046559 Ga0495667_0023171 Ga0495667_0023171_3307_3954 196
547 3300046681 Ga0495647_0218731 Ga0495647_0218731_52_675 196
548 3300046684 Ga0495669_0133609 Ga0495669_0133609_441_1088 196
549 3300046689 Ga0495613_0292797 Ga0495613_0292797_194_841 196
550 3300047315 Ga0495581_0001676 Ga0495581_0001676_6541_7188 196
551 3300047323 Ga0495683_0028336 Ga0495683_0028336_982_1629 196
552 3300048906 Ga0496103_0366263 Ga0496103_0366263_159_806 196
553 3300048912 Ga0496109_0078965 Ga0496109_0078965_704_1351 196
554 3300048917 Ga0496114_0000748 Ga0496114_0000748_14112_14759 196
555 3300048918 Ga0496115_0118606 Ga0496115_0118606_827_1474 196
556 3300048929 Ga0496126_0397263 Ga0496126_0397263_263_910 196
557 3300049575 Ga0501039_0007650 Ga0501039_0007650_3530_4207 196
558 3300049576 Ga0501040_0115411 Ga0501040_0115411_1030_1707 196
559 3300049577 Ga0501041_0047207 Ga0501041_0047207_1360_2037 196
560 3300049578 Ga0501042_0244606 Ga0501042_0244606_385_1017 196
561 3300049579 Ga0501043_0039313 Ga0501043_0039313_235_912 196
562 3300049580 Ga0501046_0020796 Ga0501046_0020796_2511_3188 196
563 3300049584 Ga0501068_0030252 Ga0501068_0030252_1945_2622 196
564 3300049587 Ga0501071_0017383 Ga0501071_0017383_1018_1695 196
565 3300049588 Ga0501072_0090378 Ga0501072_0090378_67_735 196
566 3300049589 Ga0501073_0372046 Ga0501073_0372046_91_768 196
567 3300049591 Ga0501075_0054465 Ga0501075_0054465_682_1359 196
568 3300049591 Ga0501075_0236724 Ga0501075_0236724_643_1320 196
569 3300049591 Ga0501075_0524695 Ga0501075_0524695_196_891 196
570 3300049592 Ga0501076_0021105 Ga0501076_0021105_3479_4156 196
571 3300049741 Ga0501079_0029206 Ga0501079_0029206_1582_2259 196
572 3300049742 Ga0501080_0025227 Ga0501080_0025227_3705_4382 196
573 3300049743 Ga0501081_0005186 Ga0501081_0005186_768_1445 196
574 3300049822 Ga0501035_0107203 Ga0501035_0107203_296_973 196
575 3300049824 Ga0501045_0067529 Ga0501045_0067529_395_1072 196
576 3300050494 nmdc:mga06z11_83736_c1 nmdc:mga06z11_83736_c1_884_1666 196
577 3300050508 nmdc:mga09592_117745_c1 nmdc:mga09592_117745_c1_904_1536 196
578 3300050513 nmdc:mga0rr50_309136_c1 nmdc:mga0rr50_309136_c1_355_1071 196
579 3300054114 Ga0501084_0054589 Ga0501084_0054589_1773_2450 196
580 3300060353 Ga0501082_0002352 Ga0501082_0002352_1648_2325 196
581 3300060353 Ga0501082_0105590 Ga0501082_0105590_1192_1884 196
582 iso_pu_bacteria 2861691609 2861697033 196
583 3300003775 Ga0055524_1002269 Ga0055524_10022695 197
584 3300006028 Ga0070717_10026307 Ga0070717_100263076 197
585 3300006028 Ga0070717_10406246 Ga0070717_104062462 197
586 3300025929 Ga0207664_10338989 Ga0207664_103389892 197
587 3300025939 Ga0207665_10106406 Ga0207665_101064062 197
588 3300028381 Ga0268264_10229111 Ga0268264_102291112 197
589 3300031507 Ga0307509_10000177 Ga0307509_100001772 197
590 3300031901 Ga0307406_10096425 Ga0307406_100964252 197
591 3300035086 Ga0373934_0069808 Ga0373934_0069808_665_1303 197
592 3300035111 Ga0373923_0015498 Ga0373923_0015498_2159_2797 197
593 3300035113 Ga0373936_0001304 Ga0373936_0001304_8376_9014 197
594 3300035116 Ga0373945_0025200 Ga0373945_0025200_223_861 197
595 3300035117 Ga0373953_0006486 Ga0373953_0006486_660_1298 197
596 3300035118 Ga0373954_0003435 Ga0373954_0003435_1176_1814 197
597 3300035171 Ga0373946_0000442 Ga0373946_0000442_5708_6346 197
598 3300035410 Ga0373924_0000432 Ga0373924_0000432_5293_5931 197
599 3300035692 Ga0373935_0000370 Ga0373935_0000370_13096_13734 197
600 3300035724 Ga0373933_0004813 Ga0373933_0004813_3592_4230 197
601 3300035725 Ga0373947_0000476 Ga0373947_0000476_9119_9757 197
602 3300036401 Ga0373937_0000009 Ga0373937_0000009_89947_90585 197
603 3300037068 Ga0373925_0000194 Ga0373925_0000194_21613_22251 197
604 3300037418 Ga0395900_0695846 Ga0395900_0695846_218_871 197
605 3300037853 Ga0436364_0719253 Ga0436364_0719253_675_1316 197
606 3300039437 Ga0436365_1460405 Ga0436365_1460405_146_841 197
607 3300045976 Ga0466967_0012356 Ga0466967_0012356_5319_5960 197
608 3300046454 Ga0495592_0000018 Ga0495592_0000018_27038_27676 197
609 3300046459 Ga0495629_0004511 Ga0495629_0004511_1400_2038 197
610 3300046460 Ga0495638_0045888 Ga0495638_0045888_1872_2534 197
611 3300046462 Ga0495651_0001122 Ga0495651_0001122_17246_17884 197
612 3300046463 Ga0495653_0000032 Ga0495653_0000032_59148_59786 197
613 3300046476 Ga0495662_0023189 Ga0495662_0023189_1618_2256 197
614 3300046477 Ga0495664_0000010 Ga0495664_0000010_177926_178564 197
615 3300046491 Ga0495584_0028056 Ga0495584_0028056_527_1189 197
616 3300046511 Ga0495608_0000008 Ga0495608_0000008_90085_90723 197
617 3300046514 Ga0495618_0000002 Ga0495618_0000002_180199_180837 197
618 3300046516 Ga0495628_0000009 Ga0495628_0000009_177954_178592 197
619 3300046517 Ga0495630_0001850 Ga0495630_0001850_5036_5674 197
620 3300046529 Ga0495652_0000011 Ga0495652_0000011_89775_90413 197
621 3300046533 Ga0495640_0000009 Ga0495640_0000009_38527_39165 197
622 3300046536 Ga0495587_0000006 Ga0495587_0000006_291672_292310 197
623 3300046543 Ga0495645_0000010 Ga0495645_0000010_59148_59786 197
624 3300046559 Ga0495667_0000005 Ga0495667_0000005_177954_178592 197
625 3300046642 Ga0495634_0000223 Ga0495634_0000223_45417_46055 197
626 3300046663 Ga0495635_0000008 Ga0495635_0000008_89758_90396 197
627 3300046675 Ga0495657_0000058 Ga0495657_0000058_44511_45149 197
628 3300046678 Ga0495599_0000007 Ga0495599_0000007_89775_90413 197
629 3300046679 Ga0495623_0005790 Ga0495623_0005790_7095_7733 197
630 3300046680 Ga0495646_0000021 Ga0495646_0000021_89730_90368 197
631 3300046683 Ga0495658_0120777 Ga0495658_0120777_813_1451 197
632 3300046683 Ga0495658_0263706 Ga0495658_0263706_178_921 197
633 3300046690 Ga0495624_0007573 Ga0495624_0007573_1235_1873 197
634 3300046694 Ga0495649_0051061 Ga0495649_0051061_845_1453 197
635 3300046809 Ga0495600_0000001 Ga0495600_0000001_89775_90413 197
636 3300047315 Ga0495581_0005192 Ga0495581_0005192_1712_2350 197
637 3300047317 Ga0495604_0000012 Ga0495604_0000012_177941_178579 197
638 3300047319 Ga0495674_0000011 Ga0495674_0000011_180227_180865 197
639 3300047322 Ga0495680_0001281 Ga0495680_0001281_8969_9607 197
640 3300047444 Ga0495675_0000096 Ga0495675_0000096_24411_25049 197
641 3300047471 Ga0495684_0000084 Ga0495684_0000084_5815_6453 197
642 3300047673 Ga0495593_0000727 Ga0495593_0000727_5104_5742 197
643 3300048088 Ga0495602_0000073 Ga0495602_0000073_89758_90396 197
644 3300048907 Ga0496104_0241926 Ga0496104_0241926_82_753 197
645 3300048908 Ga0496105_0094452 Ga0496105_0094452_1544_2215 197
646 3300048915 Ga0496112_0502964 Ga0496112_0502964_235_906 197
647 3300048923 Ga0496120_0056006 Ga0496120_0056006_803_1435 197
648 3300053077 Ga0495601_0000009 Ga0495601_0000009_89758_90396 197
649 3300053078 Ga0495612_0000019 Ga0495612_0000019_47432_48070 197
650 3300053084 Ga0495595_0000015 Ga0495595_0000015_71013_71651 197
651 3300053085 Ga0495619_0000012 Ga0495619_0000012_89758_90396 197
652 3300005434 Ga0070709_10040822 Ga0070709_100408225 198
653 3300005435 Ga0070714_100090193 Ga0070714_1000901934 198
654 3300005436 Ga0070713_100079441 Ga0070713_1000794414 198
655 3300005436 Ga0070713_100385968 Ga0070713_1003859682 198
656 3300005437 Ga0070710_10174003 Ga0070710_101740032 198
657 3300005439 Ga0070711_100121836 Ga0070711_1001218363 198
658 3300005445 Ga0070708_100081752 Ga0070708_1000817522 198
659 3300005467 Ga0070706_100298072 Ga0070706_1002980722 198
660 3300005468 Ga0070707_100130996 Ga0070707_1001309964 198
661 3300005468 Ga0070707_100288586 Ga0070707_1002885862 198
662 3300005471 Ga0070698_100763078 Ga0070698_1007630782 198
663 3300005518 Ga0070699_100049973 Ga0070699_1000499733 198
664 3300005518 Ga0070699_100216952 Ga0070699_1002169523 198
665 3300005518 Ga0070699_100840544 Ga0070699_1008405441 198
666 3300005536 Ga0070697_100166793 Ga0070697_1001667932 198
667 3300005536 Ga0070697_100930749 Ga0070697_1009307491 198
668 3300005546 Ga0070696_100181143 Ga0070696_1001811432 198
669 3300005937 Ga0081455_10000759 Ga0081455_1000075913 198
670 3300005937 Ga0081455_10173682 Ga0081455_101736822 198
671 3300005981 Ga0081538_10034097 Ga0081538_100340972 198
672 3300005981 Ga0081538_10049438 Ga0081538_100494384 198
673 3300005983 Ga0081540_1005852 Ga0081540_10058527 198
674 3300006028 Ga0070717_10235118 Ga0070717_102351183 198
675 3300006028 Ga0070717_10573812 Ga0070717_105738122 198
676 3300006028 Ga0070717_10811113 Ga0070717_108111132 198
677 3300006048 Ga0075363_100061152 Ga0075363_1000611522 198
678 3300006163 Ga0070715_10078649 Ga0070715_100786491 198
679 3300006173 Ga0070716_100005361 Ga0070716_1000053612 198
680 3300006173 Ga0070716_100608327 Ga0070716_1006083272 198
681 3300006175 Ga0070712_100742530 Ga0070712_1007425301 198
682 3300006844 Ga0075428_100268560 Ga0075428_1002685602 198
683 3300006846 Ga0075430_100249568 Ga0075430_1002495681 198
684 3300006847 Ga0075431_100438309 Ga0075431_1004383092 198
685 3300006852 Ga0075433_10034402 Ga0075433_100344024 198
686 3300006852 Ga0075433_10044634 Ga0075433_100446343 198
687 3300006871 Ga0075434_100183759 Ga0075434_1001837591 198
688 3300006871 Ga0075434_100527712 Ga0075434_1005277122 198
689 3300006880 Ga0075429_100844309 Ga0075429_1008443091 198
690 3300007076 Ga0075435_100051318 Ga0075435_1000513184 198
691 3300007076 Ga0075435_100155526 Ga0075435_1001555262 198
692 3300007076 Ga0075435_100425814 Ga0075435_1004258142 198
693 3300007265 Ga0099794_10001551 Ga0099794_100015516 198
694 3300007788 Ga0099795_10020732 Ga0099795_100207321 198
695 3300009147 Ga0114129_10062387 Ga0114129_100623871 198
696 3300009147 Ga0114129_10148400 Ga0114129_101484003 198
697 3300010159 Ga0099796_10012239 Ga0099796_100122392 198
698 3300013308 Ga0157375_10606456 Ga0157375_106064561 198
699 3300021358 Ga0213873_10047742 Ga0213873_100477422 198
700 3300021361 Ga0213872_10085182 Ga0213872_100851822 198
701 3300021361 Ga0213872_10115926 Ga0213872_101159262 198
702 3300021384 Ga0213876_10053268 Ga0213876_100532682 198
703 3300025898 Ga0207692_10005609 Ga0207692_100056095 198
704 3300025905 Ga0207685_10084150 Ga0207685_100841502 198
705 3300025906 Ga0207699_10023641 Ga0207699_100236414 198
706 3300025915 Ga0207693_10032075 Ga0207693_100320753 198
707 3300025915 Ga0207693_10191026 Ga0207693_101910263 198
708 3300025916 Ga0207663_10199844 Ga0207663_101998442 198
709 3300025922 Ga0207646_10397339 Ga0207646_103973392 198
710 3300025928 Ga0207700_10145858 Ga0207700_101458582 198
711 3300025929 Ga0207664_10031526 Ga0207664_100315266 198
712 3300025929 Ga0207664_10284300 Ga0207664_102843002 198
713 3300025933 Ga0207706_10099286 Ga0207706_100992863 198
714 3300025941 Ga0207711_11056212 Ga0207711_110562121 198
715 3300026078 Ga0207702_10302054 Ga0207702_103020542 198
716 3300027512 Ga0209179_1002907 Ga0209179_10029072 198
717 3300027717 Ga0209998_10021992 Ga0209998_100219922 198
718 3300027876 Ga0209974_10046838 Ga0209974_100468382 198
719 3300027907 Ga0207428_10086085 Ga0207428_100860854 198
720 3300031241 Ga0265325_10045164 Ga0265325_100451643 198
721 3300031247 Ga0265340_10016673 Ga0265340_100166732 198
722 3300031249 Ga0265339_10024316 Ga0265339_100243162 198
723 3300031507 Ga0307509_10104000 Ga0307509_101040003 198
724 3300031595 Ga0265313_10047995 Ga0265313_100479951 198
725 3300031730 Ga0307516_10051054 Ga0307516_100510543 198
726 3300035090 Ga0373949_0001647 Ga0373949_0001647_2057_2821 198
727 3300035113 Ga0373936_0000020 Ga0373936_0000020_62421_63137 198
728 3300035114 Ga0373939_0092452 Ga0373939_0092452_156_779 198
729 3300035115 Ga0373941_0004708 Ga0373941_0004708_2097_2807 198
730 3300035118 Ga0373954_0221043 Ga0373954_0221043_111_788 198
731 3300035692 Ga0373935_0133751 Ga0373935_0133751_19_654 198
732 3300036401 Ga0373937_0036036 Ga0373937_0036036_80_757 198
733 3300036401 Ga0373937_0235830 Ga0373937_0235830_474_1133 198
734 3300037418 Ga0395900_0161766 Ga0395900_0161766_505_1125 198
735 3300037466 Ga0395898_0190092 Ga0395898_0190092_107_727 198
736 3300037853 Ga0436364_0478958 Ga0436364_0478958_1749_2375 198
737 3300038443 Ga0395901_0026797 Ga0395901_0026797_4273_4893 198
738 3300039437 Ga0436365_0922321 Ga0436365_0922321_1450_2097 198
739 3300039447 Ga0436361_0926373 Ga0436361_0926373_7797_8420 198
740 3300039453 Ga0436362_0578135 Ga0436362_0578135_414_1115 198
741 3300039453 Ga0436362_0723249 Ga0436362_0723249_94_741 198
742 3300039453 Ga0436362_0899014 Ga0436362_0899014_169_804 198
743 3300042015 Ga0439462_0021112 Ga0439462_0021112_272_994 198
744 3300046499 Ga0495594_0378972 Ga0495594_0378972_94_717 198
745 3300046539 Ga0495621_0073283 Ga0495621_0073283_107_811 198
746 3300047319 Ga0495674_0081998 Ga0495674_0081998_1447_2100 198
747 3300047320 Ga0495672_0174136 Ga0495672_0174136_464_1081 198
748 3300048088 Ga0495602_0146322 Ga0495602_0146322_994_1626 198
749 3300048903 Ga0496100_0066496 Ga0496100_0066496_1451_2068 198
750 3300048904 Ga0496101_0364872 Ga0496101_0364872_342_989 198
751 3300048905 Ga0496102_0071229 Ga0496102_0071229_219_839 198
752 3300048907 Ga0496104_0504303 Ga0496104_0504303_148_795 198
753 3300048908 Ga0496105_0103494 Ga0496105_0103494_387_1004 198
754 3300048908 Ga0496105_0278486 Ga0496105_0278486_492_1139 198
755 3300048909 Ga0496106_0132600 Ga0496106_0132600_148_768 198
756 3300048910 Ga0496107_0022356 Ga0496107_0022356_71_691 198
757 3300048913 Ga0496110_0039292 Ga0496110_0039292_2821_3444 198
758 3300048913 Ga0496110_0053471 Ga0496110_0053471_827_1444 198
759 3300048913 Ga0496110_0413320 Ga0496110_0413320_549_1196 198
760 3300048914 Ga0496111_0070795 Ga0496111_0070795_650_1267 198
761 3300048915 Ga0496112_0055415 Ga0496112_0055415_2893_3510 198
762 3300048915 Ga0496112_0074067 Ga0496112_0074067_693_1316 198
763 3300048917 Ga0496114_1006043 Ga0496114_1006043_66_686 198
764 3300048918 Ga0496115_0050576 Ga0496115_0050576_462_1082 198
765 3300048918 Ga0496115_0066506 Ga0496115_0066506_863_1480 198
766 3300049570 Ga0501033_0291957 Ga0501033_0291957_325_948 198
767 3300049572 Ga0501036_0425133 Ga0501036_0425133_113_736 198
768 3300049573 Ga0501037_0246704 Ga0501037_0246704_210_833 198
769 3300049574 Ga0501038_0187359 Ga0501038_0187359_541_1170 198
770 3300049574 Ga0501038_0317503 Ga0501038_0317503_409_1032 198
771 3300049577 Ga0501041_0243889 Ga0501041_0243889_307_936 198
772 3300049577 Ga0501041_0289474 Ga0501041_0289474_208_831 198
773 3300049578 Ga0501042_0159446 Ga0501042_0159446_277_900 198
774 3300049580 Ga0501046_0059045 Ga0501046_0059045_1822_2481 198
775 3300049580 Ga0501046_0580858 Ga0501046_0580858_51_674 198
776 3300049582 Ga0501048_0222972 Ga0501048_0222972_92_715 198
777 3300049582 Ga0501048_0318592 Ga0501048_0318592_279_920 198
778 3300049582 Ga0501048_0393826 Ga0501048_0393826_192_923 198
779 3300049582 Ga0501048_0713230 Ga0501048_0713230_82_705 198
780 3300049583 Ga0501067_0058219 Ga0501067_0058219_721_1338 198
781 3300049586 Ga0501070_0139325 Ga0501070_0139325_705_1328 198
782 3300049587 Ga0501071_0129942 Ga0501071_0129942_1046_1669 198
783 3300049588 Ga0501072_0125644 Ga0501072_0125644_1277_1906 198
784 3300049588 Ga0501072_0362126 Ga0501072_0362126_504_1127 198
785 3300049588 Ga0501072_0390172 Ga0501072_0390172_63_686 198
786 3300049590 Ga0501074_0137400 Ga0501074_0137400_31_654 198
787 3300049592 Ga0501076_0161597 Ga0501076_0161597_595_1236 198
788 3300049592 Ga0501076_0182159 Ga0501076_0182159_93_716 198
789 3300049592 Ga0501076_0385911 Ga0501076_0385911_269_898 198
790 3300049593 Ga0501077_0075287 Ga0501077_0075287_1480_2109 198
791 3300049593 Ga0501077_0196569 Ga0501077_0196569_461_1084 198
792 3300049741 Ga0501079_0193116 Ga0501079_0193116_11_643 198
793 3300049742 Ga0501080_0544149 Ga0501080_0544149_210_833 198
794 3300049742 Ga0501080_0601496 Ga0501080_0601496_227_856 198
795 3300049743 Ga0501081_0029986 Ga0501081_0029986_2275_2898 198
796 3300049822 Ga0501035_0099657 Ga0501035_0099657_1321_1944 198
797 3300049824 Ga0501045_0516795 Ga0501045_0516795_86_709 198
798 3300049824 Ga0501045_0642655 Ga0501045_0642655_12_635 198
799 3300050489 nmdc:mga03683_43481_c1 nmdc:mga03683_43481_c1_564_1181 198
800 3300050492 nmdc:mga0yw44_113804_c1 nmdc:mga0yw44_113804_c1_1013_1630 198
801 3300050507 nmdc:mga05p37_548824_c1 nmdc:mga05p37_548824_c1_485_1108 198
802 3300050507 nmdc:mga05p37_585247_c1 nmdc:mga05p37_585247_c1_464_1084 198
803 3300050507 nmdc:mga05p37_99731_c1 nmdc:mga05p37_99731_c1_423_1043 198
804 3300050508 nmdc:mga09592_43414_c1 nmdc:mga09592_43414_c1_1622_2245 198
805 3300050509 nmdc:mga0qj67_388795_c1 nmdc:mga0qj67_388795_c1_335_955 198
806 3300050509 nmdc:mga0qj67_644565_c1 nmdc:mga0qj67_644565_c1_58_681 198
807 3300050510 nmdc:mga06r32_501012_c1 nmdc:mga06r32_501012_c1_103_723 198
808 3300050511 nmdc:mga08y16_564519_c1 nmdc:mga08y16_564519_c1_280_900 198
809 3300050512 nmdc:mga0n895_248016_c1 nmdc:mga0n895_248016_c1_223_882 198
810 3300050512 nmdc:mga0n895_290751_c1 nmdc:mga0n895_290751_c1_164_784 198
811 3300050512 nmdc:mga0n895_98971_c1 nmdc:mga0n895_98971_c1_636_1265 198
812 3300050513 nmdc:mga0rr50_134203_c1 nmdc:mga0rr50_134203_c1_1070_1693 198
813 3300050513 nmdc:mga0rr50_280737_c1 nmdc:mga0rr50_280737_c1_308_928 198
814 3300050514 nmdc:mga08x19_364697_c1 nmdc:mga08x19_364697_c1_266_886 198
815 3300050515 nmdc:mga0a205_243391_c1 nmdc:mga0a205_243391_c1_769_1392 198
816 3300050515 nmdc:mga0a205_391033_c1 nmdc:mga0a205_391033_c1_95_715 198
817 3300050515 nmdc:mga0a205_59905_c1 nmdc:mga0a205_59905_c1_1116_1775 198
818 3300053090 Ga0500646_0014187 Ga0500646_0014187_764_1396 198
819 3300053091 Ga0500647_0067774 Ga0500647_0067774_873_1532 198
820 3300053094 Ga0500566_0015609 Ga0500566_0015609_2014_2718 198
821 3300053095 Ga0500640_013143 Ga0500640_013143_2173_2832 198
822 3300053102 Ga0500554_012328 Ga0500554_012328_547_1206 198
823 3300053102 Ga0500554_045955 Ga0500554_045955_571_1278 198
824 3300053111 Ga0500572_017152 Ga0500572_017152_979_1638 198
825 3300053119 Ga0500595_000342 Ga0500595_000342_482_1141 198
826 3300053120 Ga0500597_051077 Ga0500597_051077_203_862 198
827 3300053123 Ga0500614_001237 Ga0500614_001237_5020_5679 198
828 3300053123 Ga0500614_004035 Ga0500614_004035_493_1200 198
829 3300053136 Ga0500559_0224523 Ga0500559_0224523_18_677 198
830 3300053178 Ga0500637_0147845 Ga0500637_0147845_523_1230 198
831 3300053178 Ga0500637_0163811 Ga0500637_0163811_403_1062 198
832 3300053737 Ga0500601_003451 Ga0500601_003451_133_792 198
833 3300054114 Ga0501084_0111453 Ga0501084_0111453_1369_1992 198
834 3300060353 Ga0501082_0022848 Ga0501082_0022848_3043_3666 198
835 3300060353 Ga0501082_0715364 Ga0501082_0715364_51_680 198
836 3300061734 Ga0530510_0034117 Ga0530510_0034117_1889_2518 198
837 3300061734 Ga0530510_0125742 Ga0530510_0125742_865_1488 198
838 3300061734 Ga0530510_0268662 Ga0530510_0268662_64_687 198
839 3300061734 Ga0530510_0694547 Ga0530510_0694547_90_722 198
840 iso_pu_bacteria 2585427527 2585532870 198
841 iso_pu_bacteria 2585427530 2585553764 198
842 iso_pu_bacteria 2667528174 2671115954 198
843 iso_pu_bacteria 2818991439 2819562248 198
844 iso_pu_bacteria 2818991448 2819613722 198
845 iso_pu_bacteria 2818991453 2819642569 198
846 iso_pu_bacteria 2818991453 2819643017 198
847 iso_pu_bacteria 2902405164 2902411625 198
848 iso_pu_bacteria 2919408235 2919410850 198
849 iso_pu_bacteria 2984601300 2984606171 198
850 iso_pu_bacteria 8005645114 8005651351 198
851 3300027671 Ga0209588_1053116 Ga0209588_10531162 199
852 3300001979 JGI24740J21852_10001471 JGI24740J21852_100014715 202
853 3300002737 JGI25162J39368_1000277 JGI25162J39368_10002774 202
854 3300003214 JGI25165J46597_1000688 JGI25165J46597_100068824 202
855 3300003320 rootH2_10006900 rootH2_100069002 202
856 3300003323 rootH1_10144639 rootH1_101446391 202
857 3300003771 Ga0055526_1004486 Ga0055526_10044868 202
858 3300003775 Ga0055524_1007126 Ga0055524_10071268 202
859 3300003790 Ga0055528_1000680 Ga0055528_100068025 202
860 3300006186 Ga0075369_10071146 Ga0075369_100711464 202
861 3300006353 Ga0075370_10149164 Ga0075370_101491642 202
862 3300009148 Ga0105243_10429824 Ga0105243_104298242 202
863 3300010375 Ga0105239_10005815 Ga0105239_1000581513 202
864 3300013100 Ga0157373_10038839 Ga0157373_100388392 202
865 3300014497 Ga0182008_10365711 Ga0182008_103657111 202
866 3300015262 Ga0182007_10000160 Ga0182007_1000016023 202
867 3300015265 Ga0182005_1012818 Ga0182005_10128183 202
868 3300025231 Ga0207427_109633 Ga0207427_1096332 202
869 3300025233 Ga0209437_100078 Ga0209437_1000785 202
870 3300025261 Ga0209233_1000163 Ga0209233_10001635 202
871 3300025273 Ga0209673_1001165 Ga0209673_100116530 202
872 3300025295 Ga0209564_1001589 Ga0209564_100158922 202
873 3300025299 Ga0209256_1001586 Ga0209256_10015869 202
874 3300025935 Ga0207709_10560847 Ga0207709_105608471 202
875 3300048919 Ga0496116_0011585 Ga0496116_0011585_6089_6697 202
876 3300048922 Ga0496119_0020352 Ga0496119_0020352_1250_1858 202
877 3300048927 Ga0496124_0002688 Ga0496124_0002688_14752_15360 202
878 3300048929 Ga0496126_0036346 Ga0496126_0036346_2853_3461 202
879 3300049570 Ga0501033_0000035 Ga0501033_0000035_80777_81385 202
880 3300049822 Ga0501035_0000673 Ga0501035_0000673_24278_24886 202
881 3300050516 nmdc:mga0sz30_68008_c1 nmdc:mga0sz30_68008_c1_35_652 202

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02979

NHase_alpha

Nitrile hydratase, alpha chain

27

218

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
4zgj-assembly1.cif.gz_A double mutant h80a/h81a of fe-type nitrile hydratase from comamonas testosteroni ni1 0.9047 13 198
4zgd-assembly7.cif.gz_M mutant r157a of fe-type nitrile hydratase from comamonas testosteroni ni1 0.8959 8 198
4zge-assembly4.cif.gz_G double mutant h80w/h81w of fe-type nitrile hydratase from comamonas testosteroni ni1 0.8957 8 198
4fm4-assembly5.cif.gz_I wild type fe-type nitrile hydratase from comamonas testosteroni ni1 0.8954 8 198
3vyh-assembly1.cif.gz_A-2 crystal structure of aw116r mutant of nitrile hydratase from pseudonocardia thermophilla 0.8858 5 198
ID Description Score Start End Superfamily
4fm4G00 Alpha Beta;Alpha-Beta Complex;Nitrile Hydratase; Chain A;Nitrile hydratase alpha /Thiocyanate hydrolase gamma 0.8831 8 198 3.90.330.10
4ob0A00 Alpha Beta;Alpha-Beta Complex;Nitrile Hydratase; Chain A;Nitrile hydratase alpha /Thiocyanate hydrolase gamma 0.8789 5 198 3.90.330.10
2zcfA00 Alpha Beta;Alpha-Beta Complex;Nitrile Hydratase; Chain A;Nitrile hydratase alpha /Thiocyanate hydrolase gamma 0.8634 3 198 3.90.330.10
2zcfA00 Alpha Beta;Alpha-Beta Complex;Nitrile Hydratase; Chain A;Nitrile hydratase alpha /Thiocyanate hydrolase gamma 0.8512 3 198 3.90.330.10
4fm4G00 Alpha Beta;Alpha-Beta Complex;Nitrile Hydratase; Chain A;Nitrile hydratase alpha /Thiocyanate hydrolase gamma 0.8304 8 198 3.90.330.10
ID Description Score Start End GO Terms
AF-A0A537BW81-F1-model_v4 Nitrile hydratase subunit alpha 0.9878 118 198 GO:0003824
GO:0046914
AF-A0A4P7LG43-F1-model_v4 Nitrile hydratase alpha/Thiocyanate hydrolase gamma domain-containing protein 0.9871 101 202 GO:0003824
GO:0046914
AF-A0A366I773-F1-model_v4 Nitrile hydratase alpha subunit 0.9869 89 200 GO:0003824
GO:0046914
AF-A0A4V3MDZ8-F1-model_v4 deleted 0.9863 114 198
AF-A0A7W1LT99-F1-model_v4 Nitrile hydratase subunit alpha 0.9862 130 197 GO:0003824
GO:0046914

Feature Viewer

pLDDT pTM Quality
90.86 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map