F484525
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 881 | 450 | 868 | 210 |
Family's Representative Sequence
| Representative Sequence | 3300014497|Ga0182008_10110336|Ga0182008_101103362 |
| Length | 250 |
| Sequence | MKEPPMAQTHDHGDHTHPAAPMVEEISDFEILEIAVRELAIEKGLFTAEDHRKFTEWAEQIGPAGGSRLVAKAWSDPAFKARVLTDAVAACREIGIDWAEPTGQGTPSDYMELRVLEDTPTLHHVIVCTLCSCYPRPLLGHSPYWYRSPNYRRRLVRWPRQVLAEFGLVLPPEVEIRVEDSNQKCRFMVLPMRPAGTESWAEEQLAEIVTRDCMIGVALPRPDRKADDVRPVHKASRPVGGEHREPGSGP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2585427527 | Rhizobium lusitanum YR374 | Isolate | Rhizosphere |
| 2 | 2585427530 | Rhizobium tropici YR635 | Isolate | Rhizosphere |
| 3 | 2667528174 | Rhizobium sp. NFR17 | Isolate | Rhizoplane |
| 4 | 2818991439 | Agrobacterium tumefaciens 1187 | Isolate | Unclassified |
| 5 | 2818991448 | Rhizobium miluonense 1234 | Isolate | Unclassified |
| 6 | 2818991453 | Rhizobium lusitanum 1158 | Isolate | Unclassified |
| 7 | 2861691609 | Methylorubrum thiocyanatum DSM 11490 | Isolate | Rhizosphere |
| 8 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 9 | 2902405164 | Methylobacterium sp. P1-11 | Isolate | Unclassified |
| 10 | 2919408235 | Rhizobium miluonense 3199 | Isolate | Unclassified |
| 11 | 2984601300 | Rhizobium pusense SORGH_AS1083 | Isolate | Aerial Root |
| 12 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 13 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 14 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 15 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 16 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 17 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 18 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 19 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 20 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 21 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 22 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 23 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 24 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 25 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 26 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 27 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 28 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 29 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 30 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 31 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 33 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 35 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 38 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 40 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 58 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 59 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 60 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 62 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 64 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 65 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 66 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 67 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 69 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 72 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 73 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 74 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 75 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 76 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 77 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 78 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 79 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 80 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 81 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 82 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 83 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 84 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 85 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 87 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 88 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 89 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 90 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 91 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 92 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 93 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 95 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 96 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 97 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 98 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 99 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 100 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 101 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 102 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 103 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 105 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 106 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 107 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009993 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG | Metagenome | Rhizosphere |
| 118 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 119 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 129 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 132 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 133 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 134 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 135 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 136 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 137 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 138 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 139 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 140 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 141 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 142 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 143 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 144 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 145 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 146 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 147 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 148 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 149 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 150 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 151 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 152 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 153 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 154 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 155 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 156 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 157 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 158 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 208 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 212 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 213 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 214 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 215 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 216 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 217 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 218 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 219 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 220 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 221 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 222 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 223 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 224 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 225 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 226 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 227 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 228 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 229 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 230 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 231 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 232 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 233 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 234 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 235 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 236 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 237 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 238 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 239 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 240 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 241 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 242 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 243 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 244 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 245 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 246 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 247 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 248 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 249 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 250 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 251 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 252 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 253 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 254 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 255 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 256 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 257 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 258 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 259 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 260 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 261 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 262 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 263 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 264 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 265 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 266 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 267 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 268 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 269 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 270 | 3300038735 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 | Metagenome | Unclassified |
| 271 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 272 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 273 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 274 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 275 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 276 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 277 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 278 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 279 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 280 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 281 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 282 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 283 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 284 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 285 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 286 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 287 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 345 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 346 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 347 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 348 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 349 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 350 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 351 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 352 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 353 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 354 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 355 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 356 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 357 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 358 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 359 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 360 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 361 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 362 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 363 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 364 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 365 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 366 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 367 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 368 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 369 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 370 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 371 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 372 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 373 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 374 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 375 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 376 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 377 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 378 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 379 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 380 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 381 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 382 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 383 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 384 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 385 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 386 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 387 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 388 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 389 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 390 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 391 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 392 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 393 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 394 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 395 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 396 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 397 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 398 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 399 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 400 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 401 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 402 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 403 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 404 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 405 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 406 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 407 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 408 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 409 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 410 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 411 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 412 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 417 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 418 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 419 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 420 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 421 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 422 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 423 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 424 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 425 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 426 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 427 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 428 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 429 | 3300053144 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 endosphere | Metagenome | Endosphere |
| 430 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 431 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 432 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 433 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 434 | 3300059478 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 435 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 436 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 437 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 438 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 439 | 3300059513 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 440 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 441 | 3300059624 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 442 | 3300059630 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 443 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 444 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 445 | 3300059644 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 446 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 447 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 448 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 449 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 450 | 8005645114 | Rhizobium tropici IGFRI Rhizo-19 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.89 |
| Metatranscriptomes | 3.63 |
| Isolates | 1.48 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.11 |
| Bulb | 0 |
| Endosphere | 5.56 |
| Nodule | 0 |
| Rhizoplane | 6.47 |
| Rhizosphere | 83.2 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.65 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10001471 | 3300001979 | Bacteria | 10812 |
| 2 | JGI24735J21928_10000853 | 3300002067 | Bacteria | 10859 |
| 3 | JGI25162J39368_1000277 | 3300002737 | Bacteria | 48696 |
| 4 | JGI25165J46597_1000688 | 3300003214 | Bacteria | 27066 |
| 5 | rootH2_10006900 | 3300003320 | Bacteria | 4482 |
| 6 | rootH1_10144639 | 3300003323 | Bacteria | 1051 |
| 7 | Ga0055525_1000388 | 3300003759 | Bacteria | 28210 |
| 8 | Ga0055542_1000060 | 3300003762 | Bacteria | 162275 |
| 9 | Ga0055529_1000043 | 3300003763 | Bacteria | 221704 |
| 10 | Ga0055526_1004486 | 3300003771 | Bacteria | 8362 |
| 11 | Ga0055524_1002269 | 3300003775 | Bacteria | 10052 |
| 12 | Ga0055524_1007126 | 3300003775 | Bacteria | 4789 |
| 13 | Ga0055528_1000680 | 3300003790 | Bacteria | 24516 |
| 14 | Ga0058859_10042072 | 3300004798 | Unclassified | 2097 |
| 15 | Ga0058863_10089197 | 3300004799 | Unclassified | 2194 |
| 16 | Ga0058861_10086667 | 3300004800 | Unclassified | 2224 |
| 17 | Ga0058860_10046890 | 3300004801 | Unclassified | 1858 |
| 18 | Ga0058862_10192943 | 3300004803 | Unclassified | 1655 |
| 19 | Ga0065712_10146685 | 3300005290 | Bacteria | 1403 |
| 20 | Ga0065715_10299140 | 3300005293 | Unclassified | 1005 |
| 21 | Ga0070683_100140008 | 3300005329 | Unclassified | 2292 |
| 22 | Ga0070690_100081269 | 3300005330 | Unclassified | 2120 |
| 23 | Ga0070670_100006650 | 3300005331 | Bacteria | 9797 |
| 24 | Ga0068869_100000518 | 3300005334 | Bacteria | 21579 |
| 25 | Ga0070680_100251344 | 3300005336 | Bacteria | 1495 |
| 26 | Ga0070680_100476832 | 3300005336 | Unclassified | 1066 |
| 27 | Ga0070682_100026267 | 3300005337 | Unclassified | 3483 |
| 28 | Ga0070682_100039367 | 3300005337 | Bacteria | 2905 |
| 29 | Ga0068868_100097817 | 3300005338 | Unclassified | 2372 |
| 30 | Ga0068868_100834577 | 3300005338 | Bacteria | 834 |
| 31 | Ga0070660_100124200 | 3300005339 | Bacteria | 2062 |
| 32 | Ga0070689_100090192 | 3300005340 | Bacteria | 2415 |
| 33 | Ga0070691_10056432 | 3300005341 | Archaea | 1882 |
| 34 | Ga0070687_100065273 | 3300005343 | Bacteria | 1936 |
| 35 | Ga0070668_100870229 | 3300005347 | Bacteria | 804 |
| 36 | Ga0070671_100179390 | 3300005355 | Bacteria | 1793 |
| 37 | Ga0070671_100636184 | 3300005355 | Bacteria | 923 |
| 38 | Ga0070674_100328111 | 3300005356 | Bacteria | 1229 |
| 39 | Ga0070673_100009443 | 3300005364 | Bacteria | 6546 |
| 40 | Ga0070659_100078713 | 3300005366 | Bacteria | 2630 |
| 41 | Ga0070667_100131778 | 3300005367 | Bacteria | 2182 |
| 42 | Ga0070709_10040822 | 3300005434 | Bacteria | 2855 |
| 43 | Ga0070709_10042260 | 3300005434 | Bacteria | 2814 |
| 44 | Ga0070714_100090193 | 3300005435 | Bacteria | 2684 |
| 45 | Ga0070714_100173969 | 3300005435 | Bacteria | 1955 |
| 46 | Ga0070713_100079441 | 3300005436 | Bacteria | 2794 |
| 47 | Ga0070713_100090161 | 3300005436 | Bacteria | 2635 |
| 48 | Ga0070713_100114720 | 3300005436 | Unclassified | 2354 |
| 49 | Ga0070713_100385968 | 3300005436 | Bacteria | 1306 |
| 50 | Ga0070713_100585871 | 3300005436 | Bacteria | 1058 |
| 51 | Ga0070710_10019648 | 3300005437 | Bacteria | 3494 |
| 52 | Ga0070710_10174003 | 3300005437 | Bacteria | 1343 |
| 53 | Ga0070710_10224606 | 3300005437 | Bacteria | 1196 |
| 54 | Ga0070711_100121836 | 3300005439 | Bacteria | 1930 |
| 55 | Ga0070711_100356692 | 3300005439 | Bacteria | 1177 |
| 56 | Ga0070694_100007379 | 3300005444 | Bacteria | 6704 |
| 57 | Ga0070694_100224035 | 3300005444 | Bacteria | 1412 |
| 58 | Ga0070708_100081752 | 3300005445 | Bacteria | 2925 |
| 59 | Ga0070663_100057016 | 3300005455 | Bacteria | 2801 |
| 60 | Ga0070678_100001861 | 3300005456 | Bacteria | 11375 |
| 61 | Ga0070678_100167666 | 3300005456 | Unclassified | 1785 |
| 62 | Ga0070681_10193364 | 3300005458 | Bacteria | 1954 |
| 63 | Ga0068867_100001294 | 3300005459 | Bacteria | 17272 |
| 64 | Ga0070706_100298072 | 3300005467 | Bacteria | 1504 |
| 65 | Ga0070706_100549273 | 3300005467 | Bacteria | 1074 |
| 66 | Ga0070706_100645321 | 3300005467 | Bacteria | 983 |
| 67 | Ga0070707_100024932 | 3300005468 | Bacteria | 5670 |
| 68 | Ga0070707_100130996 | 3300005468 | Bacteria | 2438 |
| 69 | Ga0070707_100208537 | 3300005468 | Bacteria | 1905 |
| 70 | Ga0070707_100288586 | 3300005468 | Bacteria | 1594 |
| 71 | Ga0070698_100106932 | 3300005471 | Bacteria | 2766 |
| 72 | Ga0070698_100201851 | 3300005471 | Bacteria | 1924 |
| 73 | Ga0070698_100381059 | 3300005471 | Bacteria | 1343 |
| 74 | Ga0070698_100659981 | 3300005471 | Bacteria | 987 |
| 75 | Ga0070698_100763078 | 3300005471 | Bacteria | 910 |
| 76 | Ga0070699_100049973 | 3300005518 | Bacteria | 3619 |
| 77 | Ga0070699_100070104 | 3300005518 | Bacteria | 3047 |
| 78 | Ga0070699_100216952 | 3300005518 | Bacteria | 1704 |
| 79 | Ga0070699_100840544 | 3300005518 | Bacteria | 840 |
| 80 | Ga0070679_100499598 | 3300005530 | Bacteria | 1160 |
| 81 | Ga0070684_100274784 | 3300005535 | Bacteria | 1543 |
| 82 | Ga0070697_100036169 | 3300005536 | Bacteria | 3987 |
| 83 | Ga0070697_100143209 | 3300005536 | Unclassified | 2011 |
| 84 | Ga0070697_100166793 | 3300005536 | Bacteria | 1862 |
| 85 | Ga0070697_100930749 | 3300005536 | Bacteria | 771 |
| 86 | Ga0068853_100036380 | 3300005539 | Bacteria | 4186 |
| 87 | Ga0070672_100318333 | 3300005543 | Bacteria | 1322 |
| 88 | Ga0070695_100101329 | 3300005545 | Bacteria | 1940 |
| 89 | Ga0070695_100609462 | 3300005545 | Bacteria | 858 |
| 90 | Ga0070696_100181143 | 3300005546 | Bacteria | 1563 |
| 91 | Ga0070665_100000911 | 3300005548 | Bacteria | 37941 |
| 92 | Ga0068855_100447028 | 3300005563 | Bacteria | 1411 |
| 93 | Ga0068854_100127206 | 3300005578 | Bacteria | 1942 |
| 94 | Ga0068856_100671704 | 3300005614 | Bacteria | 1056 |
| 95 | Ga0068859_100030539 | 3300005617 | Bacteria | 5408 |
| 96 | Ga0068864_100000394 | 3300005618 | Bacteria | 38005 |
| 97 | Ga0068864_100080216 | 3300005618 | Bacteria | 2859 |
| 98 | Ga0068866_10016696 | 3300005718 | Bacteria | 3287 |
| 99 | Ga0068861_100003658 | 3300005719 | Bacteria | 10250 |
| 100 | Ga0068863_100028085 | 3300005841 | Bacteria | 5370 |
| 101 | Ga0068863_100097500 | 3300005841 | Bacteria | 2792 |
| 102 | Ga0068858_100025720 | 3300005842 | Bacteria | 5475 |
| 103 | Ga0068860_100046555 | 3300005843 | Bacteria | 4135 |
| 104 | Ga0068860_100190436 | 3300005843 | Bacteria | 1985 |
| 105 | Ga0068862_100007631 | 3300005844 | Bacteria | 8956 |
| 106 | Ga0081455_10000567 | 3300005937 | Bacteria | 48149 |
| 107 | Ga0081455_10000576 | 3300005937 | Bacteria | 47827 |
| 108 | Ga0081455_10000759 | 3300005937 | Bacteria | 41962 |
| 109 | Ga0081455_10007956 | 3300005937 | Bacteria | 11088 |
| 110 | Ga0081455_10024833 | 3300005937 | Bacteria | 5540 |
| 111 | Ga0081455_10173682 | 3300005937 | Bacteria | 1638 |
| 112 | Ga0081455_10272684 | 3300005937 | Bacteria | 1226 |
| 113 | Ga0081538_10005426 | 3300005981 | Bacteria | 11450 |
| 114 | Ga0081538_10034097 | 3300005981 | Bacteria | 3373 |
| 115 | Ga0081538_10049438 | 3300005981 | Bacteria | 2550 |
| 116 | Ga0081540_1005852 | 3300005983 | Bacteria | 9093 |
| 117 | Ga0081540_1039841 | 3300005983 | Bacteria | 2458 |
| 118 | Ga0070717_10026307 | 3300006028 | Bacteria | 4641 |
| 119 | Ga0070717_10235118 | 3300006028 | Bacteria | 1614 |
| 120 | Ga0070717_10325927 | 3300006028 | Unclassified | 1369 |
| 121 | Ga0070717_10406246 | 3300006028 | Bacteria | 1224 |
| 122 | Ga0070717_10573812 | 3300006028 | Bacteria | 1022 |
| 123 | Ga0070717_10811113 | 3300006028 | Bacteria | 851 |
| 124 | Ga0075363_100061152 | 3300006048 | Bacteria | 2029 |
| 125 | Ga0075432_10088120 | 3300006058 | Bacteria | 1133 |
| 126 | Ga0070715_10078649 | 3300006163 | Bacteria | 1491 |
| 127 | Ga0070715_10227383 | 3300006163 | Bacteria | 963 |
| 128 | Ga0070716_100005361 | 3300006173 | Bacteria | 6203 |
| 129 | Ga0070716_100035211 | 3300006173 | Bacteria | 2752 |
| 130 | Ga0070716_100608327 | 3300006173 | Bacteria | 823 |
| 131 | Ga0070712_100071523 | 3300006175 | Unclassified | 2482 |
| 132 | Ga0070712_100742530 | 3300006175 | Bacteria | 839 |
| 133 | Ga0075367_10060821 | 3300006178 | Bacteria | 2253 |
| 134 | Ga0075369_10071146 | 3300006186 | Bacteria | 1531 |
| 135 | Ga0075369_10103053 | 3300006186 | Bacteria | 1281 |
| 136 | Ga0097621_100328786 | 3300006237 | Bacteria | 1355 |
| 137 | Ga0075370_10149164 | 3300006353 | Bacteria | 1370 |
| 138 | Ga0068871_100022845 | 3300006358 | Bacteria | 4828 |
| 139 | Ga0068871_100073481 | 3300006358 | Unclassified | 2819 |
| 140 | Ga0075428_100034872 | 3300006844 | Bacteria | 5548 |
| 141 | Ga0075428_100049297 | 3300006844 | Bacteria | 4620 |
| 142 | Ga0075428_100081343 | 3300006844 | Bacteria | 3535 |
| 143 | Ga0075428_100268560 | 3300006844 | Bacteria | 1836 |
| 144 | Ga0075428_101024465 | 3300006844 | Bacteria | 873 |
| 145 | Ga0075430_100099668 | 3300006846 | Bacteria | 2426 |
| 146 | Ga0075430_100108107 | 3300006846 | Bacteria | 2320 |
| 147 | Ga0075430_100129196 | 3300006846 | Bacteria | 2106 |
| 148 | Ga0075430_100249568 | 3300006846 | Bacteria | 1471 |
| 149 | Ga0075431_100060694 | 3300006847 | Bacteria | 3901 |
| 150 | Ga0075431_100105654 | 3300006847 | Bacteria | 2905 |
| 151 | Ga0075431_100438309 | 3300006847 | Bacteria | 1304 |
| 152 | Ga0075433_10034402 | 3300006852 | Bacteria | 4352 |
| 153 | Ga0075433_10044634 | 3300006852 | Bacteria | 3852 |
| 154 | Ga0075434_100018856 | 3300006871 | Bacteria | 6669 |
| 155 | Ga0075434_100112903 | 3300006871 | Bacteria | 2729 |
| 156 | Ga0075434_100183759 | 3300006871 | Bacteria | 2111 |
| 157 | Ga0075434_100527712 | 3300006871 | Bacteria | 1201 |
| 158 | Ga0075429_100017880 | 3300006880 | Bacteria | 6129 |
| 159 | Ga0075429_100844309 | 3300006880 | Unclassified | 802 |
| 160 | Ga0068865_100018974 | 3300006881 | Bacteria | 4445 |
| 161 | Ga0097620_100030538 | 3300006931 | Bacteria | 5408 |
| 162 | Ga0075435_100051318 | 3300007076 | Bacteria | 3322 |
| 163 | Ga0075435_100072774 | 3300007076 | Bacteria | 2808 |
| 164 | Ga0075435_100155526 | 3300007076 | Bacteria | 1924 |
| 165 | Ga0075435_100425814 | 3300007076 | Bacteria | 1143 |
| 166 | Ga0075435_100595407 | 3300007076 | Bacteria | 959 |
| 167 | Ga0099794_10001551 | 3300007265 | Bacteria | 8096 |
| 168 | Ga0099794_10023217 | 3300007265 | Bacteria | 2834 |
| 169 | Ga0099794_10031658 | 3300007265 | Bacteria | 2478 |
| 170 | Ga0099795_10001879 | 3300007788 | Bacteria | 4759 |
| 171 | Ga0099795_10020732 | 3300007788 | Unclassified | 2145 |
| 172 | Ga0105240_10008535 | 3300009093 | Bacteria | 14639 |
| 173 | Ga0105240_10119821 | 3300009093 | Bacteria | 3169 |
| 174 | Ga0105240_10437721 | 3300009093 | Bacteria | 1466 |
| 175 | Ga0111539_10291181 | 3300009094 | Bacteria | 1900 |
| 176 | Ga0111539_10358644 | 3300009094 | Bacteria | 1697 |
| 177 | Ga0105245_10223690 | 3300009098 | Bacteria | 1817 |
| 178 | Ga0105245_10392510 | 3300009098 | Bacteria | 1385 |
| 179 | Ga0114129_10062387 | 3300009147 | Bacteria | 5207 |
| 180 | Ga0114129_10067933 | 3300009147 | Bacteria | 4970 |
| 181 | Ga0114129_10148400 | 3300009147 | Bacteria | 3211 |
| 182 | Ga0114129_10252066 | 3300009147 | Bacteria | 2369 |
| 183 | Ga0114129_10275304 | 3300009147 | Bacteria | 2251 |
| 184 | Ga0114129_10523420 | 3300009147 | Bacteria | 1546 |
| 185 | Ga0105243_10429824 | 3300009148 | Bacteria | 1234 |
| 186 | Ga0105242_10054783 | 3300009176 | Bacteria | 3261 |
| 187 | Ga0105248_10011661 | 3300009177 | Bacteria | 9684 |
| 188 | Ga0105248_10183414 | 3300009177 | Bacteria | 2358 |
| 189 | Ga0105248_11298418 | 3300009177 | Bacteria | 823 |
| 190 | Ga0105237_10002242 | 3300009545 | Bacteria | 24086 |
| 191 | Ga0105237_10069951 | 3300009545 | Bacteria | 3505 |
| 192 | Ga0105237_10124272 | 3300009545 | Bacteria | 2575 |
| 193 | Ga0105238_10233074 | 3300009551 | Bacteria | 1817 |
| 194 | Ga0105249_10955967 | 3300009553 | Bacteria | 925 |
| 195 | Ga0105028_103858 | 3300009993 | Bacteria | 1568 |
| 196 | Ga0099796_10004830 | 3300010159 | Bacteria | 3304 |
| 197 | Ga0099796_10012239 | 3300010159 | Bacteria | 2417 |
| 198 | Ga0099796_10053613 | 3300010159 | Bacteria | 1407 |
| 199 | Ga0105239_10005815 | 3300010375 | Bacteria | 14383 |
| 200 | Ga0157373_10038839 | 3300013100 | Bacteria | 3410 |
| 201 | Ga0157370_10007661 | 3300013104 | Bacteria | 11720 |
| 202 | Ga0157370_10023883 | 3300013104 | Bacteria | 6063 |
| 203 | Ga0157370_10249531 | 3300013104 | Bacteria | 1642 |
| 204 | Ga0157370_10831278 | 3300013104 | Bacteria | 840 |
| 205 | Ga0157369_10379039 | 3300013105 | Bacteria | 1468 |
| 206 | Ga0157369_10931309 | 3300013105 | Bacteria | 891 |
| 207 | Ga0157374_10225964 | 3300013296 | Unclassified | 1838 |
| 208 | Ga0157378_10008927 | 3300013297 | Bacteria | 8726 |
| 209 | Ga0157378_10018371 | 3300013297 | Bacteria | 6140 |
| 210 | Ga0157378_10063574 | 3300013297 | Bacteria | 3298 |
| 211 | Ga0157378_10376998 | 3300013297 | Bacteria | 1392 |
| 212 | Ga0157372_10496740 | 3300013307 | Unclassified | 1423 |
| 213 | Ga0157375_10606456 | 3300013308 | Bacteria | 1253 |
| 214 | Ga0157380_10070577 | 3300014326 | Bacteria | 2823 |
| 215 | Ga0182008_10110336 | 3300014497 | Bacteria | 1363 |
| 216 | Ga0182008_10365711 | 3300014497 | Bacteria | 768 |
| 217 | Ga0157379_10002992 | 3300014968 | Bacteria | 14252 |
| 218 | Ga0157376_10791917 | 3300014969 | Unclassified | 960 |
| 219 | Ga0182007_10000160 | 3300015262 | Bacteria | 46183 |
| 220 | Ga0182005_1012818 | 3300015265 | Bacteria | 2362 |
| 221 | Ga0197907_10778953 | 3300020069 | Unclassified | 2201 |
| 222 | Ga0206356_10484009 | 3300020070 | Archaea | 1790 |
| 223 | Ga0206349_1455224 | 3300020075 | Unclassified | 2254 |
| 224 | Ga0206355_1420413 | 3300020076 | Unclassified | 2034 |
| 225 | Ga0206351_10982550 | 3300020077 | Unclassified | 2146 |
| 226 | Ga0206352_10093453 | 3300020078 | Unclassified | 2230 |
| 227 | Ga0206350_11309462 | 3300020080 | Unclassified | 2053 |
| 228 | Ga0206354_11227028 | 3300020081 | Unclassified | 2129 |
| 229 | Ga0206353_11257201 | 3300020082 | Unclassified | 2120 |
| 230 | Ga0154015_1016679 | 3300020610 | Unclassified | 1997 |
| 231 | Ga0213873_10042582 | 3300021358 | Bacteria | 1175 |
| 232 | Ga0213873_10047742 | 3300021358 | Bacteria | 1124 |
| 233 | Ga0213872_10085182 | 3300021361 | Bacteria | 1417 |
| 234 | Ga0213872_10115926 | 3300021361 | Bacteria | 1187 |
| 235 | Ga0213876_10053268 | 3300021384 | Bacteria | 2138 |
| 236 | Ga0213875_10000012 | 3300021388 | Bacteria | 312017 |
| 237 | Ga0213875_10195428 | 3300021388 | Bacteria | 952 |
| 238 | Ga0213871_10012123 | 3300021441 | Bacteria | 1994 |
| 239 | Ga0213871_10014157 | 3300021441 | Bacteria | 1887 |
| 240 | Ga0224712_10021149 | 3300022467 | Unclassified | 2222 |
| 241 | Ga0209563_100106 | 3300025230 | Bacteria | 146256 |
| 242 | Ga0207427_109633 | 3300025231 | Bacteria | 1031 |
| 243 | Ga0209437_100078 | 3300025233 | Bacteria | 278088 |
| 244 | Ga0209148_1000017 | 3300025254 | Bacteria | 787064 |
| 245 | Ga0209233_1000163 | 3300025261 | Bacteria | 152912 |
| 246 | Ga0209233_1000463 | 3300025261 | Bacteria | 25873 |
| 247 | Ga0209455_1000005 | 3300025272 | Bacteria | 1416756 |
| 248 | Ga0209673_1001165 | 3300025273 | Bacteria | 28659 |
| 249 | Ga0209564_1001589 | 3300025295 | Bacteria | 22197 |
| 250 | Ga0209256_1001586 | 3300025299 | Bacteria | 22257 |
| 251 | Ga0207692_10005609 | 3300025898 | Bacteria | 5036 |
| 252 | Ga0207692_10010022 | 3300025898 | Bacteria | 3976 |
| 253 | Ga0207692_10124317 | 3300025898 | Bacteria | 1449 |
| 254 | Ga0207710_10042272 | 3300025900 | Bacteria | 2024 |
| 255 | Ga0207680_10044877 | 3300025903 | Bacteria | 2603 |
| 256 | Ga0207680_10358733 | 3300025903 | Bacteria | 1025 |
| 257 | Ga0207685_10067805 | 3300025905 | Bacteria | 1436 |
| 258 | Ga0207685_10084150 | 3300025905 | Bacteria | 1324 |
| 259 | Ga0207699_10023641 | 3300025906 | Bacteria | 3347 |
| 260 | Ga0207699_10170550 | 3300025906 | Bacteria | 1455 |
| 261 | Ga0207645_10041895 | 3300025907 | Bacteria | 2930 |
| 262 | Ga0207643_10032438 | 3300025908 | Bacteria | 2917 |
| 263 | Ga0207707_10171389 | 3300025912 | Bacteria | 1897 |
| 264 | Ga0207671_10002514 | 3300025914 | Bacteria | 19571 |
| 265 | Ga0207693_10032075 | 3300025915 | Bacteria | 4147 |
| 266 | Ga0207693_10172970 | 3300025915 | Unclassified | 1700 |
| 267 | Ga0207693_10191026 | 3300025915 | Bacteria | 1611 |
| 268 | Ga0207663_10027466 | 3300025916 | Bacteria | 3318 |
| 269 | Ga0207663_10199844 | 3300025916 | Bacteria | 1441 |
| 270 | Ga0207663_10358616 | 3300025916 | Bacteria | 1105 |
| 271 | Ga0207663_10465404 | 3300025916 | Bacteria | 977 |
| 272 | Ga0207662_10177411 | 3300025918 | Bacteria | 1369 |
| 273 | Ga0207646_10189678 | 3300025922 | Unclassified | 1856 |
| 274 | Ga0207646_10397339 | 3300025922 | Bacteria | 1245 |
| 275 | Ga0207681_10086980 | 3300025923 | Bacteria | 2222 |
| 276 | Ga0207650_10715897 | 3300025925 | Bacteria | 846 |
| 277 | Ga0207687_10662019 | 3300025927 | Bacteria | 884 |
| 278 | Ga0207700_10064060 | 3300025928 | Unclassified | 2798 |
| 279 | Ga0207700_10145858 | 3300025928 | Bacteria | 1950 |
| 280 | Ga0207664_10002993 | 3300025929 | Bacteria | 11226 |
| 281 | Ga0207664_10031526 | 3300025929 | Bacteria | 4056 |
| 282 | Ga0207664_10086116 | 3300025929 | Bacteria | 2566 |
| 283 | Ga0207664_10197837 | 3300025929 | Bacteria | 1733 |
| 284 | Ga0207664_10284300 | 3300025929 | Bacteria | 1452 |
| 285 | Ga0207664_10338989 | 3300025929 | Bacteria | 1329 |
| 286 | Ga0207644_10368623 | 3300025931 | Bacteria | 1169 |
| 287 | Ga0207706_10099286 | 3300025933 | Bacteria | 2561 |
| 288 | Ga0207709_10048761 | 3300025935 | Bacteria | 2582 |
| 289 | Ga0207709_10560847 | 3300025935 | Bacteria | 899 |
| 290 | Ga0207670_10121115 | 3300025936 | Bacteria | 1902 |
| 291 | Ga0207704_10005581 | 3300025938 | Bacteria | 5802 |
| 292 | Ga0207665_10106406 | 3300025939 | Bacteria | 1965 |
| 293 | Ga0207691_10169702 | 3300025940 | Bacteria | 1911 |
| 294 | Ga0207711_10662996 | 3300025941 | Bacteria | 973 |
| 295 | Ga0207711_11056212 | 3300025941 | Bacteria | 752 |
| 296 | Ga0207689_10000215 | 3300025942 | Bacteria | 51175 |
| 297 | Ga0207661_10488745 | 3300025944 | Unclassified | 1124 |
| 298 | Ga0207667_10205285 | 3300025949 | Bacteria | 2021 |
| 299 | Ga0207651_10018579 | 3300025960 | Bacteria | 4142 |
| 300 | Ga0207640_10012155 | 3300025981 | Bacteria | 4896 |
| 301 | Ga0207658_10166869 | 3300025986 | Bacteria | 1809 |
| 302 | Ga0207677_10105217 | 3300026023 | Unclassified | 2088 |
| 303 | Ga0207677_10503135 | 3300026023 | Bacteria | 1048 |
| 304 | Ga0207703_10068215 | 3300026035 | Bacteria | 2930 |
| 305 | Ga0207639_10030887 | 3300026041 | Bacteria | 3933 |
| 306 | Ga0207678_10157997 | 3300026067 | Bacteria | 1936 |
| 307 | Ga0207678_10230260 | 3300026067 | Bacteria | 1587 |
| 308 | Ga0207702_10302054 | 3300026078 | Bacteria | 1519 |
| 309 | Ga0207641_10106131 | 3300026088 | Bacteria | 2482 |
| 310 | Ga0207648_10000620 | 3300026089 | Bacteria | 39786 |
| 311 | Ga0207648_10237341 | 3300026089 | Bacteria | 1623 |
| 312 | Ga0207674_10015306 | 3300026116 | Bacteria | 8431 |
| 313 | Ga0207675_100001798 | 3300026118 | Bacteria | 21469 |
| 314 | Ga0207683_10009395 | 3300026121 | Bacteria | 8331 |
| 315 | Ga0207683_10196666 | 3300026121 | Unclassified | 1832 |
| 316 | Ga0209179_1002907 | 3300027512 | Bacteria | 2391 |
| 317 | Ga0209968_1004456 | 3300027526 | Unclassified | 2103 |
| 318 | Ga0209982_1007401 | 3300027552 | Bacteria | 1604 |
| 319 | Ga0209983_1011064 | 3300027665 | Bacteria | 1846 |
| 320 | Ga0209588_1053116 | 3300027671 | Bacteria | 1311 |
| 321 | Ga0209998_10021992 | 3300027717 | Bacteria | 1373 |
| 322 | Ga0209974_10000995 | 3300027876 | Bacteria | 9973 |
| 323 | Ga0209974_10046838 | 3300027876 | Bacteria | 1447 |
| 324 | Ga0207428_10086085 | 3300027907 | Bacteria | 2446 |
| 325 | Ga0207428_10197180 | 3300027907 | Bacteria | 1516 |
| 326 | Ga0268266_10125643 | 3300028379 | Bacteria | 2288 |
| 327 | Ga0268265_10151135 | 3300028380 | Bacteria | 1959 |
| 328 | Ga0268264_10009612 | 3300028381 | Bacteria | 8011 |
| 329 | Ga0268264_10229111 | 3300028381 | Bacteria | 1715 |
| 330 | Ga0265337_1003286 | 3300028556 | Bacteria | 7064 |
| 331 | Ga0307517_10045840 | 3300028786 | Bacteria | 4580 |
| 332 | Ga0265338_10267897 | 3300028800 | Bacteria | 1253 |
| 333 | Ga0265770_1006705 | 3300030878 | Bacteria | 1604 |
| 334 | Ga0265332_10096917 | 3300031238 | Bacteria | 1245 |
| 335 | Ga0265325_10045164 | 3300031241 | Bacteria | 2290 |
| 336 | Ga0265340_10016673 | 3300031247 | Bacteria | 3802 |
| 337 | Ga0265340_10029882 | 3300031247 | Bacteria | 2735 |
| 338 | Ga0265339_10000052 | 3300031249 | Bacteria | 101603 |
| 339 | Ga0265339_10000195 | 3300031249 | Bacteria | 50154 |
| 340 | Ga0265339_10024316 | 3300031249 | Bacteria | 3492 |
| 341 | Ga0265339_10218072 | 3300031249 | Bacteria | 934 |
| 342 | Ga0265316_10000300 | 3300031344 | Bacteria | 55381 |
| 343 | Ga0307509_10000177 | 3300031507 | Bacteria | 100248 |
| 344 | Ga0307509_10104000 | 3300031507 | Bacteria | 2866 |
| 345 | Ga0265313_10000318 | 3300031595 | Bacteria | 52390 |
| 346 | Ga0265313_10047456 | 3300031595 | Bacteria | 2078 |
| 347 | Ga0265313_10047995 | 3300031595 | Bacteria | 2063 |
| 348 | Ga0316575_10064273 | 3300031665 | Bacteria | 1469 |
| 349 | Ga0316579_10000907 | 3300031691 | Bacteria | 10272 |
| 350 | Ga0316579_10001630 | 3300031691 | Bacteria | 8226 |
| 351 | Ga0265314_10000002 | 3300031711 | Bacteria | 2092193 |
| 352 | Ga0265314_10054403 | 3300031711 | Bacteria | 2770 |
| 353 | Ga0316576_10002342 | 3300031727 | Bacteria | 10765 |
| 354 | Ga0316576_10023850 | 3300031727 | Bacteria | 4267 |
| 355 | Ga0316576_10266991 | 3300031727 | Bacteria | 1283 |
| 356 | Ga0316578_10011663 | 3300031728 | Bacteria | 4609 |
| 357 | Ga0316578_10013443 | 3300031728 | Bacteria | 4343 |
| 358 | Ga0316578_10028349 | 3300031728 | Bacteria | 3170 |
| 359 | Ga0307516_10051054 | 3300031730 | Bacteria | 4055 |
| 360 | Ga0316577_10004132 | 3300031733 | Bacteria | 7451 |
| 361 | Ga0316577_10020484 | 3300031733 | Bacteria | 3665 |
| 362 | Ga0316577_10151068 | 3300031733 | Bacteria | 1309 |
| 363 | Ga0307406_10096425 | 3300031901 | Bacteria | 2004 |
| 364 | Ga0316583_10032531 | 3300032133 | Bacteria | 1854 |
| 365 | Ga0316585_10020009 | 3300032137 | Bacteria | 2045 |
| 366 | Ga0316588_1041902 | 3300033528 | Bacteria | 1096 |
| 367 | Ga0316596_1012231 | 3300033541 | Bacteria | 2109 |
| 368 | Ga0373934_0069808 | 3300035086 | Bacteria | 1404 |
| 369 | Ga0373944_0089435 | 3300035089 | Bacteria | 1027 |
| 370 | Ga0373949_0001647 | 3300035090 | Bacteria | 6229 |
| 371 | Ga0373952_0000264 | 3300035092 | Bacteria | 8612 |
| 372 | Ga0373923_0015498 | 3300035111 | Bacteria | 2879 |
| 373 | Ga0373932_0110822 | 3300035112 | Bacteria | 904 |
| 374 | Ga0373936_0000020 | 3300035113 | Bacteria | 142589 |
| 375 | Ga0373936_0001304 | 3300035113 | Bacteria | 9034 |
| 376 | Ga0373939_0092452 | 3300035114 | Bacteria | 1025 |
| 377 | Ga0373941_0004708 | 3300035115 | Bacteria | 3172 |
| 378 | Ga0373945_0025200 | 3300035116 | Bacteria | 2065 |
| 379 | Ga0373953_0006486 | 3300035117 | Bacteria | 3857 |
| 380 | Ga0373954_0003435 | 3300035118 | Bacteria | 6717 |
| 381 | Ga0373954_0017819 | 3300035118 | Bacteria | 3193 |
| 382 | Ga0373954_0221043 | 3300035118 | Bacteria | 932 |
| 383 | Ga0373954_0285819 | 3300035118 | Bacteria | 813 |
| 384 | Ga0373960_0001739 | 3300035121 | Bacteria | 4877 |
| 385 | Ga0373960_0051947 | 3300035121 | Bacteria | 1219 |
| 386 | Ga0373943_0103227 | 3300035170 | Bacteria | 1494 |
| 387 | Ga0373943_0179917 | 3300035170 | Bacteria | 1162 |
| 388 | Ga0373946_0000442 | 3300035171 | Bacteria | 13617 |
| 389 | Ga0373946_0047787 | 3300035171 | Bacteria | 1778 |
| 390 | Ga0373955_0005573 | 3300035172 | Bacteria | 5660 |
| 391 | Ga0373942_0083265 | 3300035207 | Bacteria | 953 |
| 392 | Ga0373961_0054789 | 3300035241 | Unclassified | 1193 |
| 393 | Ga0316574_0018417 | 3300035398 | Bacteria | 4103 |
| 394 | Ga0316574_0085714 | 3300035398 | Bacteria | 2004 |
| 395 | Ga0373924_0000432 | 3300035410 | Bacteria | 12866 |
| 396 | Ga0373924_0085533 | 3300035410 | Bacteria | 1345 |
| 397 | Ga0373924_0214187 | 3300035410 | Bacteria | 850 |
| 398 | Ga0373924_0231023 | 3300035410 | Bacteria | 818 |
| 399 | Ga0373931_0224265 | 3300035691 | Bacteria | 1133 |
| 400 | Ga0373935_0000370 | 3300035692 | Bacteria | 23018 |
| 401 | Ga0373935_0077822 | 3300035692 | Bacteria | 2150 |
| 402 | Ga0373935_0133751 | 3300035692 | Bacteria | 1669 |
| 403 | Ga0373927_0277319 | 3300035695 | Bacteria | 1103 |
| 404 | Ga0373933_0004813 | 3300035724 | Bacteria | 7379 |
| 405 | Ga0373933_0026832 | 3300035724 | Bacteria | 3311 |
| 406 | Ga0373933_0110412 | 3300035724 | Bacteria | 1715 |
| 407 | Ga0373933_0118762 | 3300035724 | Bacteria | 1655 |
| 408 | Ga0373947_0000476 | 3300035725 | Bacteria | 22980 |
| 409 | Ga0373947_0194922 | 3300035725 | Bacteria | 1323 |
| 410 | Ga0373937_0000009 | 3300036401 | Bacteria | 169521 |
| 411 | Ga0373937_0005182 | 3300036401 | Bacteria | 11122 |
| 412 | Ga0373937_0036036 | 3300036401 | Bacteria | 4507 |
| 413 | Ga0373937_0235830 | 3300036401 | Bacteria | 1723 |
| 414 | Ga0373937_0313292 | 3300036401 | Bacteria | 1484 |
| 415 | Ga0373937_0820526 | 3300036401 | Bacteria | 878 |
| 416 | Ga0316582_0000071 | 3300036647 | Bacteria | 25766 |
| 417 | Ga0316582_0049554 | 3300036647 | Bacteria | 2657 |
| 418 | Ga0316582_0150545 | 3300036647 | Bacteria | 1573 |
| 419 | Ga0316584_0000431 | 3300036712 | Bacteria | 21725 |
| 420 | Ga0316584_0003128 | 3300036712 | Bacteria | 10698 |
| 421 | Ga0316584_0039055 | 3300036712 | Bacteria | 3533 |
| 422 | Ga0316584_0049428 | 3300036712 | Bacteria | 3143 |
| 423 | Ga0373925_0000194 | 3300037068 | Bacteria | 66124 |
| 424 | Ga0373925_0181292 | 3300037068 | Bacteria | 1667 |
| 425 | Ga0373925_0223044 | 3300037068 | Bacteria | 1505 |
| 426 | Ga0395899_0000039 | 3300037312 | Bacteria | 269620 |
| 427 | Ga0395900_0161766 | 3300037418 | Bacteria | 2283 |
| 428 | Ga0395900_0695846 | 3300037418 | Bacteria | 950 |
| 429 | Ga0395898_0000051 | 3300037466 | Bacteria | 281872 |
| 430 | Ga0395898_0190092 | 3300037466 | Bacteria | 1962 |
| 431 | Ga0395898_0582130 | 3300037466 | Bacteria | 1062 |
| 432 | Ga0395905_0021914 | 3300037471 | Bacteria | 6043 |
| 433 | Ga0395905_0285138 | 3300037471 | Bacteria | 1538 |
| 434 | Ga0316581_0008892 | 3300037588 | Bacteria | 2747 |
| 435 | Ga0436364_0005137 | 3300037853 | Bacteria | 1519 |
| 436 | Ga0436364_0478958 | 3300037853 | Bacteria | 2468 |
| 437 | Ga0436364_0719253 | 3300037853 | Bacteria | 1680 |
| 438 | Ga0395901_0026797 | 3300038443 | Bacteria | 5918 |
| 439 | Ga0400485_22206 | 3300038735 | Bacteria | 1467 |
| 440 | Ga0242420_001000 | 3300038996 | Unclassified | 3580 |
| 441 | Ga0400487_54806 | 3300039110 | Bacteria | 2264 |
| 442 | Ga0436365_0147248 | 3300039437 | Bacteria | 3410 |
| 443 | Ga0436365_0353660 | 3300039437 | Bacteria | 3442 |
| 444 | Ga0436365_0509139 | 3300039437 | Bacteria | 998 |
| 445 | Ga0436365_0922321 | 3300039437 | Bacteria | 2721 |
| 446 | Ga0436365_1460405 | 3300039437 | Bacteria | 2566 |
| 447 | Ga0436365_1838315 | 3300039437 | Bacteria | 8288 |
| 448 | Ga0436360_1121536 | 3300039438 | Bacteria | 946 |
| 449 | Ga0436360_1138920 | 3300039438 | Bacteria | 6564 |
| 450 | Ga0436360_1198600 | 3300039438 | Bacteria | 938 |
| 451 | Ga0436361_0090326 | 3300039447 | Bacteria | 1043 |
| 452 | Ga0436361_0559050 | 3300039447 | Bacteria | 1447 |
| 453 | Ga0436361_0926373 | 3300039447 | Bacteria | 19457 |
| 454 | Ga0436361_0955955 | 3300039447 | Bacteria | 3659 |
| 455 | Ga0436363_0506886 | 3300039450 | Bacteria | 958 |
| 456 | Ga0436363_1720038 | 3300039450 | Bacteria | 946 |
| 457 | Ga0436362_0261986 | 3300039453 | Bacteria | 1298 |
| 458 | Ga0436362_0454622 | 3300039453 | Bacteria | 2360 |
| 459 | Ga0436362_0578135 | 3300039453 | Bacteria | 1279 |
| 460 | Ga0436362_0723249 | 3300039453 | Bacteria | 2034 |
| 461 | Ga0436362_0899014 | 3300039453 | Bacteria | 870 |
| 462 | Ga0439462_0021112 | 3300042015 | Bacteria | 1700 |
| 463 | Ga0466965_0080054 | 3300044683 | Bacteria | 1651 |
| 464 | Ga0466966_0163454 | 3300044684 | Bacteria | 1355 |
| 465 | Ga0466963_0062019 | 3300044694 | Bacteria | 2501 |
| 466 | Ga0466963_0138795 | 3300044694 | Bacteria | 1683 |
| 467 | Ga0466963_0563093 | 3300044694 | Bacteria | 805 |
| 468 | Ga0466971_0000088 | 3300044719 | Bacteria | 33636 |
| 469 | Ga0466957_0046391 | 3300044842 | Bacteria | 2638 |
| 470 | Ga0466959_0037942 | 3300045049 | Bacteria | 3561 |
| 471 | Ga0451576_0000424 | 3300045051 | Bacteria | 97297 |
| 472 | Ga0451576_0085164 | 3300045051 | Bacteria | 3288 |
| 473 | Ga0451576_0498432 | 3300045051 | Bacteria | 1279 |
| 474 | Ga0466967_0012356 | 3300045976 | Bacteria | 6527 |
| 475 | Ga0466967_0073576 | 3300045976 | Bacteria | 3066 |
| 476 | Ga0466967_0184790 | 3300045976 | Bacteria | 1968 |
| 477 | Ga0466967_0925219 | 3300045976 | Bacteria | 867 |
| 478 | Ga0495592_0000018 | 3300046454 | Bacteria | 140962 |
| 479 | Ga0495603_0000898 | 3300046455 | Bacteria | 17131 |
| 480 | Ga0495591_013627 | 3300046458 | Bacteria | 2962 |
| 481 | Ga0495629_0000267 | 3300046459 | Bacteria | 45302 |
| 482 | Ga0495629_0004511 | 3300046459 | Bacteria | 10415 |
| 483 | Ga0495629_0275977 | 3300046459 | Bacteria | 1154 |
| 484 | Ga0495638_0045888 | 3300046460 | Bacteria | 2747 |
| 485 | Ga0495651_0001122 | 3300046462 | Bacteria | 20711 |
| 486 | Ga0495653_0000032 | 3300046463 | Bacteria | 132763 |
| 487 | Ga0495653_0132616 | 3300046463 | Bacteria | 1761 |
| 488 | Ga0495650_0000523 | 3300046471 | Bacteria | 56288 |
| 489 | Ga0495580_0006425 | 3300046472 | Bacteria | 9568 |
| 490 | Ga0495580_0275798 | 3300046472 | Bacteria | 1148 |
| 491 | Ga0495662_0023189 | 3300046476 | Bacteria | 2997 |
| 492 | Ga0495664_0000010 | 3300046477 | Bacteria | 268381 |
| 493 | Ga0495664_0025929 | 3300046477 | Bacteria | 3413 |
| 494 | Ga0495584_0028056 | 3300046491 | Bacteria | 2851 |
| 495 | Ga0495594_0378972 | 3300046499 | Bacteria | 805 |
| 496 | Ga0495607_0298236 | 3300046501 | Bacteria | 759 |
| 497 | Ga0495606_0067615 | 3300046507 | Bacteria | 2262 |
| 498 | Ga0495606_0390781 | 3300046507 | Bacteria | 727 |
| 499 | Ga0495608_0000008 | 3300046511 | Bacteria | 268629 |
| 500 | Ga0495608_0247248 | 3300046511 | Bacteria | 1113 |
| 501 | Ga0495618_0000002 | 3300046514 | Bacteria | 271353 |
| 502 | Ga0495628_0000009 | 3300046516 | Bacteria | 237611 |
| 503 | Ga0495630_0001850 | 3300046517 | Bacteria | 14780 |
| 504 | Ga0495648_0005048 | 3300046524 | Bacteria | 11084 |
| 505 | Ga0495642_0001548 | 3300046528 | Bacteria | 10151 |
| 506 | Ga0495652_0000011 | 3300046529 | Bacteria | 255329 |
| 507 | Ga0495654_0033722 | 3300046530 | Bacteria | 2589 |
| 508 | Ga0495640_0000009 | 3300046533 | Bacteria | 217086 |
| 509 | Ga0495640_0097433 | 3300046533 | Bacteria | 1934 |
| 510 | Ga0495640_0153499 | 3300046533 | Bacteria | 1478 |
| 511 | Ga0495587_0000006 | 3300046536 | Bacteria | 310070 |
| 512 | Ga0495598_0064423 | 3300046537 | Bacteria | 1139 |
| 513 | Ga0495598_0223097 | 3300046537 | Bacteria | 689 |
| 514 | Ga0495621_0073283 | 3300046539 | Bacteria | 1265 |
| 515 | Ga0495645_0000010 | 3300046543 | Bacteria | 238337 |
| 516 | Ga0495645_0002332 | 3300046543 | Bacteria | 12884 |
| 517 | Ga0495645_0128622 | 3300046543 | Bacteria | 1777 |
| 518 | Ga0495667_0000005 | 3300046559 | Bacteria | 268252 |
| 519 | Ga0495667_0023171 | 3300046559 | Bacteria | 4184 |
| 520 | Ga0495634_0000223 | 3300046642 | Bacteria | 53103 |
| 521 | Ga0495635_0000008 | 3300046663 | Bacteria | 268349 |
| 522 | Ga0495635_0190932 | 3300046663 | Bacteria | 1391 |
| 523 | Ga0495659_0043020 | 3300046664 | Bacteria | 1619 |
| 524 | Ga0495657_0000058 | 3300046675 | Bacteria | 97827 |
| 525 | Ga0495599_0000007 | 3300046678 | Bacteria | 236638 |
| 526 | Ga0495599_0148253 | 3300046678 | Bacteria | 1454 |
| 527 | Ga0495623_0005790 | 3300046679 | Bacteria | 8063 |
| 528 | Ga0495623_0101578 | 3300046679 | Bacteria | 1752 |
| 529 | Ga0495646_0000021 | 3300046680 | Bacteria | 115358 |
| 530 | Ga0495647_0218731 | 3300046681 | Bacteria | 840 |
| 531 | Ga0495658_0120777 | 3300046683 | Bacteria | 1585 |
| 532 | Ga0495658_0263706 | 3300046683 | Bacteria | 1085 |
| 533 | Ga0495669_0049667 | 3300046684 | Bacteria | 1879 |
| 534 | Ga0495669_0114131 | 3300046684 | Bacteria | 1263 |
| 535 | Ga0495669_0133609 | 3300046684 | Bacteria | 1169 |
| 536 | Ga0495613_0292797 | 3300046689 | Bacteria | 1128 |
| 537 | Ga0495624_0007573 | 3300046690 | Bacteria | 7619 |
| 538 | Ga0495649_0051061 | 3300046694 | Bacteria | 2243 |
| 539 | Ga0495649_0176326 | 3300046694 | Bacteria | 1117 |
| 540 | Ga0495589_0091173 | 3300046794 | Bacteria | 1480 |
| 541 | Ga0495600_0000001 | 3300046809 | Bacteria | 214870 |
| 542 | Ga0495600_0267744 | 3300046809 | Bacteria | 1084 |
| 543 | Ga0495581_0001676 | 3300047315 | Bacteria | 12341 |
| 544 | Ga0495581_0005192 | 3300047315 | Bacteria | 7535 |
| 545 | Ga0495581_0300992 | 3300047315 | Bacteria | 937 |
| 546 | Ga0495604_0000012 | 3300047317 | Bacteria | 268341 |
| 547 | Ga0495674_0000011 | 3300047319 | Bacteria | 270911 |
| 548 | Ga0495674_0081998 | 3300047319 | Bacteria | 2766 |
| 549 | Ga0495672_0174136 | 3300047320 | Bacteria | 1095 |
| 550 | Ga0495676_0124674 | 3300047321 | Bacteria | 1868 |
| 551 | Ga0495676_0709573 | 3300047321 | Bacteria | 650 |
| 552 | Ga0495680_0001281 | 3300047322 | Bacteria | 27427 |
| 553 | Ga0495680_0262945 | 3300047322 | Bacteria | 1220 |
| 554 | Ga0495683_0028336 | 3300047323 | Bacteria | 2863 |
| 555 | Ga0495687_004265 | 3300047443 | Bacteria | 9786 |
| 556 | Ga0495675_0000096 | 3300047444 | Bacteria | 62617 |
| 557 | Ga0495684_0000084 | 3300047471 | Bacteria | 65600 |
| 558 | Ga0495686_0021343 | 3300047472 | Bacteria | 4303 |
| 559 | Ga0495593_0000727 | 3300047673 | Bacteria | 19074 |
| 560 | Ga0495593_0084241 | 3300047673 | Bacteria | 1641 |
| 561 | Ga0495593_0271481 | 3300047673 | Bacteria | 849 |
| 562 | Ga0495602_0000073 | 3300048088 | Bacteria | 98745 |
| 563 | Ga0495602_0146322 | 3300048088 | Bacteria | 1864 |
| 564 | Ga0495602_0251698 | 3300048088 | Bacteria | 1316 |
| 565 | Ga0496100_0060233 | 3300048903 | Bacteria | 2498 |
| 566 | Ga0496100_0066496 | 3300048903 | Bacteria | 2391 |
| 567 | Ga0496100_0276526 | 3300048903 | Bacteria | 1250 |
| 568 | Ga0496101_0004742 | 3300048904 | Bacteria | 8620 |
| 569 | Ga0496101_0364872 | 3300048904 | Bacteria | 1136 |
| 570 | Ga0496102_0015589 | 3300048905 | Bacteria | 6621 |
| 571 | Ga0496102_0071229 | 3300048905 | Bacteria | 3192 |
| 572 | Ga0496102_0607427 | 3300048905 | Unclassified | 1017 |
| 573 | Ga0496103_0116176 | 3300048906 | Bacteria | 1702 |
| 574 | Ga0496103_0366263 | 3300048906 | Bacteria | 926 |
| 575 | Ga0496104_0070167 | 3300048907 | Bacteria | 3330 |
| 576 | Ga0496104_0164835 | 3300048907 | Unclassified | 2125 |
| 577 | Ga0496104_0241926 | 3300048907 | Bacteria | 1717 |
| 578 | Ga0496104_0329160 | 3300048907 | Unclassified | 1441 |
| 579 | Ga0496104_0504303 | 3300048907 | Bacteria | 1121 |
| 580 | Ga0496105_0021445 | 3300048908 | Bacteria | 5227 |
| 581 | Ga0496105_0094452 | 3300048908 | Bacteria | 2470 |
| 582 | Ga0496105_0103494 | 3300048908 | Bacteria | 2351 |
| 583 | Ga0496105_0122743 | 3300048908 | Bacteria | 2142 |
| 584 | Ga0496105_0135221 | 3300048908 | Bacteria | 2031 |
| 585 | Ga0496105_0167307 | 3300048908 | Bacteria | 1803 |
| 586 | Ga0496105_0278486 | 3300048908 | Bacteria | 1349 |
| 587 | Ga0496106_0088567 | 3300048909 | Unclassified | 2386 |
| 588 | Ga0496106_0132600 | 3300048909 | Bacteria | 1954 |
| 589 | Ga0496107_0022356 | 3300048910 | Bacteria | 4469 |
| 590 | Ga0496107_0135397 | 3300048910 | Bacteria | 1820 |
| 591 | Ga0496107_0138383 | 3300048910 | Bacteria | 1799 |
| 592 | Ga0496107_0195253 | 3300048910 | Bacteria | 1504 |
| 593 | Ga0496107_0279402 | 3300048910 | Unclassified | 1243 |
| 594 | Ga0496108_0052495 | 3300048911 | Unclassified | 3417 |
| 595 | Ga0496109_0071103 | 3300048912 | Bacteria | 3194 |
| 596 | Ga0496109_0078965 | 3300048912 | Bacteria | 3031 |
| 597 | Ga0496109_0152040 | 3300048912 | Bacteria | 2167 |
| 598 | Ga0496109_0217645 | 3300048912 | Unclassified | 1796 |
| 599 | Ga0496110_0039292 | 3300048913 | Bacteria | 4120 |
| 600 | Ga0496110_0053471 | 3300048913 | Bacteria | 3550 |
| 601 | Ga0496110_0124637 | 3300048913 | Bacteria | 2324 |
| 602 | Ga0496110_0413320 | 3300048913 | Bacteria | 1230 |
| 603 | Ga0496111_0070795 | 3300048914 | Bacteria | 2537 |
| 604 | Ga0496112_0055415 | 3300048915 | Bacteria | 3898 |
| 605 | Ga0496112_0074067 | 3300048915 | Bacteria | 3367 |
| 606 | Ga0496112_0300527 | 3300048915 | Bacteria | 1550 |
| 607 | Ga0496112_0328687 | 3300048915 | Bacteria | 1473 |
| 608 | Ga0496112_0502964 | 3300048915 | Bacteria | 1147 |
| 609 | Ga0496113_0019088 | 3300048916 | Bacteria | 4790 |
| 610 | Ga0496113_0201809 | 3300048916 | Unclassified | 1581 |
| 611 | Ga0496114_0000748 | 3300048917 | Bacteria | 24240 |
| 612 | Ga0496114_0009701 | 3300048917 | Bacteria | 7647 |
| 613 | Ga0496114_0021798 | 3300048917 | Bacteria | 5214 |
| 614 | Ga0496114_1006043 | 3300048917 | Bacteria | 717 |
| 615 | Ga0496115_0012871 | 3300048918 | Bacteria | 6308 |
| 616 | Ga0496115_0050576 | 3300048918 | Bacteria | 3330 |
| 617 | Ga0496115_0066506 | 3300048918 | Bacteria | 2913 |
| 618 | Ga0496115_0070013 | 3300048918 | Bacteria | 2843 |
| 619 | Ga0496115_0118606 | 3300048918 | Bacteria | 2176 |
| 620 | Ga0496115_0522568 | 3300048918 | Bacteria | 951 |
| 621 | Ga0496116_0011585 | 3300048919 | Bacteria | 7281 |
| 622 | Ga0496116_0057432 | 3300048919 | Bacteria | 2544 |
| 623 | Ga0496116_0089581 | 3300048919 | Bacteria | 1876 |
| 624 | Ga0496117_0078347 | 3300048920 | Bacteria | 2182 |
| 625 | Ga0496118_0027838 | 3300048921 | Bacteria | 4774 |
| 626 | Ga0496119_0020352 | 3300048922 | Bacteria | 4845 |
| 627 | Ga0496120_0056006 | 3300048923 | Bacteria | 2227 |
| 628 | Ga0496124_0002688 | 3300048927 | Bacteria | 22761 |
| 629 | Ga0496126_0036346 | 3300048929 | Bacteria | 4605 |
| 630 | Ga0496126_0397263 | 3300048929 | Bacteria | 1119 |
| 631 | Ga0501031_0001977 | 3300049568 | Bacteria | 12946 |
| 632 | Ga0501032_0000037 | 3300049569 | Bacteria | 116729 |
| 633 | Ga0501032_0103539 | 3300049569 | Bacteria | 1886 |
| 634 | Ga0501032_0111022 | 3300049569 | Bacteria | 1814 |
| 635 | Ga0501033_0000009 | 3300049570 | Bacteria | 272351 |
| 636 | Ga0501033_0000033 | 3300049570 | Bacteria | 154380 |
| 637 | Ga0501033_0000035 | 3300049570 | Bacteria | 150558 |
| 638 | Ga0501033_0100386 | 3300049570 | Bacteria | 2112 |
| 639 | Ga0501033_0291957 | 3300049570 | Bacteria | 1149 |
| 640 | Ga0501036_0009934 | 3300049572 | Bacteria | 7836 |
| 641 | Ga0501036_0022713 | 3300049572 | Bacteria | 5280 |
| 642 | Ga0501036_0159439 | 3300049572 | Bacteria | 1902 |
| 643 | Ga0501036_0425133 | 3300049572 | Bacteria | 1107 |
| 644 | Ga0501037_0000010 | 3300049573 | Bacteria | 200115 |
| 645 | Ga0501037_0246704 | 3300049573 | Bacteria | 1250 |
| 646 | Ga0501038_0062993 | 3300049574 | Bacteria | 3167 |
| 647 | Ga0501038_0078124 | 3300049574 | Bacteria | 2793 |
| 648 | Ga0501038_0187359 | 3300049574 | Bacteria | 1667 |
| 649 | Ga0501038_0317503 | 3300049574 | Bacteria | 1219 |
| 650 | Ga0501039_0003180 | 3300049575 | Bacteria | 12285 |
| 651 | Ga0501039_0007650 | 3300049575 | Bacteria | 8249 |
| 652 | Ga0501039_0008462 | 3300049575 | Bacteria | 7842 |
| 653 | Ga0501039_0008997 | 3300049575 | Bacteria | 7606 |
| 654 | Ga0501040_0005873 | 3300049576 | Bacteria | 7947 |
| 655 | Ga0501040_0021327 | 3300049576 | Bacteria | 4325 |
| 656 | Ga0501040_0115411 | 3300049576 | Bacteria | 1880 |
| 657 | Ga0501041_0047207 | 3300049577 | Bacteria | 2621 |
| 658 | Ga0501041_0076877 | 3300049577 | Bacteria | 2053 |
| 659 | Ga0501041_0086900 | 3300049577 | Bacteria | 1929 |
| 660 | Ga0501041_0176310 | 3300049577 | Bacteria | 1338 |
| 661 | Ga0501041_0243889 | 3300049577 | Bacteria | 1129 |
| 662 | Ga0501041_0289474 | 3300049577 | Bacteria | 1031 |
| 663 | Ga0501042_0011708 | 3300049578 | Bacteria | 5926 |
| 664 | Ga0501042_0018160 | 3300049578 | Bacteria | 4867 |
| 665 | Ga0501042_0030422 | 3300049578 | Bacteria | 3812 |
| 666 | Ga0501042_0159446 | 3300049578 | Bacteria | 1627 |
| 667 | Ga0501042_0244606 | 3300049578 | Bacteria | 1294 |
| 668 | Ga0501043_0001434 | 3300049579 | Bacteria | 20831 |
| 669 | Ga0501043_0019135 | 3300049579 | Bacteria | 5375 |
| 670 | Ga0501043_0039313 | 3300049579 | Bacteria | 3718 |
| 671 | Ga0501043_0151153 | 3300049579 | Bacteria | 1817 |
| 672 | Ga0501046_0008688 | 3300049580 | Bacteria | 8830 |
| 673 | Ga0501046_0020796 | 3300049580 | Bacteria | 5421 |
| 674 | Ga0501046_0059045 | 3300049580 | Bacteria | 3006 |
| 675 | Ga0501046_0075055 | 3300049580 | Bacteria | 2622 |
| 676 | Ga0501046_0580858 | 3300049580 | Bacteria | 796 |
| 677 | Ga0501047_0006514 | 3300049581 | Bacteria | 10993 |
| 678 | Ga0501047_0017854 | 3300049581 | Bacteria | 6797 |
| 679 | Ga0501047_0051345 | 3300049581 | Bacteria | 3984 |
| 680 | Ga0501048_0018802 | 3300049582 | Bacteria | 5079 |
| 681 | Ga0501048_0222972 | 3300049582 | Bacteria | 1337 |
| 682 | Ga0501048_0318592 | 3300049582 | Bacteria | 1108 |
| 683 | Ga0501048_0393826 | 3300049582 | Bacteria | 990 |
| 684 | Ga0501048_0713230 | 3300049582 | Bacteria | 720 |
| 685 | Ga0501067_0058219 | 3300049583 | Bacteria | 2140 |
| 686 | Ga0501068_0030252 | 3300049584 | Bacteria | 3211 |
| 687 | Ga0501068_0040092 | 3300049584 | Bacteria | 2810 |
| 688 | Ga0501068_0073888 | 3300049584 | Bacteria | 2083 |
| 689 | Ga0501069_0202191 | 3300049585 | Bacteria | 1151 |
| 690 | Ga0501070_0003344 | 3300049586 | Bacteria | 13925 |
| 691 | Ga0501070_0005558 | 3300049586 | Bacteria | 10748 |
| 692 | Ga0501070_0139325 | 3300049586 | Bacteria | 2003 |
| 693 | Ga0501071_0003846 | 3300049587 | Bacteria | 9449 |
| 694 | Ga0501071_0017030 | 3300049587 | Bacteria | 5005 |
| 695 | Ga0501071_0017383 | 3300049587 | Bacteria | 4959 |
| 696 | Ga0501071_0086404 | 3300049587 | Bacteria | 2301 |
| 697 | Ga0501071_0129942 | 3300049587 | Bacteria | 1870 |
| 698 | Ga0501071_0157727 | 3300049587 | Bacteria | 1695 |
| 699 | Ga0501071_0322941 | 3300049587 | Bacteria | 1172 |
| 700 | Ga0501071_0731193 | 3300049587 | Bacteria | 762 |
| 701 | Ga0501072_0004067 | 3300049588 | Bacteria | 11070 |
| 702 | Ga0501072_0090378 | 3300049588 | Bacteria | 2431 |
| 703 | Ga0501072_0115999 | 3300049588 | Unclassified | 2133 |
| 704 | Ga0501072_0125644 | 3300049588 | Bacteria | 2044 |
| 705 | Ga0501072_0362126 | 3300049588 | Bacteria | 1151 |
| 706 | Ga0501072_0390172 | 3300049588 | Bacteria | 1105 |
| 707 | Ga0501073_0101475 | 3300049589 | Bacteria | 1998 |
| 708 | Ga0501073_0170652 | 3300049589 | Bacteria | 1506 |
| 709 | Ga0501073_0255646 | 3300049589 | Bacteria | 1209 |
| 710 | Ga0501073_0372046 | 3300049589 | Bacteria | 987 |
| 711 | Ga0501073_0433137 | 3300049589 | Bacteria | 909 |
| 712 | Ga0501074_0010115 | 3300049590 | Bacteria | 6849 |
| 713 | Ga0501074_0017774 | 3300049590 | Bacteria | 5166 |
| 714 | Ga0501074_0137400 | 3300049590 | Bacteria | 1748 |
| 715 | Ga0501074_0169592 | 3300049590 | Bacteria | 1558 |
| 716 | Ga0501074_0388222 | 3300049590 | Bacteria | 990 |
| 717 | Ga0501075_0010712 | 3300049591 | Bacteria | 6454 |
| 718 | Ga0501075_0014324 | 3300049591 | Bacteria | 5682 |
| 719 | Ga0501075_0054465 | 3300049591 | Bacteria | 3009 |
| 720 | Ga0501075_0236724 | 3300049591 | Bacteria | 1392 |
| 721 | Ga0501075_0524695 | 3300049591 | Bacteria | 904 |
| 722 | Ga0501075_1088318 | 3300049591 | Bacteria | 607 |
| 723 | Ga0501076_0002360 | 3300049592 | Bacteria | 12914 |
| 724 | Ga0501076_0021105 | 3300049592 | Bacteria | 4991 |
| 725 | Ga0501076_0073873 | 3300049592 | Bacteria | 2730 |
| 726 | Ga0501076_0152290 | 3300049592 | Bacteria | 1881 |
| 727 | Ga0501076_0161597 | 3300049592 | Bacteria | 1825 |
| 728 | Ga0501076_0182159 | 3300049592 | Bacteria | 1712 |
| 729 | Ga0501076_0385911 | 3300049592 | Bacteria | 1151 |
| 730 | Ga0501077_0007388 | 3300049593 | Bacteria | 6774 |
| 731 | Ga0501077_0048340 | 3300049593 | Bacteria | 2702 |
| 732 | Ga0501077_0075287 | 3300049593 | Bacteria | 2138 |
| 733 | Ga0501077_0196569 | 3300049593 | Bacteria | 1281 |
| 734 | Ga0501079_0000190 | 3300049741 | Bacteria | 35319 |
| 735 | Ga0501079_0029206 | 3300049741 | Bacteria | 4232 |
| 736 | Ga0501079_0067025 | 3300049741 | Bacteria | 2770 |
| 737 | Ga0501079_0074440 | 3300049741 | Bacteria | 2625 |
| 738 | Ga0501079_0183967 | 3300049741 | Bacteria | 1631 |
| 739 | Ga0501079_0193116 | 3300049741 | Bacteria | 1589 |
| 740 | Ga0501079_0936749 | 3300049741 | Bacteria | 682 |
| 741 | Ga0501080_0009780 | 3300049742 | Bacteria | 8760 |
| 742 | Ga0501080_0017029 | 3300049742 | Bacteria | 6711 |
| 743 | Ga0501080_0025227 | 3300049742 | Bacteria | 5517 |
| 744 | Ga0501080_0218814 | 3300049742 | Bacteria | 1743 |
| 745 | Ga0501080_0223677 | 3300049742 | Bacteria | 1722 |
| 746 | Ga0501080_0249725 | 3300049742 | Bacteria | 1618 |
| 747 | Ga0501080_0544149 | 3300049742 | Bacteria | 1034 |
| 748 | Ga0501080_0552407 | 3300049742 | Bacteria | 1026 |
| 749 | Ga0501080_0601496 | 3300049742 | Bacteria | 976 |
| 750 | Ga0501080_0628767 | 3300049742 | Bacteria | 951 |
| 751 | Ga0501081_0005186 | 3300049743 | Bacteria | 8387 |
| 752 | Ga0501081_0005502 | 3300049743 | Bacteria | 8178 |
| 753 | Ga0501081_0029986 | 3300049743 | Bacteria | 3678 |
| 754 | Ga0501081_0070752 | 3300049743 | Bacteria | 2431 |
| 755 | Ga0501081_1176155 | 3300049743 | Bacteria | 581 |
| 756 | Ga0501083_0063347 | 3300049744 | Bacteria | 2466 |
| 757 | Ga0501083_0101988 | 3300049744 | Bacteria | 1892 |
| 758 | Ga0501035_0000001 | 3300049822 | Bacteria | 1037138 |
| 759 | Ga0501035_0000673 | 3300049822 | Bacteria | 37395 |
| 760 | Ga0501035_0001302 | 3300049822 | Bacteria | 25776 |
| 761 | Ga0501035_0033351 | 3300049822 | Bacteria | 4683 |
| 762 | Ga0501035_0099657 | 3300049822 | Bacteria | 2550 |
| 763 | Ga0501035_0107203 | 3300049822 | Bacteria | 2449 |
| 764 | Ga0501035_0123607 | 3300049822 | Bacteria | 2260 |
| 765 | Ga0501044_0000265 | 3300049823 | Bacteria | 66253 |
| 766 | Ga0501044_0030532 | 3300049823 | Bacteria | 5679 |
| 767 | Ga0501045_0005389 | 3300049824 | Bacteria | 8860 |
| 768 | Ga0501045_0056113 | 3300049824 | Bacteria | 2880 |
| 769 | Ga0501045_0067529 | 3300049824 | Bacteria | 2626 |
| 770 | Ga0501045_0516795 | 3300049824 | Bacteria | 886 |
| 771 | Ga0501045_0642655 | 3300049824 | Bacteria | 784 |
| 772 | nmdc:mga03683_43481_c1 | 3300050489 | Bacteria | 1853 |
| 773 | nmdc:mga0yw44_113804_c1 | 3300050492 | Bacteria | 1736 |
| 774 | nmdc:mga06z11_83736_c1 | 3300050494 | Bacteria | 1717 |
| 775 | nmdc:mga05p37_206978_c1 | 3300050507 | Bacteria | 2373 |
| 776 | nmdc:mga05p37_213433_c1 | 3300050507 | Bacteria | 2332 |
| 777 | nmdc:mga05p37_340096_c1 | 3300050507 | Bacteria | 1770 |
| 778 | nmdc:mga05p37_548824_c1 | 3300050507 | Bacteria | 1316 |
| 779 | nmdc:mga05p37_585247_c1 | 3300050507 | Bacteria | 1263 |
| 780 | nmdc:mga05p37_99731_c1 | 3300050507 | Bacteria | 3577 |
| 781 | nmdc:mga09592_117745_c1 | 3300050508 | Unclassified | 2280 |
| 782 | nmdc:mga09592_238070_c2 | 3300050508 | Bacteria | 1162 |
| 783 | nmdc:mga09592_359167_c1 | 3300050508 | Bacteria | 1261 |
| 784 | nmdc:mga09592_43414_c1 | 3300050508 | Bacteria | 3785 |
| 785 | nmdc:mga09592_559079_c1 | 3300050508 | Bacteria | 982 |
| 786 | nmdc:mga0qj67_388795_c1 | 3300050509 | Bacteria | 1126 |
| 787 | nmdc:mga0qj67_41272_c1 | 3300050509 | Bacteria | 3629 |
| 788 | nmdc:mga0qj67_644565_c1 | 3300050509 | Bacteria | 845 |
| 789 | nmdc:mga06r32_15205_c1 | 3300050510 | Bacteria | 6992 |
| 790 | nmdc:mga06r32_234862_c1 | 3300050510 | Bacteria | 1821 |
| 791 | nmdc:mga06r32_501012_c1 | 3300050510 | Bacteria | 1191 |
| 792 | nmdc:mga06r32_704262_c1 | 3300050510 | Bacteria | 975 |
| 793 | nmdc:mga06r32_73952_c1 | 3300050510 | Bacteria | 3302 |
| 794 | nmdc:mga08y16_170731_c1 | 3300050511 | Bacteria | 2259 |
| 795 | nmdc:mga08y16_294141_c1 | 3300050511 | Bacteria | 1674 |
| 796 | nmdc:mga08y16_564519_c1 | 3300050511 | Bacteria | 1150 |
| 797 | nmdc:mga0n895_248016_c1 | 3300050512 | Bacteria | 1807 |
| 798 | nmdc:mga0n895_290751_c1 | 3300050512 | Bacteria | 1657 |
| 799 | nmdc:mga0n895_51441_c1 | 3300050512 | Unclassified | 4041 |
| 800 | nmdc:mga0n895_98971_c1 | 3300050512 | Bacteria | 2924 |
| 801 | nmdc:mga0rr50_134203_c1 | 3300050513 | Bacteria | 1985 |
| 802 | nmdc:mga0rr50_280737_c1 | 3300050513 | Bacteria | 1390 |
| 803 | nmdc:mga0rr50_309136_c1 | 3300050513 | Bacteria | 1323 |
| 804 | nmdc:mga08x19_364697_c1 | 3300050514 | Bacteria | 1010 |
| 805 | nmdc:mga0a205_243391_c1 | 3300050515 | Bacteria | 1680 |
| 806 | nmdc:mga0a205_391033_c1 | 3300050515 | Bacteria | 1255 |
| 807 | nmdc:mga0a205_59905_c1 | 3300050515 | Bacteria | 3677 |
| 808 | nmdc:mga0sz30_51245_c1 | 3300050516 | Bacteria | 1750 |
| 809 | nmdc:mga0sz30_68008_c1 | 3300050516 | Bacteria | 1530 |
| 810 | Ga0495601_0000009 | 3300053077 | Bacteria | 270622 |
| 811 | Ga0495612_0000019 | 3300053078 | Bacteria | 137844 |
| 812 | Ga0495595_0000015 | 3300053084 | Bacteria | 144946 |
| 813 | Ga0495595_0115197 | 3300053084 | Bacteria | 1306 |
| 814 | Ga0495619_0000012 | 3300053085 | Bacteria | 268349 |
| 815 | Ga0500578_0362254 | 3300053086 | Bacteria | 845 |
| 816 | Ga0500646_0014187 | 3300053090 | Bacteria | 2067 |
| 817 | Ga0500647_0067774 | 3300053091 | Bacteria | 1716 |
| 818 | Ga0500566_0004593 | 3300053094 | Bacteria | 8226 |
| 819 | Ga0500566_0015609 | 3300053094 | Bacteria | 4457 |
| 820 | Ga0500640_013143 | 3300053095 | Bacteria | 3417 |
| 821 | Ga0500554_012328 | 3300053102 | Bacteria | 2146 |
| 822 | Ga0500554_045955 | 3300053102 | Bacteria | 1358 |
| 823 | Ga0500572_017152 | 3300053111 | Bacteria | 1857 |
| 824 | Ga0500595_000342 | 3300053119 | Bacteria | 30337 |
| 825 | Ga0500597_051077 | 3300053120 | Bacteria | 1762 |
| 826 | Ga0500614_001237 | 3300053123 | Bacteria | 6218 |
| 827 | Ga0500614_004035 | 3300053123 | Bacteria | 3124 |
| 828 | Ga0500642_0033444 | 3300053130 | Bacteria | 2166 |
| 829 | Ga0500559_0224523 | 3300053136 | Bacteria | 885 |
| 830 | Ga0500568_0000017 | 3300053139 | Bacteria | 197578 |
| 831 | Ga0500585_159549 | 3300053144 | Bacteria | 781 |
| 832 | Ga0500637_0147845 | 3300053178 | Bacteria | 1358 |
| 833 | Ga0500637_0163811 | 3300053178 | Bacteria | 1281 |
| 834 | Ga0500601_003451 | 3300053737 | Bacteria | 1714 |
| 835 | Ga0501084_0001245 | 3300054114 | Bacteria | 20042 |
| 836 | Ga0501084_0054589 | 3300054114 | Bacteria | 3342 |
| 837 | Ga0501084_0106430 | 3300054114 | Bacteria | 2356 |
| 838 | Ga0501084_0111453 | 3300054114 | Bacteria | 2300 |
| 839 | Ga0501084_0451798 | 3300054114 | Bacteria | 1086 |
| 840 | Ga0590075_050800 | 3300059424 | Unclassified | 1064 |
| 841 | Ga0587093_001174 | 3300059478 | Bacteria | 2132 |
| 842 | Ga0587077_010762 | 3300059493 | Bacteria | 1423 |
| 843 | Ga0587080_047620 | 3300059503 | Bacteria | 800 |
| 844 | Ga0587082_003109 | 3300059504 | Bacteria | 1959 |
| 845 | Ga0587085_001870 | 3300059506 | Bacteria | 2052 |
| 846 | Ga0587094_004307 | 3300059513 | Bacteria | 1610 |
| 847 | Ga0587101_007846 | 3300059623 | Bacteria | 1273 |
| 848 | Ga0587109_014559 | 3300059624 | Bacteria | 1322 |
| 849 | Ga0587128_008311 | 3300059630 | Bacteria | 1339 |
| 850 | Ga0587068_031971 | 3300059641 | Bacteria | 917 |
| 851 | Ga0587072_004675 | 3300059643 | Bacteria | 2006 |
| 852 | Ga0587075_002440 | 3300059644 | Bacteria | 1962 |
| 853 | Ga0587079_008668 | 3300059647 | Bacteria | 1561 |
| 854 | Ga0501082_0002352 | 3300060353 | Bacteria | 16554 |
| 855 | Ga0501082_0017960 | 3300060353 | Bacteria | 6092 |
| 856 | Ga0501082_0022848 | 3300060353 | Bacteria | 5387 |
| 857 | Ga0501082_0105590 | 3300060353 | Bacteria | 2437 |
| 858 | Ga0501082_0686359 | 3300060353 | Bacteria | 896 |
| 859 | Ga0501082_0715364 | 3300060353 | Bacteria | 876 |
| 860 | Ga0501082_1320116 | 3300060353 | Bacteria | 630 |
| 861 | Ga0466962_0000164 | 3300061719 | Bacteria | 28308 |
| 862 | Ga0530510_0009460 | 3300061734 | Bacteria | 6832 |
| 863 | Ga0530510_0012374 | 3300061734 | Bacteria | 5994 |
| 864 | Ga0530510_0014900 | 3300061734 | Bacteria | 5490 |
| 865 | Ga0530510_0034117 | 3300061734 | Bacteria | 3665 |
| 866 | Ga0530510_0125742 | 3300061734 | Bacteria | 1884 |
| 867 | Ga0530510_0268662 | 3300061734 | Bacteria | 1273 |
| 868 | Ga0530510_0694547 | 3300061734 | Bacteria | 775 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300039450 | Ga0436363_1720038 | Ga0436363_1720038_11_616 | 172 |
| 2 | 3300005366 | Ga0070659_100078713 | Ga0070659_1000787133 | 177 |
| 3 | 3300049741 | Ga0501079_0936749 | Ga0501079_0936749_84_620 | 177 |
| 4 | 3300049743 | Ga0501081_1176155 | Ga0501081_1176155_11_547 | 177 |
| 5 | 3300049591 | Ga0501075_1088318 | Ga0501075_1088318_50_589 | 178 |
| 6 | 3300059424 | Ga0590075_050800 | Ga0590075_050800_279_860 | 179 |
| 7 | 3300049590 | Ga0501074_0388222 | Ga0501074_0388222_369_914 | 181 |
| 8 | 3300025949 | Ga0207667_10205285 | Ga0207667_102052853 | 184 |
| 9 | 3300009147 | Ga0114129_10252066 | Ga0114129_102520663 | 185 |
| 10 | 3300050507 | nmdc:mga05p37_213433_c1 | nmdc:mga05p37_213433_c1_1280_1840 | 185 |
| 11 | 3300050510 | nmdc:mga06r32_15205_c1 | nmdc:mga06r32_15205_c1_10_570 | 185 |
| 12 | 3300049744 | Ga0501083_0101988 | Ga0501083_0101988_780_1406 | 186 |
| 13 | 3300050508 | nmdc:mga09592_559079_c1 | nmdc:mga09592_559079_c1_71_730 | 186 |
| 14 | 3300005548 | Ga0070665_100000911 | Ga0070665_10000091131 | 187 |
| 15 | 3300005614 | Ga0068856_100671704 | Ga0068856_1006717042 | 187 |
| 16 | 3300007076 | Ga0075435_100595407 | Ga0075435_1005954071 | 187 |
| 17 | 3300013105 | Ga0157369_10931309 | Ga0157369_109313092 | 187 |
| 18 | 3300028379 | Ga0268266_10125643 | Ga0268266_101256435 | 187 |
| 19 | 3300039437 | Ga0436365_0353660 | Ga0436365_0353660_1458_2102 | 187 |
| 20 | 3300045049 | Ga0466959_0037942 | Ga0466959_0037942_21_650 | 187 |
| 21 | 3300045976 | Ga0466967_0073576 | Ga0466967_0073576_1845_2423 | 187 |
| 22 | 3300009093 | Ga0105240_10008535 | Ga0105240_100085356 | 188 |
| 23 | 3300009545 | Ga0105237_10124272 | Ga0105237_101242724 | 188 |
| 24 | 3300013104 | Ga0157370_10249531 | Ga0157370_102495312 | 188 |
| 25 | 3300026067 | Ga0207678_10157997 | Ga0207678_101579972 | 188 |
| 26 | 3300027552 | Ga0209982_1007401 | Ga0209982_10074012 | 188 |
| 27 | 3300035695 | Ga0373927_0277319 | Ga0373927_0277319_424_1089 | 188 |
| 28 | 3300035724 | Ga0373933_0118762 | Ga0373933_0118762_537_1202 | 188 |
| 29 | 3300049587 | Ga0501071_0731193 | Ga0501071_0731193_64_687 | 188 |
| 30 | 3300049742 | Ga0501080_0552407 | Ga0501080_0552407_59_682 | 188 |
| 31 | 3300053086 | Ga0500578_0362254 | Ga0500578_0362254_82_771 | 188 |
| 32 | 3300005329 | Ga0070683_100140008 | Ga0070683_1001400083 | 189 |
| 33 | 3300005535 | Ga0070684_100274784 | Ga0070684_1002747842 | 189 |
| 34 | 3300005937 | Ga0081455_10000576 | Ga0081455_1000057649 | 189 |
| 35 | 3300005937 | Ga0081455_10007956 | Ga0081455_100079564 | 189 |
| 36 | 3300005937 | Ga0081455_10024833 | Ga0081455_100248335 | 189 |
| 37 | 3300005937 | Ga0081455_10272684 | Ga0081455_102726842 | 189 |
| 38 | 3300005981 | Ga0081538_10005426 | Ga0081538_1000542610 | 189 |
| 39 | 3300006028 | Ga0070717_10325927 | Ga0070717_103259272 | 189 |
| 40 | 3300006058 | Ga0075432_10088120 | Ga0075432_100881202 | 189 |
| 41 | 3300006358 | Ga0068871_100073481 | Ga0068871_1000734815 | 189 |
| 42 | 3300006846 | Ga0075430_100108107 | Ga0075430_1001081073 | 189 |
| 43 | 3300006846 | Ga0075430_100129196 | Ga0075430_1001291962 | 189 |
| 44 | 3300007265 | Ga0099794_10023217 | Ga0099794_100232172 | 189 |
| 45 | 3300009094 | Ga0111539_10358644 | Ga0111539_103586442 | 189 |
| 46 | 3300013104 | Ga0157370_10023883 | Ga0157370_100238834 | 189 |
| 47 | 3300020075 | Ga0206349_1455224 | Ga0206349_14552243 | 189 |
| 48 | 3300020076 | Ga0206355_1420413 | Ga0206355_14204132 | 189 |
| 49 | 3300020080 | Ga0206350_11309462 | Ga0206350_113094623 | 189 |
| 50 | 3300020081 | Ga0206354_11227028 | Ga0206354_112270282 | 189 |
| 51 | 3300020082 | Ga0206353_11257201 | Ga0206353_112572012 | 189 |
| 52 | 3300020610 | Ga0154015_1016679 | Ga0154015_10166792 | 189 |
| 53 | 3300022467 | Ga0224712_10021149 | Ga0224712_100211492 | 189 |
| 54 | 3300026023 | Ga0207677_10105217 | Ga0207677_101052172 | 189 |
| 55 | 3300026121 | Ga0207683_10196666 | Ga0207683_101966662 | 189 |
| 56 | 3300027907 | Ga0207428_10197180 | Ga0207428_101971803 | 189 |
| 57 | 3300035207 | Ga0373942_0083265 | Ga0373942_0083265_270_899 | 189 |
| 58 | 3300035398 | Ga0316574_0018417 | Ga0316574_0018417_2565_3245 | 189 |
| 59 | 3300035410 | Ga0373924_0231023 | Ga0373924_0231023_49_708 | 189 |
| 60 | 3300036647 | Ga0316582_0049554 | Ga0316582_0049554_1400_2080 | 189 |
| 61 | 3300036712 | Ga0316584_0049428 | Ga0316584_0049428_1498_2178 | 189 |
| 62 | 3300050508 | nmdc:mga09592_359167_c1 | nmdc:mga09592_359167_c1_204_845 | 189 |
| 63 | 3300050509 | nmdc:mga0qj67_41272_c1 | nmdc:mga0qj67_41272_c1_2399_3040 | 189 |
| 64 | 3300050511 | nmdc:mga08y16_294141_c1 | nmdc:mga08y16_294141_c1_390_1019 | 189 |
| 65 | 3300005290 | Ga0065712_10146685 | Ga0065712_101466851 | 190 |
| 66 | 3300005330 | Ga0070690_100081269 | Ga0070690_1000812692 | 190 |
| 67 | 3300005337 | Ga0070682_100039367 | Ga0070682_1000393673 | 190 |
| 68 | 3300005347 | Ga0070668_100870229 | Ga0070668_1008702292 | 190 |
| 69 | 3300005356 | Ga0070674_100328111 | Ga0070674_1003281112 | 190 |
| 70 | 3300005436 | Ga0070713_100090161 | Ga0070713_1000901611 | 190 |
| 71 | 3300005436 | Ga0070713_100585871 | Ga0070713_1005858711 | 190 |
| 72 | 3300005437 | Ga0070710_10019648 | Ga0070710_100196482 | 190 |
| 73 | 3300005439 | Ga0070711_100356692 | Ga0070711_1003566922 | 190 |
| 74 | 3300005456 | Ga0070678_100001861 | Ga0070678_1000018619 | 190 |
| 75 | 3300005471 | Ga0070698_100201851 | Ga0070698_1002018513 | 190 |
| 76 | 3300005471 | Ga0070698_100381059 | Ga0070698_1003810591 | 190 |
| 77 | 3300005545 | Ga0070695_100101329 | Ga0070695_1001013292 | 190 |
| 78 | 3300005718 | Ga0068866_10016696 | Ga0068866_100166962 | 190 |
| 79 | 3300005843 | Ga0068860_100190436 | Ga0068860_1001904364 | 190 |
| 80 | 3300005983 | Ga0081540_1039841 | Ga0081540_10398412 | 190 |
| 81 | 3300006163 | Ga0070715_10227383 | Ga0070715_102273832 | 190 |
| 82 | 3300006173 | Ga0070716_100035211 | Ga0070716_1000352113 | 190 |
| 83 | 3300006237 | Ga0097621_100328786 | Ga0097621_1003287862 | 190 |
| 84 | 3300006358 | Ga0068871_100022845 | Ga0068871_1000228453 | 190 |
| 85 | 3300006846 | Ga0075430_100099668 | Ga0075430_1000996683 | 190 |
| 86 | 3300006871 | Ga0075434_100112903 | Ga0075434_1001129032 | 190 |
| 87 | 3300006881 | Ga0068865_100018974 | Ga0068865_1000189745 | 190 |
| 88 | 3300009098 | Ga0105245_10223690 | Ga0105245_102236903 | 190 |
| 89 | 3300009176 | Ga0105242_10054783 | Ga0105242_100547833 | 190 |
| 90 | 3300009177 | Ga0105248_10183414 | Ga0105248_101834142 | 190 |
| 91 | 3300013297 | Ga0157378_10008927 | Ga0157378_100089273 | 190 |
| 92 | 3300014326 | Ga0157380_10070577 | Ga0157380_100705773 | 190 |
| 93 | 3300021388 | Ga0213875_10000012 | Ga0213875_10000012245 | 190 |
| 94 | 3300021388 | Ga0213875_10195428 | Ga0213875_101954282 | 190 |
| 95 | 3300025898 | Ga0207692_10010022 | Ga0207692_100100224 | 190 |
| 96 | 3300025900 | Ga0207710_10042272 | Ga0207710_100422723 | 190 |
| 97 | 3300025903 | Ga0207680_10044877 | Ga0207680_100448773 | 190 |
| 98 | 3300025905 | Ga0207685_10067805 | Ga0207685_100678053 | 190 |
| 99 | 3300025929 | Ga0207664_10002993 | Ga0207664_100029939 | 190 |
| 100 | 3300025935 | Ga0207709_10048761 | Ga0207709_100487613 | 190 |
| 101 | 3300025938 | Ga0207704_10005581 | Ga0207704_100055818 | 190 |
| 102 | 3300026121 | Ga0207683_10009395 | Ga0207683_100093952 | 190 |
| 103 | 3300035121 | Ga0373960_0001739 | Ga0373960_0001739_51_665 | 190 |
| 104 | 3300035725 | Ga0373947_0194922 | Ga0373947_0194922_116_802 | 190 |
| 105 | 3300036401 | Ga0373937_0005182 | Ga0373937_0005182_93_671 | 190 |
| 106 | 3300037068 | Ga0373925_0223044 | Ga0373925_0223044_281_967 | 190 |
| 107 | 3300037466 | Ga0395898_0582130 | Ga0395898_0582130_109_714 | 190 |
| 108 | 3300037471 | Ga0395905_0021914 | Ga0395905_0021914_4000_4617 | 190 |
| 109 | 3300037471 | Ga0395905_0285138 | Ga0395905_0285138_225_842 | 190 |
| 110 | 3300039447 | Ga0436361_0955955 | Ga0436361_0955955_885_1475 | 190 |
| 111 | 3300039453 | Ga0436362_0261986 | Ga0436362_0261986_676_1251 | 190 |
| 112 | 3300044684 | Ga0466966_0163454 | Ga0466966_0163454_189_878 | 190 |
| 113 | 3300044694 | Ga0466963_0138795 | Ga0466963_0138795_469_1158 | 190 |
| 114 | 3300044842 | Ga0466957_0046391 | Ga0466957_0046391_329_1018 | 190 |
| 115 | 3300046528 | Ga0495642_0001548 | Ga0495642_0001548_4748_5377 | 190 |
| 116 | 3300046533 | Ga0495640_0153499 | Ga0495640_0153499_812_1390 | 190 |
| 117 | 3300046537 | Ga0495598_0223097 | Ga0495598_0223097_22_666 | 190 |
| 118 | 3300047321 | Ga0495676_0709573 | Ga0495676_0709573_37_615 | 190 |
| 119 | 3300048904 | Ga0496101_0004742 | Ga0496101_0004742_6631_7275 | 190 |
| 120 | 3300048905 | Ga0496102_0015589 | Ga0496102_0015589_1275_1919 | 190 |
| 121 | 3300048906 | Ga0496103_0116176 | Ga0496103_0116176_611_1255 | 190 |
| 122 | 3300048908 | Ga0496105_0021445 | Ga0496105_0021445_2842_3486 | 190 |
| 123 | 3300048908 | Ga0496105_0122743 | Ga0496105_0122743_13_711 | 190 |
| 124 | 3300048910 | Ga0496107_0138383 | Ga0496107_0138383_437_1081 | 190 |
| 125 | 3300048912 | Ga0496109_0152040 | Ga0496109_0152040_616_1266 | 190 |
| 126 | 3300048915 | Ga0496112_0328687 | Ga0496112_0328687_568_1185 | 190 |
| 127 | 3300048917 | Ga0496114_0009701 | Ga0496114_0009701_6388_7032 | 190 |
| 128 | 3300048918 | Ga0496115_0070013 | Ga0496115_0070013_37_681 | 190 |
| 129 | 3300048918 | Ga0496115_0522568 | Ga0496115_0522568_27_716 | 190 |
| 130 | 3300049569 | Ga0501032_0111022 | Ga0501032_0111022_42_725 | 190 |
| 131 | 3300049570 | Ga0501033_0100386 | Ga0501033_0100386_1447_2070 | 190 |
| 132 | 3300049572 | Ga0501036_0159439 | Ga0501036_0159439_176_799 | 190 |
| 133 | 3300049574 | Ga0501038_0062993 | Ga0501038_0062993_1011_1634 | 190 |
| 134 | 3300049575 | Ga0501039_0008997 | Ga0501039_0008997_1301_1924 | 190 |
| 135 | 3300049576 | Ga0501040_0005873 | Ga0501040_0005873_5665_6288 | 190 |
| 136 | 3300049577 | Ga0501041_0076877 | Ga0501041_0076877_197_820 | 190 |
| 137 | 3300049578 | Ga0501042_0011708 | Ga0501042_0011708_1522_2145 | 190 |
| 138 | 3300049579 | Ga0501043_0019135 | Ga0501043_0019135_3213_3836 | 190 |
| 139 | 3300049580 | Ga0501046_0008688 | Ga0501046_0008688_5272_5895 | 190 |
| 140 | 3300049584 | Ga0501068_0040092 | Ga0501068_0040092_775_1398 | 190 |
| 141 | 3300049585 | Ga0501069_0202191 | Ga0501069_0202191_27_602 | 190 |
| 142 | 3300049587 | Ga0501071_0003846 | Ga0501071_0003846_7407_8030 | 190 |
| 143 | 3300049588 | Ga0501072_0004067 | Ga0501072_0004067_5292_5915 | 190 |
| 144 | 3300049588 | Ga0501072_0115999 | Ga0501072_0115999_1240_1863 | 190 |
| 145 | 3300049589 | Ga0501073_0101475 | Ga0501073_0101475_125_748 | 190 |
| 146 | 3300049590 | Ga0501074_0017774 | Ga0501074_0017774_3627_4250 | 190 |
| 147 | 3300049592 | Ga0501076_0002360 | Ga0501076_0002360_3146_3769 | 190 |
| 148 | 3300049593 | Ga0501077_0007388 | Ga0501077_0007388_4812_5435 | 190 |
| 149 | 3300049741 | Ga0501079_0000190 | Ga0501079_0000190_33197_33820 | 190 |
| 150 | 3300049742 | Ga0501080_0017029 | Ga0501080_0017029_5145_5768 | 190 |
| 151 | 3300049743 | Ga0501081_0005502 | Ga0501081_0005502_3134_3757 | 190 |
| 152 | 3300049822 | Ga0501035_0123607 | Ga0501035_0123607_963_1586 | 190 |
| 153 | 3300049824 | Ga0501045_0005389 | Ga0501045_0005389_4835_5458 | 190 |
| 154 | 3300050508 | nmdc:mga09592_238070_c2 | nmdc:mga09592_238070_c2_573_1151 | 190 |
| 155 | 3300050510 | nmdc:mga06r32_234862_c1 | nmdc:mga06r32_234862_c1_657_1289 | 190 |
| 156 | 3300053139 | Ga0500568_0000017 | Ga0500568_0000017_1742_2485 | 190 |
| 157 | 3300054114 | Ga0501084_0001245 | Ga0501084_0001245_5229_5852 | 190 |
| 158 | 3300060353 | Ga0501082_0017960 | Ga0501082_0017960_198_821 | 190 |
| 159 | 3300060353 | Ga0501082_1320116 | Ga0501082_1320116_14_589 | 190 |
| 160 | 3300061734 | Ga0530510_0014900 | Ga0530510_0014900_1540_2163 | 190 |
| 161 | 3300004798 | Ga0058859_10042072 | Ga0058859_100420722 | 191 |
| 162 | 3300004799 | Ga0058863_10089197 | Ga0058863_100891972 | 191 |
| 163 | 3300004800 | Ga0058861_10086667 | Ga0058861_100866673 | 191 |
| 164 | 3300004801 | Ga0058860_10046890 | Ga0058860_100468902 | 191 |
| 165 | 3300004803 | Ga0058862_10192943 | Ga0058862_101929432 | 191 |
| 166 | 3300005337 | Ga0070682_100026267 | Ga0070682_1000262673 | 191 |
| 167 | 3300005338 | Ga0068868_100097817 | Ga0068868_1000978172 | 191 |
| 168 | 3300005341 | Ga0070691_10056432 | Ga0070691_100564322 | 191 |
| 169 | 3300005434 | Ga0070709_10042260 | Ga0070709_100422602 | 191 |
| 170 | 3300005444 | Ga0070694_100224035 | Ga0070694_1002240351 | 191 |
| 171 | 3300005456 | Ga0070678_100167666 | Ga0070678_1001676663 | 191 |
| 172 | 3300005536 | Ga0070697_100036169 | Ga0070697_1000361695 | 191 |
| 173 | 3300013104 | Ga0157370_10007661 | Ga0157370_100076618 | 191 |
| 174 | 3300013296 | Ga0157374_10225964 | Ga0157374_102259642 | 191 |
| 175 | 3300013307 | Ga0157372_10496740 | Ga0157372_104967402 | 191 |
| 176 | 3300014969 | Ga0157376_10791917 | Ga0157376_107919172 | 191 |
| 177 | 3300020069 | Ga0197907_10778953 | Ga0197907_107789533 | 191 |
| 178 | 3300020070 | Ga0206356_10484009 | Ga0206356_104840092 | 191 |
| 179 | 3300020077 | Ga0206351_10982550 | Ga0206351_109825502 | 191 |
| 180 | 3300020078 | Ga0206352_10093453 | Ga0206352_100934533 | 191 |
| 181 | 3300025906 | Ga0207699_10170550 | Ga0207699_101705502 | 191 |
| 182 | 3300025916 | Ga0207663_10358616 | Ga0207663_103586162 | 191 |
| 183 | 3300025916 | Ga0207663_10465404 | Ga0207663_104654042 | 191 |
| 184 | 3300025944 | Ga0207661_10488745 | Ga0207661_104887452 | 191 |
| 185 | 3300026089 | Ga0207648_10237341 | Ga0207648_102373412 | 191 |
| 186 | 3300028800 | Ga0265338_10267897 | Ga0265338_102678972 | 191 |
| 187 | 3300035112 | Ga0373932_0110822 | Ga0373932_0110822_177_803 | 191 |
| 188 | 3300036647 | Ga0316582_0150545 | Ga0316582_0150545_38_712 | 191 |
| 189 | 3300036712 | Ga0316584_0039055 | Ga0316584_0039055_1686_2360 | 191 |
| 190 | 3300038996 | Ga0242420_001000 | Ga0242420_001000_1263_1958 | 191 |
| 191 | 3300039110 | Ga0400487_54806 | Ga0400487_54806_65_736 | 191 |
| 192 | 3300039450 | Ga0436363_0506886 | Ga0436363_0506886_132_752 | 191 |
| 193 | 3300045051 | Ga0451576_0085164 | Ga0451576_0085164_1229_1819 | 191 |
| 194 | 3300046537 | Ga0495598_0064423 | Ga0495598_0064423_57_716 | 191 |
| 195 | 3300048905 | Ga0496102_0607427 | Ga0496102_0607427_31_726 | 191 |
| 196 | 3300048907 | Ga0496104_0329160 | Ga0496104_0329160_219_914 | 191 |
| 197 | 3300048909 | Ga0496106_0088567 | Ga0496106_0088567_236_931 | 191 |
| 198 | 3300048910 | Ga0496107_0279402 | Ga0496107_0279402_114_809 | 191 |
| 199 | 3300048911 | Ga0496108_0052495 | Ga0496108_0052495_226_921 | 191 |
| 200 | 3300048912 | Ga0496109_0217645 | Ga0496109_0217645_625_1320 | 191 |
| 201 | 3300048916 | Ga0496113_0201809 | Ga0496113_0201809_728_1423 | 191 |
| 202 | 3300049577 | Ga0501041_0176310 | Ga0501041_0176310_562_1179 | 191 |
| 203 | 3300049587 | Ga0501071_0322941 | Ga0501071_0322941_497_1114 | 191 |
| 204 | 3300049589 | Ga0501073_0433137 | Ga0501073_0433137_279_896 | 191 |
| 205 | 3300049742 | Ga0501080_0223677 | Ga0501080_0223677_967_1584 | 191 |
| 206 | 3300059478 | Ga0587093_001174 | Ga0587093_001174_831_1526 | 191 |
| 207 | 3300059493 | Ga0587077_010762 | Ga0587077_010762_71_766 | 191 |
| 208 | 3300059503 | Ga0587080_047620 | Ga0587080_047620_73_768 | 191 |
| 209 | 3300059504 | Ga0587082_003109 | Ga0587082_003109_360_1055 | 191 |
| 210 | 3300059506 | Ga0587085_001870 | Ga0587085_001870_636_1331 | 191 |
| 211 | 3300059513 | Ga0587094_004307 | Ga0587094_004307_755_1450 | 191 |
| 212 | 3300059623 | Ga0587101_007846 | Ga0587101_007846_28_723 | 191 |
| 213 | 3300059624 | Ga0587109_014559 | Ga0587109_014559_21_716 | 191 |
| 214 | 3300059630 | Ga0587128_008311 | Ga0587128_008311_89_784 | 191 |
| 215 | 3300059641 | Ga0587068_031971 | Ga0587068_031971_200_895 | 191 |
| 216 | 3300059643 | Ga0587072_004675 | Ga0587072_004675_407_1102 | 191 |
| 217 | 3300059644 | Ga0587075_002440 | Ga0587075_002440_363_1058 | 191 |
| 218 | 3300059647 | Ga0587079_008668 | Ga0587079_008668_276_971 | 191 |
| 219 | 3300005578 | Ga0068854_100127206 | Ga0068854_1001272063 | 192 |
| 220 | 3300006844 | Ga0075428_100081343 | Ga0075428_1000813433 | 192 |
| 221 | 3300009093 | Ga0105240_10437721 | Ga0105240_104377213 | 192 |
| 222 | 3300009147 | Ga0114129_10275304 | Ga0114129_102753042 | 192 |
| 223 | 3300009545 | Ga0105237_10002242 | Ga0105237_1000224213 | 192 |
| 224 | 3300021441 | Ga0213871_10012123 | Ga0213871_100121232 | 192 |
| 225 | 3300025914 | Ga0207671_10002514 | Ga0207671_100025144 | 192 |
| 226 | 3300025981 | Ga0207640_10012155 | Ga0207640_100121555 | 192 |
| 227 | 3300031727 | Ga0316576_10023850 | Ga0316576_100238504 | 192 |
| 228 | 3300031728 | Ga0316578_10013443 | Ga0316578_100134434 | 192 |
| 229 | 3300035171 | Ga0373946_0047787 | Ga0373946_0047787_414_1022 | 192 |
| 230 | 3300039438 | Ga0436360_1138920 | Ga0436360_1138920_3981_4715 | 192 |
| 231 | 3300039447 | Ga0436361_0559050 | Ga0436361_0559050_680_1432 | 192 |
| 232 | 3300045051 | Ga0451576_0000424 | Ga0451576_0000424_36280_37002 | 192 |
| 233 | 3300046663 | Ga0495635_0190932 | Ga0495635_0190932_442_1125 | 192 |
| 234 | 3300046684 | Ga0495669_0049667 | Ga0495669_0049667_206_886 | 192 |
| 235 | 3300047321 | Ga0495676_0124674 | Ga0495676_0124674_659_1267 | 192 |
| 236 | 3300049568 | Ga0501031_0001977 | Ga0501031_0001977_9746_10504 | 192 |
| 237 | 3300049569 | Ga0501032_0000037 | Ga0501032_0000037_113304_114068 | 192 |
| 238 | 3300049570 | Ga0501033_0000009 | Ga0501033_0000009_158571_159335 | 192 |
| 239 | 3300049570 | Ga0501033_0000033 | Ga0501033_0000033_123416_124180 | 192 |
| 240 | 3300049574 | Ga0501038_0078124 | Ga0501038_0078124_1811_2575 | 192 |
| 241 | 3300049575 | Ga0501039_0003180 | Ga0501039_0003180_5450_6208 | 192 |
| 242 | 3300049579 | Ga0501043_0001434 | Ga0501043_0001434_11380_12138 | 192 |
| 243 | 3300049581 | Ga0501047_0006514 | Ga0501047_0006514_3186_3944 | 192 |
| 244 | 3300049586 | Ga0501070_0005558 | Ga0501070_0005558_1350_2108 | 192 |
| 245 | 3300049587 | Ga0501071_0157727 | Ga0501071_0157727_684_1442 | 192 |
| 246 | 3300049822 | Ga0501035_0000001 | Ga0501035_0000001_724707_725465 | 192 |
| 247 | 3300050507 | nmdc:mga05p37_340096_c1 | nmdc:mga05p37_340096_c1_871_1512 | 192 |
| 248 | 3300050510 | nmdc:mga06r32_704262_c1 | nmdc:mga06r32_704262_c1_185_826 | 192 |
| 249 | 3300005293 | Ga0065715_10299140 | Ga0065715_102991402 | 193 |
| 250 | 3300005336 | Ga0070680_100476832 | Ga0070680_1004768322 | 193 |
| 251 | 3300005467 | Ga0070706_100549273 | Ga0070706_1005492731 | 193 |
| 252 | 3300005471 | Ga0070698_100106932 | Ga0070698_1001069322 | 193 |
| 253 | 3300006844 | Ga0075428_100049297 | Ga0075428_1000492974 | 193 |
| 254 | 3300006847 | Ga0075431_100105654 | Ga0075431_1001056543 | 193 |
| 255 | 3300006871 | Ga0075434_100018856 | Ga0075434_1000188563 | 193 |
| 256 | 3300006880 | Ga0075429_100017880 | Ga0075429_1000178805 | 193 |
| 257 | 3300009177 | Ga0105248_11298418 | Ga0105248_112984181 | 193 |
| 258 | 3300025922 | Ga0207646_10189678 | Ga0207646_101896782 | 193 |
| 259 | 3300025929 | Ga0207664_10086116 | Ga0207664_100861162 | 193 |
| 260 | 3300027665 | Ga0209983_1011064 | Ga0209983_10110643 | 193 |
| 261 | 3300027876 | Ga0209974_10000995 | Ga0209974_100009955 | 193 |
| 262 | 3300028556 | Ga0265337_1003286 | Ga0265337_10032863 | 193 |
| 263 | 3300030878 | Ga0265770_1006705 | Ga0265770_10067053 | 193 |
| 264 | 3300037068 | Ga0373925_0181292 | Ga0373925_0181292_1024_1653 | 193 |
| 265 | 3300044719 | Ga0466971_0000088 | Ga0466971_0000088_29513_30277 | 193 |
| 266 | 3300047315 | Ga0495581_0300992 | Ga0495581_0300992_100_729 | 193 |
| 267 | 3300048920 | Ga0496117_0078347 | Ga0496117_0078347_220_921 | 193 |
| 268 | 3300048921 | Ga0496118_0027838 | Ga0496118_0027838_3094_3795 | 193 |
| 269 | 3300050512 | nmdc:mga0n895_51441_c1 | nmdc:mga0n895_51441_c1_19_738 | 193 |
| 270 | 3300061719 | Ga0466962_0000164 | Ga0466962_0000164_22451_23215 | 193 |
| 271 | 3300061734 | Ga0530510_0012374 | Ga0530510_0012374_336_944 | 193 |
| 272 | 3300002067 | JGI24735J21928_10000853 | JGI24735J21928_100008536 | 194 |
| 273 | 3300005339 | Ga0070660_100124200 | Ga0070660_1001242003 | 194 |
| 274 | 3300005355 | Ga0070671_100179390 | Ga0070671_1001793902 | 194 |
| 275 | 3300005444 | Ga0070694_100007379 | Ga0070694_1000073792 | 194 |
| 276 | 3300005539 | Ga0068853_100036380 | Ga0068853_1000363801 | 194 |
| 277 | 3300005545 | Ga0070695_100609462 | Ga0070695_1006094622 | 194 |
| 278 | 3300005618 | Ga0068864_100080216 | Ga0068864_1000802163 | 194 |
| 279 | 3300005841 | Ga0068863_100097500 | Ga0068863_1000975004 | 194 |
| 280 | 3300005937 | Ga0081455_10000567 | Ga0081455_100005674 | 194 |
| 281 | 3300006186 | Ga0075369_10103053 | Ga0075369_101030531 | 194 |
| 282 | 3300009093 | Ga0105240_10119821 | Ga0105240_101198214 | 194 |
| 283 | 3300009147 | Ga0114129_10523420 | Ga0114129_105234202 | 194 |
| 284 | 3300009545 | Ga0105237_10069951 | Ga0105237_100699514 | 194 |
| 285 | 3300009551 | Ga0105238_10233074 | Ga0105238_102330743 | 194 |
| 286 | 3300009553 | Ga0105249_10955967 | Ga0105249_109559672 | 194 |
| 287 | 3300013105 | Ga0157369_10379039 | Ga0157369_103790392 | 194 |
| 288 | 3300025916 | Ga0207663_10027466 | Ga0207663_100274664 | 194 |
| 289 | 3300025931 | Ga0207644_10368623 | Ga0207644_103686232 | 194 |
| 290 | 3300026041 | Ga0207639_10030887 | Ga0207639_100308871 | 194 |
| 291 | 3300028786 | Ga0307517_10045840 | Ga0307517_100458404 | 194 |
| 292 | 3300031238 | Ga0265332_10096917 | Ga0265332_100969172 | 194 |
| 293 | 3300031249 | Ga0265339_10000195 | Ga0265339_1000019538 | 194 |
| 294 | 3300031344 | Ga0265316_10000300 | Ga0265316_1000030018 | 194 |
| 295 | 3300031711 | Ga0265314_10000002 | Ga0265314_10000002187 | 194 |
| 296 | 3300035092 | Ga0373952_0000264 | Ga0373952_0000264_4867_5595 | 194 |
| 297 | 3300035121 | Ga0373960_0051947 | Ga0373960_0051947_271_999 | 194 |
| 298 | 3300035170 | Ga0373943_0179917 | Ga0373943_0179917_288_950 | 194 |
| 299 | 3300035691 | Ga0373931_0224265 | Ga0373931_0224265_174_839 | 194 |
| 300 | 3300036401 | Ga0373937_0820526 | Ga0373937_0820526_197_832 | 194 |
| 301 | 3300037312 | Ga0395899_0000039 | Ga0395899_0000039_17080_17850 | 194 |
| 302 | 3300039437 | Ga0436365_0147248 | Ga0436365_0147248_789_1535 | 194 |
| 303 | 3300039437 | Ga0436365_1838315 | Ga0436365_1838315_6070_6831 | 194 |
| 304 | 3300044683 | Ga0466965_0080054 | Ga0466965_0080054_348_944 | 194 |
| 305 | 3300044694 | Ga0466963_0563093 | Ga0466963_0563093_42_638 | 194 |
| 306 | 3300045976 | Ga0466967_0925219 | Ga0466967_0925219_15_611 | 194 |
| 307 | 3300046459 | Ga0495629_0275977 | Ga0495629_0275977_390_1037 | 194 |
| 308 | 3300046472 | Ga0495580_0275798 | Ga0495580_0275798_66_728 | 194 |
| 309 | 3300046507 | Ga0495606_0067615 | Ga0495606_0067615_813_1466 | 194 |
| 310 | 3300046684 | Ga0495669_0114131 | Ga0495669_0114131_522_1175 | 194 |
| 311 | 3300046694 | Ga0495649_0176326 | Ga0495649_0176326_191_874 | 194 |
| 312 | 3300046794 | Ga0495589_0091173 | Ga0495589_0091173_690_1343 | 194 |
| 313 | 3300047443 | Ga0495687_004265 | Ga0495687_004265_3927_4580 | 194 |
| 314 | 3300047673 | Ga0495593_0084241 | Ga0495593_0084241_547_1194 | 194 |
| 315 | 3300047673 | Ga0495593_0271481 | Ga0495593_0271481_29_682 | 194 |
| 316 | 3300048088 | Ga0495602_0251698 | Ga0495602_0251698_324_1076 | 194 |
| 317 | 3300048903 | Ga0496100_0060233 | Ga0496100_0060233_1775_2437 | 194 |
| 318 | 3300048903 | Ga0496100_0276526 | Ga0496100_0276526_60_821 | 194 |
| 319 | 3300048907 | Ga0496104_0070167 | Ga0496104_0070167_314_976 | 194 |
| 320 | 3300048907 | Ga0496104_0164835 | Ga0496104_0164835_1028_1684 | 194 |
| 321 | 3300048908 | Ga0496105_0135221 | Ga0496105_0135221_801_1439 | 194 |
| 322 | 3300048908 | Ga0496105_0167307 | Ga0496105_0167307_803_1465 | 194 |
| 323 | 3300048910 | Ga0496107_0195253 | Ga0496107_0195253_502_1164 | 194 |
| 324 | 3300048912 | Ga0496109_0071103 | Ga0496109_0071103_2206_2844 | 194 |
| 325 | 3300048913 | Ga0496110_0124637 | Ga0496110_0124637_1279_2034 | 194 |
| 326 | 3300048915 | Ga0496112_0300527 | Ga0496112_0300527_588_1226 | 194 |
| 327 | 3300048916 | Ga0496113_0019088 | Ga0496113_0019088_3917_4567 | 194 |
| 328 | 3300048917 | Ga0496114_0021798 | Ga0496114_0021798_2820_3482 | 194 |
| 329 | 3300048918 | Ga0496115_0012871 | Ga0496115_0012871_1733_2395 | 194 |
| 330 | 3300049572 | Ga0501036_0009934 | Ga0501036_0009934_6979_7740 | 194 |
| 331 | 3300049573 | Ga0501037_0000010 | Ga0501037_0000010_141025_141786 | 194 |
| 332 | 3300049579 | Ga0501043_0151153 | Ga0501043_0151153_435_1091 | 194 |
| 333 | 3300049581 | Ga0501047_0017854 | Ga0501047_0017854_3089_3745 | 194 |
| 334 | 3300049581 | Ga0501047_0051345 | Ga0501047_0051345_2062_2715 | 194 |
| 335 | 3300049586 | Ga0501070_0003344 | Ga0501070_0003344_4300_4956 | 194 |
| 336 | 3300049589 | Ga0501073_0170652 | Ga0501073_0170652_446_1102 | 194 |
| 337 | 3300049590 | Ga0501074_0010115 | Ga0501074_0010115_4823_5479 | 194 |
| 338 | 3300049741 | Ga0501079_0183967 | Ga0501079_0183967_44_715 | 194 |
| 339 | 3300049742 | Ga0501080_0009780 | Ga0501080_0009780_2809_3465 | 194 |
| 340 | 3300049742 | Ga0501080_0249725 | Ga0501080_0249725_22_693 | 194 |
| 341 | 3300049822 | Ga0501035_0001302 | Ga0501035_0001302_1430_2086 | 194 |
| 342 | 3300049823 | Ga0501044_0000265 | Ga0501044_0000265_8987_9748 | 194 |
| 343 | 3300049823 | Ga0501044_0030532 | Ga0501044_0030532_1995_2651 | 194 |
| 344 | 3300050516 | nmdc:mga0sz30_51245_c1 | nmdc:mga0sz30_51245_c1_769_1452 | 194 |
| 345 | 3300053144 | Ga0500585_159549 | Ga0500585_159549_29_694 | 194 |
| 346 | 3300060353 | Ga0501082_0686359 | Ga0501082_0686359_31_657 | 194 |
| 347 | 3300003759 | Ga0055525_1000388 | Ga0055525_100038820 | 195 |
| 348 | 3300003762 | Ga0055542_1000060 | Ga0055542_1000060135 | 195 |
| 349 | 3300003763 | Ga0055529_1000043 | Ga0055529_100004333 | 195 |
| 350 | 3300005467 | Ga0070706_100645321 | Ga0070706_1006453211 | 195 |
| 351 | 3300005468 | Ga0070707_100024932 | Ga0070707_1000249322 | 195 |
| 352 | 3300005468 | Ga0070707_100208537 | Ga0070707_1002085373 | 195 |
| 353 | 3300005536 | Ga0070697_100143209 | Ga0070697_1001432091 | 195 |
| 354 | 3300006844 | Ga0075428_100034872 | Ga0075428_1000348728 | 195 |
| 355 | 3300006847 | Ga0075431_100060694 | Ga0075431_1000606944 | 195 |
| 356 | 3300007076 | Ga0075435_100072774 | Ga0075435_1000727742 | 195 |
| 357 | 3300009094 | Ga0111539_10291181 | Ga0111539_102911813 | 195 |
| 358 | 3300009147 | Ga0114129_10067933 | Ga0114129_100679333 | 195 |
| 359 | 3300009993 | Ga0105028_103858 | Ga0105028_1038581 | 195 |
| 360 | 3300010159 | Ga0099796_10053613 | Ga0099796_100536132 | 195 |
| 361 | 3300013297 | Ga0157378_10376998 | Ga0157378_103769982 | 195 |
| 362 | 3300025230 | Ga0209563_100106 | Ga0209563_100106112 | 195 |
| 363 | 3300025254 | Ga0209148_1000017 | Ga0209148_1000017282 | 195 |
| 364 | 3300025261 | Ga0209233_1000463 | Ga0209233_10004637 | 195 |
| 365 | 3300025272 | Ga0209455_1000005 | Ga0209455_1000005282 | 195 |
| 366 | 3300028380 | Ga0268265_10151135 | Ga0268265_101511351 | 195 |
| 367 | 3300031665 | Ga0316575_10064273 | Ga0316575_100642732 | 195 |
| 368 | 3300031691 | Ga0316579_10000907 | Ga0316579_1000090712 | 195 |
| 369 | 3300031691 | Ga0316579_10001630 | Ga0316579_100016305 | 195 |
| 370 | 3300031727 | Ga0316576_10266991 | Ga0316576_102669912 | 195 |
| 371 | 3300031728 | Ga0316578_10028349 | Ga0316578_100283494 | 195 |
| 372 | 3300031733 | Ga0316577_10004132 | Ga0316577_100041325 | 195 |
| 373 | 3300031733 | Ga0316577_10020484 | Ga0316577_100204843 | 195 |
| 374 | 3300032133 | Ga0316583_10032531 | Ga0316583_100325312 | 195 |
| 375 | 3300032137 | Ga0316585_10020009 | Ga0316585_100200092 | 195 |
| 376 | 3300033541 | Ga0316596_1012231 | Ga0316596_10122313 | 195 |
| 377 | 3300035118 | Ga0373954_0017819 | Ga0373954_0017819_1626_2369 | 195 |
| 378 | 3300035118 | Ga0373954_0285819 | Ga0373954_0285819_90_743 | 195 |
| 379 | 3300035172 | Ga0373955_0005573 | Ga0373955_0005573_533_1276 | 195 |
| 380 | 3300035241 | Ga0373961_0054789 | Ga0373961_0054789_20_670 | 195 |
| 381 | 3300035398 | Ga0316574_0085714 | Ga0316574_0085714_942_1637 | 195 |
| 382 | 3300035410 | Ga0373924_0085533 | Ga0373924_0085533_546_1289 | 195 |
| 383 | 3300035410 | Ga0373924_0214187 | Ga0373924_0214187_51_746 | 195 |
| 384 | 3300035692 | Ga0373935_0077822 | Ga0373935_0077822_775_1410 | 195 |
| 385 | 3300035724 | Ga0373933_0026832 | Ga0373933_0026832_549_1292 | 195 |
| 386 | 3300035724 | Ga0373933_0110412 | Ga0373933_0110412_680_1333 | 195 |
| 387 | 3300036401 | Ga0373937_0313292 | Ga0373937_0313292_179_922 | 195 |
| 388 | 3300036647 | Ga0316582_0000071 | Ga0316582_0000071_23246_23941 | 195 |
| 389 | 3300036712 | Ga0316584_0000431 | Ga0316584_0000431_9249_9944 | 195 |
| 390 | 3300036712 | Ga0316584_0003128 | Ga0316584_0003128_7929_8624 | 195 |
| 391 | 3300037588 | Ga0316581_0008892 | Ga0316581_0008892_1060_1755 | 195 |
| 392 | 3300037853 | Ga0436364_0005137 | Ga0436364_0005137_564_1184 | 195 |
| 393 | 3300038735 | Ga0400485_22206 | Ga0400485_22206_161_856 | 195 |
| 394 | 3300039437 | Ga0436365_0509139 | Ga0436365_0509139_232_852 | 195 |
| 395 | 3300045051 | Ga0451576_0498432 | Ga0451576_0498432_529_1203 | 195 |
| 396 | 3300046477 | Ga0495664_0025929 | Ga0495664_0025929_2542_3177 | 195 |
| 397 | 3300046524 | Ga0495648_0005048 | Ga0495648_0005048_6527_7159 | 195 |
| 398 | 3300046533 | Ga0495640_0097433 | Ga0495640_0097433_940_1683 | 195 |
| 399 | 3300046543 | Ga0495645_0128622 | Ga0495645_0128622_193_828 | 195 |
| 400 | 3300046664 | Ga0495659_0043020 | Ga0495659_0043020_142_786 | 195 |
| 401 | 3300046678 | Ga0495599_0148253 | Ga0495599_0148253_663_1298 | 195 |
| 402 | 3300046679 | Ga0495623_0101578 | Ga0495623_0101578_764_1399 | 195 |
| 403 | 3300046809 | Ga0495600_0267744 | Ga0495600_0267744_332_967 | 195 |
| 404 | 3300047322 | Ga0495680_0262945 | Ga0495680_0262945_52_795 | 195 |
| 405 | 3300047472 | Ga0495686_0021343 | Ga0495686_0021343_3496_4125 | 195 |
| 406 | 3300048910 | Ga0496107_0135397 | Ga0496107_0135397_679_1440 | 195 |
| 407 | 3300048919 | Ga0496116_0057432 | Ga0496116_0057432_1022_1759 | 195 |
| 408 | 3300048919 | Ga0496116_0089581 | Ga0496116_0089581_705_1448 | 195 |
| 409 | 3300049569 | Ga0501032_0103539 | Ga0501032_0103539_779_1417 | 195 |
| 410 | 3300049572 | Ga0501036_0022713 | Ga0501036_0022713_1100_1738 | 195 |
| 411 | 3300049575 | Ga0501039_0008462 | Ga0501039_0008462_6128_6766 | 195 |
| 412 | 3300049576 | Ga0501040_0021327 | Ga0501040_0021327_162_800 | 195 |
| 413 | 3300049577 | Ga0501041_0086900 | Ga0501041_0086900_50_688 | 195 |
| 414 | 3300049578 | Ga0501042_0018160 | Ga0501042_0018160_89_727 | 195 |
| 415 | 3300049578 | Ga0501042_0030422 | Ga0501042_0030422_2281_2919 | 195 |
| 416 | 3300049580 | Ga0501046_0075055 | Ga0501046_0075055_680_1318 | 195 |
| 417 | 3300049582 | Ga0501048_0018802 | Ga0501048_0018802_1012_1650 | 195 |
| 418 | 3300049584 | Ga0501068_0073888 | Ga0501068_0073888_1195_1833 | 195 |
| 419 | 3300049587 | Ga0501071_0017030 | Ga0501071_0017030_917_1555 | 195 |
| 420 | 3300049587 | Ga0501071_0086404 | Ga0501071_0086404_287_925 | 195 |
| 421 | 3300049589 | Ga0501073_0255646 | Ga0501073_0255646_95_733 | 195 |
| 422 | 3300049590 | Ga0501074_0169592 | Ga0501074_0169592_615_1253 | 195 |
| 423 | 3300049591 | Ga0501075_0010712 | Ga0501075_0010712_4498_5136 | 195 |
| 424 | 3300049591 | Ga0501075_0014324 | Ga0501075_0014324_2464_3102 | 195 |
| 425 | 3300049592 | Ga0501076_0073873 | Ga0501076_0073873_1152_1790 | 195 |
| 426 | 3300049592 | Ga0501076_0152290 | Ga0501076_0152290_122_763 | 195 |
| 427 | 3300049593 | Ga0501077_0048340 | Ga0501077_0048340_1068_1706 | 195 |
| 428 | 3300049741 | Ga0501079_0067025 | Ga0501079_0067025_990_1628 | 195 |
| 429 | 3300049741 | Ga0501079_0074440 | Ga0501079_0074440_275_913 | 195 |
| 430 | 3300049742 | Ga0501080_0218814 | Ga0501080_0218814_848_1486 | 195 |
| 431 | 3300049742 | Ga0501080_0628767 | Ga0501080_0628767_236_874 | 195 |
| 432 | 3300049743 | Ga0501081_0070752 | Ga0501081_0070752_841_1479 | 195 |
| 433 | 3300049744 | Ga0501083_0063347 | Ga0501083_0063347_820_1458 | 195 |
| 434 | 3300049822 | Ga0501035_0033351 | Ga0501035_0033351_3293_3931 | 195 |
| 435 | 3300049824 | Ga0501045_0056113 | Ga0501045_0056113_942_1580 | 195 |
| 436 | 3300050507 | nmdc:mga05p37_206978_c1 | nmdc:mga05p37_206978_c1_664_1290 | 195 |
| 437 | 3300050510 | nmdc:mga06r32_73952_c1 | nmdc:mga06r32_73952_c1_1997_2623 | 195 |
| 438 | 3300050511 | nmdc:mga08y16_170731_c1 | nmdc:mga08y16_170731_c1_1010_1633 | 195 |
| 439 | 3300053084 | Ga0495595_0115197 | Ga0495595_0115197_32_775 | 195 |
| 440 | 3300053094 | Ga0500566_0004593 | Ga0500566_0004593_2809_3474 | 195 |
| 441 | 3300053130 | Ga0500642_0033444 | Ga0500642_0033444_123_800 | 195 |
| 442 | 3300054114 | Ga0501084_0106430 | Ga0501084_0106430_876_1514 | 195 |
| 443 | 3300054114 | Ga0501084_0451798 | Ga0501084_0451798_383_1021 | 195 |
| 444 | 3300061734 | Ga0530510_0009460 | Ga0530510_0009460_1283_1921 | 195 |
| 445 | iso_pu_bacteria | 2888419890 | 2888427387 | 195 |
| 446 | 3300005331 | Ga0070670_100006650 | Ga0070670_1000066505 | 196 |
| 447 | 3300005334 | Ga0068869_100000518 | Ga0068869_1000005189 | 196 |
| 448 | 3300005336 | Ga0070680_100251344 | Ga0070680_1002513442 | 196 |
| 449 | 3300005338 | Ga0068868_100834577 | Ga0068868_1008345771 | 196 |
| 450 | 3300005340 | Ga0070689_100090192 | Ga0070689_1000901922 | 196 |
| 451 | 3300005343 | Ga0070687_100065273 | Ga0070687_1000652732 | 196 |
| 452 | 3300005355 | Ga0070671_100636184 | Ga0070671_1006361841 | 196 |
| 453 | 3300005364 | Ga0070673_100009443 | Ga0070673_1000094437 | 196 |
| 454 | 3300005367 | Ga0070667_100131778 | Ga0070667_1001317782 | 196 |
| 455 | 3300005435 | Ga0070714_100173969 | Ga0070714_1001739692 | 196 |
| 456 | 3300005436 | Ga0070713_100114720 | Ga0070713_1001147204 | 196 |
| 457 | 3300005437 | Ga0070710_10224606 | Ga0070710_102246062 | 196 |
| 458 | 3300005455 | Ga0070663_100057016 | Ga0070663_1000570162 | 196 |
| 459 | 3300005458 | Ga0070681_10193364 | Ga0070681_101933641 | 196 |
| 460 | 3300005459 | Ga0068867_100001294 | Ga0068867_1000012945 | 196 |
| 461 | 3300005471 | Ga0070698_100659981 | Ga0070698_1006599811 | 196 |
| 462 | 3300005518 | Ga0070699_100070104 | Ga0070699_1000701043 | 196 |
| 463 | 3300005530 | Ga0070679_100499598 | Ga0070679_1004995982 | 196 |
| 464 | 3300005543 | Ga0070672_100318333 | Ga0070672_1003183332 | 196 |
| 465 | 3300005563 | Ga0068855_100447028 | Ga0068855_1004470282 | 196 |
| 466 | 3300005617 | Ga0068859_100030539 | Ga0068859_1000305392 | 196 |
| 467 | 3300005618 | Ga0068864_100000394 | Ga0068864_10000039436 | 196 |
| 468 | 3300005719 | Ga0068861_100003658 | Ga0068861_10000365811 | 196 |
| 469 | 3300005841 | Ga0068863_100028085 | Ga0068863_1000280854 | 196 |
| 470 | 3300005842 | Ga0068858_100025720 | Ga0068858_1000257207 | 196 |
| 471 | 3300005843 | Ga0068860_100046555 | Ga0068860_1000465551 | 196 |
| 472 | 3300005844 | Ga0068862_100007631 | Ga0068862_1000076316 | 196 |
| 473 | 3300006175 | Ga0070712_100071523 | Ga0070712_1000715233 | 196 |
| 474 | 3300006178 | Ga0075367_10060821 | Ga0075367_100608214 | 196 |
| 475 | 3300006844 | Ga0075428_101024465 | Ga0075428_1010244651 | 196 |
| 476 | 3300006931 | Ga0097620_100030538 | Ga0097620_1000305382 | 196 |
| 477 | 3300007265 | Ga0099794_10031658 | Ga0099794_100316581 | 196 |
| 478 | 3300007788 | Ga0099795_10001879 | Ga0099795_100018794 | 196 |
| 479 | 3300009098 | Ga0105245_10392510 | Ga0105245_103925102 | 196 |
| 480 | 3300009177 | Ga0105248_10011661 | Ga0105248_1001166110 | 196 |
| 481 | 3300010159 | Ga0099796_10004830 | Ga0099796_100048305 | 196 |
| 482 | 3300013104 | Ga0157370_10831278 | Ga0157370_108312782 | 196 |
| 483 | 3300013297 | Ga0157378_10018371 | Ga0157378_100183718 | 196 |
| 484 | 3300013297 | Ga0157378_10063574 | Ga0157378_100635742 | 196 |
| 485 | 3300014497 | Ga0182008_10110336 | Ga0182008_101103362 | 196 |
| 486 | 3300014968 | Ga0157379_10002992 | Ga0157379_100029922 | 196 |
| 487 | 3300021358 | Ga0213873_10042582 | Ga0213873_100425822 | 196 |
| 488 | 3300021441 | Ga0213871_10014157 | Ga0213871_100141573 | 196 |
| 489 | 3300025898 | Ga0207692_10124317 | Ga0207692_101243172 | 196 |
| 490 | 3300025903 | Ga0207680_10358733 | Ga0207680_103587332 | 196 |
| 491 | 3300025907 | Ga0207645_10041895 | Ga0207645_100418953 | 196 |
| 492 | 3300025908 | Ga0207643_10032438 | Ga0207643_100324382 | 196 |
| 493 | 3300025912 | Ga0207707_10171389 | Ga0207707_101713892 | 196 |
| 494 | 3300025915 | Ga0207693_10172970 | Ga0207693_101729703 | 196 |
| 495 | 3300025918 | Ga0207662_10177411 | Ga0207662_101774112 | 196 |
| 496 | 3300025923 | Ga0207681_10086980 | Ga0207681_100869801 | 196 |
| 497 | 3300025925 | Ga0207650_10715897 | Ga0207650_107158972 | 196 |
| 498 | 3300025927 | Ga0207687_10662019 | Ga0207687_106620192 | 196 |
| 499 | 3300025928 | Ga0207700_10064060 | Ga0207700_100640604 | 196 |
| 500 | 3300025929 | Ga0207664_10197837 | Ga0207664_101978374 | 196 |
| 501 | 3300025936 | Ga0207670_10121115 | Ga0207670_101211152 | 196 |
| 502 | 3300025940 | Ga0207691_10169702 | Ga0207691_101697022 | 196 |
| 503 | 3300025941 | Ga0207711_10662996 | Ga0207711_106629962 | 196 |
| 504 | 3300025942 | Ga0207689_10000215 | Ga0207689_1000021537 | 196 |
| 505 | 3300025960 | Ga0207651_10018579 | Ga0207651_100185793 | 196 |
| 506 | 3300025986 | Ga0207658_10166869 | Ga0207658_101668691 | 196 |
| 507 | 3300026023 | Ga0207677_10503135 | Ga0207677_105031351 | 196 |
| 508 | 3300026035 | Ga0207703_10068215 | Ga0207703_100682153 | 196 |
| 509 | 3300026067 | Ga0207678_10230260 | Ga0207678_102302602 | 196 |
| 510 | 3300026088 | Ga0207641_10106131 | Ga0207641_101061311 | 196 |
| 511 | 3300026089 | Ga0207648_10000620 | Ga0207648_1000062022 | 196 |
| 512 | 3300026116 | Ga0207674_10015306 | Ga0207674_100153065 | 196 |
| 513 | 3300026118 | Ga0207675_100001798 | Ga0207675_10000179821 | 196 |
| 514 | 3300027526 | Ga0209968_1004456 | Ga0209968_10044562 | 196 |
| 515 | 3300028381 | Ga0268264_10009612 | Ga0268264_100096125 | 196 |
| 516 | 3300031247 | Ga0265340_10029882 | Ga0265340_100298822 | 196 |
| 517 | 3300031249 | Ga0265339_10000052 | Ga0265339_1000005286 | 196 |
| 518 | 3300031249 | Ga0265339_10218072 | Ga0265339_102180722 | 196 |
| 519 | 3300031595 | Ga0265313_10000318 | Ga0265313_1000031828 | 196 |
| 520 | 3300031595 | Ga0265313_10047456 | Ga0265313_100474563 | 196 |
| 521 | 3300031711 | Ga0265314_10054403 | Ga0265314_100544032 | 196 |
| 522 | 3300031727 | Ga0316576_10002342 | Ga0316576_100023425 | 196 |
| 523 | 3300031728 | Ga0316578_10011663 | Ga0316578_100116632 | 196 |
| 524 | 3300031733 | Ga0316577_10151068 | Ga0316577_101510682 | 196 |
| 525 | 3300033528 | Ga0316588_1041902 | Ga0316588_10419021 | 196 |
| 526 | 3300035089 | Ga0373944_0089435 | Ga0373944_0089435_179_916 | 196 |
| 527 | 3300035170 | Ga0373943_0103227 | Ga0373943_0103227_324_1061 | 196 |
| 528 | 3300037466 | Ga0395898_0000051 | Ga0395898_0000051_224086_224874 | 196 |
| 529 | 3300039438 | Ga0436360_1121536 | Ga0436360_1121536_27_650 | 196 |
| 530 | 3300039438 | Ga0436360_1198600 | Ga0436360_1198600_153_776 | 196 |
| 531 | 3300039447 | Ga0436361_0090326 | Ga0436361_0090326_377_1024 | 196 |
| 532 | 3300039453 | Ga0436362_0454622 | Ga0436362_0454622_1261_1884 | 196 |
| 533 | 3300044694 | Ga0466963_0062019 | Ga0466963_0062019_982_1617 | 196 |
| 534 | 3300045976 | Ga0466967_0184790 | Ga0466967_0184790_441_1076 | 196 |
| 535 | 3300046455 | Ga0495603_0000898 | Ga0495603_0000898_7329_7976 | 196 |
| 536 | 3300046458 | Ga0495591_013627 | Ga0495591_013627_595_1242 | 196 |
| 537 | 3300046459 | Ga0495629_0000267 | Ga0495629_0000267_19165_19812 | 196 |
| 538 | 3300046463 | Ga0495653_0132616 | Ga0495653_0132616_1016_1663 | 196 |
| 539 | 3300046471 | Ga0495650_0000523 | Ga0495650_0000523_43727_44374 | 196 |
| 540 | 3300046472 | Ga0495580_0006425 | Ga0495580_0006425_5540_6187 | 196 |
| 541 | 3300046501 | Ga0495607_0298236 | Ga0495607_0298236_68_715 | 196 |
| 542 | 3300046507 | Ga0495606_0390781 | Ga0495606_0390781_30_677 | 196 |
| 543 | 3300046511 | Ga0495608_0247248 | Ga0495608_0247248_337_984 | 196 |
| 544 | 3300046530 | Ga0495654_0033722 | Ga0495654_0033722_1513_2160 | 196 |
| 545 | 3300046543 | Ga0495645_0002332 | Ga0495645_0002332_4421_5068 | 196 |
| 546 | 3300046559 | Ga0495667_0023171 | Ga0495667_0023171_3307_3954 | 196 |
| 547 | 3300046681 | Ga0495647_0218731 | Ga0495647_0218731_52_675 | 196 |
| 548 | 3300046684 | Ga0495669_0133609 | Ga0495669_0133609_441_1088 | 196 |
| 549 | 3300046689 | Ga0495613_0292797 | Ga0495613_0292797_194_841 | 196 |
| 550 | 3300047315 | Ga0495581_0001676 | Ga0495581_0001676_6541_7188 | 196 |
| 551 | 3300047323 | Ga0495683_0028336 | Ga0495683_0028336_982_1629 | 196 |
| 552 | 3300048906 | Ga0496103_0366263 | Ga0496103_0366263_159_806 | 196 |
| 553 | 3300048912 | Ga0496109_0078965 | Ga0496109_0078965_704_1351 | 196 |
| 554 | 3300048917 | Ga0496114_0000748 | Ga0496114_0000748_14112_14759 | 196 |
| 555 | 3300048918 | Ga0496115_0118606 | Ga0496115_0118606_827_1474 | 196 |
| 556 | 3300048929 | Ga0496126_0397263 | Ga0496126_0397263_263_910 | 196 |
| 557 | 3300049575 | Ga0501039_0007650 | Ga0501039_0007650_3530_4207 | 196 |
| 558 | 3300049576 | Ga0501040_0115411 | Ga0501040_0115411_1030_1707 | 196 |
| 559 | 3300049577 | Ga0501041_0047207 | Ga0501041_0047207_1360_2037 | 196 |
| 560 | 3300049578 | Ga0501042_0244606 | Ga0501042_0244606_385_1017 | 196 |
| 561 | 3300049579 | Ga0501043_0039313 | Ga0501043_0039313_235_912 | 196 |
| 562 | 3300049580 | Ga0501046_0020796 | Ga0501046_0020796_2511_3188 | 196 |
| 563 | 3300049584 | Ga0501068_0030252 | Ga0501068_0030252_1945_2622 | 196 |
| 564 | 3300049587 | Ga0501071_0017383 | Ga0501071_0017383_1018_1695 | 196 |
| 565 | 3300049588 | Ga0501072_0090378 | Ga0501072_0090378_67_735 | 196 |
| 566 | 3300049589 | Ga0501073_0372046 | Ga0501073_0372046_91_768 | 196 |
| 567 | 3300049591 | Ga0501075_0054465 | Ga0501075_0054465_682_1359 | 196 |
| 568 | 3300049591 | Ga0501075_0236724 | Ga0501075_0236724_643_1320 | 196 |
| 569 | 3300049591 | Ga0501075_0524695 | Ga0501075_0524695_196_891 | 196 |
| 570 | 3300049592 | Ga0501076_0021105 | Ga0501076_0021105_3479_4156 | 196 |
| 571 | 3300049741 | Ga0501079_0029206 | Ga0501079_0029206_1582_2259 | 196 |
| 572 | 3300049742 | Ga0501080_0025227 | Ga0501080_0025227_3705_4382 | 196 |
| 573 | 3300049743 | Ga0501081_0005186 | Ga0501081_0005186_768_1445 | 196 |
| 574 | 3300049822 | Ga0501035_0107203 | Ga0501035_0107203_296_973 | 196 |
| 575 | 3300049824 | Ga0501045_0067529 | Ga0501045_0067529_395_1072 | 196 |
| 576 | 3300050494 | nmdc:mga06z11_83736_c1 | nmdc:mga06z11_83736_c1_884_1666 | 196 |
| 577 | 3300050508 | nmdc:mga09592_117745_c1 | nmdc:mga09592_117745_c1_904_1536 | 196 |
| 578 | 3300050513 | nmdc:mga0rr50_309136_c1 | nmdc:mga0rr50_309136_c1_355_1071 | 196 |
| 579 | 3300054114 | Ga0501084_0054589 | Ga0501084_0054589_1773_2450 | 196 |
| 580 | 3300060353 | Ga0501082_0002352 | Ga0501082_0002352_1648_2325 | 196 |
| 581 | 3300060353 | Ga0501082_0105590 | Ga0501082_0105590_1192_1884 | 196 |
| 582 | iso_pu_bacteria | 2861691609 | 2861697033 | 196 |
| 583 | 3300003775 | Ga0055524_1002269 | Ga0055524_10022695 | 197 |
| 584 | 3300006028 | Ga0070717_10026307 | Ga0070717_100263076 | 197 |
| 585 | 3300006028 | Ga0070717_10406246 | Ga0070717_104062462 | 197 |
| 586 | 3300025929 | Ga0207664_10338989 | Ga0207664_103389892 | 197 |
| 587 | 3300025939 | Ga0207665_10106406 | Ga0207665_101064062 | 197 |
| 588 | 3300028381 | Ga0268264_10229111 | Ga0268264_102291112 | 197 |
| 589 | 3300031507 | Ga0307509_10000177 | Ga0307509_100001772 | 197 |
| 590 | 3300031901 | Ga0307406_10096425 | Ga0307406_100964252 | 197 |
| 591 | 3300035086 | Ga0373934_0069808 | Ga0373934_0069808_665_1303 | 197 |
| 592 | 3300035111 | Ga0373923_0015498 | Ga0373923_0015498_2159_2797 | 197 |
| 593 | 3300035113 | Ga0373936_0001304 | Ga0373936_0001304_8376_9014 | 197 |
| 594 | 3300035116 | Ga0373945_0025200 | Ga0373945_0025200_223_861 | 197 |
| 595 | 3300035117 | Ga0373953_0006486 | Ga0373953_0006486_660_1298 | 197 |
| 596 | 3300035118 | Ga0373954_0003435 | Ga0373954_0003435_1176_1814 | 197 |
| 597 | 3300035171 | Ga0373946_0000442 | Ga0373946_0000442_5708_6346 | 197 |
| 598 | 3300035410 | Ga0373924_0000432 | Ga0373924_0000432_5293_5931 | 197 |
| 599 | 3300035692 | Ga0373935_0000370 | Ga0373935_0000370_13096_13734 | 197 |
| 600 | 3300035724 | Ga0373933_0004813 | Ga0373933_0004813_3592_4230 | 197 |
| 601 | 3300035725 | Ga0373947_0000476 | Ga0373947_0000476_9119_9757 | 197 |
| 602 | 3300036401 | Ga0373937_0000009 | Ga0373937_0000009_89947_90585 | 197 |
| 603 | 3300037068 | Ga0373925_0000194 | Ga0373925_0000194_21613_22251 | 197 |
| 604 | 3300037418 | Ga0395900_0695846 | Ga0395900_0695846_218_871 | 197 |
| 605 | 3300037853 | Ga0436364_0719253 | Ga0436364_0719253_675_1316 | 197 |
| 606 | 3300039437 | Ga0436365_1460405 | Ga0436365_1460405_146_841 | 197 |
| 607 | 3300045976 | Ga0466967_0012356 | Ga0466967_0012356_5319_5960 | 197 |
| 608 | 3300046454 | Ga0495592_0000018 | Ga0495592_0000018_27038_27676 | 197 |
| 609 | 3300046459 | Ga0495629_0004511 | Ga0495629_0004511_1400_2038 | 197 |
| 610 | 3300046460 | Ga0495638_0045888 | Ga0495638_0045888_1872_2534 | 197 |
| 611 | 3300046462 | Ga0495651_0001122 | Ga0495651_0001122_17246_17884 | 197 |
| 612 | 3300046463 | Ga0495653_0000032 | Ga0495653_0000032_59148_59786 | 197 |
| 613 | 3300046476 | Ga0495662_0023189 | Ga0495662_0023189_1618_2256 | 197 |
| 614 | 3300046477 | Ga0495664_0000010 | Ga0495664_0000010_177926_178564 | 197 |
| 615 | 3300046491 | Ga0495584_0028056 | Ga0495584_0028056_527_1189 | 197 |
| 616 | 3300046511 | Ga0495608_0000008 | Ga0495608_0000008_90085_90723 | 197 |
| 617 | 3300046514 | Ga0495618_0000002 | Ga0495618_0000002_180199_180837 | 197 |
| 618 | 3300046516 | Ga0495628_0000009 | Ga0495628_0000009_177954_178592 | 197 |
| 619 | 3300046517 | Ga0495630_0001850 | Ga0495630_0001850_5036_5674 | 197 |
| 620 | 3300046529 | Ga0495652_0000011 | Ga0495652_0000011_89775_90413 | 197 |
| 621 | 3300046533 | Ga0495640_0000009 | Ga0495640_0000009_38527_39165 | 197 |
| 622 | 3300046536 | Ga0495587_0000006 | Ga0495587_0000006_291672_292310 | 197 |
| 623 | 3300046543 | Ga0495645_0000010 | Ga0495645_0000010_59148_59786 | 197 |
| 624 | 3300046559 | Ga0495667_0000005 | Ga0495667_0000005_177954_178592 | 197 |
| 625 | 3300046642 | Ga0495634_0000223 | Ga0495634_0000223_45417_46055 | 197 |
| 626 | 3300046663 | Ga0495635_0000008 | Ga0495635_0000008_89758_90396 | 197 |
| 627 | 3300046675 | Ga0495657_0000058 | Ga0495657_0000058_44511_45149 | 197 |
| 628 | 3300046678 | Ga0495599_0000007 | Ga0495599_0000007_89775_90413 | 197 |
| 629 | 3300046679 | Ga0495623_0005790 | Ga0495623_0005790_7095_7733 | 197 |
| 630 | 3300046680 | Ga0495646_0000021 | Ga0495646_0000021_89730_90368 | 197 |
| 631 | 3300046683 | Ga0495658_0120777 | Ga0495658_0120777_813_1451 | 197 |
| 632 | 3300046683 | Ga0495658_0263706 | Ga0495658_0263706_178_921 | 197 |
| 633 | 3300046690 | Ga0495624_0007573 | Ga0495624_0007573_1235_1873 | 197 |
| 634 | 3300046694 | Ga0495649_0051061 | Ga0495649_0051061_845_1453 | 197 |
| 635 | 3300046809 | Ga0495600_0000001 | Ga0495600_0000001_89775_90413 | 197 |
| 636 | 3300047315 | Ga0495581_0005192 | Ga0495581_0005192_1712_2350 | 197 |
| 637 | 3300047317 | Ga0495604_0000012 | Ga0495604_0000012_177941_178579 | 197 |
| 638 | 3300047319 | Ga0495674_0000011 | Ga0495674_0000011_180227_180865 | 197 |
| 639 | 3300047322 | Ga0495680_0001281 | Ga0495680_0001281_8969_9607 | 197 |
| 640 | 3300047444 | Ga0495675_0000096 | Ga0495675_0000096_24411_25049 | 197 |
| 641 | 3300047471 | Ga0495684_0000084 | Ga0495684_0000084_5815_6453 | 197 |
| 642 | 3300047673 | Ga0495593_0000727 | Ga0495593_0000727_5104_5742 | 197 |
| 643 | 3300048088 | Ga0495602_0000073 | Ga0495602_0000073_89758_90396 | 197 |
| 644 | 3300048907 | Ga0496104_0241926 | Ga0496104_0241926_82_753 | 197 |
| 645 | 3300048908 | Ga0496105_0094452 | Ga0496105_0094452_1544_2215 | 197 |
| 646 | 3300048915 | Ga0496112_0502964 | Ga0496112_0502964_235_906 | 197 |
| 647 | 3300048923 | Ga0496120_0056006 | Ga0496120_0056006_803_1435 | 197 |
| 648 | 3300053077 | Ga0495601_0000009 | Ga0495601_0000009_89758_90396 | 197 |
| 649 | 3300053078 | Ga0495612_0000019 | Ga0495612_0000019_47432_48070 | 197 |
| 650 | 3300053084 | Ga0495595_0000015 | Ga0495595_0000015_71013_71651 | 197 |
| 651 | 3300053085 | Ga0495619_0000012 | Ga0495619_0000012_89758_90396 | 197 |
| 652 | 3300005434 | Ga0070709_10040822 | Ga0070709_100408225 | 198 |
| 653 | 3300005435 | Ga0070714_100090193 | Ga0070714_1000901934 | 198 |
| 654 | 3300005436 | Ga0070713_100079441 | Ga0070713_1000794414 | 198 |
| 655 | 3300005436 | Ga0070713_100385968 | Ga0070713_1003859682 | 198 |
| 656 | 3300005437 | Ga0070710_10174003 | Ga0070710_101740032 | 198 |
| 657 | 3300005439 | Ga0070711_100121836 | Ga0070711_1001218363 | 198 |
| 658 | 3300005445 | Ga0070708_100081752 | Ga0070708_1000817522 | 198 |
| 659 | 3300005467 | Ga0070706_100298072 | Ga0070706_1002980722 | 198 |
| 660 | 3300005468 | Ga0070707_100130996 | Ga0070707_1001309964 | 198 |
| 661 | 3300005468 | Ga0070707_100288586 | Ga0070707_1002885862 | 198 |
| 662 | 3300005471 | Ga0070698_100763078 | Ga0070698_1007630782 | 198 |
| 663 | 3300005518 | Ga0070699_100049973 | Ga0070699_1000499733 | 198 |
| 664 | 3300005518 | Ga0070699_100216952 | Ga0070699_1002169523 | 198 |
| 665 | 3300005518 | Ga0070699_100840544 | Ga0070699_1008405441 | 198 |
| 666 | 3300005536 | Ga0070697_100166793 | Ga0070697_1001667932 | 198 |
| 667 | 3300005536 | Ga0070697_100930749 | Ga0070697_1009307491 | 198 |
| 668 | 3300005546 | Ga0070696_100181143 | Ga0070696_1001811432 | 198 |
| 669 | 3300005937 | Ga0081455_10000759 | Ga0081455_1000075913 | 198 |
| 670 | 3300005937 | Ga0081455_10173682 | Ga0081455_101736822 | 198 |
| 671 | 3300005981 | Ga0081538_10034097 | Ga0081538_100340972 | 198 |
| 672 | 3300005981 | Ga0081538_10049438 | Ga0081538_100494384 | 198 |
| 673 | 3300005983 | Ga0081540_1005852 | Ga0081540_10058527 | 198 |
| 674 | 3300006028 | Ga0070717_10235118 | Ga0070717_102351183 | 198 |
| 675 | 3300006028 | Ga0070717_10573812 | Ga0070717_105738122 | 198 |
| 676 | 3300006028 | Ga0070717_10811113 | Ga0070717_108111132 | 198 |
| 677 | 3300006048 | Ga0075363_100061152 | Ga0075363_1000611522 | 198 |
| 678 | 3300006163 | Ga0070715_10078649 | Ga0070715_100786491 | 198 |
| 679 | 3300006173 | Ga0070716_100005361 | Ga0070716_1000053612 | 198 |
| 680 | 3300006173 | Ga0070716_100608327 | Ga0070716_1006083272 | 198 |
| 681 | 3300006175 | Ga0070712_100742530 | Ga0070712_1007425301 | 198 |
| 682 | 3300006844 | Ga0075428_100268560 | Ga0075428_1002685602 | 198 |
| 683 | 3300006846 | Ga0075430_100249568 | Ga0075430_1002495681 | 198 |
| 684 | 3300006847 | Ga0075431_100438309 | Ga0075431_1004383092 | 198 |
| 685 | 3300006852 | Ga0075433_10034402 | Ga0075433_100344024 | 198 |
| 686 | 3300006852 | Ga0075433_10044634 | Ga0075433_100446343 | 198 |
| 687 | 3300006871 | Ga0075434_100183759 | Ga0075434_1001837591 | 198 |
| 688 | 3300006871 | Ga0075434_100527712 | Ga0075434_1005277122 | 198 |
| 689 | 3300006880 | Ga0075429_100844309 | Ga0075429_1008443091 | 198 |
| 690 | 3300007076 | Ga0075435_100051318 | Ga0075435_1000513184 | 198 |
| 691 | 3300007076 | Ga0075435_100155526 | Ga0075435_1001555262 | 198 |
| 692 | 3300007076 | Ga0075435_100425814 | Ga0075435_1004258142 | 198 |
| 693 | 3300007265 | Ga0099794_10001551 | Ga0099794_100015516 | 198 |
| 694 | 3300007788 | Ga0099795_10020732 | Ga0099795_100207321 | 198 |
| 695 | 3300009147 | Ga0114129_10062387 | Ga0114129_100623871 | 198 |
| 696 | 3300009147 | Ga0114129_10148400 | Ga0114129_101484003 | 198 |
| 697 | 3300010159 | Ga0099796_10012239 | Ga0099796_100122392 | 198 |
| 698 | 3300013308 | Ga0157375_10606456 | Ga0157375_106064561 | 198 |
| 699 | 3300021358 | Ga0213873_10047742 | Ga0213873_100477422 | 198 |
| 700 | 3300021361 | Ga0213872_10085182 | Ga0213872_100851822 | 198 |
| 701 | 3300021361 | Ga0213872_10115926 | Ga0213872_101159262 | 198 |
| 702 | 3300021384 | Ga0213876_10053268 | Ga0213876_100532682 | 198 |
| 703 | 3300025898 | Ga0207692_10005609 | Ga0207692_100056095 | 198 |
| 704 | 3300025905 | Ga0207685_10084150 | Ga0207685_100841502 | 198 |
| 705 | 3300025906 | Ga0207699_10023641 | Ga0207699_100236414 | 198 |
| 706 | 3300025915 | Ga0207693_10032075 | Ga0207693_100320753 | 198 |
| 707 | 3300025915 | Ga0207693_10191026 | Ga0207693_101910263 | 198 |
| 708 | 3300025916 | Ga0207663_10199844 | Ga0207663_101998442 | 198 |
| 709 | 3300025922 | Ga0207646_10397339 | Ga0207646_103973392 | 198 |
| 710 | 3300025928 | Ga0207700_10145858 | Ga0207700_101458582 | 198 |
| 711 | 3300025929 | Ga0207664_10031526 | Ga0207664_100315266 | 198 |
| 712 | 3300025929 | Ga0207664_10284300 | Ga0207664_102843002 | 198 |
| 713 | 3300025933 | Ga0207706_10099286 | Ga0207706_100992863 | 198 |
| 714 | 3300025941 | Ga0207711_11056212 | Ga0207711_110562121 | 198 |
| 715 | 3300026078 | Ga0207702_10302054 | Ga0207702_103020542 | 198 |
| 716 | 3300027512 | Ga0209179_1002907 | Ga0209179_10029072 | 198 |
| 717 | 3300027717 | Ga0209998_10021992 | Ga0209998_100219922 | 198 |
| 718 | 3300027876 | Ga0209974_10046838 | Ga0209974_100468382 | 198 |
| 719 | 3300027907 | Ga0207428_10086085 | Ga0207428_100860854 | 198 |
| 720 | 3300031241 | Ga0265325_10045164 | Ga0265325_100451643 | 198 |
| 721 | 3300031247 | Ga0265340_10016673 | Ga0265340_100166732 | 198 |
| 722 | 3300031249 | Ga0265339_10024316 | Ga0265339_100243162 | 198 |
| 723 | 3300031507 | Ga0307509_10104000 | Ga0307509_101040003 | 198 |
| 724 | 3300031595 | Ga0265313_10047995 | Ga0265313_100479951 | 198 |
| 725 | 3300031730 | Ga0307516_10051054 | Ga0307516_100510543 | 198 |
| 726 | 3300035090 | Ga0373949_0001647 | Ga0373949_0001647_2057_2821 | 198 |
| 727 | 3300035113 | Ga0373936_0000020 | Ga0373936_0000020_62421_63137 | 198 |
| 728 | 3300035114 | Ga0373939_0092452 | Ga0373939_0092452_156_779 | 198 |
| 729 | 3300035115 | Ga0373941_0004708 | Ga0373941_0004708_2097_2807 | 198 |
| 730 | 3300035118 | Ga0373954_0221043 | Ga0373954_0221043_111_788 | 198 |
| 731 | 3300035692 | Ga0373935_0133751 | Ga0373935_0133751_19_654 | 198 |
| 732 | 3300036401 | Ga0373937_0036036 | Ga0373937_0036036_80_757 | 198 |
| 733 | 3300036401 | Ga0373937_0235830 | Ga0373937_0235830_474_1133 | 198 |
| 734 | 3300037418 | Ga0395900_0161766 | Ga0395900_0161766_505_1125 | 198 |
| 735 | 3300037466 | Ga0395898_0190092 | Ga0395898_0190092_107_727 | 198 |
| 736 | 3300037853 | Ga0436364_0478958 | Ga0436364_0478958_1749_2375 | 198 |
| 737 | 3300038443 | Ga0395901_0026797 | Ga0395901_0026797_4273_4893 | 198 |
| 738 | 3300039437 | Ga0436365_0922321 | Ga0436365_0922321_1450_2097 | 198 |
| 739 | 3300039447 | Ga0436361_0926373 | Ga0436361_0926373_7797_8420 | 198 |
| 740 | 3300039453 | Ga0436362_0578135 | Ga0436362_0578135_414_1115 | 198 |
| 741 | 3300039453 | Ga0436362_0723249 | Ga0436362_0723249_94_741 | 198 |
| 742 | 3300039453 | Ga0436362_0899014 | Ga0436362_0899014_169_804 | 198 |
| 743 | 3300042015 | Ga0439462_0021112 | Ga0439462_0021112_272_994 | 198 |
| 744 | 3300046499 | Ga0495594_0378972 | Ga0495594_0378972_94_717 | 198 |
| 745 | 3300046539 | Ga0495621_0073283 | Ga0495621_0073283_107_811 | 198 |
| 746 | 3300047319 | Ga0495674_0081998 | Ga0495674_0081998_1447_2100 | 198 |
| 747 | 3300047320 | Ga0495672_0174136 | Ga0495672_0174136_464_1081 | 198 |
| 748 | 3300048088 | Ga0495602_0146322 | Ga0495602_0146322_994_1626 | 198 |
| 749 | 3300048903 | Ga0496100_0066496 | Ga0496100_0066496_1451_2068 | 198 |
| 750 | 3300048904 | Ga0496101_0364872 | Ga0496101_0364872_342_989 | 198 |
| 751 | 3300048905 | Ga0496102_0071229 | Ga0496102_0071229_219_839 | 198 |
| 752 | 3300048907 | Ga0496104_0504303 | Ga0496104_0504303_148_795 | 198 |
| 753 | 3300048908 | Ga0496105_0103494 | Ga0496105_0103494_387_1004 | 198 |
| 754 | 3300048908 | Ga0496105_0278486 | Ga0496105_0278486_492_1139 | 198 |
| 755 | 3300048909 | Ga0496106_0132600 | Ga0496106_0132600_148_768 | 198 |
| 756 | 3300048910 | Ga0496107_0022356 | Ga0496107_0022356_71_691 | 198 |
| 757 | 3300048913 | Ga0496110_0039292 | Ga0496110_0039292_2821_3444 | 198 |
| 758 | 3300048913 | Ga0496110_0053471 | Ga0496110_0053471_827_1444 | 198 |
| 759 | 3300048913 | Ga0496110_0413320 | Ga0496110_0413320_549_1196 | 198 |
| 760 | 3300048914 | Ga0496111_0070795 | Ga0496111_0070795_650_1267 | 198 |
| 761 | 3300048915 | Ga0496112_0055415 | Ga0496112_0055415_2893_3510 | 198 |
| 762 | 3300048915 | Ga0496112_0074067 | Ga0496112_0074067_693_1316 | 198 |
| 763 | 3300048917 | Ga0496114_1006043 | Ga0496114_1006043_66_686 | 198 |
| 764 | 3300048918 | Ga0496115_0050576 | Ga0496115_0050576_462_1082 | 198 |
| 765 | 3300048918 | Ga0496115_0066506 | Ga0496115_0066506_863_1480 | 198 |
| 766 | 3300049570 | Ga0501033_0291957 | Ga0501033_0291957_325_948 | 198 |
| 767 | 3300049572 | Ga0501036_0425133 | Ga0501036_0425133_113_736 | 198 |
| 768 | 3300049573 | Ga0501037_0246704 | Ga0501037_0246704_210_833 | 198 |
| 769 | 3300049574 | Ga0501038_0187359 | Ga0501038_0187359_541_1170 | 198 |
| 770 | 3300049574 | Ga0501038_0317503 | Ga0501038_0317503_409_1032 | 198 |
| 771 | 3300049577 | Ga0501041_0243889 | Ga0501041_0243889_307_936 | 198 |
| 772 | 3300049577 | Ga0501041_0289474 | Ga0501041_0289474_208_831 | 198 |
| 773 | 3300049578 | Ga0501042_0159446 | Ga0501042_0159446_277_900 | 198 |
| 774 | 3300049580 | Ga0501046_0059045 | Ga0501046_0059045_1822_2481 | 198 |
| 775 | 3300049580 | Ga0501046_0580858 | Ga0501046_0580858_51_674 | 198 |
| 776 | 3300049582 | Ga0501048_0222972 | Ga0501048_0222972_92_715 | 198 |
| 777 | 3300049582 | Ga0501048_0318592 | Ga0501048_0318592_279_920 | 198 |
| 778 | 3300049582 | Ga0501048_0393826 | Ga0501048_0393826_192_923 | 198 |
| 779 | 3300049582 | Ga0501048_0713230 | Ga0501048_0713230_82_705 | 198 |
| 780 | 3300049583 | Ga0501067_0058219 | Ga0501067_0058219_721_1338 | 198 |
| 781 | 3300049586 | Ga0501070_0139325 | Ga0501070_0139325_705_1328 | 198 |
| 782 | 3300049587 | Ga0501071_0129942 | Ga0501071_0129942_1046_1669 | 198 |
| 783 | 3300049588 | Ga0501072_0125644 | Ga0501072_0125644_1277_1906 | 198 |
| 784 | 3300049588 | Ga0501072_0362126 | Ga0501072_0362126_504_1127 | 198 |
| 785 | 3300049588 | Ga0501072_0390172 | Ga0501072_0390172_63_686 | 198 |
| 786 | 3300049590 | Ga0501074_0137400 | Ga0501074_0137400_31_654 | 198 |
| 787 | 3300049592 | Ga0501076_0161597 | Ga0501076_0161597_595_1236 | 198 |
| 788 | 3300049592 | Ga0501076_0182159 | Ga0501076_0182159_93_716 | 198 |
| 789 | 3300049592 | Ga0501076_0385911 | Ga0501076_0385911_269_898 | 198 |
| 790 | 3300049593 | Ga0501077_0075287 | Ga0501077_0075287_1480_2109 | 198 |
| 791 | 3300049593 | Ga0501077_0196569 | Ga0501077_0196569_461_1084 | 198 |
| 792 | 3300049741 | Ga0501079_0193116 | Ga0501079_0193116_11_643 | 198 |
| 793 | 3300049742 | Ga0501080_0544149 | Ga0501080_0544149_210_833 | 198 |
| 794 | 3300049742 | Ga0501080_0601496 | Ga0501080_0601496_227_856 | 198 |
| 795 | 3300049743 | Ga0501081_0029986 | Ga0501081_0029986_2275_2898 | 198 |
| 796 | 3300049822 | Ga0501035_0099657 | Ga0501035_0099657_1321_1944 | 198 |
| 797 | 3300049824 | Ga0501045_0516795 | Ga0501045_0516795_86_709 | 198 |
| 798 | 3300049824 | Ga0501045_0642655 | Ga0501045_0642655_12_635 | 198 |
| 799 | 3300050489 | nmdc:mga03683_43481_c1 | nmdc:mga03683_43481_c1_564_1181 | 198 |
| 800 | 3300050492 | nmdc:mga0yw44_113804_c1 | nmdc:mga0yw44_113804_c1_1013_1630 | 198 |
| 801 | 3300050507 | nmdc:mga05p37_548824_c1 | nmdc:mga05p37_548824_c1_485_1108 | 198 |
| 802 | 3300050507 | nmdc:mga05p37_585247_c1 | nmdc:mga05p37_585247_c1_464_1084 | 198 |
| 803 | 3300050507 | nmdc:mga05p37_99731_c1 | nmdc:mga05p37_99731_c1_423_1043 | 198 |
| 804 | 3300050508 | nmdc:mga09592_43414_c1 | nmdc:mga09592_43414_c1_1622_2245 | 198 |
| 805 | 3300050509 | nmdc:mga0qj67_388795_c1 | nmdc:mga0qj67_388795_c1_335_955 | 198 |
| 806 | 3300050509 | nmdc:mga0qj67_644565_c1 | nmdc:mga0qj67_644565_c1_58_681 | 198 |
| 807 | 3300050510 | nmdc:mga06r32_501012_c1 | nmdc:mga06r32_501012_c1_103_723 | 198 |
| 808 | 3300050511 | nmdc:mga08y16_564519_c1 | nmdc:mga08y16_564519_c1_280_900 | 198 |
| 809 | 3300050512 | nmdc:mga0n895_248016_c1 | nmdc:mga0n895_248016_c1_223_882 | 198 |
| 810 | 3300050512 | nmdc:mga0n895_290751_c1 | nmdc:mga0n895_290751_c1_164_784 | 198 |
| 811 | 3300050512 | nmdc:mga0n895_98971_c1 | nmdc:mga0n895_98971_c1_636_1265 | 198 |
| 812 | 3300050513 | nmdc:mga0rr50_134203_c1 | nmdc:mga0rr50_134203_c1_1070_1693 | 198 |
| 813 | 3300050513 | nmdc:mga0rr50_280737_c1 | nmdc:mga0rr50_280737_c1_308_928 | 198 |
| 814 | 3300050514 | nmdc:mga08x19_364697_c1 | nmdc:mga08x19_364697_c1_266_886 | 198 |
| 815 | 3300050515 | nmdc:mga0a205_243391_c1 | nmdc:mga0a205_243391_c1_769_1392 | 198 |
| 816 | 3300050515 | nmdc:mga0a205_391033_c1 | nmdc:mga0a205_391033_c1_95_715 | 198 |
| 817 | 3300050515 | nmdc:mga0a205_59905_c1 | nmdc:mga0a205_59905_c1_1116_1775 | 198 |
| 818 | 3300053090 | Ga0500646_0014187 | Ga0500646_0014187_764_1396 | 198 |
| 819 | 3300053091 | Ga0500647_0067774 | Ga0500647_0067774_873_1532 | 198 |
| 820 | 3300053094 | Ga0500566_0015609 | Ga0500566_0015609_2014_2718 | 198 |
| 821 | 3300053095 | Ga0500640_013143 | Ga0500640_013143_2173_2832 | 198 |
| 822 | 3300053102 | Ga0500554_012328 | Ga0500554_012328_547_1206 | 198 |
| 823 | 3300053102 | Ga0500554_045955 | Ga0500554_045955_571_1278 | 198 |
| 824 | 3300053111 | Ga0500572_017152 | Ga0500572_017152_979_1638 | 198 |
| 825 | 3300053119 | Ga0500595_000342 | Ga0500595_000342_482_1141 | 198 |
| 826 | 3300053120 | Ga0500597_051077 | Ga0500597_051077_203_862 | 198 |
| 827 | 3300053123 | Ga0500614_001237 | Ga0500614_001237_5020_5679 | 198 |
| 828 | 3300053123 | Ga0500614_004035 | Ga0500614_004035_493_1200 | 198 |
| 829 | 3300053136 | Ga0500559_0224523 | Ga0500559_0224523_18_677 | 198 |
| 830 | 3300053178 | Ga0500637_0147845 | Ga0500637_0147845_523_1230 | 198 |
| 831 | 3300053178 | Ga0500637_0163811 | Ga0500637_0163811_403_1062 | 198 |
| 832 | 3300053737 | Ga0500601_003451 | Ga0500601_003451_133_792 | 198 |
| 833 | 3300054114 | Ga0501084_0111453 | Ga0501084_0111453_1369_1992 | 198 |
| 834 | 3300060353 | Ga0501082_0022848 | Ga0501082_0022848_3043_3666 | 198 |
| 835 | 3300060353 | Ga0501082_0715364 | Ga0501082_0715364_51_680 | 198 |
| 836 | 3300061734 | Ga0530510_0034117 | Ga0530510_0034117_1889_2518 | 198 |
| 837 | 3300061734 | Ga0530510_0125742 | Ga0530510_0125742_865_1488 | 198 |
| 838 | 3300061734 | Ga0530510_0268662 | Ga0530510_0268662_64_687 | 198 |
| 839 | 3300061734 | Ga0530510_0694547 | Ga0530510_0694547_90_722 | 198 |
| 840 | iso_pu_bacteria | 2585427527 | 2585532870 | 198 |
| 841 | iso_pu_bacteria | 2585427530 | 2585553764 | 198 |
| 842 | iso_pu_bacteria | 2667528174 | 2671115954 | 198 |
| 843 | iso_pu_bacteria | 2818991439 | 2819562248 | 198 |
| 844 | iso_pu_bacteria | 2818991448 | 2819613722 | 198 |
| 845 | iso_pu_bacteria | 2818991453 | 2819642569 | 198 |
| 846 | iso_pu_bacteria | 2818991453 | 2819643017 | 198 |
| 847 | iso_pu_bacteria | 2902405164 | 2902411625 | 198 |
| 848 | iso_pu_bacteria | 2919408235 | 2919410850 | 198 |
| 849 | iso_pu_bacteria | 2984601300 | 2984606171 | 198 |
| 850 | iso_pu_bacteria | 8005645114 | 8005651351 | 198 |
| 851 | 3300027671 | Ga0209588_1053116 | Ga0209588_10531162 | 199 |
| 852 | 3300001979 | JGI24740J21852_10001471 | JGI24740J21852_100014715 | 202 |
| 853 | 3300002737 | JGI25162J39368_1000277 | JGI25162J39368_10002774 | 202 |
| 854 | 3300003214 | JGI25165J46597_1000688 | JGI25165J46597_100068824 | 202 |
| 855 | 3300003320 | rootH2_10006900 | rootH2_100069002 | 202 |
| 856 | 3300003323 | rootH1_10144639 | rootH1_101446391 | 202 |
| 857 | 3300003771 | Ga0055526_1004486 | Ga0055526_10044868 | 202 |
| 858 | 3300003775 | Ga0055524_1007126 | Ga0055524_10071268 | 202 |
| 859 | 3300003790 | Ga0055528_1000680 | Ga0055528_100068025 | 202 |
| 860 | 3300006186 | Ga0075369_10071146 | Ga0075369_100711464 | 202 |
| 861 | 3300006353 | Ga0075370_10149164 | Ga0075370_101491642 | 202 |
| 862 | 3300009148 | Ga0105243_10429824 | Ga0105243_104298242 | 202 |
| 863 | 3300010375 | Ga0105239_10005815 | Ga0105239_1000581513 | 202 |
| 864 | 3300013100 | Ga0157373_10038839 | Ga0157373_100388392 | 202 |
| 865 | 3300014497 | Ga0182008_10365711 | Ga0182008_103657111 | 202 |
| 866 | 3300015262 | Ga0182007_10000160 | Ga0182007_1000016023 | 202 |
| 867 | 3300015265 | Ga0182005_1012818 | Ga0182005_10128183 | 202 |
| 868 | 3300025231 | Ga0207427_109633 | Ga0207427_1096332 | 202 |
| 869 | 3300025233 | Ga0209437_100078 | Ga0209437_1000785 | 202 |
| 870 | 3300025261 | Ga0209233_1000163 | Ga0209233_10001635 | 202 |
| 871 | 3300025273 | Ga0209673_1001165 | Ga0209673_100116530 | 202 |
| 872 | 3300025295 | Ga0209564_1001589 | Ga0209564_100158922 | 202 |
| 873 | 3300025299 | Ga0209256_1001586 | Ga0209256_10015869 | 202 |
| 874 | 3300025935 | Ga0207709_10560847 | Ga0207709_105608471 | 202 |
| 875 | 3300048919 | Ga0496116_0011585 | Ga0496116_0011585_6089_6697 | 202 |
| 876 | 3300048922 | Ga0496119_0020352 | Ga0496119_0020352_1250_1858 | 202 |
| 877 | 3300048927 | Ga0496124_0002688 | Ga0496124_0002688_14752_15360 | 202 |
| 878 | 3300048929 | Ga0496126_0036346 | Ga0496126_0036346_2853_3461 | 202 |
| 879 | 3300049570 | Ga0501033_0000035 | Ga0501033_0000035_80777_81385 | 202 |
| 880 | 3300049822 | Ga0501035_0000673 | Ga0501035_0000673_24278_24886 | 202 |
| 881 | 3300050516 | nmdc:mga0sz30_68008_c1 | nmdc:mga0sz30_68008_c1_35_652 | 202 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4zgj-assembly1.cif.gz_A | double mutant h80a/h81a of fe-type nitrile hydratase from comamonas testosteroni ni1 | 0.9047 | 13 | 198 |
| 4zgd-assembly7.cif.gz_M | mutant r157a of fe-type nitrile hydratase from comamonas testosteroni ni1 | 0.8959 | 8 | 198 |
| 4zge-assembly4.cif.gz_G | double mutant h80w/h81w of fe-type nitrile hydratase from comamonas testosteroni ni1 | 0.8957 | 8 | 198 |
| 4fm4-assembly5.cif.gz_I | wild type fe-type nitrile hydratase from comamonas testosteroni ni1 | 0.8954 | 8 | 198 |
| 3vyh-assembly1.cif.gz_A-2 | crystal structure of aw116r mutant of nitrile hydratase from pseudonocardia thermophilla | 0.8858 | 5 | 198 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4fm4G00 | Alpha Beta;Alpha-Beta Complex;Nitrile Hydratase; Chain A;Nitrile hydratase alpha /Thiocyanate hydrolase gamma | 0.8831 | 8 | 198 | 3.90.330.10 |
| 4ob0A00 | Alpha Beta;Alpha-Beta Complex;Nitrile Hydratase; Chain A;Nitrile hydratase alpha /Thiocyanate hydrolase gamma | 0.8789 | 5 | 198 | 3.90.330.10 |
| 2zcfA00 | Alpha Beta;Alpha-Beta Complex;Nitrile Hydratase; Chain A;Nitrile hydratase alpha /Thiocyanate hydrolase gamma | 0.8634 | 3 | 198 | 3.90.330.10 |
| 2zcfA00 | Alpha Beta;Alpha-Beta Complex;Nitrile Hydratase; Chain A;Nitrile hydratase alpha /Thiocyanate hydrolase gamma | 0.8512 | 3 | 198 | 3.90.330.10 |
| 4fm4G00 | Alpha Beta;Alpha-Beta Complex;Nitrile Hydratase; Chain A;Nitrile hydratase alpha /Thiocyanate hydrolase gamma | 0.8304 | 8 | 198 | 3.90.330.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A537BW81-F1-model_v4 | Nitrile hydratase subunit alpha | 0.9878 | 118 | 198 |
GO:0003824
GO:0046914 |
| AF-A0A4P7LG43-F1-model_v4 | Nitrile hydratase alpha/Thiocyanate hydrolase gamma domain-containing protein | 0.9871 | 101 | 202 |
GO:0003824
GO:0046914 |
| AF-A0A366I773-F1-model_v4 | Nitrile hydratase alpha subunit | 0.9869 | 89 | 200 |
GO:0003824
GO:0046914 |
| AF-A0A4V3MDZ8-F1-model_v4 | deleted | 0.9863 | 114 | 198 |
|
| AF-A0A7W1LT99-F1-model_v4 | Nitrile hydratase subunit alpha | 0.9862 | 130 | 197 |
GO:0003824
GO:0046914 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar