F484465
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 879 | 456 | 825 | 85 |
Family's Representative Sequence
| Representative Sequence | 3300032004|Ga0307414_10147875|Ga0307414_101478752 |
| Length | 98 |
| Sequence | MAHKKGASSSRNGRDSNAQRLGVKRFGGQIVKAGEIIVRQRGTHFHPGTNVGRGGDDTLFATAPGAVTFGTKRGRKTISVLRPSASGLDVAAGAAPKA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221546 | Microbacterium sp. Root53 | Isolate | Unclassified |
| 2 | 2643221566 | Microbacterium sp. Root166 | Isolate | Unclassified |
| 3 | 2643221572 | Leifsonia sp. Root60 | Isolate | Unclassified |
| 4 | 2643221597 | Microbacterium sp. Root180 | Isolate | Unclassified |
| 5 | 2643221635 | Yonghaparkia sp. Root332 | Isolate | Unclassified |
| 6 | 2643221669 | Leifsonia sp. Root1293 | Isolate | Unclassified |
| 7 | 2643221681 | Aeromicrobium sp. Root472D3 | Isolate | Unclassified |
| 8 | 2643221961 | Aeromicrobium sp. Root236 | Isolate | Unclassified |
| 9 | 2643221962 | Aeromicrobium sp. Root344 | Isolate | Unclassified |
| 10 | 2751185788 | Curtobacterium pusillum AA3 | Isolate | Unclassified |
| 11 | 2757320536 | Microbacterium sp. NFIX05 | Isolate | Unclassified |
| 12 | 2758568522 | Promicromonospora thailandica SAI-039 | Isolate | Unclassified |
| 13 | 2773857758 | Microbacterium chocolatum 1320 | Isolate | Unclassified |
| 14 | 2773857759 | Microbacterium sp. 1294 | Isolate | Unclassified |
| 15 | 2808606439 | Nocardioides sp. SLBN-172 | Isolate | Unclassified |
| 16 | 2808606447 | Microbacterium sp. HAR-UPW-R2A-48 | Isolate | Unclassified |
| 17 | 2808606700 | Arthrobacter agilis UMCV2 | Isolate | Rhizosphere |
| 18 | 2811994872 | Microbacterium sp. MU4Y-5-1 | Isolate | Unclassified |
| 19 | 2811994880 | Cellulomonas sp. SLBN-39 | Isolate | Unclassified |
| 20 | 2833709550 | Microbacterium sp. 3290 | Isolate | Rhizosphere |
| 21 | 2852632344 | Microbacterium sp. AK009 | Isolate | Rhizosphere |
| 22 | 2857720070 | Microbacterium sp. R-72113 | Isolate | Unclassified |
| 23 | 2857729791 | Plantibacter sp. R-72288 | Isolate | Unclassified |
| 24 | 2857733635 | Salinibacterium sp. R-73062 | Isolate | Unclassified |
| 25 | 2870628048 | Microbacterium thalassium DSM 12511 | Isolate | Rhizosphere |
| 26 | 2891968417 | Nocardioides luteus SAI-037 | Isolate | Unclassified |
| 27 | 2895660088 | Leifsonia flava SYP-B2174 | Isolate | Rhizosphere |
| 28 | 2904430863 | Curtobacterium oceanosedimentum 1519 | Isolate | Rhizosphere |
| 29 | 2904501621 | Curtobacterium sp. 1909 | Isolate | Unclassified |
| 30 | 2904509784 | Microbacterium sp. 1676 | Isolate | Rhizosphere |
| 31 | 2905926851 | Arthrobacter sedimenti MIC A30 | Isolate | Rhizosphere |
| 32 | 2906799679 | Microbacterium karelineae TRM80801 | Isolate | Unclassified |
| 33 | 2908674828 | Curtobacterium sp. 1517 | Isolate | Rhizosphere |
| 34 | 2908678064 | Microbacterium sp. 1518 | Isolate | Rhizosphere |
| 35 | 2909074476 | Curtobacterium sp. 1310 | Isolate | Rhizosphere |
| 36 | 2919039151 | Curtobacterium sp. 260 | Isolate | Rhizosphere |
| 37 | 2919042368 | Curtobacterium sp. 320 | Isolate | Rhizosphere |
| 38 | 2919069694 | Microbacterium sp. 1154 | Isolate | Unclassified |
| 39 | 2928090899 | Microbacterium sp. 1262 | Isolate | Rhizosphere |
| 40 | 2928104781 | Curtobacterium sp. 1544 | Isolate | Rhizosphere |
| 41 | 2928121344 | Plantibacter flavus 1756 | Isolate | Rhizosphere |
| 42 | 2928500415 | Curtobacterium oceanosedimentum 1257 | Isolate | Rhizosphere |
| 43 | 2946003308 | Arthrobacter agilis W3I6 | Isolate | Rhizosphere |
| 44 | 2974294766 | Microbacterium proteolyticum SORGH_AS 209 | Isolate | Unclassified |
| 45 | 2974324384 | Microbacterium sp. SORGH_AS 344 | Isolate | Unclassified |
| 46 | 2977228692 | Microbacterium sp. SORGH_AS 421 | Isolate | Unclassified |
| 47 | 2977236895 | Microbacterium testaceum SORGH_AS 426 | Isolate | Unclassified |
| 48 | 2977264416 | Microbacterium testaceum SORGH_AS 594 | Isolate | Unclassified |
| 49 | 2984542743 | Microbacterium sp. SORGH_AS454 | Isolate | Aerial Root |
| 50 | 2984551494 | Curtobacterium sp. SORGH_AS776 | Isolate | Aerial Root |
| 51 | 2984580707 | Microbacterium paludicola SORGH_AS919 | Isolate | Aerial Root |
| 52 | 2984592036 | Aeromicrobium sp. SORGH_AS981 | Isolate | Aerial Root |
| 53 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 54 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 55 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 56 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 57 | 3300003162 | Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 58 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 59 | 3300003544 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 60 | 3300003559 | Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_43 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 61 | 3300003574 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 62 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 63 | 3300003693 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 64 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 65 | 3300004785 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-1 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 66 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 67 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 68 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 69 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 70 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 71 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 74 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 75 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 76 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 78 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 83 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 86 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 87 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 91 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 92 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 93 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 94 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 95 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 96 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 97 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 98 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 99 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 100 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 101 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 102 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 103 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 104 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 105 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 106 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 107 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 108 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 109 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 110 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 111 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 112 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 113 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 114 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 115 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 116 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 117 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 118 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 119 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 120 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 121 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 122 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 123 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 124 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 125 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 126 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 127 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 129 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 130 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 137 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 138 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 139 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 140 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 141 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 142 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 143 | 3300009987 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG | Metagenome | Rhizosphere |
| 144 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 145 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 146 | 3300012478 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.9.old.080610 | Metagenome | Rhizosphere |
| 147 | 3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Metagenome | Rhizosphere |
| 148 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300013250 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 | Metagenome | Rhizosphere |
| 151 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 153 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 155 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 156 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 157 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 158 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 159 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 160 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 161 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 162 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 163 | 3300020071 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 164 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 165 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 166 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 167 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 168 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 169 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 170 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 171 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 172 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 173 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 174 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 175 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 176 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 229 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 233 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 234 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 235 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 236 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 237 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 238 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 239 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 240 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 241 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 242 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 243 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 244 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 245 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 246 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 247 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 248 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 249 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 250 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 251 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 252 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 253 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 254 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 255 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 256 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 257 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 258 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 259 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 260 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 261 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 262 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 263 | 3300033527 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 264 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 265 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 266 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 267 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 268 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 269 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 270 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 271 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 272 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 273 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 274 | 3300038735 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 | Metagenome | Unclassified |
| 275 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 276 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 277 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 278 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 279 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 280 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 281 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 282 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 283 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 284 | 3300041444 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaT | Metatranscriptome | Rhizoplane |
| 285 | 3300041450 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaT | Metatranscriptome | Rhizoplane |
| 286 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 287 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 288 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 289 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 290 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 291 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 292 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 293 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 294 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 295 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 296 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 297 | 3300041502 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaT | Metatranscriptome | Unclassified |
| 298 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 299 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 300 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 301 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 302 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 303 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 304 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 305 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 306 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 307 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 308 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 309 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 310 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 311 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 312 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 313 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 314 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 315 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 316 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 317 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 318 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 319 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 320 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 321 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 341 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 342 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 343 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 344 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 345 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 346 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 347 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 348 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 349 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 350 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 351 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 352 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 353 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 354 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 355 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 356 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 357 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 358 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 359 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 360 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 361 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 362 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 363 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 364 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 365 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 366 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 367 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 368 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 369 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 370 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 371 | 3300049534 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 372 | 3300049537 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 373 | 3300049541 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 374 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 375 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 376 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 377 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 378 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 379 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 380 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 381 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 382 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 383 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 384 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 385 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 386 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 387 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 388 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 389 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 390 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 391 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 392 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 393 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 394 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 395 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 396 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 397 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 398 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 399 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 400 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 401 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 402 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 403 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 404 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 405 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 406 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 407 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 408 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 409 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 410 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 411 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 412 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 414 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 415 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 416 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 417 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 418 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 419 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 420 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 421 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 422 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 423 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 424 | 3300059478 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 425 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 426 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 427 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 428 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 429 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 430 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 431 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 432 | 3300059507 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 433 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 434 | 3300059509 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 435 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 436 | 3300059604 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 437 | 3300059605 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 438 | 3300059608 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 166R_SD_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 439 | 3300059622 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 440 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 441 | 3300059626 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 442 | 3300059628 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 160R_AD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 443 | 3300059630 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 444 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 445 | 3300059642 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 446 | 3300059644 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 447 | 3300059646 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 448 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 449 | 3300059650 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 69R_SD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 450 | 3300059655 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 451 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 452 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 453 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 454 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 455 | 8004212874 | Microbacterium sp. NC79 | Isolate | Rhizosphere |
| 456 | 8045830549 | Microbacterium yannicii DSM 23203 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 78.95 |
| Metatranscriptomes | 14.9 |
| Isolates | 6.14 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.46 |
| Bulb | 0 |
| Endosphere | 6.48 |
| Nodule | 0 |
| Rhizoplane | 7.05 |
| Rhizosphere | 72.81 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 13.2 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24739J22299_10073607 | 3300001989 | Bacteria | 1060 |
| 2 | JGI24743J22301_10010175 | 3300001991 | Bacteria | 1675 |
| 3 | JGI24735J21928_10084376 | 3300002067 | Bacteria | 910 |
| 4 | JGI25154J39366_1001284 | 3300002738 | Bacteria | 9360 |
| 5 | Ga0006778J45830_1015710 | 3300003162 | Bacteria | 568 |
| 6 | JGI25407J50210_10045377 | 3300003373 | Bacteria | 1120 |
| 7 | JGI25407J50210_10190372 | 3300003373 | Bacteria | 506 |
| 8 | Ga0007417J51691_1012460 | 3300003544 | Bacteria | 776 |
| 9 | Ga0007427J51700_111594 | 3300003559 | Bacteria | 664 |
| 10 | Ga0007410J51695_1024883 | 3300003574 | Bacteria | 564 |
| 11 | Ga0007410J51695_1028109 | 3300003574 | Bacteria | 537 |
| 12 | Ga0006562J51391_1077031 | 3300003578 | Bacteria | 636 |
| 13 | Ga0032354_1026694 | 3300003693 | Bacteria | 557 |
| 14 | Ga0055542_1006658 | 3300003762 | Bacteria | 2442 |
| 15 | Ga0058858_1426826 | 3300004785 | Bacteria | 719 |
| 16 | Ga0058859_11241572 | 3300004798 | Bacteria | 678 |
| 17 | Ga0058863_11633219 | 3300004799 | Bacteria | 722 |
| 18 | Ga0058861_11584081 | 3300004800 | Bacteria | 798 |
| 19 | Ga0058860_12151711 | 3300004801 | Bacteria | 837 |
| 20 | Ga0065715_10795225 | 3300005293 | Bacteria | 607 |
| 21 | Ga0070658_10029253 | 3300005327 | Bacteria | 4426 |
| 22 | Ga0070658_10047629 | 3300005327 | Bacteria | 3469 |
| 23 | Ga0070658_10069192 | 3300005327 | Bacteria | 2887 |
| 24 | Ga0070677_10882910 | 3300005333 | Bacteria | 516 |
| 25 | Ga0068869_100115301 | 3300005334 | Bacteria | 2048 |
| 26 | Ga0070682_100259104 | 3300005337 | Bacteria | 1258 |
| 27 | Ga0070682_100570786 | 3300005337 | Bacteria | 888 |
| 28 | Ga0068868_100150079 | 3300005338 | Bacteria | 1919 |
| 29 | Ga0070660_100596074 | 3300005339 | Bacteria | 924 |
| 30 | Ga0070660_100831217 | 3300005339 | Bacteria | 777 |
| 31 | Ga0070687_100394995 | 3300005343 | Bacteria | 905 |
| 32 | Ga0070661_100023380 | 3300005344 | Bacteria | 4429 |
| 33 | Ga0070661_100067572 | 3300005344 | Bacteria | 2627 |
| 34 | Ga0070668_100483203 | 3300005347 | Bacteria | 1070 |
| 35 | Ga0070668_100770527 | 3300005347 | Bacteria | 853 |
| 36 | Ga0070671_100207927 | 3300005355 | Bacteria | 1660 |
| 37 | Ga0070674_100407309 | 3300005356 | Bacteria | 1113 |
| 38 | Ga0070674_100796350 | 3300005356 | Bacteria | 816 |
| 39 | Ga0070688_100167655 | 3300005365 | Bacteria | 1513 |
| 40 | Ga0070659_100013488 | 3300005366 | Bacteria | 6082 |
| 41 | Ga0070667_100096421 | 3300005367 | Bacteria | 2550 |
| 42 | Ga0070667_100181210 | 3300005367 | Bacteria | 1863 |
| 43 | Ga0070667_100587386 | 3300005367 | Bacteria | 1026 |
| 44 | Ga0070713_100193100 | 3300005436 | Bacteria | 1836 |
| 45 | Ga0070700_100858929 | 3300005441 | Bacteria | 735 |
| 46 | Ga0070663_100255275 | 3300005455 | Bacteria | 1389 |
| 47 | Ga0070663_100300989 | 3300005455 | Bacteria | 1284 |
| 48 | Ga0070663_100393866 | 3300005455 | Bacteria | 1131 |
| 49 | Ga0070663_101184557 | 3300005455 | Bacteria | 671 |
| 50 | Ga0070678_100231487 | 3300005456 | Bacteria | 1541 |
| 51 | Ga0070662_100789224 | 3300005457 | Bacteria | 807 |
| 52 | Ga0070662_101528167 | 3300005457 | Bacteria | 576 |
| 53 | Ga0070681_10546975 | 3300005458 | Bacteria | 1071 |
| 54 | Ga0070681_10850130 | 3300005458 | Bacteria | 830 |
| 55 | Ga0070685_10047048 | 3300005466 | Bacteria | 2479 |
| 56 | Ga0070685_10559517 | 3300005466 | Bacteria | 817 |
| 57 | Ga0070706_101630657 | 3300005467 | Bacteria | 588 |
| 58 | Ga0070679_101993241 | 3300005530 | Bacteria | 530 |
| 59 | Ga0070697_100121856 | 3300005536 | Bacteria | 2182 |
| 60 | Ga0068853_100028090 | 3300005539 | Bacteria | 4731 |
| 61 | Ga0068853_100052946 | 3300005539 | Bacteria | 3495 |
| 62 | Ga0068853_102058853 | 3300005539 | Bacteria | 553 |
| 63 | Ga0068853_102248699 | 3300005539 | Bacteria | 528 |
| 64 | Ga0070672_100207081 | 3300005543 | Bacteria | 1642 |
| 65 | Ga0070695_100147064 | 3300005545 | Bacteria | 1640 |
| 66 | Ga0070696_100044500 | 3300005546 | Bacteria | 3073 |
| 67 | Ga0070693_100150524 | 3300005547 | Bacteria | 1473 |
| 68 | Ga0070665_100027879 | 3300005548 | Bacteria | 5687 |
| 69 | Ga0070704_100119640 | 3300005549 | Bacteria | 2020 |
| 70 | Ga0068855_100030427 | 3300005563 | Bacteria | 6458 |
| 71 | Ga0068855_100031330 | 3300005563 | Bacteria | 6350 |
| 72 | Ga0068855_100056300 | 3300005563 | Bacteria | 4615 |
| 73 | Ga0068855_100501765 | 3300005563 | Bacteria | 1318 |
| 74 | Ga0070664_100683268 | 3300005564 | Bacteria | 955 |
| 75 | Ga0068857_100021798 | 3300005577 | Bacteria | 5639 |
| 76 | Ga0068857_100249321 | 3300005577 | Bacteria | 1627 |
| 77 | Ga0068854_100102323 | 3300005578 | Bacteria | 2149 |
| 78 | Ga0068854_100405067 | 3300005578 | Bacteria | 1130 |
| 79 | Ga0068854_100660295 | 3300005578 | Bacteria | 899 |
| 80 | Ga0068856_100344429 | 3300005614 | Bacteria | 1509 |
| 81 | Ga0068856_101781922 | 3300005614 | Bacteria | 627 |
| 82 | Ga0068856_101823740 | 3300005614 | Bacteria | 620 |
| 83 | Ga0068856_102531017 | 3300005614 | Bacteria | 520 |
| 84 | Ga0070702_101405681 | 3300005615 | Bacteria | 571 |
| 85 | Ga0068852_100017671 | 3300005616 | Bacteria | 5601 |
| 86 | Ga0068852_100066070 | 3300005616 | Bacteria | 3158 |
| 87 | Ga0068859_100052312 | 3300005617 | Bacteria | 4106 |
| 88 | Ga0068864_100148152 | 3300005618 | Bacteria | 2123 |
| 89 | Ga0068851_10000174 | 3300005834 | Bacteria | 32729 |
| 90 | Ga0068870_11008324 | 3300005840 | Bacteria | 594 |
| 91 | Ga0068870_11415049 | 3300005840 | Bacteria | 510 |
| 92 | Ga0068863_100056137 | 3300005841 | Bacteria | 3728 |
| 93 | Ga0068863_100252035 | 3300005841 | Bacteria | 1705 |
| 94 | Ga0068863_101873710 | 3300005841 | Bacteria | 610 |
| 95 | Ga0068860_100001180 | 3300005843 | Bacteria | 28624 |
| 96 | Ga0068860_100086873 | 3300005843 | Bacteria | 2977 |
| 97 | Ga0068860_100424812 | 3300005843 | Bacteria | 1318 |
| 98 | Ga0081455_10003134 | 3300005937 | Bacteria | 19237 |
| 99 | Ga0081455_10014161 | 3300005937 | Bacteria | 7835 |
| 100 | Ga0081538_10000991 | 3300005981 | Bacteria | 30132 |
| 101 | Ga0081538_10048190 | 3300005981 | Bacteria | 2602 |
| 102 | Ga0070717_10109999 | 3300006028 | Bacteria | 2349 |
| 103 | Ga0070717_10887028 | 3300006028 | Bacteria | 812 |
| 104 | Ga0075365_10111041 | 3300006038 | Bacteria | 1884 |
| 105 | Ga0075365_10262019 | 3300006038 | Bacteria | 1215 |
| 106 | Ga0075365_10579281 | 3300006038 | Bacteria | 794 |
| 107 | Ga0075368_10101365 | 3300006042 | Bacteria | 1182 |
| 108 | Ga0075368_10359718 | 3300006042 | Bacteria | 635 |
| 109 | Ga0075363_100011874 | 3300006048 | Bacteria | 4183 |
| 110 | Ga0075363_100272113 | 3300006048 | Bacteria | 978 |
| 111 | Ga0075363_100990878 | 3300006048 | Bacteria | 517 |
| 112 | Ga0075364_10028577 | 3300006051 | Bacteria | 3570 |
| 113 | Ga0075364_10217284 | 3300006051 | Bacteria | 1296 |
| 114 | Ga0075364_10759428 | 3300006051 | Bacteria | 661 |
| 115 | Ga0070715_10828491 | 3300006163 | Bacteria | 564 |
| 116 | Ga0070716_101514141 | 3300006173 | Bacteria | 549 |
| 117 | Ga0075367_10000695 | 3300006178 | Bacteria | 12946 |
| 118 | Ga0075367_10192528 | 3300006178 | Bacteria | 1272 |
| 119 | Ga0075369_10000991 | 3300006186 | Bacteria | 9469 |
| 120 | Ga0075369_10013993 | 3300006186 | Bacteria | 3197 |
| 121 | Ga0075369_10639133 | 3300006186 | Bacteria | 511 |
| 122 | Ga0075366_10569042 | 3300006195 | Bacteria | 702 |
| 123 | Ga0097621_101678718 | 3300006237 | Bacteria | 605 |
| 124 | Ga0075370_10004480 | 3300006353 | Bacteria | 6789 |
| 125 | Ga0075370_10188480 | 3300006353 | Bacteria | 1215 |
| 126 | Ga0075370_10504242 | 3300006353 | Bacteria | 730 |
| 127 | Ga0075370_10819922 | 3300006353 | Bacteria | 568 |
| 128 | Ga0068865_101940892 | 3300006881 | Bacteria | 534 |
| 129 | Ga0097620_100052313 | 3300006931 | Bacteria | 4106 |
| 130 | Ga0105251_10087257 | 3300009011 | Bacteria | 1436 |
| 131 | Ga0105251_10257942 | 3300009011 | Bacteria | 786 |
| 132 | Ga0105244_10056209 | 3300009036 | Bacteria | 1993 |
| 133 | Ga0105244_10102657 | 3300009036 | Bacteria | 1397 |
| 134 | Ga0105240_10005074 | 3300009093 | Bacteria | 19737 |
| 135 | Ga0105240_10078100 | 3300009093 | Bacteria | 4077 |
| 136 | Ga0105240_11267102 | 3300009093 | Bacteria | 779 |
| 137 | Ga0105240_11791100 | 3300009093 | Bacteria | 640 |
| 138 | Ga0111539_11700456 | 3300009094 | Bacteria | 732 |
| 139 | Ga0105245_10032365 | 3300009098 | Bacteria | 4629 |
| 140 | Ga0105247_10377835 | 3300009101 | Bacteria | 1004 |
| 141 | Ga0105247_11733047 | 3300009101 | Bacteria | 518 |
| 142 | Ga0105243_11176410 | 3300009148 | Bacteria | 779 |
| 143 | Ga0105241_10010709 | 3300009174 | Bacteria | 6729 |
| 144 | Ga0105241_10320648 | 3300009174 | Bacteria | 1336 |
| 145 | Ga0105241_10345131 | 3300009174 | Bacteria | 1291 |
| 146 | Ga0105241_10902309 | 3300009174 | Bacteria | 821 |
| 147 | Ga0105242_10703009 | 3300009176 | Bacteria | 989 |
| 148 | Ga0105237_10000660 | 3300009545 | Bacteria | 47919 |
| 149 | Ga0105237_10061574 | 3300009545 | Bacteria | 3752 |
| 150 | Ga0105237_10108611 | 3300009545 | Bacteria | 2766 |
| 151 | Ga0105237_10182819 | 3300009545 | Bacteria | 2096 |
| 152 | Ga0105237_11649273 | 3300009545 | Bacteria | 648 |
| 153 | Ga0105238_10006538 | 3300009551 | Bacteria | 11608 |
| 154 | Ga0105238_10141262 | 3300009551 | Bacteria | 2385 |
| 155 | Ga0105249_12375663 | 3300009553 | Bacteria | 603 |
| 156 | Ga0105030_113292 | 3300009987 | Bacteria | 719 |
| 157 | Ga0105239_10230657 | 3300010375 | Bacteria | 2077 |
| 158 | Ga0105239_10627199 | 3300010375 | Bacteria | 1227 |
| 159 | Ga0105239_11108833 | 3300010375 | Bacteria | 911 |
| 160 | Ga0105246_10092415 | 3300011119 | Bacteria | 2183 |
| 161 | Ga0105246_10734437 | 3300011119 | Bacteria | 869 |
| 162 | Ga0157328_1005549 | 3300012478 | Bacteria | 741 |
| 163 | Ga0157342_1068135 | 3300012507 | Bacteria | 536 |
| 164 | Ga0157370_10032625 | 3300013104 | Bacteria | 5084 |
| 165 | Ga0157370_10056334 | 3300013104 | Bacteria | 3741 |
| 166 | Ga0157370_10312667 | 3300013104 | Bacteria | 1449 |
| 167 | Ga0157369_10042192 | 3300013105 | Bacteria | 4977 |
| 168 | Ga0157369_10330001 | 3300013105 | Bacteria | 1585 |
| 169 | Ga0157369_10488439 | 3300013105 | Bacteria | 1274 |
| 170 | Ga0157369_10751155 | 3300013105 | Bacteria | 1003 |
| 171 | Ga0157369_10906875 | 3300013105 | Bacteria | 904 |
| 172 | Ga0171462_1003 | 3300013250 | Bacteria | 853796 |
| 173 | Ga0157374_11406583 | 3300013296 | Bacteria | 720 |
| 174 | Ga0157374_11948036 | 3300013296 | Bacteria | 614 |
| 175 | Ga0163162_10010190 | 3300013306 | Bacteria | 9129 |
| 176 | Ga0163162_10140160 | 3300013306 | Bacteria | 2531 |
| 177 | Ga0163162_10425353 | 3300013306 | Bacteria | 1460 |
| 178 | Ga0163162_11130635 | 3300013306 | Bacteria | 888 |
| 179 | Ga0157372_10716384 | 3300013307 | Bacteria | 1164 |
| 180 | Ga0157372_11232771 | 3300013307 | Bacteria | 864 |
| 181 | Ga0157372_11595936 | 3300013307 | Bacteria | 751 |
| 182 | Ga0157375_11348787 | 3300013308 | Bacteria | 839 |
| 183 | Ga0157375_11617684 | 3300013308 | Bacteria | 766 |
| 184 | Ga0163163_10027908 | 3300014325 | Bacteria | 5412 |
| 185 | Ga0157380_10027310 | 3300014326 | Bacteria | 4340 |
| 186 | Ga0157380_11512147 | 3300014326 | Bacteria | 725 |
| 187 | Ga0157380_13187689 | 3300014326 | Bacteria | 524 |
| 188 | Ga0157377_10132403 | 3300014745 | Bacteria | 1525 |
| 189 | Ga0157377_10663261 | 3300014745 | Bacteria | 752 |
| 190 | Ga0157379_10017319 | 3300014968 | Bacteria | 6349 |
| 191 | Ga0157379_10023926 | 3300014968 | Bacteria | 5422 |
| 192 | Ga0157379_12544100 | 3300014968 | Bacteria | 512 |
| 193 | Ga0157376_10365935 | 3300014969 | Bacteria | 1384 |
| 194 | Ga0157376_10510567 | 3300014969 | Bacteria | 1183 |
| 195 | Ga0157376_11190019 | 3300014969 | Bacteria | 790 |
| 196 | Ga0163161_10754691 | 3300017792 | Bacteria | 814 |
| 197 | Ga0197907_10326987 | 3300020069 | Bacteria | 677 |
| 198 | Ga0197907_10854447 | 3300020069 | Bacteria | 872 |
| 199 | Ga0197907_10912036 | 3300020069 | Bacteria | 741 |
| 200 | Ga0197907_10935291 | 3300020069 | Bacteria | 679 |
| 201 | Ga0206356_10978583 | 3300020070 | Bacteria | 780 |
| 202 | Ga0206356_11078444 | 3300020070 | Bacteria | 701 |
| 203 | Ga0206356_11307403 | 3300020070 | Bacteria | 1172 |
| 204 | Ga0206356_11376106 | 3300020070 | Bacteria | 1124 |
| 205 | Ga0206348_109438 | 3300020071 | Bacteria | 661 |
| 206 | Ga0206349_1061883 | 3300020075 | Bacteria | 770 |
| 207 | Ga0206349_1634353 | 3300020075 | Bacteria | 1044 |
| 208 | Ga0206349_1930185 | 3300020075 | Bacteria | 1379 |
| 209 | Ga0206355_1014107 | 3300020076 | Bacteria | 723 |
| 210 | Ga0206355_1167418 | 3300020076 | Bacteria | 808 |
| 211 | Ga0206355_1276013 | 3300020076 | Bacteria | 1622 |
| 212 | Ga0206355_1492312 | 3300020076 | Bacteria | 538 |
| 213 | Ga0206355_1665678 | 3300020076 | Bacteria | 836 |
| 214 | Ga0206355_1716449 | 3300020076 | Bacteria | 578 |
| 215 | Ga0206351_10093022 | 3300020077 | Bacteria | 792 |
| 216 | Ga0206351_10773028 | 3300020077 | Bacteria | 716 |
| 217 | Ga0206351_10924608 | 3300020077 | Bacteria | 635 |
| 218 | Ga0206352_10090527 | 3300020078 | Bacteria | 728 |
| 219 | Ga0206352_10675540 | 3300020078 | Bacteria | 1079 |
| 220 | Ga0206352_10998634 | 3300020078 | Bacteria | 843 |
| 221 | Ga0206350_10430210 | 3300020080 | Bacteria | 824 |
| 222 | Ga0206350_11165638 | 3300020080 | Bacteria | 692 |
| 223 | Ga0206350_11217244 | 3300020080 | Bacteria | 958 |
| 224 | Ga0206350_11364143 | 3300020080 | Bacteria | 733 |
| 225 | Ga0206350_11438219 | 3300020080 | Bacteria | 718 |
| 226 | Ga0206354_10160236 | 3300020081 | Bacteria | 1036 |
| 227 | Ga0206354_10402436 | 3300020081 | Bacteria | 685 |
| 228 | Ga0206354_10565015 | 3300020081 | Bacteria | 849 |
| 229 | Ga0206354_10694027 | 3300020081 | Bacteria | 510 |
| 230 | Ga0206354_11544819 | 3300020081 | Bacteria | 644 |
| 231 | Ga0206353_10903616 | 3300020082 | Bacteria | 510 |
| 232 | Ga0206353_11635006 | 3300020082 | Bacteria | 925 |
| 233 | Ga0154015_1053277 | 3300020610 | Bacteria | 973 |
| 234 | Ga0154015_1157237 | 3300020610 | Bacteria | 615 |
| 235 | Ga0154015_1239016 | 3300020610 | Bacteria | 839 |
| 236 | Ga0154015_1250307 | 3300020610 | Bacteria | 1094 |
| 237 | Ga0154015_1266277 | 3300020610 | Bacteria | 571 |
| 238 | Ga0154015_1310473 | 3300020610 | Bacteria | 688 |
| 239 | Ga0154015_1416389 | 3300020610 | Bacteria | 584 |
| 240 | Ga0213872_10356248 | 3300021361 | Bacteria | 599 |
| 241 | Ga0224712_10148613 | 3300022467 | Bacteria | 1036 |
| 242 | Ga0224712_10189565 | 3300022467 | Bacteria | 930 |
| 243 | Ga0224712_10352643 | 3300022467 | Bacteria | 695 |
| 244 | Ga0224712_10369055 | 3300022467 | Bacteria | 680 |
| 245 | Ga0224712_10369422 | 3300022467 | Bacteria | 680 |
| 246 | Ga0209646_1000071 | 3300025246 | Bacteria | 228702 |
| 247 | Ga0209148_1000624 | 3300025254 | Bacteria | 31386 |
| 248 | Ga0207656_10000002 | 3300025321 | Bacteria | 792178 |
| 249 | Ga0207655_1003360 | 3300025728 | Bacteria | 11974 |
| 250 | Ga0207713_1099531 | 3300025735 | Bacteria | 1006 |
| 251 | Ga0207682_10470612 | 3300025893 | Bacteria | 595 |
| 252 | Ga0207692_10028262 | 3300025898 | Bacteria | 2650 |
| 253 | Ga0207710_10032300 | 3300025900 | Bacteria | 2293 |
| 254 | Ga0207710_10169267 | 3300025900 | Bacteria | 1068 |
| 255 | Ga0207710_10257946 | 3300025900 | Bacteria | 873 |
| 256 | Ga0207685_10807095 | 3300025905 | Bacteria | 517 |
| 257 | Ga0207643_10464632 | 3300025908 | Bacteria | 806 |
| 258 | Ga0207643_10926238 | 3300025908 | Bacteria | 564 |
| 259 | Ga0207705_10054040 | 3300025909 | Bacteria | 2895 |
| 260 | Ga0207705_10426787 | 3300025909 | Bacteria | 1027 |
| 261 | Ga0207705_11112833 | 3300025909 | Bacteria | 608 |
| 262 | Ga0207684_11283800 | 3300025910 | Bacteria | 603 |
| 263 | Ga0207654_10000001 | 3300025911 | Bacteria | 1816198 |
| 264 | Ga0207654_11260105 | 3300025911 | Bacteria | 539 |
| 265 | Ga0207707_11371392 | 3300025912 | Bacteria | 565 |
| 266 | Ga0207695_10021351 | 3300025913 | Bacteria | 7388 |
| 267 | Ga0207695_10022892 | 3300025913 | Bacteria | 7077 |
| 268 | Ga0207695_10173790 | 3300025913 | Bacteria | 2078 |
| 269 | Ga0207695_10720620 | 3300025913 | Bacteria | 878 |
| 270 | Ga0207671_10000002 | 3300025914 | Bacteria | 1144816 |
| 271 | Ga0207671_10044467 | 3300025914 | Bacteria | 3284 |
| 272 | Ga0207693_10033430 | 3300025915 | Bacteria | 4058 |
| 273 | Ga0207663_10321275 | 3300025916 | Bacteria | 1163 |
| 274 | Ga0207660_11139543 | 3300025917 | Bacteria | 635 |
| 275 | Ga0207660_11169074 | 3300025917 | Bacteria | 626 |
| 276 | Ga0207662_10251634 | 3300025918 | Bacteria | 1160 |
| 277 | Ga0207662_11299709 | 3300025918 | Bacteria | 517 |
| 278 | Ga0207657_10010777 | 3300025919 | Bacteria | 9101 |
| 279 | Ga0207657_11379855 | 3300025919 | Bacteria | 530 |
| 280 | Ga0207649_10032826 | 3300025920 | Bacteria | 3097 |
| 281 | Ga0207652_11793600 | 3300025921 | Bacteria | 519 |
| 282 | Ga0207694_10000153 | 3300025924 | Bacteria | 71753 |
| 283 | Ga0207694_10040322 | 3300025924 | Bacteria | 3594 |
| 284 | Ga0207694_10084470 | 3300025924 | Bacteria | 2497 |
| 285 | Ga0207650_10831746 | 3300025925 | Bacteria | 783 |
| 286 | Ga0207659_10906264 | 3300025926 | Bacteria | 758 |
| 287 | Ga0207687_10020899 | 3300025927 | Bacteria | 4345 |
| 288 | Ga0207687_10029146 | 3300025927 | Bacteria | 3711 |
| 289 | Ga0207700_10356705 | 3300025928 | Bacteria | 1274 |
| 290 | Ga0207700_10976598 | 3300025928 | Bacteria | 758 |
| 291 | Ga0207664_10393745 | 3300025929 | Bacteria | 1231 |
| 292 | Ga0207664_11170215 | 3300025929 | Bacteria | 686 |
| 293 | Ga0207644_10119010 | 3300025931 | Bacteria | 2008 |
| 294 | Ga0207690_10020759 | 3300025932 | Bacteria | 4063 |
| 295 | Ga0207686_10863071 | 3300025934 | Bacteria | 729 |
| 296 | Ga0207709_10885638 | 3300025935 | Bacteria | 725 |
| 297 | Ga0207709_11013473 | 3300025935 | Bacteria | 679 |
| 298 | Ga0207669_10657570 | 3300025937 | Bacteria | 858 |
| 299 | Ga0207704_10853159 | 3300025938 | Bacteria | 763 |
| 300 | Ga0207691_10217438 | 3300025940 | Bacteria | 1658 |
| 301 | Ga0207691_10881571 | 3300025940 | Bacteria | 750 |
| 302 | Ga0207711_10063716 | 3300025941 | Bacteria | 3183 |
| 303 | Ga0207711_10260653 | 3300025941 | Bacteria | 1593 |
| 304 | Ga0207667_10054976 | 3300025949 | Bacteria | 4186 |
| 305 | Ga0207667_10110945 | 3300025949 | Bacteria | 2829 |
| 306 | Ga0207667_10189711 | 3300025949 | Bacteria | 2109 |
| 307 | Ga0207667_10266651 | 3300025949 | Bacteria | 1751 |
| 308 | Ga0207667_10483383 | 3300025949 | Bacteria | 1257 |
| 309 | Ga0207667_11098447 | 3300025949 | Bacteria | 779 |
| 310 | Ga0207651_10300070 | 3300025960 | Bacteria | 1335 |
| 311 | Ga0207668_10858252 | 3300025972 | Bacteria | 806 |
| 312 | Ga0207668_11187525 | 3300025972 | Bacteria | 685 |
| 313 | Ga0207640_10433669 | 3300025981 | Bacteria | 1079 |
| 314 | Ga0207658_10020806 | 3300025986 | Bacteria | 4545 |
| 315 | Ga0207658_10380954 | 3300025986 | Bacteria | 1235 |
| 316 | Ga0207658_10491206 | 3300025986 | Bacteria | 1092 |
| 317 | Ga0207677_10020605 | 3300026023 | Bacteria | 4007 |
| 318 | Ga0207677_10079415 | 3300026023 | Bacteria | 2346 |
| 319 | Ga0207677_10124572 | 3300026023 | Bacteria | 1945 |
| 320 | Ga0207703_10000031 | 3300026035 | Bacteria | 196940 |
| 321 | Ga0207703_10248429 | 3300026035 | Bacteria | 1602 |
| 322 | Ga0207639_10022174 | 3300026041 | Bacteria | 4572 |
| 323 | Ga0207678_10001249 | 3300026067 | Bacteria | 23448 |
| 324 | Ga0207678_10450075 | 3300026067 | Bacteria | 1119 |
| 325 | Ga0207678_10623151 | 3300026067 | Bacteria | 947 |
| 326 | Ga0207708_10424430 | 3300026075 | Bacteria | 1103 |
| 327 | Ga0207702_10053773 | 3300026078 | Bacteria | 3410 |
| 328 | Ga0207702_10093978 | 3300026078 | Bacteria | 2631 |
| 329 | Ga0207702_10354150 | 3300026078 | Bacteria | 1405 |
| 330 | Ga0207641_10044128 | 3300026088 | Bacteria | 3748 |
| 331 | Ga0207641_10253188 | 3300026088 | Bacteria | 1645 |
| 332 | Ga0207641_12452901 | 3300026088 | Bacteria | 520 |
| 333 | Ga0207648_12021970 | 3300026089 | Bacteria | 537 |
| 334 | Ga0207676_10107667 | 3300026095 | Bacteria | 2325 |
| 335 | Ga0207674_10059775 | 3300026116 | Bacteria | 3856 |
| 336 | Ga0207674_10229669 | 3300026116 | Bacteria | 1803 |
| 337 | Ga0207683_10021780 | 3300026121 | Bacteria | 5494 |
| 338 | Ga0207683_10128823 | 3300026121 | Bacteria | 2275 |
| 339 | Ga0207698_10140748 | 3300026142 | Bacteria | 2078 |
| 340 | Ga0207698_10640032 | 3300026142 | Bacteria | 1052 |
| 341 | Ga0209813_10136791 | 3300027866 | Bacteria | 866 |
| 342 | Ga0209813_10482102 | 3300027866 | Bacteria | 512 |
| 343 | Ga0268266_10087579 | 3300028379 | Bacteria | 2725 |
| 344 | Ga0268266_10306749 | 3300028379 | Bacteria | 1482 |
| 345 | Ga0268266_11383849 | 3300028379 | Bacteria | 679 |
| 346 | Ga0268265_10884593 | 3300028380 | Bacteria | 876 |
| 347 | Ga0268264_10000987 | 3300028381 | Bacteria | 29098 |
| 348 | Ga0268264_10137202 | 3300028381 | Bacteria | 2176 |
| 349 | Ga0268264_10511587 | 3300028381 | Bacteria | 1172 |
| 350 | Ga0268264_11402415 | 3300028381 | Bacteria | 709 |
| 351 | Ga0265334_10007622 | 3300028573 | Bacteria | 4637 |
| 352 | Ga0307515_10446720 | 3300028794 | Bacteria | 909 |
| 353 | Ga0307515_10483612 | 3300028794 | Bacteria | 850 |
| 354 | Ga0307511_10316414 | 3300030521 | Bacteria | 693 |
| 355 | Ga0314311_1122579 | 3300030733 | Bacteria | 927 |
| 356 | Ga0316181_1252750 | 3300030744 | Bacteria | 1754 |
| 357 | Ga0316182_1109466 | 3300030745 | Bacteria | 3392 |
| 358 | Ga0307513_10907350 | 3300031456 | Bacteria | 589 |
| 359 | Ga0307509_10536258 | 3300031507 | Bacteria | 850 |
| 360 | Ga0307408_100270314 | 3300031548 | Bacteria | 1411 |
| 361 | Ga0307408_101175431 | 3300031548 | Bacteria | 715 |
| 362 | Ga0307514_10383541 | 3300031649 | Bacteria | 728 |
| 363 | Ga0316575_10002481 | 3300031665 | Bacteria | 6207 |
| 364 | Ga0316579_10030946 | 3300031691 | Bacteria | 2447 |
| 365 | Ga0316579_10079621 | 3300031691 | Bacteria | 1559 |
| 366 | Ga0316579_10121107 | 3300031691 | Bacteria | 1257 |
| 367 | Ga0316576_10006347 | 3300031727 | Bacteria | 7349 |
| 368 | Ga0316576_10039257 | 3300031727 | Bacteria | 3397 |
| 369 | Ga0316576_10046810 | 3300031727 | Bacteria | 3132 |
| 370 | Ga0316576_10083058 | 3300031727 | Bacteria | 2379 |
| 371 | Ga0316578_10025525 | 3300031728 | Bacteria | 3323 |
| 372 | Ga0316578_10040601 | 3300031728 | Bacteria | 2691 |
| 373 | Ga0316578_10050930 | 3300031728 | Bacteria | 2424 |
| 374 | Ga0307405_10579826 | 3300031731 | Bacteria | 912 |
| 375 | Ga0307405_11055901 | 3300031731 | Bacteria | 696 |
| 376 | Ga0307405_11752215 | 3300031731 | Bacteria | 551 |
| 377 | Ga0307405_11761025 | 3300031731 | Bacteria | 550 |
| 378 | Ga0316577_10037186 | 3300031733 | Bacteria | 2722 |
| 379 | Ga0316577_10150171 | 3300031733 | Bacteria | 1313 |
| 380 | Ga0316577_10303288 | 3300031733 | Bacteria | 905 |
| 381 | Ga0307413_10352090 | 3300031824 | Bacteria | 1137 |
| 382 | Ga0307410_10099134 | 3300031852 | Bacteria | 2085 |
| 383 | Ga0307410_10852134 | 3300031852 | Bacteria | 778 |
| 384 | Ga0307410_11872070 | 3300031852 | Bacteria | 534 |
| 385 | Ga0307406_10014155 | 3300031901 | Bacteria | 4584 |
| 386 | Ga0307406_10492598 | 3300031901 | Bacteria | 992 |
| 387 | Ga0307406_10983925 | 3300031901 | Bacteria | 723 |
| 388 | Ga0307407_10031786 | 3300031903 | Bacteria | 2863 |
| 389 | Ga0307407_10485365 | 3300031903 | Bacteria | 903 |
| 390 | Ga0307412_10226887 | 3300031911 | Bacteria | 1436 |
| 391 | Ga0307409_100039407 | 3300031995 | Bacteria | 3506 |
| 392 | Ga0307409_100114010 | 3300031995 | Bacteria | 2273 |
| 393 | Ga0307409_100455060 | 3300031995 | Bacteria | 1236 |
| 394 | Ga0307416_100114623 | 3300032002 | Bacteria | 2385 |
| 395 | Ga0307416_100284593 | 3300032002 | Bacteria | 1632 |
| 396 | Ga0307416_101076555 | 3300032002 | Bacteria | 908 |
| 397 | Ga0307414_10147875 | 3300032004 | Bacteria | 1849 |
| 398 | Ga0307414_11262500 | 3300032004 | Bacteria | 685 |
| 399 | Ga0307414_12025678 | 3300032004 | Bacteria | 537 |
| 400 | Ga0307411_10276741 | 3300032005 | Bacteria | 1334 |
| 401 | Ga0307415_100393359 | 3300032126 | Bacteria | 1181 |
| 402 | Ga0316583_10006503 | 3300032133 | Bacteria | 4197 |
| 403 | Ga0316583_10157169 | 3300032133 | Bacteria | 791 |
| 404 | Ga0316585_10008208 | 3300032137 | Bacteria | 3024 |
| 405 | Ga0316580_10037842 | 3300032139 | Bacteria | 1491 |
| 406 | Ga0316580_10083811 | 3300032139 | Bacteria | 975 |
| 407 | Ga0316593_10004078 | 3300032168 | Bacteria | 3705 |
| 408 | Ga0316593_10036808 | 3300032168 | Bacteria | 1615 |
| 409 | Ga0316593_10116587 | 3300032168 | Bacteria | 956 |
| 410 | Ga0316592_1040494 | 3300033524 | Bacteria | 1030 |
| 411 | Ga0316592_1100203 | 3300033524 | Bacteria | 666 |
| 412 | Ga0316586_1059785 | 3300033527 | Bacteria | 691 |
| 413 | Ga0316588_1066174 | 3300033528 | Bacteria | 885 |
| 414 | Ga0316588_1143549 | 3300033528 | Bacteria | 611 |
| 415 | Ga0316588_1157459 | 3300033528 | Bacteria | 584 |
| 416 | Ga0316596_1000246 | 3300033541 | Bacteria | 8300 |
| 417 | Ga0316596_1030137 | 3300033541 | Bacteria | 1406 |
| 418 | Ga0316596_1070862 | 3300033541 | Bacteria | 933 |
| 419 | Ga0316596_1185114 | 3300033541 | Bacteria | 577 |
| 420 | Ga0316596_1202893 | 3300033541 | Unclassified | 552 |
| 421 | Ga0316574_0009952 | 3300035398 | Bacteria | 5350 |
| 422 | Ga0316574_0030284 | 3300035398 | Bacteria | 3276 |
| 423 | Ga0316574_0136834 | 3300035398 | Bacteria | 1577 |
| 424 | Ga0316574_0170914 | 3300035398 | Bacteria | 1399 |
| 425 | Ga0316582_0299072 | 3300036647 | Bacteria | 1105 |
| 426 | Ga0316582_0442099 | 3300036647 | Bacteria | 896 |
| 427 | Ga0316582_0673026 | 3300036647 | Bacteria | 711 |
| 428 | Ga0316584_0001267 | 3300036712 | Bacteria | 14951 |
| 429 | Ga0316584_0045469 | 3300036712 | Bacteria | 3277 |
| 430 | Ga0316584_0080072 | 3300036712 | Bacteria | 2447 |
| 431 | Ga0316584_0950130 | 3300036712 | Bacteria | 576 |
| 432 | Ga0395899_0381370 | 3300037312 | Bacteria | 937 |
| 433 | Ga0395900_0017198 | 3300037418 | Bacteria | 7380 |
| 434 | Ga0395900_0127340 | 3300037418 | Bacteria | 2611 |
| 435 | Ga0395900_1424141 | 3300037418 | Bacteria | 606 |
| 436 | Ga0395900_1502563 | 3300037418 | Bacteria | 586 |
| 437 | Ga0395898_0287877 | 3300037466 | Bacteria | 1567 |
| 438 | Ga0395898_0346737 | 3300037466 | Bacteria | 1416 |
| 439 | Ga0395898_1424394 | 3300037466 | Bacteria | 620 |
| 440 | Ga0395898_1907993 | 3300037466 | Bacteria | 514 |
| 441 | Ga0316581_0000149 | 3300037588 | Bacteria | 10812 |
| 442 | Ga0395901_0778705 | 3300038443 | Bacteria | 947 |
| 443 | Ga0400485_19729 | 3300038735 | Bacteria | 13426 |
| 444 | Ga0400486_32646 | 3300038742 | Bacteria | 15037 |
| 445 | Ga0400489_87014 | 3300039093 | Bacteria | 1317 |
| 446 | Ga0436365_1513875 | 3300039437 | Bacteria | 1120 |
| 447 | Ga0436361_0965496 | 3300039447 | Bacteria | 1300 |
| 448 | Ga0436362_1249237 | 3300039453 | Bacteria | 570 |
| 449 | Ga0439439_0110793 | 3300041406 | Bacteria | 761 |
| 450 | Ga0439466_0114319 | 3300041411 | Bacteria | 836 |
| 451 | Ga0439466_0161318 | 3300041411 | Bacteria | 686 |
| 452 | Ga0439465_0048243 | 3300041413 | Bacteria | 1389 |
| 453 | Ga0439465_0090100 | 3300041413 | Bacteria | 1048 |
| 454 | Ga0439465_0123823 | 3300041413 | Bacteria | 908 |
| 455 | Ga0451789_0231381 | 3300041443 | Bacteria | 669 |
| 456 | Ga0451789_0396782 | 3300041443 | Bacteria | 1311 |
| 457 | Ga0451790_30891 | 3300041444 | Bacteria | 581 |
| 458 | Ga0451796_10591 | 3300041450 | Bacteria | 716 |
| 459 | Ga0451793_0715769 | 3300041452 | Bacteria | 780 |
| 460 | Ga0451793_0789263 | 3300041452 | Bacteria | 2434 |
| 461 | Ga0451797_1218952 | 3300041453 | Bacteria | 507 |
| 462 | Ga0451797_1255051 | 3300041453 | Bacteria | 544 |
| 463 | Ga0451795_0292788 | 3300041456 | Bacteria | 580 |
| 464 | Ga0451795_0294527 | 3300041456 | Bacteria | 640 |
| 465 | Ga0451795_0902187 | 3300041456 | Bacteria | 845 |
| 466 | Ga0451800_1058039 | 3300041459 | Bacteria | 694 |
| 467 | Ga0451800_1401438 | 3300041459 | Bacteria | 634 |
| 468 | Ga0451802_0085081 | 3300041460 | Bacteria | 751 |
| 469 | Ga0451802_0143883 | 3300041460 | Bacteria | 616 |
| 470 | Ga0451802_0800214 | 3300041460 | Bacteria | 558 |
| 471 | Ga0451807_1553210 | 3300041486 | Bacteria | 649 |
| 472 | Ga0451807_1667980 | 3300041486 | Bacteria | 627 |
| 473 | Ga0451807_2621320 | 3300041486 | Bacteria | 537 |
| 474 | Ga0451833_0276161 | 3300041491 | Bacteria | 4559 |
| 475 | Ga0451837_0160140 | 3300041494 | Bacteria | 681 |
| 476 | Ga0451837_0210431 | 3300041494 | Bacteria | 814 |
| 477 | Ga0451837_0949823 | 3300041494 | Bacteria | 558 |
| 478 | Ga0451837_1052852 | 3300041494 | Bacteria | 3865 |
| 479 | Ga0451839_0010674 | 3300041496 | Bacteria | 2785 |
| 480 | Ga0451841_0315296 | 3300041498 | Bacteria | 551 |
| 481 | Ga0451841_0963788 | 3300041498 | Bacteria | 1753 |
| 482 | Ga0451845_0086215 | 3300041501 | Bacteria | 1298 |
| 483 | Ga0451846_47497 | 3300041502 | Bacteria | 581 |
| 484 | Ga0451843_0176465 | 3300041509 | Bacteria | 743 |
| 485 | Ga0451843_0390362 | 3300041509 | Bacteria | 552 |
| 486 | Ga0451843_1649887 | 3300041509 | Bacteria | 618 |
| 487 | Ga0451843_1745894 | 3300041509 | Bacteria | 638 |
| 488 | Ga0451855_1387741 | 3300041511 | Bacteria | 578 |
| 489 | Ga0451853_0057221 | 3300041512 | Bacteria | 7174 |
| 490 | Ga0451853_0407957 | 3300041512 | Bacteria | 569 |
| 491 | Ga0451853_2386619 | 3300041512 | Bacteria | 1746 |
| 492 | Ga0451853_2624360 | 3300041512 | Bacteria | 504 |
| 493 | Ga0439445_0027772 | 3300042004 | Bacteria | 1455 |
| 494 | Ga0439432_056326 | 3300042006 | Bacteria | 1218 |
| 495 | Ga0439446_0094568 | 3300042156 | Bacteria | 939 |
| 496 | Ga0439459_0112591 | 3300042438 | Bacteria | 678 |
| 497 | Ga0466969_0017660 | 3300044656 | Bacteria | 3723 |
| 498 | Ga0466969_0062150 | 3300044656 | Bacteria | 1813 |
| 499 | Ga0466969_0248751 | 3300044656 | Bacteria | 806 |
| 500 | Ga0466972_0037579 | 3300044658 | Bacteria | 2367 |
| 501 | Ga0466972_0168960 | 3300044658 | Bacteria | 1027 |
| 502 | Ga0466972_0213221 | 3300044658 | Bacteria | 903 |
| 503 | Ga0466972_0217083 | 3300044658 | Bacteria | 895 |
| 504 | Ga0466972_0402998 | 3300044658 | Bacteria | 641 |
| 505 | Ga0466965_0161261 | 3300044683 | Bacteria | 1176 |
| 506 | Ga0466965_0238911 | 3300044683 | Bacteria | 972 |
| 507 | Ga0466965_0406016 | 3300044683 | Bacteria | 753 |
| 508 | Ga0466965_0422065 | 3300044683 | Bacteria | 739 |
| 509 | Ga0466965_0474493 | 3300044683 | Bacteria | 699 |
| 510 | Ga0466965_0894244 | 3300044683 | Bacteria | 518 |
| 511 | Ga0466966_0098303 | 3300044684 | Bacteria | 1812 |
| 512 | Ga0466966_0131941 | 3300044684 | Bacteria | 1529 |
| 513 | Ga0466966_0398987 | 3300044684 | Bacteria | 826 |
| 514 | Ga0466961_0041554 | 3300044693 | Bacteria | 2948 |
| 515 | Ga0466961_0067005 | 3300044693 | Bacteria | 2280 |
| 516 | Ga0466961_0109310 | 3300044693 | Bacteria | 1740 |
| 517 | Ga0466961_0426426 | 3300044693 | Bacteria | 804 |
| 518 | Ga0466961_0904767 | 3300044693 | Bacteria | 525 |
| 519 | Ga0466963_0239166 | 3300044694 | Bacteria | 1273 |
| 520 | Ga0466964_0023349 | 3300044706 | Bacteria | 2405 |
| 521 | Ga0453684_0837163 | 3300044712 | Bacteria | 990 |
| 522 | Ga0466971_0246736 | 3300044719 | Bacteria | 850 |
| 523 | Ga0466968_0088816 | 3300044735 | Bacteria | 1367 |
| 524 | Ga0466968_0090654 | 3300044735 | Bacteria | 1354 |
| 525 | Ga0466970_0005900 | 3300044765 | Bacteria | 6101 |
| 526 | Ga0466970_0058962 | 3300044765 | Bacteria | 2055 |
| 527 | Ga0466970_0193928 | 3300044765 | Bacteria | 1129 |
| 528 | Ga0466970_0369744 | 3300044765 | Bacteria | 815 |
| 529 | Ga0466970_0864876 | 3300044765 | Bacteria | 531 |
| 530 | Ga0466957_0101812 | 3300044842 | Bacteria | 1811 |
| 531 | Ga0466957_0536768 | 3300044842 | Bacteria | 814 |
| 532 | Ga0466957_0693127 | 3300044842 | Bacteria | 718 |
| 533 | Ga0466957_0980112 | 3300044842 | Bacteria | 606 |
| 534 | Ga0466960_0250145 | 3300044901 | Bacteria | 984 |
| 535 | Ga0466960_0977053 | 3300044901 | Bacteria | 519 |
| 536 | Ga0466959_0143603 | 3300045049 | Bacteria | 1685 |
| 537 | Ga0466959_0190525 | 3300045049 | Bacteria | 1431 |
| 538 | Ga0466959_0391539 | 3300045049 | Bacteria | 945 |
| 539 | Ga0466958_0327777 | 3300045836 | Bacteria | 984 |
| 540 | Ga0466958_0981194 | 3300045836 | Bacteria | 551 |
| 541 | Ga0466967_0305278 | 3300045976 | Bacteria | 1532 |
| 542 | Ga0466967_0484939 | 3300045976 | Bacteria | 1211 |
| 543 | Ga0466967_0832639 | 3300045976 | Bacteria | 917 |
| 544 | Ga0466967_0987869 | 3300045976 | Bacteria | 838 |
| 545 | Ga0466967_1835973 | 3300045976 | Bacteria | 603 |
| 546 | Ga0466967_2177912 | 3300045976 | Bacteria | 550 |
| 547 | Ga0495627_097854 | 3300046453 | Bacteria | 840 |
| 548 | Ga0495591_122499 | 3300046458 | Bacteria | 634 |
| 549 | Ga0495638_0135324 | 3300046460 | Bacteria | 1444 |
| 550 | Ga0495650_0010799 | 3300046471 | Bacteria | 5065 |
| 551 | Ga0495650_0024978 | 3300046471 | Bacteria | 2812 |
| 552 | Ga0495639_0171620 | 3300046475 | Bacteria | 1053 |
| 553 | Ga0495620_0275483 | 3300046515 | Bacteria | 640 |
| 554 | Ga0495631_0349853 | 3300046518 | Bacteria | 629 |
| 555 | Ga0495643_0142616 | 3300046522 | Bacteria | 1193 |
| 556 | Ga0495654_0032925 | 3300046530 | Bacteria | 2626 |
| 557 | Ga0495609_0049279 | 3300046538 | Bacteria | 1880 |
| 558 | Ga0495656_0251254 | 3300046615 | Bacteria | 893 |
| 559 | Ga0495625_0142695 | 3300046660 | Bacteria | 1615 |
| 560 | Ga0495657_0334786 | 3300046675 | Bacteria | 898 |
| 561 | Ga0495647_0407478 | 3300046681 | Bacteria | 625 |
| 562 | Ga0495671_0229100 | 3300046692 | Bacteria | 899 |
| 563 | Ga0495649_0078152 | 3300046694 | Bacteria | 1771 |
| 564 | Ga0495672_0245464 | 3300047320 | Bacteria | 872 |
| 565 | Ga0495672_0428121 | 3300047320 | Bacteria | 601 |
| 566 | Ga0495686_0187319 | 3300047472 | Bacteria | 1195 |
| 567 | Ga0495626_0211333 | 3300048091 | Bacteria | 791 |
| 568 | Ga0496100_0018960 | 3300048903 | Bacteria | 4095 |
| 569 | Ga0496100_0209265 | 3300048903 | Bacteria | 1426 |
| 570 | Ga0496100_0231191 | 3300048903 | Bacteria | 1360 |
| 571 | Ga0496101_0006334 | 3300048904 | Bacteria | 7616 |
| 572 | Ga0496102_0022739 | 3300048905 | Bacteria | 5557 |
| 573 | Ga0496102_0217530 | 3300048905 | Bacteria | 1801 |
| 574 | Ga0496102_0346625 | 3300048905 | Bacteria | 1398 |
| 575 | Ga0496102_1780292 | 3300048905 | Bacteria | 533 |
| 576 | Ga0496103_0011718 | 3300048906 | Bacteria | 5201 |
| 577 | Ga0496104_0005777 | 3300048907 | Bacteria | 10829 |
| 578 | Ga0496104_0121240 | 3300048907 | Bacteria | 2510 |
| 579 | Ga0496104_0202754 | 3300048907 | Bacteria | 1895 |
| 580 | Ga0496105_0002712 | 3300048908 | Bacteria | 12913 |
| 581 | Ga0496105_0053232 | 3300048908 | Bacteria | 3342 |
| 582 | Ga0496105_0133027 | 3300048908 | Bacteria | 2049 |
| 583 | Ga0496106_0020578 | 3300048909 | Bacteria | 4898 |
| 584 | Ga0496107_0004317 | 3300048910 | Bacteria | 9625 |
| 585 | Ga0496107_0065388 | 3300048910 | Bacteria | 2636 |
| 586 | Ga0496108_0010564 | 3300048911 | Bacteria | 7495 |
| 587 | Ga0496108_0035480 | 3300048911 | Bacteria | 4146 |
| 588 | Ga0496108_0211667 | 3300048911 | Bacteria | 1683 |
| 589 | Ga0496109_0008423 | 3300048912 | Bacteria | 8766 |
| 590 | Ga0496109_0033739 | 3300048912 | Bacteria | 4606 |
| 591 | Ga0496110_1716588 | 3300048913 | Bacteria | 538 |
| 592 | Ga0496111_0001311 | 3300048914 | Bacteria | 13958 |
| 593 | Ga0496111_0174980 | 3300048914 | Bacteria | 1595 |
| 594 | Ga0496111_0685254 | 3300048914 | Bacteria | 746 |
| 595 | Ga0496111_0762851 | 3300048914 | Bacteria | 701 |
| 596 | Ga0496112_0031543 | 3300048915 | Bacteria | 5142 |
| 597 | Ga0496112_0040203 | 3300048915 | Bacteria | 4572 |
| 598 | Ga0496112_0212811 | 3300048915 | Bacteria | 1890 |
| 599 | Ga0496112_1614501 | 3300048915 | Bacteria | 562 |
| 600 | Ga0496113_0049454 | 3300048916 | Bacteria | 3130 |
| 601 | Ga0496113_0107738 | 3300048916 | Bacteria | 2165 |
| 602 | Ga0496114_0023635 | 3300048917 | Bacteria | 5016 |
| 603 | Ga0496114_0063976 | 3300048917 | Bacteria | 3080 |
| 604 | Ga0496114_0181650 | 3300048917 | Bacteria | 1837 |
| 605 | Ga0496114_0553668 | 3300048917 | Bacteria | 1016 |
| 606 | Ga0496114_1141878 | 3300048917 | Bacteria | 664 |
| 607 | Ga0496114_1271347 | 3300048917 | Bacteria | 622 |
| 608 | Ga0496115_0033887 | 3300048918 | Bacteria | 4034 |
| 609 | Ga0496115_0058473 | 3300048918 | Bacteria | 3102 |
| 610 | Ga0496115_0487868 | 3300048918 | Bacteria | 991 |
| 611 | Ga0496116_0022531 | 3300048919 | Bacteria | 4717 |
| 612 | Ga0496117_0000053 | 3300048920 | Bacteria | 279396 |
| 613 | Ga0496117_0002379 | 3300048920 | Bacteria | 23971 |
| 614 | Ga0496117_0005856 | 3300048920 | Bacteria | 12723 |
| 615 | Ga0496117_0019479 | 3300048920 | Bacteria | 5570 |
| 616 | Ga0496117_0034093 | 3300048920 | Bacteria | 3842 |
| 617 | Ga0496117_0188220 | 3300048920 | Bacteria | 1179 |
| 618 | Ga0496117_0319738 | 3300048920 | Bacteria | 814 |
| 619 | Ga0496118_0000134 | 3300048921 | Bacteria | 130991 |
| 620 | Ga0496118_0003938 | 3300048921 | Bacteria | 18160 |
| 621 | Ga0496118_0277403 | 3300048921 | Bacteria | 935 |
| 622 | Ga0496118_0332049 | 3300048921 | Bacteria | 819 |
| 623 | Ga0496118_0454331 | 3300048921 | Bacteria | 649 |
| 624 | Ga0496119_0002876 | 3300048922 | Bacteria | 18371 |
| 625 | Ga0496119_0002920 | 3300048922 | Bacteria | 18233 |
| 626 | Ga0496119_0007344 | 3300048922 | Bacteria | 9964 |
| 627 | Ga0496119_0033701 | 3300048922 | Bacteria | 3389 |
| 628 | Ga0496119_0099165 | 3300048922 | Bacteria | 1639 |
| 629 | Ga0496119_0106653 | 3300048922 | Bacteria | 1563 |
| 630 | Ga0496120_0001606 | 3300048923 | Bacteria | 26223 |
| 631 | Ga0496120_0002418 | 3300048923 | Bacteria | 18940 |
| 632 | Ga0496120_0005690 | 3300048923 | Bacteria | 9839 |
| 633 | Ga0496120_0010747 | 3300048923 | Bacteria | 6347 |
| 634 | Ga0496120_0018423 | 3300048923 | Bacteria | 4502 |
| 635 | Ga0496120_0026291 | 3300048923 | Bacteria | 3596 |
| 636 | Ga0496120_0060529 | 3300048923 | Bacteria | 2118 |
| 637 | Ga0496120_0149235 | 3300048923 | Bacteria | 1177 |
| 638 | Ga0496122_0000030 | 3300048925 | Bacteria | 331586 |
| 639 | Ga0496122_0001750 | 3300048925 | Bacteria | 33455 |
| 640 | Ga0496122_0002826 | 3300048925 | Bacteria | 23793 |
| 641 | Ga0496122_0024042 | 3300048925 | Bacteria | 5344 |
| 642 | Ga0496122_0170148 | 3300048925 | Bacteria | 1315 |
| 643 | Ga0496123_0000024 | 3300048926 | Bacteria | 331587 |
| 644 | Ga0496123_0003526 | 3300048926 | Bacteria | 17426 |
| 645 | Ga0496123_0003716 | 3300048926 | Bacteria | 16787 |
| 646 | Ga0496123_0141416 | 3300048926 | Bacteria | 1315 |
| 647 | Ga0496123_0335998 | 3300048926 | Bacteria | 708 |
| 648 | Ga0496124_0000256 | 3300048927 | Bacteria | 102144 |
| 649 | Ga0496124_0003673 | 3300048927 | Bacteria | 18552 |
| 650 | Ga0496124_0058865 | 3300048927 | Bacteria | 3229 |
| 651 | Ga0496124_0227210 | 3300048927 | Bacteria | 1398 |
| 652 | Ga0496124_0490252 | 3300048927 | Bacteria | 827 |
| 653 | Ga0496124_0493084 | 3300048927 | Bacteria | 823 |
| 654 | Ga0496125_0004043 | 3300048928 | Bacteria | 17191 |
| 655 | Ga0496125_0004883 | 3300048928 | Bacteria | 15211 |
| 656 | Ga0496125_0580132 | 3300048928 | Bacteria | 616 |
| 657 | Ga0496126_0004970 | 3300048929 | Bacteria | 15509 |
| 658 | Ga0496126_0008058 | 3300048929 | Bacteria | 11419 |
| 659 | Ga0496126_0083076 | 3300048929 | Bacteria | 2828 |
| 660 | Ga0496126_0466232 | 3300048929 | Bacteria | 1014 |
| 661 | Ga0501306_055966 | 3300049127 | Bacteria | 642 |
| 662 | Ga0501308_080432 | 3300049128 | Bacteria | 518 |
| 663 | Ga0501305_048878 | 3300049161 | Bacteria | 705 |
| 664 | Ga0501311_028365 | 3300049527 | Bacteria | 799 |
| 665 | Ga0501311_053509 | 3300049527 | Bacteria | 638 |
| 666 | Ga0501317_015058 | 3300049533 | Bacteria | 988 |
| 667 | Ga0501317_033450 | 3300049533 | Bacteria | 757 |
| 668 | Ga0501317_036146 | 3300049533 | Bacteria | 737 |
| 669 | Ga0501317_061733 | 3300049533 | Bacteria | 616 |
| 670 | Ga0501318_041901 | 3300049534 | Bacteria | 657 |
| 671 | Ga0501321_016150 | 3300049537 | Bacteria | 886 |
| 672 | Ga0501325_012740 | 3300049541 | Bacteria | 796 |
| 673 | Ga0501031_0005342 | 3300049568 | Bacteria | 8367 |
| 674 | Ga0501032_0068474 | 3300049569 | Bacteria | 2369 |
| 675 | Ga0501032_0095790 | 3300049569 | Bacteria | 1967 |
| 676 | Ga0501032_0161073 | 3300049569 | Bacteria | 1473 |
| 677 | Ga0501033_0072472 | 3300049570 | Bacteria | 2529 |
| 678 | Ga0501033_0717353 | 3300049570 | Bacteria | 679 |
| 679 | Ga0501034_0037990 | 3300049571 | Bacteria | 4876 |
| 680 | Ga0501034_0970943 | 3300049571 | Bacteria | 734 |
| 681 | Ga0501034_1714836 | 3300049571 | Bacteria | 500 |
| 682 | Ga0501036_0087292 | 3300049572 | Bacteria | 2636 |
| 683 | Ga0501036_0158878 | 3300049572 | Bacteria | 1906 |
| 684 | Ga0501036_0182437 | 3300049572 | Bacteria | 1767 |
| 685 | Ga0501036_1024362 | 3300049572 | Bacteria | 675 |
| 686 | Ga0501037_0025811 | 3300049573 | Bacteria | 4339 |
| 687 | Ga0501037_0034216 | 3300049573 | Bacteria | 3749 |
| 688 | Ga0501037_0053602 | 3300049573 | Bacteria | 2950 |
| 689 | Ga0501037_0177813 | 3300049573 | Bacteria | 1511 |
| 690 | Ga0501038_0014449 | 3300049574 | Bacteria | 7196 |
| 691 | Ga0501038_0284053 | 3300049574 | Bacteria | 1302 |
| 692 | Ga0501039_0011177 | 3300049575 | Bacteria | 6840 |
| 693 | Ga0501039_0086806 | 3300049575 | Bacteria | 2437 |
| 694 | Ga0501040_0541873 | 3300049576 | Bacteria | 840 |
| 695 | Ga0501041_0942164 | 3300049577 | Bacteria | 555 |
| 696 | Ga0501042_0095433 | 3300049578 | Bacteria | 2136 |
| 697 | Ga0501042_0779368 | 3300049578 | Bacteria | 696 |
| 698 | Ga0501042_1051445 | 3300049578 | Bacteria | 593 |
| 699 | Ga0501043_0010788 | 3300049579 | Bacteria | 7155 |
| 700 | Ga0501043_0115130 | 3300049579 | Bacteria | 2110 |
| 701 | Ga0501043_0178628 | 3300049579 | Bacteria | 1654 |
| 702 | Ga0501046_0010145 | 3300049580 | Bacteria | 8108 |
| 703 | Ga0501046_0771402 | 3300049580 | Bacteria | 675 |
| 704 | Ga0501047_0245072 | 3300049581 | Bacteria | 1641 |
| 705 | Ga0501047_0266290 | 3300049581 | Bacteria | 1560 |
| 706 | Ga0501047_0958811 | 3300049581 | Bacteria | 669 |
| 707 | Ga0501048_0023082 | 3300049582 | Bacteria | 4548 |
| 708 | Ga0501048_0591621 | 3300049582 | Bacteria | 796 |
| 709 | Ga0501048_1228041 | 3300049582 | Bacteria | 539 |
| 710 | Ga0501067_0083654 | 3300049583 | Bacteria | 1770 |
| 711 | Ga0501067_0153901 | 3300049583 | Bacteria | 1281 |
| 712 | Ga0501067_0502075 | 3300049583 | Bacteria | 679 |
| 713 | Ga0501068_0182487 | 3300049584 | Bacteria | 1327 |
| 714 | Ga0501068_0277994 | 3300049584 | Bacteria | 1070 |
| 715 | Ga0501069_0018628 | 3300049585 | Bacteria | 3748 |
| 716 | Ga0501069_0039598 | 3300049585 | Bacteria | 2604 |
| 717 | Ga0501069_0110795 | 3300049585 | Bacteria | 1563 |
| 718 | Ga0501070_0053511 | 3300049586 | Bacteria | 3348 |
| 719 | Ga0501070_0059346 | 3300049586 | Bacteria | 3171 |
| 720 | Ga0501070_0180838 | 3300049586 | Bacteria | 1735 |
| 721 | Ga0501071_0478029 | 3300049587 | Bacteria | 955 |
| 722 | Ga0501071_1219130 | 3300049587 | Bacteria | 581 |
| 723 | Ga0501073_0027393 | 3300049589 | Bacteria | 4075 |
| 724 | Ga0501073_0354250 | 3300049589 | Bacteria | 1013 |
| 725 | Ga0501073_0440406 | 3300049589 | Bacteria | 901 |
| 726 | Ga0501074_0295009 | 3300049590 | Bacteria | 1152 |
| 727 | Ga0501074_1259389 | 3300049590 | Bacteria | 518 |
| 728 | Ga0501076_0431158 | 3300049592 | Bacteria | 1085 |
| 729 | Ga0501077_0796427 | 3300049593 | Bacteria | 608 |
| 730 | Ga0501079_0094252 | 3300049741 | Bacteria | 2320 |
| 731 | Ga0501079_0111553 | 3300049741 | Bacteria | 2125 |
| 732 | Ga0501080_0021682 | 3300049742 | Bacteria | 5948 |
| 733 | Ga0501080_0155978 | 3300049742 | Bacteria | 2109 |
| 734 | Ga0501081_0218466 | 3300049743 | Bacteria | 1386 |
| 735 | Ga0501081_0316629 | 3300049743 | Bacteria | 1146 |
| 736 | Ga0501035_0215456 | 3300049822 | Bacteria | 1641 |
| 737 | Ga0501035_0467071 | 3300049822 | Bacteria | 1042 |
| 738 | Ga0501035_1376757 | 3300049822 | Bacteria | 541 |
| 739 | Ga0501044_0042949 | 3300049823 | Bacteria | 4698 |
| 740 | Ga0501044_1628706 | 3300049823 | Bacteria | 510 |
| 741 | Ga0501045_0473750 | 3300049824 | Bacteria | 930 |
| 742 | nmdc:mga03n38_222569_c1 | 3300050490 | Bacteria | 986 |
| 743 | nmdc:mga00v17_114948_c1 | 3300050491 | Bacteria | 1710 |
| 744 | nmdc:mga00v17_173872_c1 | 3300050491 | Bacteria | 1389 |
| 745 | nmdc:mga00v17_296205_c1 | 3300050491 | Bacteria | 1051 |
| 746 | nmdc:mga00v17_310638_c1 | 3300050491 | Bacteria | 1024 |
| 747 | nmdc:mga00v17_62442_c1 | 3300050491 | Bacteria | 2292 |
| 748 | nmdc:mga00v17_971_c1 | 3300050491 | Bacteria | 15352 |
| 749 | nmdc:mga0yw44_114563_c1 | 3300050492 | Bacteria | 1731 |
| 750 | nmdc:mga0yw44_22559_c1 | 3300050492 | Bacteria | 3532 |
| 751 | nmdc:mga0yw44_289036_c1 | 3300050492 | Bacteria | 1097 |
| 752 | nmdc:mga0yw44_82211_c1 | 3300050492 | Bacteria | 2020 |
| 753 | nmdc:mga0k408_872708_c1 | 3300050493 | Bacteria | 522 |
| 754 | nmdc:mga06z11_391110_c1 | 3300050494 | Bacteria | 836 |
| 755 | nmdc:mga06z11_4263_c1 | 3300050494 | Bacteria | 5614 |
| 756 | nmdc:mga04h51_82785_c1 | 3300050495 | Bacteria | 1142 |
| 757 | nmdc:mga07m45_16476_c1 | 3300050496 | Bacteria | 3957 |
| 758 | nmdc:mga07m45_60779_c1 | 3300050496 | Bacteria | 2139 |
| 759 | nmdc:mga07m45_657785_c1 | 3300050496 | Bacteria | 604 |
| 760 | nmdc:mga07m45_733198_c1 | 3300050496 | Bacteria | 568 |
| 761 | nmdc:mga0sz30_2151_c1 | 3300050516 | Bacteria | 7038 |
| 762 | nmdc:mga0sz30_4797_c2 | 3300050516 | Bacteria | 3699 |
| 763 | Ga0495619_0873288 | 3300053085 | Bacteria | 606 |
| 764 | Ga0500643_000174 | 3300053087 | Bacteria | 63222 |
| 765 | Ga0500651_0001075 | 3300053093 | Bacteria | 13493 |
| 766 | Ga0500641_0006257 | 3300053096 | Bacteria | 4224 |
| 767 | Ga0500556_0000001 | 3300053104 | Bacteria | 1135060 |
| 768 | Ga0500559_0016386 | 3300053136 | Bacteria | 3128 |
| 769 | Ga0500568_0000006 | 3300053139 | Bacteria | 522235 |
| 770 | Ga0500573_0000023 | 3300053140 | Bacteria | 152268 |
| 771 | Ga0500573_0323798 | 3300053140 | Bacteria | 760 |
| 772 | Ga0500573_0369953 | 3300053140 | Bacteria | 689 |
| 773 | Ga0500616_0000221 | 3300053153 | Bacteria | 88983 |
| 774 | Ga0500620_000031 | 3300053155 | Bacteria | 27977 |
| 775 | Ga0501084_0434284 | 3300054114 | Bacteria | 1110 |
| 776 | Ga0501084_0476250 | 3300054114 | Bacteria | 1055 |
| 777 | Ga0590075_078126 | 3300059424 | Bacteria | 857 |
| 778 | Ga0587093_048773 | 3300059478 | Bacteria | 663 |
| 779 | Ga0587066_073211 | 3300059490 | Bacteria | 726 |
| 780 | Ga0587066_080776 | 3300059490 | Bacteria | 704 |
| 781 | Ga0587070_056282 | 3300059491 | Bacteria | 800 |
| 782 | Ga0587073_0124378 | 3300059492 | Bacteria | 700 |
| 783 | Ga0587073_0124825 | 3300059492 | Bacteria | 699 |
| 784 | Ga0587073_0242641 | 3300059492 | Bacteria | 561 |
| 785 | Ga0587077_102352 | 3300059493 | Bacteria | 690 |
| 786 | Ga0587080_109638 | 3300059503 | Bacteria | 600 |
| 787 | Ga0587082_049701 | 3300059504 | Bacteria | 796 |
| 788 | Ga0587083_0074773 | 3300059505 | Bacteria | 794 |
| 789 | Ga0587086_015905 | 3300059507 | Bacteria | 977 |
| 790 | Ga0587088_031686 | 3300059508 | Bacteria | 949 |
| 791 | Ga0587088_054641 | 3300059508 | Bacteria | 792 |
| 792 | Ga0587089_042758 | 3300059509 | Bacteria | 706 |
| 793 | Ga0587089_109428 | 3300059509 | Bacteria | 509 |
| 794 | Ga0587091_026687 | 3300059511 | Bacteria | 1054 |
| 795 | Ga0587091_099077 | 3300059511 | Bacteria | 681 |
| 796 | Ga0587098_034335 | 3300059604 | Bacteria | 712 |
| 797 | Ga0587106_035625 | 3300059605 | Bacteria | 821 |
| 798 | Ga0587106_051237 | 3300059605 | Bacteria | 732 |
| 799 | Ga0587106_149983 | 3300059605 | Bacteria | 518 |
| 800 | Ga0587129_023990 | 3300059608 | Bacteria | 557 |
| 801 | Ga0587099_049749 | 3300059622 | Bacteria | 557 |
| 802 | Ga0587101_039922 | 3300059623 | Bacteria | 770 |
| 803 | Ga0587101_106997 | 3300059623 | Bacteria | 563 |
| 804 | Ga0587115_009733 | 3300059626 | Bacteria | 1185 |
| 805 | Ga0587115_042285 | 3300059626 | Bacteria | 716 |
| 806 | Ga0587122_016159 | 3300059628 | Bacteria | 769 |
| 807 | Ga0587128_023558 | 3300059630 | Bacteria | 966 |
| 808 | Ga0587128_085130 | 3300059630 | Bacteria | 639 |
| 809 | Ga0587068_073356 | 3300059641 | Bacteria | 679 |
| 810 | Ga0587069_024639 | 3300059642 | Bacteria | 930 |
| 811 | Ga0587075_068341 | 3300059644 | Bacteria | 655 |
| 812 | Ga0587078_089476 | 3300059646 | Bacteria | 503 |
| 813 | Ga0587079_051091 | 3300059647 | Bacteria | 868 |
| 814 | Ga0587079_076662 | 3300059647 | Bacteria | 756 |
| 815 | Ga0587104_009990 | 3300059650 | Bacteria | 691 |
| 816 | Ga0587114_017539 | 3300059655 | Bacteria | 972 |
| 817 | Ga0587071_040609 | 3300060344 | Bacteria | 931 |
| 818 | Ga0587071_083584 | 3300060344 | Bacteria | 715 |
| 819 | Ga0587111_0096733 | 3300060346 | Bacteria | 729 |
| 820 | Ga0501082_0150864 | 3300060353 | Bacteria | 2019 |
| 821 | Ga0501082_0571534 | 3300060353 | Bacteria | 989 |
| 822 | Ga0501082_0706465 | 3300060353 | Bacteria | 882 |
| 823 | Ga0466962_0043154 | 3300061719 | Bacteria | 2158 |
| 824 | Ga0466962_0178297 | 3300061719 | Bacteria | 1036 |
| 825 | Ga0466962_0590282 | 3300061719 | Bacteria | 566 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300003373 | JGI25407J50210_10045377 | JGI25407J50210_100453773 | 79 |
| 2 | 3300005981 | Ga0081538_10000991 | Ga0081538_1000099120 | 79 |
| 3 | iso_pu_bacteria | 2751185788 | 2753301336 | 79 |
| 4 | iso_pu_bacteria | 2857733635 | 2857733678 | 79 |
| 5 | iso_pu_bacteria | 2904430863 | 2904433443 | 79 |
| 6 | iso_pu_bacteria | 2904501621 | 2904503690 | 79 |
| 7 | iso_pu_bacteria | 2908674828 | 2908675330 | 79 |
| 8 | iso_pu_bacteria | 2909074476 | 2909075347 | 79 |
| 9 | iso_pu_bacteria | 2919039151 | 2919040014 | 79 |
| 10 | iso_pu_bacteria | 2919042368 | 2919044963 | 79 |
| 11 | iso_pu_bacteria | 2928104781 | 2928106751 | 79 |
| 12 | iso_pu_bacteria | 2928500415 | 2928501355 | 79 |
| 13 | iso_pu_bacteria | 2984551494 | 2984553523 | 79 |
| 14 | iso_pu_bacteria | 8004212874 | 8004214050 | 79 |
| 15 | iso_pu_bacteria | 2643221546 | 2643753461 | 80 |
| 16 | iso_pu_bacteria | 2643221635 | 2644198464 | 80 |
| 17 | iso_pu_bacteria | 2808606447 | 2809227500 | 80 |
| 18 | iso_pu_bacteria | 2811994880 | 2812364754 | 80 |
| 19 | iso_pu_bacteria | 2852632344 | 2852634262 | 80 |
| 20 | iso_pu_bacteria | 2984592036 | 2984594183 | 80 |
| 21 | 3300031691 | Ga0316579_10079621 | Ga0316579_100796212 | 81 |
| 22 | 3300031727 | Ga0316576_10083058 | Ga0316576_100830582 | 81 |
| 23 | 3300031728 | Ga0316578_10050930 | Ga0316578_100509303 | 81 |
| 24 | 3300032139 | Ga0316580_10083811 | Ga0316580_100838113 | 81 |
| 25 | 3300035398 | Ga0316574_0170914 | Ga0316574_0170914_344_595 | 81 |
| 26 | 3300036647 | Ga0316582_0442099 | Ga0316582_0442099_611_862 | 81 |
| 27 | iso_pu_bacteria | 2643221566 | 2643848163 | 81 |
| 28 | iso_pu_bacteria | 2643221572 | 2643875189 | 81 |
| 29 | iso_pu_bacteria | 2643221597 | 2643995665 | 81 |
| 30 | iso_pu_bacteria | 2643221669 | 2644382245 | 81 |
| 31 | iso_pu_bacteria | 2643221681 | 2644456396 | 81 |
| 32 | iso_pu_bacteria | 2643221961 | 2645723000 | 81 |
| 33 | iso_pu_bacteria | 2643221962 | 2645725955 | 81 |
| 34 | iso_pu_bacteria | 2757320536 | 2758226058 | 81 |
| 35 | iso_pu_bacteria | 2758568522 | 2760306592 | 81 |
| 36 | iso_pu_bacteria | 2773857758 | 2774380297 | 81 |
| 37 | iso_pu_bacteria | 2773857759 | 2774384586 | 81 |
| 38 | iso_pu_bacteria | 2808606439 | 2809195363 | 81 |
| 39 | iso_pu_bacteria | 2808606700 | 2810363920 | 81 |
| 40 | iso_pu_bacteria | 2811994872 | 2812323272 | 81 |
| 41 | iso_pu_bacteria | 2833709550 | 2833711030 | 81 |
| 42 | iso_pu_bacteria | 2857720070 | 2857720236 | 81 |
| 43 | iso_pu_bacteria | 2857729791 | 2857730044 | 81 |
| 44 | iso_pu_bacteria | 2870628048 | 2870630427 | 81 |
| 45 | iso_pu_bacteria | 2891968417 | 2891972140 | 81 |
| 46 | iso_pu_bacteria | 2895660088 | 2895661316 | 81 |
| 47 | iso_pu_bacteria | 2904509784 | 2904511925 | 81 |
| 48 | iso_pu_bacteria | 2905926851 | 2905926929 | 81 |
| 49 | iso_pu_bacteria | 2906799679 | 2906800636 | 81 |
| 50 | iso_pu_bacteria | 2908678064 | 2908680838 | 81 |
| 51 | iso_pu_bacteria | 2919069694 | 2919071612 | 81 |
| 52 | iso_pu_bacteria | 2928090899 | 2928091926 | 81 |
| 53 | iso_pu_bacteria | 2928121344 | 2928123269 | 81 |
| 54 | iso_pu_bacteria | 2946003308 | 2946004207 | 81 |
| 55 | iso_pu_bacteria | 2974294766 | 2974297254 | 81 |
| 56 | iso_pu_bacteria | 2974324384 | 2974326511 | 81 |
| 57 | iso_pu_bacteria | 2977228692 | 2977231491 | 81 |
| 58 | iso_pu_bacteria | 2977236895 | 2977240265 | 81 |
| 59 | iso_pu_bacteria | 2977264416 | 2977266705 | 81 |
| 60 | iso_pu_bacteria | 2984542743 | 2984545457 | 81 |
| 61 | iso_pu_bacteria | 2984580707 | 2984581307 | 81 |
| 62 | iso_pu_bacteria | 8045830549 | 8045831660 | 81 |
| 63 | 3300031456 | Ga0307513_10907350 | Ga0307513_109073502 | 82 |
| 64 | 3300031727 | Ga0316576_10006347 | Ga0316576_1000634710 | 82 |
| 65 | 3300031728 | Ga0316578_10040601 | Ga0316578_100406012 | 82 |
| 66 | 3300031733 | Ga0316577_10303288 | Ga0316577_103032883 | 82 |
| 67 | 3300032168 | Ga0316593_10036808 | Ga0316593_100368082 | 82 |
| 68 | 3300033528 | Ga0316588_1143549 | Ga0316588_11435492 | 82 |
| 69 | 3300033541 | Ga0316596_1070862 | Ga0316596_10708622 | 82 |
| 70 | 3300035398 | Ga0316574_0009952 | Ga0316574_0009952_2640_2888 | 82 |
| 71 | 3300036712 | Ga0316584_0045469 | Ga0316584_0045469_867_1115 | 82 |
| 72 | 3300047472 | Ga0495686_0187319 | Ga0495686_0187319_923_1171 | 82 |
| 73 | 3300053104 | Ga0500556_0000001 | Ga0500556_0000001_550040_550288 | 82 |
| 74 | 3300053139 | Ga0500568_0000006 | Ga0500568_0000006_144355_144603 | 82 |
| 75 | 3300003578 | Ga0006562J51391_1077031 | Ga0006562J51391_10770312 | 83 |
| 76 | 3300009011 | Ga0105251_10257942 | Ga0105251_102579422 | 83 |
| 77 | 3300020076 | Ga0206355_1167418 | Ga0206355_11674182 | 83 |
| 78 | 3300025900 | Ga0207710_10257946 | Ga0207710_102579462 | 83 |
| 79 | 3300030521 | Ga0307511_10316414 | Ga0307511_103164142 | 83 |
| 80 | 3300031824 | Ga0307413_10352090 | Ga0307413_103520901 | 83 |
| 81 | 3300031852 | Ga0307410_10852134 | Ga0307410_108521342 | 83 |
| 82 | 3300036712 | Ga0316584_0950130 | Ga0316584_0950130_185_442 | 83 |
| 83 | 3300041460 | Ga0451802_0143883 | Ga0451802_0143883_138_389 | 83 |
| 84 | 3300044656 | Ga0466969_0062150 | Ga0466969_0062150_903_1154 | 83 |
| 85 | 3300044658 | Ga0466972_0402998 | Ga0466972_0402998_156_407 | 83 |
| 86 | 3300044735 | Ga0466968_0088816 | Ga0466968_0088816_352_603 | 83 |
| 87 | 3300044765 | Ga0466970_0005900 | Ga0466970_0005900_4332_4583 | 83 |
| 88 | 3300046518 | Ga0495631_0349853 | Ga0495631_0349853_175_426 | 83 |
| 89 | 3300046538 | Ga0495609_0049279 | Ga0495609_0049279_584_835 | 83 |
| 90 | 3300048091 | Ga0495626_0211333 | Ga0495626_0211333_26_277 | 83 |
| 91 | 3300048903 | Ga0496100_0209265 | Ga0496100_0209265_811_1062 | 83 |
| 92 | 3300048905 | Ga0496102_0346625 | Ga0496102_0346625_601_852 | 83 |
| 93 | 3300048913 | Ga0496110_1716588 | Ga0496110_1716588_143_394 | 83 |
| 94 | 3300048920 | Ga0496117_0002379 | Ga0496117_0002379_13239_13490 | 83 |
| 95 | 3300048921 | Ga0496118_0000134 | Ga0496118_0000134_57145_57396 | 83 |
| 96 | 3300048922 | Ga0496119_0033701 | Ga0496119_0033701_1349_1600 | 83 |
| 97 | 3300048923 | Ga0496120_0060529 | Ga0496120_0060529_897_1148 | 83 |
| 98 | 3300048927 | Ga0496124_0000256 | Ga0496124_0000256_66557_66808 | 83 |
| 99 | 3300048927 | Ga0496124_0490252 | Ga0496124_0490252_13_264 | 83 |
| 100 | 3300048927 | Ga0496124_0493084 | Ga0496124_0493084_73_324 | 83 |
| 101 | 3300053087 | Ga0500643_000174 | Ga0500643_000174_52139_52390 | 83 |
| 102 | 3300053140 | Ga0500573_0000023 | Ga0500573_0000023_99423_99674 | 83 |
| 103 | 3300053153 | Ga0500616_0000221 | Ga0500616_0000221_53389_53640 | 83 |
| 104 | 3300059630 | Ga0587128_085130 | Ga0587128_085130_371_622 | 83 |
| 105 | 3300003762 | Ga0055542_1006658 | Ga0055542_10066582 | 84 |
| 106 | 3300005327 | Ga0070658_10029253 | Ga0070658_100292533 | 84 |
| 107 | 3300005327 | Ga0070658_10047629 | Ga0070658_100476292 | 84 |
| 108 | 3300005327 | Ga0070658_10069192 | Ga0070658_100691925 | 84 |
| 109 | 3300005338 | Ga0068868_100150079 | Ga0068868_1001500792 | 84 |
| 110 | 3300005339 | Ga0070660_100831217 | Ga0070660_1008312172 | 84 |
| 111 | 3300005344 | Ga0070661_100023380 | Ga0070661_1000233805 | 84 |
| 112 | 3300005355 | Ga0070671_100207927 | Ga0070671_1002079272 | 84 |
| 113 | 3300005366 | Ga0070659_100013488 | Ga0070659_1000134885 | 84 |
| 114 | 3300005367 | Ga0070667_100096421 | Ga0070667_1000964213 | 84 |
| 115 | 3300005436 | Ga0070713_100193100 | Ga0070713_1001931003 | 84 |
| 116 | 3300005455 | Ga0070663_100393866 | Ga0070663_1003938663 | 84 |
| 117 | 3300005457 | Ga0070662_100789224 | Ga0070662_1007892241 | 84 |
| 118 | 3300005466 | Ga0070685_10559517 | Ga0070685_105595172 | 84 |
| 119 | 3300005530 | Ga0070679_101993241 | Ga0070679_1019932411 | 84 |
| 120 | 3300005539 | Ga0068853_100028090 | Ga0068853_1000280904 | 84 |
| 121 | 3300005539 | Ga0068853_102248699 | Ga0068853_1022486991 | 84 |
| 122 | 3300005543 | Ga0070672_100207081 | Ga0070672_1002070813 | 84 |
| 123 | 3300005563 | Ga0068855_100031330 | Ga0068855_1000313305 | 84 |
| 124 | 3300005563 | Ga0068855_100501765 | Ga0068855_1005017653 | 84 |
| 125 | 3300005577 | Ga0068857_100021798 | Ga0068857_1000217982 | 84 |
| 126 | 3300005577 | Ga0068857_100249321 | Ga0068857_1002493212 | 84 |
| 127 | 3300005578 | Ga0068854_100405067 | Ga0068854_1004050672 | 84 |
| 128 | 3300005614 | Ga0068856_100344429 | Ga0068856_1003444291 | 84 |
| 129 | 3300005614 | Ga0068856_101781922 | Ga0068856_1017819221 | 84 |
| 130 | 3300005615 | Ga0070702_101405681 | Ga0070702_1014056811 | 84 |
| 131 | 3300005616 | Ga0068852_100017671 | Ga0068852_1000176712 | 84 |
| 132 | 3300005616 | Ga0068852_100066070 | Ga0068852_1000660702 | 84 |
| 133 | 3300005617 | Ga0068859_100052312 | Ga0068859_1000523124 | 84 |
| 134 | 3300005834 | Ga0068851_10000174 | Ga0068851_100001748 | 84 |
| 135 | 3300005841 | Ga0068863_100252035 | Ga0068863_1002520352 | 84 |
| 136 | 3300005841 | Ga0068863_101873710 | Ga0068863_1018737102 | 84 |
| 137 | 3300005937 | Ga0081455_10003134 | Ga0081455_1000313411 | 84 |
| 138 | 3300005937 | Ga0081455_10014161 | Ga0081455_100141612 | 84 |
| 139 | 3300006028 | Ga0070717_10887028 | Ga0070717_108870282 | 84 |
| 140 | 3300006038 | Ga0075365_10579281 | Ga0075365_105792812 | 84 |
| 141 | 3300006173 | Ga0070716_101514141 | Ga0070716_1015141412 | 84 |
| 142 | 3300006931 | Ga0097620_100052313 | Ga0097620_1000523134 | 84 |
| 143 | 3300009093 | Ga0105240_10005074 | Ga0105240_1000507422 | 84 |
| 144 | 3300009093 | Ga0105240_11267102 | Ga0105240_112671022 | 84 |
| 145 | 3300009098 | Ga0105245_10032365 | Ga0105245_100323655 | 84 |
| 146 | 3300009101 | Ga0105247_10377835 | Ga0105247_103778352 | 84 |
| 147 | 3300009101 | Ga0105247_11733047 | Ga0105247_117330471 | 84 |
| 148 | 3300009148 | Ga0105243_11176410 | Ga0105243_111764102 | 84 |
| 149 | 3300009174 | Ga0105241_10010709 | Ga0105241_100107096 | 84 |
| 150 | 3300009174 | Ga0105241_10345131 | Ga0105241_103451313 | 84 |
| 151 | 3300009545 | Ga0105237_10000660 | Ga0105237_1000066048 | 84 |
| 152 | 3300009545 | Ga0105237_10182819 | Ga0105237_101828192 | 84 |
| 153 | 3300009545 | Ga0105237_11649273 | Ga0105237_116492732 | 84 |
| 154 | 3300009551 | Ga0105238_10006538 | Ga0105238_100065389 | 84 |
| 155 | 3300009553 | Ga0105249_12375663 | Ga0105249_123756631 | 84 |
| 156 | 3300010375 | Ga0105239_10230657 | Ga0105239_102306575 | 84 |
| 157 | 3300010375 | Ga0105239_11108833 | Ga0105239_111088332 | 84 |
| 158 | 3300011119 | Ga0105246_10734437 | Ga0105246_107344373 | 84 |
| 159 | 3300013104 | Ga0157370_10312667 | Ga0157370_103126672 | 84 |
| 160 | 3300013105 | Ga0157369_10488439 | Ga0157369_104884392 | 84 |
| 161 | 3300013105 | Ga0157369_10751155 | Ga0157369_107511551 | 84 |
| 162 | 3300013296 | Ga0157374_11406583 | Ga0157374_114065832 | 84 |
| 163 | 3300013296 | Ga0157374_11948036 | Ga0157374_119480362 | 84 |
| 164 | 3300013306 | Ga0163162_11130635 | Ga0163162_111306352 | 84 |
| 165 | 3300013307 | Ga0157372_11232771 | Ga0157372_112327712 | 84 |
| 166 | 3300014325 | Ga0163163_10027908 | Ga0163163_100279086 | 84 |
| 167 | 3300014326 | Ga0157380_11512147 | Ga0157380_115121472 | 84 |
| 168 | 3300014968 | Ga0157379_10023926 | Ga0157379_100239262 | 84 |
| 169 | 3300014969 | Ga0157376_10510567 | Ga0157376_105105672 | 84 |
| 170 | 3300020069 | Ga0197907_10326987 | Ga0197907_103269872 | 84 |
| 171 | 3300020069 | Ga0197907_10854447 | Ga0197907_108544471 | 84 |
| 172 | 3300020069 | Ga0197907_10912036 | Ga0197907_109120361 | 84 |
| 173 | 3300020069 | Ga0197907_10935291 | Ga0197907_109352912 | 84 |
| 174 | 3300020070 | Ga0206356_10978583 | Ga0206356_109785831 | 84 |
| 175 | 3300020076 | Ga0206355_1014107 | Ga0206355_10141072 | 84 |
| 176 | 3300020076 | Ga0206355_1276013 | Ga0206355_12760132 | 84 |
| 177 | 3300020076 | Ga0206355_1665678 | Ga0206355_16656782 | 84 |
| 178 | 3300020077 | Ga0206351_10773028 | Ga0206351_107730281 | 84 |
| 179 | 3300020077 | Ga0206351_10924608 | Ga0206351_109246082 | 84 |
| 180 | 3300020078 | Ga0206352_10090527 | Ga0206352_100905272 | 84 |
| 181 | 3300020080 | Ga0206350_10430210 | Ga0206350_104302101 | 84 |
| 182 | 3300020080 | Ga0206350_11165638 | Ga0206350_111656382 | 84 |
| 183 | 3300020080 | Ga0206350_11364143 | Ga0206350_113641431 | 84 |
| 184 | 3300020080 | Ga0206350_11438219 | Ga0206350_114382192 | 84 |
| 185 | 3300020081 | Ga0206354_10694027 | Ga0206354_106940271 | 84 |
| 186 | 3300020082 | Ga0206353_10903616 | Ga0206353_109036162 | 84 |
| 187 | 3300020610 | Ga0154015_1053277 | Ga0154015_10532772 | 84 |
| 188 | 3300020610 | Ga0154015_1157237 | Ga0154015_11572372 | 84 |
| 189 | 3300020610 | Ga0154015_1250307 | Ga0154015_12503073 | 84 |
| 190 | 3300020610 | Ga0154015_1310473 | Ga0154015_13104732 | 84 |
| 191 | 3300020610 | Ga0154015_1416389 | Ga0154015_14163892 | 84 |
| 192 | 3300022467 | Ga0224712_10369055 | Ga0224712_103690551 | 84 |
| 193 | 3300022467 | Ga0224712_10369422 | Ga0224712_103694221 | 84 |
| 194 | 3300025254 | Ga0209148_1000624 | Ga0209148_100062423 | 84 |
| 195 | 3300025321 | Ga0207656_10000002 | Ga0207656_10000002243 | 84 |
| 196 | 3300025900 | Ga0207710_10169267 | Ga0207710_101692672 | 84 |
| 197 | 3300025909 | Ga0207705_10054040 | Ga0207705_100540402 | 84 |
| 198 | 3300025909 | Ga0207705_10426787 | Ga0207705_104267872 | 84 |
| 199 | 3300025909 | Ga0207705_11112833 | Ga0207705_111128331 | 84 |
| 200 | 3300025911 | Ga0207654_10000001 | Ga0207654_100000011612 | 84 |
| 201 | 3300025911 | Ga0207654_11260105 | Ga0207654_112601051 | 84 |
| 202 | 3300025913 | Ga0207695_10021351 | Ga0207695_100213515 | 84 |
| 203 | 3300025913 | Ga0207695_10022892 | Ga0207695_100228922 | 84 |
| 204 | 3300025913 | Ga0207695_10720620 | Ga0207695_107206201 | 84 |
| 205 | 3300025914 | Ga0207671_10000002 | Ga0207671_10000002537 | 84 |
| 206 | 3300025914 | Ga0207671_10044467 | Ga0207671_100444675 | 84 |
| 207 | 3300025919 | Ga0207657_10010777 | Ga0207657_100107773 | 84 |
| 208 | 3300025920 | Ga0207649_10032826 | Ga0207649_100328265 | 84 |
| 209 | 3300025924 | Ga0207694_10000153 | Ga0207694_1000015344 | 84 |
| 210 | 3300025924 | Ga0207694_10040322 | Ga0207694_100403225 | 84 |
| 211 | 3300025926 | Ga0207659_10906264 | Ga0207659_109062642 | 84 |
| 212 | 3300025927 | Ga0207687_10020899 | Ga0207687_100208992 | 84 |
| 213 | 3300025927 | Ga0207687_10029146 | Ga0207687_100291462 | 84 |
| 214 | 3300025928 | Ga0207700_10976598 | Ga0207700_109765982 | 84 |
| 215 | 3300025932 | Ga0207690_10020759 | Ga0207690_100207595 | 84 |
| 216 | 3300025935 | Ga0207709_10885638 | Ga0207709_108856382 | 84 |
| 217 | 3300025938 | Ga0207704_10853159 | Ga0207704_108531592 | 84 |
| 218 | 3300025940 | Ga0207691_10217438 | Ga0207691_102174382 | 84 |
| 219 | 3300025941 | Ga0207711_10063716 | Ga0207711_100637165 | 84 |
| 220 | 3300025949 | Ga0207667_10054976 | Ga0207667_100549765 | 84 |
| 221 | 3300025949 | Ga0207667_10189711 | Ga0207667_101897113 | 84 |
| 222 | 3300025949 | Ga0207667_10266651 | Ga0207667_102666511 | 84 |
| 223 | 3300025986 | Ga0207658_10020806 | Ga0207658_100208063 | 84 |
| 224 | 3300026023 | Ga0207677_10020605 | Ga0207677_100206053 | 84 |
| 225 | 3300026023 | Ga0207677_10124572 | Ga0207677_101245723 | 84 |
| 226 | 3300026035 | Ga0207703_10000031 | Ga0207703_10000031118 | 84 |
| 227 | 3300026041 | Ga0207639_10022174 | Ga0207639_100221741 | 84 |
| 228 | 3300026067 | Ga0207678_10623151 | Ga0207678_106231512 | 84 |
| 229 | 3300026078 | Ga0207702_10053773 | Ga0207702_100537732 | 84 |
| 230 | 3300026088 | Ga0207641_10253188 | Ga0207641_102531881 | 84 |
| 231 | 3300026088 | Ga0207641_12452901 | Ga0207641_124529012 | 84 |
| 232 | 3300026116 | Ga0207674_10059775 | Ga0207674_100597752 | 84 |
| 233 | 3300026116 | Ga0207674_10229669 | Ga0207674_102296692 | 84 |
| 234 | 3300026142 | Ga0207698_10140748 | Ga0207698_101407482 | 84 |
| 235 | 3300026142 | Ga0207698_10640032 | Ga0207698_106400322 | 84 |
| 236 | 3300028381 | Ga0268264_11402415 | Ga0268264_114024152 | 84 |
| 237 | 3300028794 | Ga0307515_10483612 | Ga0307515_104836123 | 84 |
| 238 | 3300031691 | Ga0316579_10121107 | Ga0316579_101211072 | 84 |
| 239 | 3300031727 | Ga0316576_10046810 | Ga0316576_100468103 | 84 |
| 240 | 3300031733 | Ga0316577_10150171 | Ga0316577_101501713 | 84 |
| 241 | 3300032004 | Ga0307414_11262500 | Ga0307414_112625002 | 84 |
| 242 | 3300032133 | Ga0316583_10157169 | Ga0316583_101571691 | 84 |
| 243 | 3300032168 | Ga0316593_10116587 | Ga0316593_101165872 | 84 |
| 244 | 3300033524 | Ga0316592_1100203 | Ga0316592_11002032 | 84 |
| 245 | 3300033528 | Ga0316588_1157459 | Ga0316588_11574591 | 84 |
| 246 | 3300033541 | Ga0316596_1030137 | Ga0316596_10301373 | 84 |
| 247 | 3300035398 | Ga0316574_0136834 | Ga0316574_0136834_685_945 | 84 |
| 248 | 3300036647 | Ga0316582_0673026 | Ga0316582_0673026_423_683 | 84 |
| 249 | 3300036712 | Ga0316584_0001267 | Ga0316584_0001267_2435_2695 | 84 |
| 250 | 3300037418 | Ga0395900_0017198 | Ga0395900_0017198_3299_3553 | 84 |
| 251 | 3300037466 | Ga0395898_0346737 | Ga0395898_0346737_452_706 | 84 |
| 252 | 3300041459 | Ga0451800_1058039 | Ga0451800_1058039_236_490 | 84 |
| 253 | 3300041486 | Ga0451807_2621320 | Ga0451807_2621320_93_347 | 84 |
| 254 | 3300041494 | Ga0451837_0160140 | Ga0451837_0160140_100_354 | 84 |
| 255 | 3300041498 | Ga0451841_0315296 | Ga0451841_0315296_92_346 | 84 |
| 256 | 3300041509 | Ga0451843_0176465 | Ga0451843_0176465_136_390 | 84 |
| 257 | 3300041509 | Ga0451843_1745894 | Ga0451843_1745894_190_444 | 84 |
| 258 | 3300041512 | Ga0451853_0057221 | Ga0451853_0057221_2803_3057 | 84 |
| 259 | 3300041512 | Ga0451853_2624360 | Ga0451853_2624360_91_345 | 84 |
| 260 | 3300044683 | Ga0466965_0161261 | Ga0466965_0161261_257_511 | 84 |
| 261 | 3300044683 | Ga0466965_0422065 | Ga0466965_0422065_352_606 | 84 |
| 262 | 3300044712 | Ga0453684_0837163 | Ga0453684_0837163_94_348 | 84 |
| 263 | 3300044719 | Ga0466971_0246736 | Ga0466971_0246736_268_522 | 84 |
| 264 | 3300044901 | Ga0466960_0977053 | Ga0466960_0977053_58_312 | 84 |
| 265 | 3300045976 | Ga0466967_0987869 | Ga0466967_0987869_266_520 | 84 |
| 266 | 3300046471 | Ga0495650_0024978 | Ga0495650_0024978_649_909 | 84 |
| 267 | 3300048914 | Ga0496111_0685254 | Ga0496111_0685254_98_352 | 84 |
| 268 | 3300048915 | Ga0496112_1614501 | Ga0496112_1614501_282_536 | 84 |
| 269 | 3300048917 | Ga0496114_0063976 | Ga0496114_0063976_2682_2936 | 84 |
| 270 | 3300048917 | Ga0496114_1141878 | Ga0496114_1141878_266_520 | 84 |
| 271 | 3300048917 | Ga0496114_1271347 | Ga0496114_1271347_229_483 | 84 |
| 272 | 3300048920 | Ga0496117_0034093 | Ga0496117_0034093_3397_3651 | 84 |
| 273 | 3300048921 | Ga0496118_0454331 | Ga0496118_0454331_207_461 | 84 |
| 274 | 3300048922 | Ga0496119_0002920 | Ga0496119_0002920_11705_11959 | 84 |
| 275 | 3300048922 | Ga0496119_0106653 | Ga0496119_0106653_904_1158 | 84 |
| 276 | 3300048923 | Ga0496120_0002418 | Ga0496120_0002418_14442_14696 | 84 |
| 277 | 3300048923 | Ga0496120_0018423 | Ga0496120_0018423_1068_1322 | 84 |
| 278 | 3300048923 | Ga0496120_0026291 | Ga0496120_0026291_1267_1521 | 84 |
| 279 | 3300048923 | Ga0496120_0149235 | Ga0496120_0149235_136_390 | 84 |
| 280 | 3300048925 | Ga0496122_0001750 | Ga0496122_0001750_27663_27917 | 84 |
| 281 | 3300048926 | Ga0496123_0003716 | Ga0496123_0003716_8086_8340 | 84 |
| 282 | 3300048929 | Ga0496126_0083076 | Ga0496126_0083076_1988_2242 | 84 |
| 283 | 3300049533 | Ga0501317_036146 | Ga0501317_036146_466_720 | 84 |
| 284 | 3300049533 | Ga0501317_061733 | Ga0501317_061733_351_605 | 84 |
| 285 | 3300049568 | Ga0501031_0005342 | Ga0501031_0005342_1105_1359 | 84 |
| 286 | 3300049569 | Ga0501032_0068474 | Ga0501032_0068474_2041_2295 | 84 |
| 287 | 3300049569 | Ga0501032_0095790 | Ga0501032_0095790_434_688 | 84 |
| 288 | 3300049569 | Ga0501032_0161073 | Ga0501032_0161073_75_329 | 84 |
| 289 | 3300049570 | Ga0501033_0072472 | Ga0501033_0072472_673_927 | 84 |
| 290 | 3300049570 | Ga0501033_0717353 | Ga0501033_0717353_330_584 | 84 |
| 291 | 3300049571 | Ga0501034_0037990 | Ga0501034_0037990_306_560 | 84 |
| 292 | 3300049571 | Ga0501034_0970943 | Ga0501034_0970943_13_267 | 84 |
| 293 | 3300049571 | Ga0501034_1714836 | Ga0501034_1714836_172_426 | 84 |
| 294 | 3300049572 | Ga0501036_0087292 | Ga0501036_0087292_47_301 | 84 |
| 295 | 3300049572 | Ga0501036_0158878 | Ga0501036_0158878_1579_1833 | 84 |
| 296 | 3300049573 | Ga0501037_0025811 | Ga0501037_0025811_219_473 | 84 |
| 297 | 3300049573 | Ga0501037_0034216 | Ga0501037_0034216_3436_3690 | 84 |
| 298 | 3300049573 | Ga0501037_0053602 | Ga0501037_0053602_702_956 | 84 |
| 299 | 3300049574 | Ga0501038_0014449 | Ga0501038_0014449_2198_2452 | 84 |
| 300 | 3300049574 | Ga0501038_0284053 | Ga0501038_0284053_931_1185 | 84 |
| 301 | 3300049575 | Ga0501039_0011177 | Ga0501039_0011177_6446_6700 | 84 |
| 302 | 3300049575 | Ga0501039_0086806 | Ga0501039_0086806_1223_1477 | 84 |
| 303 | 3300049577 | Ga0501041_0942164 | Ga0501041_0942164_223_477 | 84 |
| 304 | 3300049578 | Ga0501042_0095433 | Ga0501042_0095433_769_1023 | 84 |
| 305 | 3300049578 | Ga0501042_1051445 | Ga0501042_1051445_65_319 | 84 |
| 306 | 3300049579 | Ga0501043_0010788 | Ga0501043_0010788_6834_7088 | 84 |
| 307 | 3300049579 | Ga0501043_0115130 | Ga0501043_0115130_1513_1767 | 84 |
| 308 | 3300049579 | Ga0501043_0178628 | Ga0501043_0178628_1349_1603 | 84 |
| 309 | 3300049580 | Ga0501046_0010145 | Ga0501046_0010145_4107_4361 | 84 |
| 310 | 3300049580 | Ga0501046_0771402 | Ga0501046_0771402_215_469 | 84 |
| 311 | 3300049581 | Ga0501047_0245072 | Ga0501047_0245072_75_329 | 84 |
| 312 | 3300049581 | Ga0501047_0266290 | Ga0501047_0266290_1232_1486 | 84 |
| 313 | 3300049581 | Ga0501047_0958811 | Ga0501047_0958811_295_549 | 84 |
| 314 | 3300049582 | Ga0501048_0023082 | Ga0501048_0023082_1840_2094 | 84 |
| 315 | 3300049582 | Ga0501048_0591621 | Ga0501048_0591621_111_365 | 84 |
| 316 | 3300049583 | Ga0501067_0083654 | Ga0501067_0083654_726_983 | 84 |
| 317 | 3300049583 | Ga0501067_0153901 | Ga0501067_0153901_274_528 | 84 |
| 318 | 3300049583 | Ga0501067_0502075 | Ga0501067_0502075_313_567 | 84 |
| 319 | 3300049584 | Ga0501068_0182487 | Ga0501068_0182487_287_541 | 84 |
| 320 | 3300049584 | Ga0501068_0277994 | Ga0501068_0277994_77_334 | 84 |
| 321 | 3300049585 | Ga0501069_0018628 | Ga0501069_0018628_1985_2239 | 84 |
| 322 | 3300049586 | Ga0501070_0180838 | Ga0501070_0180838_1373_1627 | 84 |
| 323 | 3300049587 | Ga0501071_0478029 | Ga0501071_0478029_177_431 | 84 |
| 324 | 3300049589 | Ga0501073_0027393 | Ga0501073_0027393_3634_3888 | 84 |
| 325 | 3300049589 | Ga0501073_0354250 | Ga0501073_0354250_26_280 | 84 |
| 326 | 3300049590 | Ga0501074_1259389 | Ga0501074_1259389_92_346 | 84 |
| 327 | 3300049592 | Ga0501076_0431158 | Ga0501076_0431158_379_633 | 84 |
| 328 | 3300049741 | Ga0501079_0111553 | Ga0501079_0111553_983_1237 | 84 |
| 329 | 3300049742 | Ga0501080_0021682 | Ga0501080_0021682_1242_1496 | 84 |
| 330 | 3300049743 | Ga0501081_0316629 | Ga0501081_0316629_364_618 | 84 |
| 331 | 3300049822 | Ga0501035_0215456 | Ga0501035_0215456_75_329 | 84 |
| 332 | 3300049822 | Ga0501035_0467071 | Ga0501035_0467071_311_565 | 84 |
| 333 | 3300049822 | Ga0501035_1376757 | Ga0501035_1376757_213_467 | 84 |
| 334 | 3300049823 | Ga0501044_0042949 | Ga0501044_0042949_4370_4624 | 84 |
| 335 | 3300049823 | Ga0501044_1628706 | Ga0501044_1628706_100_354 | 84 |
| 336 | 3300049824 | Ga0501045_0473750 | Ga0501045_0473750_106_360 | 84 |
| 337 | 3300053136 | Ga0500559_0016386 | Ga0500559_0016386_1382_1636 | 84 |
| 338 | 3300053140 | Ga0500573_0369953 | Ga0500573_0369953_132_386 | 84 |
| 339 | 3300053155 | Ga0500620_000031 | Ga0500620_000031_12395_12649 | 84 |
| 340 | 3300054114 | Ga0501084_0476250 | Ga0501084_0476250_299_553 | 84 |
| 341 | 3300059490 | Ga0587066_073211 | Ga0587066_073211_19_273 | 84 |
| 342 | 3300059490 | Ga0587066_080776 | Ga0587066_080776_166_420 | 84 |
| 343 | 3300059491 | Ga0587070_056282 | Ga0587070_056282_92_346 | 84 |
| 344 | 3300059492 | Ga0587073_0242641 | Ga0587073_0242641_127_381 | 84 |
| 345 | 3300059493 | Ga0587077_102352 | Ga0587077_102352_29_283 | 84 |
| 346 | 3300059507 | Ga0587086_015905 | Ga0587086_015905_392_646 | 84 |
| 347 | 3300059508 | Ga0587088_031686 | Ga0587088_031686_55_309 | 84 |
| 348 | 3300059509 | Ga0587089_042758 | Ga0587089_042758_427_681 | 84 |
| 349 | 3300059509 | Ga0587089_109428 | Ga0587089_109428_226_480 | 84 |
| 350 | 3300059511 | Ga0587091_026687 | Ga0587091_026687_414_668 | 84 |
| 351 | 3300059604 | Ga0587098_034335 | Ga0587098_034335_18_272 | 84 |
| 352 | 3300059605 | Ga0587106_035625 | Ga0587106_035625_409_663 | 84 |
| 353 | 3300059605 | Ga0587106_149983 | Ga0587106_149983_126_380 | 84 |
| 354 | 3300059608 | Ga0587129_023990 | Ga0587129_023990_209_463 | 84 |
| 355 | 3300059623 | Ga0587101_039922 | Ga0587101_039922_87_341 | 84 |
| 356 | 3300059623 | Ga0587101_106997 | Ga0587101_106997_218_472 | 84 |
| 357 | 3300059626 | Ga0587115_042285 | Ga0587115_042285_282_536 | 84 |
| 358 | 3300059641 | Ga0587068_073356 | Ga0587068_073356_21_275 | 84 |
| 359 | 3300059642 | Ga0587069_024639 | Ga0587069_024639_285_539 | 84 |
| 360 | 3300059646 | Ga0587078_089476 | Ga0587078_089476_92_346 | 84 |
| 361 | 3300059647 | Ga0587079_051091 | Ga0587079_051091_169_423 | 84 |
| 362 | 3300059647 | Ga0587079_076662 | Ga0587079_076662_477_731 | 84 |
| 363 | 3300059650 | Ga0587104_009990 | Ga0587104_009990_405_659 | 84 |
| 364 | 3300060344 | Ga0587071_040609 | Ga0587071_040609_282_536 | 84 |
| 365 | 3300060346 | Ga0587111_0096733 | Ga0587111_0096733_95_349 | 84 |
| 366 | 3300060353 | Ga0501082_0706465 | Ga0501082_0706465_516_770 | 84 |
| 367 | 3300061719 | Ga0466962_0590282 | Ga0466962_0590282_54_308 | 84 |
| 368 | 3300001989 | JGI24739J22299_10073607 | JGI24739J22299_100736073 | 85 |
| 369 | 3300001991 | JGI24743J22301_10010175 | JGI24743J22301_100101753 | 85 |
| 370 | 3300002067 | JGI24735J21928_10084376 | JGI24735J21928_100843761 | 85 |
| 371 | 3300002738 | JGI25154J39366_1001284 | JGI25154J39366_100128410 | 85 |
| 372 | 3300003162 | Ga0006778J45830_1015710 | Ga0006778J45830_10157102 | 85 |
| 373 | 3300003373 | JGI25407J50210_10190372 | JGI25407J50210_101903722 | 85 |
| 374 | 3300003544 | Ga0007417J51691_1012460 | Ga0007417J51691_10124602 | 85 |
| 375 | 3300003559 | Ga0007427J51700_111594 | Ga0007427J51700_1115942 | 85 |
| 376 | 3300003574 | Ga0007410J51695_1024883 | Ga0007410J51695_10248832 | 85 |
| 377 | 3300003574 | Ga0007410J51695_1028109 | Ga0007410J51695_10281092 | 85 |
| 378 | 3300003693 | Ga0032354_1026694 | Ga0032354_10266942 | 85 |
| 379 | 3300004785 | Ga0058858_1426826 | Ga0058858_14268262 | 85 |
| 380 | 3300004798 | Ga0058859_11241572 | Ga0058859_112415721 | 85 |
| 381 | 3300004799 | Ga0058863_11633219 | Ga0058863_116332191 | 85 |
| 382 | 3300004800 | Ga0058861_11584081 | Ga0058861_115840811 | 85 |
| 383 | 3300004801 | Ga0058860_12151711 | Ga0058860_121517111 | 85 |
| 384 | 3300005293 | Ga0065715_10795225 | Ga0065715_107952251 | 85 |
| 385 | 3300005333 | Ga0070677_10882910 | Ga0070677_108829101 | 85 |
| 386 | 3300005334 | Ga0068869_100115301 | Ga0068869_1001153011 | 85 |
| 387 | 3300005337 | Ga0070682_100259104 | Ga0070682_1002591042 | 85 |
| 388 | 3300005337 | Ga0070682_100570786 | Ga0070682_1005707861 | 85 |
| 389 | 3300005339 | Ga0070660_100596074 | Ga0070660_1005960742 | 85 |
| 390 | 3300005343 | Ga0070687_100394995 | Ga0070687_1003949952 | 85 |
| 391 | 3300005344 | Ga0070661_100067572 | Ga0070661_1000675723 | 85 |
| 392 | 3300005347 | Ga0070668_100483203 | Ga0070668_1004832032 | 85 |
| 393 | 3300005347 | Ga0070668_100770527 | Ga0070668_1007705272 | 85 |
| 394 | 3300005356 | Ga0070674_100407309 | Ga0070674_1004073092 | 85 |
| 395 | 3300005356 | Ga0070674_100796350 | Ga0070674_1007963501 | 85 |
| 396 | 3300005365 | Ga0070688_100167655 | Ga0070688_1001676551 | 85 |
| 397 | 3300005367 | Ga0070667_100181210 | Ga0070667_1001812102 | 85 |
| 398 | 3300005367 | Ga0070667_100587386 | Ga0070667_1005873862 | 85 |
| 399 | 3300005441 | Ga0070700_100858929 | Ga0070700_1008589291 | 85 |
| 400 | 3300005455 | Ga0070663_100255275 | Ga0070663_1002552752 | 85 |
| 401 | 3300005455 | Ga0070663_100300989 | Ga0070663_1003009892 | 85 |
| 402 | 3300005455 | Ga0070663_101184557 | Ga0070663_1011845571 | 85 |
| 403 | 3300005456 | Ga0070678_100231487 | Ga0070678_1002314872 | 85 |
| 404 | 3300005457 | Ga0070662_101528167 | Ga0070662_1015281671 | 85 |
| 405 | 3300005458 | Ga0070681_10546975 | Ga0070681_105469751 | 85 |
| 406 | 3300005458 | Ga0070681_10850130 | Ga0070681_108501301 | 85 |
| 407 | 3300005466 | Ga0070685_10047048 | Ga0070685_100470483 | 85 |
| 408 | 3300005467 | Ga0070706_101630657 | Ga0070706_1016306571 | 85 |
| 409 | 3300005536 | Ga0070697_100121856 | Ga0070697_1001218564 | 85 |
| 410 | 3300005539 | Ga0068853_100052946 | Ga0068853_1000529462 | 85 |
| 411 | 3300005539 | Ga0068853_102058853 | Ga0068853_1020588531 | 85 |
| 412 | 3300005545 | Ga0070695_100147064 | Ga0070695_1001470642 | 85 |
| 413 | 3300005546 | Ga0070696_100044500 | Ga0070696_1000445002 | 85 |
| 414 | 3300005547 | Ga0070693_100150524 | Ga0070693_1001505241 | 85 |
| 415 | 3300005548 | Ga0070665_100027879 | Ga0070665_1000278795 | 85 |
| 416 | 3300005549 | Ga0070704_100119640 | Ga0070704_1001196402 | 85 |
| 417 | 3300005563 | Ga0068855_100030427 | Ga0068855_1000304272 | 85 |
| 418 | 3300005563 | Ga0068855_100056300 | Ga0068855_1000563004 | 85 |
| 419 | 3300005564 | Ga0070664_100683268 | Ga0070664_1006832683 | 85 |
| 420 | 3300005578 | Ga0068854_100102323 | Ga0068854_1001023233 | 85 |
| 421 | 3300005578 | Ga0068854_100660295 | Ga0068854_1006602952 | 85 |
| 422 | 3300005614 | Ga0068856_101823740 | Ga0068856_1018237402 | 85 |
| 423 | 3300005614 | Ga0068856_102531017 | Ga0068856_1025310171 | 85 |
| 424 | 3300005618 | Ga0068864_100148152 | Ga0068864_1001481524 | 85 |
| 425 | 3300005840 | Ga0068870_11008324 | Ga0068870_110083241 | 85 |
| 426 | 3300005840 | Ga0068870_11415049 | Ga0068870_114150491 | 85 |
| 427 | 3300005841 | Ga0068863_100056137 | Ga0068863_1000561373 | 85 |
| 428 | 3300005843 | Ga0068860_100001180 | Ga0068860_10000118019 | 85 |
| 429 | 3300005843 | Ga0068860_100086873 | Ga0068860_1000868734 | 85 |
| 430 | 3300005843 | Ga0068860_100424812 | Ga0068860_1004248122 | 85 |
| 431 | 3300005981 | Ga0081538_10048190 | Ga0081538_100481901 | 85 |
| 432 | 3300006028 | Ga0070717_10109999 | Ga0070717_101099992 | 85 |
| 433 | 3300006038 | Ga0075365_10111041 | Ga0075365_101110413 | 85 |
| 434 | 3300006038 | Ga0075365_10262019 | Ga0075365_102620192 | 85 |
| 435 | 3300006042 | Ga0075368_10101365 | Ga0075368_101013653 | 85 |
| 436 | 3300006042 | Ga0075368_10359718 | Ga0075368_103597182 | 85 |
| 437 | 3300006048 | Ga0075363_100011874 | Ga0075363_1000118741 | 85 |
| 438 | 3300006048 | Ga0075363_100272113 | Ga0075363_1002721131 | 85 |
| 439 | 3300006048 | Ga0075363_100990878 | Ga0075363_1009908781 | 85 |
| 440 | 3300006051 | Ga0075364_10028577 | Ga0075364_100285773 | 85 |
| 441 | 3300006051 | Ga0075364_10217284 | Ga0075364_102172842 | 85 |
| 442 | 3300006051 | Ga0075364_10759428 | Ga0075364_107594282 | 85 |
| 443 | 3300006163 | Ga0070715_10828491 | Ga0070715_108284912 | 85 |
| 444 | 3300006178 | Ga0075367_10000695 | Ga0075367_100006959 | 85 |
| 445 | 3300006178 | Ga0075367_10192528 | Ga0075367_101925282 | 85 |
| 446 | 3300006186 | Ga0075369_10000991 | Ga0075369_100009917 | 85 |
| 447 | 3300006186 | Ga0075369_10013993 | Ga0075369_100139933 | 85 |
| 448 | 3300006186 | Ga0075369_10639133 | Ga0075369_106391331 | 85 |
| 449 | 3300006195 | Ga0075366_10569042 | Ga0075366_105690422 | 85 |
| 450 | 3300006237 | Ga0097621_101678718 | Ga0097621_1016787181 | 85 |
| 451 | 3300006353 | Ga0075370_10004480 | Ga0075370_100044807 | 85 |
| 452 | 3300006353 | Ga0075370_10188480 | Ga0075370_101884801 | 85 |
| 453 | 3300006353 | Ga0075370_10504242 | Ga0075370_105042422 | 85 |
| 454 | 3300006353 | Ga0075370_10819922 | Ga0075370_108199222 | 85 |
| 455 | 3300006881 | Ga0068865_101940892 | Ga0068865_1019408922 | 85 |
| 456 | 3300009011 | Ga0105251_10087257 | Ga0105251_100872572 | 85 |
| 457 | 3300009036 | Ga0105244_10056209 | Ga0105244_100562092 | 85 |
| 458 | 3300009036 | Ga0105244_10102657 | Ga0105244_101026572 | 85 |
| 459 | 3300009093 | Ga0105240_10078100 | Ga0105240_100781005 | 85 |
| 460 | 3300009093 | Ga0105240_11791100 | Ga0105240_117911002 | 85 |
| 461 | 3300009094 | Ga0111539_11700456 | Ga0111539_117004562 | 85 |
| 462 | 3300009174 | Ga0105241_10320648 | Ga0105241_103206482 | 85 |
| 463 | 3300009174 | Ga0105241_10902309 | Ga0105241_109023092 | 85 |
| 464 | 3300009176 | Ga0105242_10703009 | Ga0105242_107030092 | 85 |
| 465 | 3300009545 | Ga0105237_10061574 | Ga0105237_100615742 | 85 |
| 466 | 3300009545 | Ga0105237_10108611 | Ga0105237_101086114 | 85 |
| 467 | 3300009551 | Ga0105238_10141262 | Ga0105238_101412624 | 85 |
| 468 | 3300009987 | Ga0105030_113292 | Ga0105030_1132921 | 85 |
| 469 | 3300010375 | Ga0105239_10627199 | Ga0105239_106271993 | 85 |
| 470 | 3300011119 | Ga0105246_10092415 | Ga0105246_100924154 | 85 |
| 471 | 3300012478 | Ga0157328_1005549 | Ga0157328_10055492 | 85 |
| 472 | 3300012507 | Ga0157342_1068135 | Ga0157342_10681351 | 85 |
| 473 | 3300013104 | Ga0157370_10032625 | Ga0157370_100326252 | 85 |
| 474 | 3300013104 | Ga0157370_10056334 | Ga0157370_100563343 | 85 |
| 475 | 3300013105 | Ga0157369_10042192 | Ga0157369_100421926 | 85 |
| 476 | 3300013105 | Ga0157369_10330001 | Ga0157369_103300012 | 85 |
| 477 | 3300013105 | Ga0157369_10906875 | Ga0157369_109068752 | 85 |
| 478 | 3300013250 | Ga0171462_1003 | Ga0171462_1003330 | 85 |
| 479 | 3300013306 | Ga0163162_10010190 | Ga0163162_1001019010 | 85 |
| 480 | 3300013306 | Ga0163162_10140160 | Ga0163162_101401603 | 85 |
| 481 | 3300013306 | Ga0163162_10425353 | Ga0163162_104253534 | 85 |
| 482 | 3300013307 | Ga0157372_10716384 | Ga0157372_107163842 | 85 |
| 483 | 3300013307 | Ga0157372_11595936 | Ga0157372_115959362 | 85 |
| 484 | 3300013308 | Ga0157375_11348787 | Ga0157375_113487872 | 85 |
| 485 | 3300013308 | Ga0157375_11617684 | Ga0157375_116176841 | 85 |
| 486 | 3300014326 | Ga0157380_10027310 | Ga0157380_100273103 | 85 |
| 487 | 3300014326 | Ga0157380_13187689 | Ga0157380_131876891 | 85 |
| 488 | 3300014745 | Ga0157377_10132403 | Ga0157377_101324033 | 85 |
| 489 | 3300014745 | Ga0157377_10663261 | Ga0157377_106632612 | 85 |
| 490 | 3300014968 | Ga0157379_10017319 | Ga0157379_100173194 | 85 |
| 491 | 3300014968 | Ga0157379_12544100 | Ga0157379_125441001 | 85 |
| 492 | 3300014969 | Ga0157376_10365935 | Ga0157376_103659352 | 85 |
| 493 | 3300014969 | Ga0157376_11190019 | Ga0157376_111900192 | 85 |
| 494 | 3300017792 | Ga0163161_10754691 | Ga0163161_107546911 | 85 |
| 495 | 3300020070 | Ga0206356_11078444 | Ga0206356_110784442 | 85 |
| 496 | 3300020070 | Ga0206356_11307403 | Ga0206356_113074032 | 85 |
| 497 | 3300020070 | Ga0206356_11376106 | Ga0206356_113761062 | 85 |
| 498 | 3300020071 | Ga0206348_109438 | Ga0206348_1094381 | 85 |
| 499 | 3300020075 | Ga0206349_1061883 | Ga0206349_10618832 | 85 |
| 500 | 3300020075 | Ga0206349_1634353 | Ga0206349_16343532 | 85 |
| 501 | 3300020075 | Ga0206349_1930185 | Ga0206349_19301851 | 85 |
| 502 | 3300020076 | Ga0206355_1492312 | Ga0206355_14923122 | 85 |
| 503 | 3300020076 | Ga0206355_1716449 | Ga0206355_17164492 | 85 |
| 504 | 3300020077 | Ga0206351_10093022 | Ga0206351_100930222 | 85 |
| 505 | 3300020078 | Ga0206352_10675540 | Ga0206352_106755402 | 85 |
| 506 | 3300020078 | Ga0206352_10998634 | Ga0206352_109986342 | 85 |
| 507 | 3300020080 | Ga0206350_11217244 | Ga0206350_112172442 | 85 |
| 508 | 3300020081 | Ga0206354_10160236 | Ga0206354_101602362 | 85 |
| 509 | 3300020081 | Ga0206354_10402436 | Ga0206354_104024362 | 85 |
| 510 | 3300020081 | Ga0206354_10565015 | Ga0206354_105650151 | 85 |
| 511 | 3300020081 | Ga0206354_11544819 | Ga0206354_115448192 | 85 |
| 512 | 3300020082 | Ga0206353_11635006 | Ga0206353_116350062 | 85 |
| 513 | 3300020610 | Ga0154015_1239016 | Ga0154015_12390161 | 85 |
| 514 | 3300020610 | Ga0154015_1266277 | Ga0154015_12662771 | 85 |
| 515 | 3300021361 | Ga0213872_10356248 | Ga0213872_103562482 | 85 |
| 516 | 3300022467 | Ga0224712_10148613 | Ga0224712_101486132 | 85 |
| 517 | 3300022467 | Ga0224712_10189565 | Ga0224712_101895652 | 85 |
| 518 | 3300022467 | Ga0224712_10352643 | Ga0224712_103526431 | 85 |
| 519 | 3300025246 | Ga0209646_1000071 | Ga0209646_1000071121 | 85 |
| 520 | 3300025728 | Ga0207655_1003360 | Ga0207655_10033609 | 85 |
| 521 | 3300025735 | Ga0207713_1099531 | Ga0207713_10995312 | 85 |
| 522 | 3300025893 | Ga0207682_10470612 | Ga0207682_104706122 | 85 |
| 523 | 3300025898 | Ga0207692_10028262 | Ga0207692_100282622 | 85 |
| 524 | 3300025900 | Ga0207710_10032300 | Ga0207710_100323003 | 85 |
| 525 | 3300025905 | Ga0207685_10807095 | Ga0207685_108070952 | 85 |
| 526 | 3300025908 | Ga0207643_10464632 | Ga0207643_104646322 | 85 |
| 527 | 3300025908 | Ga0207643_10926238 | Ga0207643_109262381 | 85 |
| 528 | 3300025910 | Ga0207684_11283800 | Ga0207684_112838002 | 85 |
| 529 | 3300025912 | Ga0207707_11371392 | Ga0207707_113713922 | 85 |
| 530 | 3300025913 | Ga0207695_10173790 | Ga0207695_101737902 | 85 |
| 531 | 3300025915 | Ga0207693_10033430 | Ga0207693_100334304 | 85 |
| 532 | 3300025916 | Ga0207663_10321275 | Ga0207663_103212752 | 85 |
| 533 | 3300025917 | Ga0207660_11139543 | Ga0207660_111395432 | 85 |
| 534 | 3300025917 | Ga0207660_11169074 | Ga0207660_111690742 | 85 |
| 535 | 3300025918 | Ga0207662_10251634 | Ga0207662_102516343 | 85 |
| 536 | 3300025918 | Ga0207662_11299709 | Ga0207662_112997092 | 85 |
| 537 | 3300025919 | Ga0207657_11379855 | Ga0207657_113798552 | 85 |
| 538 | 3300025921 | Ga0207652_11793600 | Ga0207652_117936001 | 85 |
| 539 | 3300025924 | Ga0207694_10084470 | Ga0207694_100844702 | 85 |
| 540 | 3300025925 | Ga0207650_10831746 | Ga0207650_108317461 | 85 |
| 541 | 3300025928 | Ga0207700_10356705 | Ga0207700_103567051 | 85 |
| 542 | 3300025929 | Ga0207664_10393745 | Ga0207664_103937452 | 85 |
| 543 | 3300025929 | Ga0207664_11170215 | Ga0207664_111702152 | 85 |
| 544 | 3300025931 | Ga0207644_10119010 | Ga0207644_101190104 | 85 |
| 545 | 3300025934 | Ga0207686_10863071 | Ga0207686_108630712 | 85 |
| 546 | 3300025935 | Ga0207709_11013473 | Ga0207709_110134732 | 85 |
| 547 | 3300025937 | Ga0207669_10657570 | Ga0207669_106575702 | 85 |
| 548 | 3300025940 | Ga0207691_10881571 | Ga0207691_108815712 | 85 |
| 549 | 3300025941 | Ga0207711_10260653 | Ga0207711_102606533 | 85 |
| 550 | 3300025949 | Ga0207667_10110945 | Ga0207667_101109452 | 85 |
| 551 | 3300025949 | Ga0207667_10483383 | Ga0207667_104833832 | 85 |
| 552 | 3300025949 | Ga0207667_11098447 | Ga0207667_110984472 | 85 |
| 553 | 3300025960 | Ga0207651_10300070 | Ga0207651_103000702 | 85 |
| 554 | 3300025972 | Ga0207668_10858252 | Ga0207668_108582522 | 85 |
| 555 | 3300025972 | Ga0207668_11187525 | Ga0207668_111875252 | 85 |
| 556 | 3300025981 | Ga0207640_10433669 | Ga0207640_104336692 | 85 |
| 557 | 3300025986 | Ga0207658_10380954 | Ga0207658_103809542 | 85 |
| 558 | 3300025986 | Ga0207658_10491206 | Ga0207658_104912062 | 85 |
| 559 | 3300026023 | Ga0207677_10079415 | Ga0207677_100794152 | 85 |
| 560 | 3300026035 | Ga0207703_10248429 | Ga0207703_102484293 | 85 |
| 561 | 3300026067 | Ga0207678_10001249 | Ga0207678_1000124910 | 85 |
| 562 | 3300026067 | Ga0207678_10450075 | Ga0207678_104500752 | 85 |
| 563 | 3300026075 | Ga0207708_10424430 | Ga0207708_104244302 | 85 |
| 564 | 3300026078 | Ga0207702_10093978 | Ga0207702_100939782 | 85 |
| 565 | 3300026078 | Ga0207702_10354150 | Ga0207702_103541502 | 85 |
| 566 | 3300026088 | Ga0207641_10044128 | Ga0207641_100441283 | 85 |
| 567 | 3300026089 | Ga0207648_12021970 | Ga0207648_120219701 | 85 |
| 568 | 3300026095 | Ga0207676_10107667 | Ga0207676_101076673 | 85 |
| 569 | 3300026121 | Ga0207683_10021780 | Ga0207683_100217803 | 85 |
| 570 | 3300026121 | Ga0207683_10128823 | Ga0207683_101288232 | 85 |
| 571 | 3300027866 | Ga0209813_10136791 | Ga0209813_101367912 | 85 |
| 572 | 3300027866 | Ga0209813_10482102 | Ga0209813_104821021 | 85 |
| 573 | 3300028379 | Ga0268266_10087579 | Ga0268266_100875792 | 85 |
| 574 | 3300028379 | Ga0268266_10306749 | Ga0268266_103067492 | 85 |
| 575 | 3300028379 | Ga0268266_11383849 | Ga0268266_113838492 | 85 |
| 576 | 3300028380 | Ga0268265_10884593 | Ga0268265_108845933 | 85 |
| 577 | 3300028381 | Ga0268264_10000987 | Ga0268264_100009879 | 85 |
| 578 | 3300028381 | Ga0268264_10137202 | Ga0268264_101372023 | 85 |
| 579 | 3300028381 | Ga0268264_10511587 | Ga0268264_105115873 | 85 |
| 580 | 3300028573 | Ga0265334_10007622 | Ga0265334_100076222 | 85 |
| 581 | 3300028794 | Ga0307515_10446720 | Ga0307515_104467202 | 85 |
| 582 | 3300030733 | Ga0314311_1122579 | Ga0314311_11225793 | 85 |
| 583 | 3300030744 | Ga0316181_1252750 | Ga0316181_12527502 | 85 |
| 584 | 3300030745 | Ga0316182_1109466 | Ga0316182_11094663 | 85 |
| 585 | 3300031507 | Ga0307509_10536258 | Ga0307509_105362582 | 85 |
| 586 | 3300031548 | Ga0307408_100270314 | Ga0307408_1002703142 | 85 |
| 587 | 3300031548 | Ga0307408_101175431 | Ga0307408_1011754312 | 85 |
| 588 | 3300031649 | Ga0307514_10383541 | Ga0307514_103835412 | 85 |
| 589 | 3300031665 | Ga0316575_10002481 | Ga0316575_100024815 | 85 |
| 590 | 3300031691 | Ga0316579_10030946 | Ga0316579_100309462 | 85 |
| 591 | 3300031727 | Ga0316576_10039257 | Ga0316576_100392572 | 85 |
| 592 | 3300031728 | Ga0316578_10025525 | Ga0316578_100255252 | 85 |
| 593 | 3300031731 | Ga0307405_10579826 | Ga0307405_105798262 | 85 |
| 594 | 3300031731 | Ga0307405_11055901 | Ga0307405_110559011 | 85 |
| 595 | 3300031731 | Ga0307405_11752215 | Ga0307405_117522151 | 85 |
| 596 | 3300031731 | Ga0307405_11761025 | Ga0307405_117610252 | 85 |
| 597 | 3300031733 | Ga0316577_10037186 | Ga0316577_100371863 | 85 |
| 598 | 3300031852 | Ga0307410_10099134 | Ga0307410_100991343 | 85 |
| 599 | 3300031852 | Ga0307410_11872070 | Ga0307410_118720702 | 85 |
| 600 | 3300031901 | Ga0307406_10014155 | Ga0307406_100141551 | 85 |
| 601 | 3300031901 | Ga0307406_10492598 | Ga0307406_104925982 | 85 |
| 602 | 3300031901 | Ga0307406_10983925 | Ga0307406_109839252 | 85 |
| 603 | 3300031903 | Ga0307407_10031786 | Ga0307407_100317862 | 85 |
| 604 | 3300031903 | Ga0307407_10485365 | Ga0307407_104853652 | 85 |
| 605 | 3300031911 | Ga0307412_10226887 | Ga0307412_102268872 | 85 |
| 606 | 3300031995 | Ga0307409_100039407 | Ga0307409_1000394074 | 85 |
| 607 | 3300031995 | Ga0307409_100114010 | Ga0307409_1001140103 | 85 |
| 608 | 3300031995 | Ga0307409_100455060 | Ga0307409_1004550603 | 85 |
| 609 | 3300032002 | Ga0307416_100114623 | Ga0307416_1001146232 | 85 |
| 610 | 3300032002 | Ga0307416_100284593 | Ga0307416_1002845932 | 85 |
| 611 | 3300032002 | Ga0307416_101076555 | Ga0307416_1010765552 | 85 |
| 612 | 3300032004 | Ga0307414_10147875 | Ga0307414_101478752 | 85 |
| 613 | 3300032004 | Ga0307414_12025678 | Ga0307414_120256781 | 85 |
| 614 | 3300032005 | Ga0307411_10276741 | Ga0307411_102767412 | 85 |
| 615 | 3300032126 | Ga0307415_100393359 | Ga0307415_1003933593 | 85 |
| 616 | 3300032133 | Ga0316583_10006503 | Ga0316583_100065033 | 85 |
| 617 | 3300032137 | Ga0316585_10008208 | Ga0316585_100082082 | 85 |
| 618 | 3300032139 | Ga0316580_10037842 | Ga0316580_100378422 | 85 |
| 619 | 3300032168 | Ga0316593_10004078 | Ga0316593_100040783 | 85 |
| 620 | 3300033524 | Ga0316592_1040494 | Ga0316592_10404942 | 85 |
| 621 | 3300033527 | Ga0316586_1059785 | Ga0316586_10597852 | 85 |
| 622 | 3300033528 | Ga0316588_1066174 | Ga0316588_10661742 | 85 |
| 623 | 3300033541 | Ga0316596_1000246 | Ga0316596_10002463 | 85 |
| 624 | 3300033541 | Ga0316596_1185114 | Ga0316596_11851141 | 85 |
| 625 | 3300033541 | Ga0316596_1202893 | Ga0316596_12028932 | 85 |
| 626 | 3300035398 | Ga0316574_0030284 | Ga0316574_0030284_1994_2254 | 85 |
| 627 | 3300036647 | Ga0316582_0299072 | Ga0316582_0299072_806_1066 | 85 |
| 628 | 3300036712 | Ga0316584_0080072 | Ga0316584_0080072_1946_2206 | 85 |
| 629 | 3300037312 | Ga0395899_0381370 | Ga0395899_0381370_596_862 | 85 |
| 630 | 3300037418 | Ga0395900_0127340 | Ga0395900_0127340_876_1142 | 85 |
| 631 | 3300037418 | Ga0395900_1424141 | Ga0395900_1424141_112_372 | 85 |
| 632 | 3300037418 | Ga0395900_1502563 | Ga0395900_1502563_169_426 | 85 |
| 633 | 3300037466 | Ga0395898_0287877 | Ga0395898_0287877_313_579 | 85 |
| 634 | 3300037466 | Ga0395898_1424394 | Ga0395898_1424394_194_451 | 85 |
| 635 | 3300037466 | Ga0395898_1907993 | Ga0395898_1907993_21_278 | 85 |
| 636 | 3300037588 | Ga0316581_0000149 | Ga0316581_0000149_2471_2731 | 85 |
| 637 | 3300038443 | Ga0395901_0778705 | Ga0395901_0778705_364_630 | 85 |
| 638 | 3300038735 | Ga0400485_19729 | Ga0400485_19729_8815_9072 | 85 |
| 639 | 3300038742 | Ga0400486_32646 | Ga0400486_32646_9281_9538 | 85 |
| 640 | 3300039093 | Ga0400489_87014 | Ga0400489_87014_89_346 | 85 |
| 641 | 3300039437 | Ga0436365_1513875 | Ga0436365_1513875_557_823 | 85 |
| 642 | 3300039447 | Ga0436361_0965496 | Ga0436361_0965496_810_1076 | 85 |
| 643 | 3300039453 | Ga0436362_1249237 | Ga0436362_1249237_200_457 | 85 |
| 644 | 3300041406 | Ga0439439_0110793 | Ga0439439_0110793_309_566 | 85 |
| 645 | 3300041411 | Ga0439466_0114319 | Ga0439466_0114319_499_756 | 85 |
| 646 | 3300041411 | Ga0439466_0161318 | Ga0439466_0161318_82_339 | 85 |
| 647 | 3300041413 | Ga0439465_0048243 | Ga0439465_0048243_727_984 | 85 |
| 648 | 3300041413 | Ga0439465_0090100 | Ga0439465_0090100_699_956 | 85 |
| 649 | 3300041413 | Ga0439465_0123823 | Ga0439465_0123823_279_545 | 85 |
| 650 | 3300041443 | Ga0451789_0231381 | Ga0451789_0231381_289_546 | 85 |
| 651 | 3300041443 | Ga0451789_0396782 | Ga0451789_0396782_474_737 | 85 |
| 652 | 3300041444 | Ga0451790_30891 | Ga0451790_30891_296_553 | 85 |
| 653 | 3300041450 | Ga0451796_10591 | Ga0451796_10591_421_684 | 85 |
| 654 | 3300041452 | Ga0451793_0715769 | Ga0451793_0715769_22_279 | 85 |
| 655 | 3300041452 | Ga0451793_0789263 | Ga0451793_0789263_828_1085 | 85 |
| 656 | 3300041453 | Ga0451797_1218952 | Ga0451797_1218952_231_488 | 85 |
| 657 | 3300041453 | Ga0451797_1255051 | Ga0451797_1255051_218_475 | 85 |
| 658 | 3300041456 | Ga0451795_0292788 | Ga0451795_0292788_258_521 | 85 |
| 659 | 3300041456 | Ga0451795_0294527 | Ga0451795_0294527_261_518 | 85 |
| 660 | 3300041456 | Ga0451795_0902187 | Ga0451795_0902187_67_324 | 85 |
| 661 | 3300041459 | Ga0451800_1401438 | Ga0451800_1401438_140_400 | 85 |
| 662 | 3300041460 | Ga0451802_0085081 | Ga0451802_0085081_110_367 | 85 |
| 663 | 3300041460 | Ga0451802_0800214 | Ga0451802_0800214_101_364 | 85 |
| 664 | 3300041486 | Ga0451807_1553210 | Ga0451807_1553210_132_389 | 85 |
| 665 | 3300041486 | Ga0451807_1667980 | Ga0451807_1667980_58_321 | 85 |
| 666 | 3300041491 | Ga0451833_0276161 | Ga0451833_0276161_974_1231 | 85 |
| 667 | 3300041494 | Ga0451837_0210431 | Ga0451837_0210431_199_462 | 85 |
| 668 | 3300041494 | Ga0451837_0949823 | Ga0451837_0949823_19_276 | 85 |
| 669 | 3300041494 | Ga0451837_1052852 | Ga0451837_1052852_1640_1897 | 85 |
| 670 | 3300041496 | Ga0451839_0010674 | Ga0451839_0010674_2274_2531 | 85 |
| 671 | 3300041498 | Ga0451841_0963788 | Ga0451841_0963788_793_1050 | 85 |
| 672 | 3300041501 | Ga0451845_0086215 | Ga0451845_0086215_377_634 | 85 |
| 673 | 3300041502 | Ga0451846_47497 | Ga0451846_47497_292_549 | 85 |
| 674 | 3300041509 | Ga0451843_0390362 | Ga0451843_0390362_101_364 | 85 |
| 675 | 3300041509 | Ga0451843_1649887 | Ga0451843_1649887_237_494 | 85 |
| 676 | 3300041511 | Ga0451855_1387741 | Ga0451855_1387741_26_283 | 85 |
| 677 | 3300041512 | Ga0451853_0407957 | Ga0451853_0407957_188_445 | 85 |
| 678 | 3300041512 | Ga0451853_2386619 | Ga0451853_2386619_382_645 | 85 |
| 679 | 3300042004 | Ga0439445_0027772 | Ga0439445_0027772_339_596 | 85 |
| 680 | 3300042006 | Ga0439432_056326 | Ga0439432_056326_908_1165 | 85 |
| 681 | 3300042156 | Ga0439446_0094568 | Ga0439446_0094568_236_493 | 85 |
| 682 | 3300042438 | Ga0439459_0112591 | Ga0439459_0112591_281_538 | 85 |
| 683 | 3300044656 | Ga0466969_0017660 | Ga0466969_0017660_3388_3645 | 85 |
| 684 | 3300044656 | Ga0466969_0248751 | Ga0466969_0248751_365_622 | 85 |
| 685 | 3300044658 | Ga0466972_0037579 | Ga0466972_0037579_622_879 | 85 |
| 686 | 3300044658 | Ga0466972_0168960 | Ga0466972_0168960_20_289 | 85 |
| 687 | 3300044658 | Ga0466972_0213221 | Ga0466972_0213221_439_696 | 85 |
| 688 | 3300044658 | Ga0466972_0217083 | Ga0466972_0217083_315_572 | 85 |
| 689 | 3300044683 | Ga0466965_0238911 | Ga0466965_0238911_255_512 | 85 |
| 690 | 3300044683 | Ga0466965_0406016 | Ga0466965_0406016_12_272 | 85 |
| 691 | 3300044683 | Ga0466965_0474493 | Ga0466965_0474493_133_390 | 85 |
| 692 | 3300044683 | Ga0466965_0894244 | Ga0466965_0894244_166_432 | 85 |
| 693 | 3300044684 | Ga0466966_0098303 | Ga0466966_0098303_1048_1305 | 85 |
| 694 | 3300044684 | Ga0466966_0131941 | Ga0466966_0131941_772_1038 | 85 |
| 695 | 3300044684 | Ga0466966_0398987 | Ga0466966_0398987_166_423 | 85 |
| 696 | 3300044693 | Ga0466961_0041554 | Ga0466961_0041554_358_615 | 85 |
| 697 | 3300044693 | Ga0466961_0067005 | Ga0466961_0067005_525_791 | 85 |
| 698 | 3300044693 | Ga0466961_0109310 | Ga0466961_0109310_979_1236 | 85 |
| 699 | 3300044693 | Ga0466961_0426426 | Ga0466961_0426426_384_641 | 85 |
| 700 | 3300044693 | Ga0466961_0904767 | Ga0466961_0904767_236_493 | 85 |
| 701 | 3300044694 | Ga0466963_0239166 | Ga0466963_0239166_368_634 | 85 |
| 702 | 3300044706 | Ga0466964_0023349 | Ga0466964_0023349_1368_1625 | 85 |
| 703 | 3300044735 | Ga0466968_0090654 | Ga0466968_0090654_811_1077 | 85 |
| 704 | 3300044765 | Ga0466970_0058962 | Ga0466970_0058962_196_453 | 85 |
| 705 | 3300044765 | Ga0466970_0193928 | Ga0466970_0193928_755_1021 | 85 |
| 706 | 3300044765 | Ga0466970_0369744 | Ga0466970_0369744_432_701 | 85 |
| 707 | 3300044765 | Ga0466970_0864876 | Ga0466970_0864876_157_414 | 85 |
| 708 | 3300044842 | Ga0466957_0101812 | Ga0466957_0101812_847_1104 | 85 |
| 709 | 3300044842 | Ga0466957_0536768 | Ga0466957_0536768_524_790 | 85 |
| 710 | 3300044842 | Ga0466957_0693127 | Ga0466957_0693127_155_421 | 85 |
| 711 | 3300044842 | Ga0466957_0980112 | Ga0466957_0980112_36_305 | 85 |
| 712 | 3300044901 | Ga0466960_0250145 | Ga0466960_0250145_317_574 | 85 |
| 713 | 3300045049 | Ga0466959_0143603 | Ga0466959_0143603_87_353 | 85 |
| 714 | 3300045049 | Ga0466959_0190525 | Ga0466959_0190525_520_786 | 85 |
| 715 | 3300045049 | Ga0466959_0391539 | Ga0466959_0391539_246_503 | 85 |
| 716 | 3300045836 | Ga0466958_0327777 | Ga0466958_0327777_380_649 | 85 |
| 717 | 3300045836 | Ga0466958_0981194 | Ga0466958_0981194_207_464 | 85 |
| 718 | 3300045976 | Ga0466967_0305278 | Ga0466967_0305278_166_423 | 85 |
| 719 | 3300045976 | Ga0466967_0484939 | Ga0466967_0484939_414_671 | 85 |
| 720 | 3300045976 | Ga0466967_0832639 | Ga0466967_0832639_306_575 | 85 |
| 721 | 3300045976 | Ga0466967_1835973 | Ga0466967_1835973_118_375 | 85 |
| 722 | 3300045976 | Ga0466967_2177912 | Ga0466967_2177912_227_484 | 85 |
| 723 | 3300046453 | Ga0495627_097854 | Ga0495627_097854_42_299 | 85 |
| 724 | 3300046458 | Ga0495591_122499 | Ga0495591_122499_285_542 | 85 |
| 725 | 3300046460 | Ga0495638_0135324 | Ga0495638_0135324_656_913 | 85 |
| 726 | 3300046471 | Ga0495650_0010799 | Ga0495650_0010799_1519_1782 | 85 |
| 727 | 3300046475 | Ga0495639_0171620 | Ga0495639_0171620_149_406 | 85 |
| 728 | 3300046515 | Ga0495620_0275483 | Ga0495620_0275483_228_485 | 85 |
| 729 | 3300046522 | Ga0495643_0142616 | Ga0495643_0142616_514_771 | 85 |
| 730 | 3300046530 | Ga0495654_0032925 | Ga0495654_0032925_177_434 | 85 |
| 731 | 3300046615 | Ga0495656_0251254 | Ga0495656_0251254_477_734 | 85 |
| 732 | 3300046660 | Ga0495625_0142695 | Ga0495625_0142695_1227_1484 | 85 |
| 733 | 3300046675 | Ga0495657_0334786 | Ga0495657_0334786_76_339 | 85 |
| 734 | 3300046681 | Ga0495647_0407478 | Ga0495647_0407478_208_465 | 85 |
| 735 | 3300046692 | Ga0495671_0229100 | Ga0495671_0229100_632_889 | 85 |
| 736 | 3300046694 | Ga0495649_0078152 | Ga0495649_0078152_1400_1657 | 85 |
| 737 | 3300047320 | Ga0495672_0245464 | Ga0495672_0245464_380_637 | 85 |
| 738 | 3300047320 | Ga0495672_0428121 | Ga0495672_0428121_30_287 | 85 |
| 739 | 3300048903 | Ga0496100_0018960 | Ga0496100_0018960_3099_3356 | 85 |
| 740 | 3300048903 | Ga0496100_0231191 | Ga0496100_0231191_654_911 | 85 |
| 741 | 3300048904 | Ga0496101_0006334 | Ga0496101_0006334_2261_2518 | 85 |
| 742 | 3300048905 | Ga0496102_0022739 | Ga0496102_0022739_1505_1762 | 85 |
| 743 | 3300048905 | Ga0496102_0217530 | Ga0496102_0217530_800_1060 | 85 |
| 744 | 3300048905 | Ga0496102_1780292 | Ga0496102_1780292_124_381 | 85 |
| 745 | 3300048906 | Ga0496103_0011718 | Ga0496103_0011718_250_507 | 85 |
| 746 | 3300048907 | Ga0496104_0005777 | Ga0496104_0005777_2223_2480 | 85 |
| 747 | 3300048907 | Ga0496104_0121240 | Ga0496104_0121240_1828_2085 | 85 |
| 748 | 3300048907 | Ga0496104_0202754 | Ga0496104_0202754_261_518 | 85 |
| 749 | 3300048908 | Ga0496105_0002712 | Ga0496105_0002712_4862_5119 | 85 |
| 750 | 3300048908 | Ga0496105_0053232 | Ga0496105_0053232_776_1033 | 85 |
| 751 | 3300048908 | Ga0496105_0133027 | Ga0496105_0133027_944_1201 | 85 |
| 752 | 3300048909 | Ga0496106_0020578 | Ga0496106_0020578_3954_4211 | 85 |
| 753 | 3300048910 | Ga0496107_0004317 | Ga0496107_0004317_1635_1892 | 85 |
| 754 | 3300048910 | Ga0496107_0065388 | Ga0496107_0065388_996_1253 | 85 |
| 755 | 3300048911 | Ga0496108_0010564 | Ga0496108_0010564_4139_4396 | 85 |
| 756 | 3300048911 | Ga0496108_0035480 | Ga0496108_0035480_271_528 | 85 |
| 757 | 3300048911 | Ga0496108_0211667 | Ga0496108_0211667_981_1238 | 85 |
| 758 | 3300048912 | Ga0496109_0008423 | Ga0496109_0008423_3874_4131 | 85 |
| 759 | 3300048912 | Ga0496109_0033739 | Ga0496109_0033739_2410_2667 | 85 |
| 760 | 3300048914 | Ga0496111_0001311 | Ga0496111_0001311_5032_5289 | 85 |
| 761 | 3300048914 | Ga0496111_0174980 | Ga0496111_0174980_575_832 | 85 |
| 762 | 3300048914 | Ga0496111_0762851 | Ga0496111_0762851_63_320 | 85 |
| 763 | 3300048915 | Ga0496112_0031543 | Ga0496112_0031543_2152_2409 | 85 |
| 764 | 3300048915 | Ga0496112_0040203 | Ga0496112_0040203_867_1124 | 85 |
| 765 | 3300048915 | Ga0496112_0212811 | Ga0496112_0212811_1368_1625 | 85 |
| 766 | 3300048916 | Ga0496113_0049454 | Ga0496113_0049454_1745_2002 | 85 |
| 767 | 3300048916 | Ga0496113_0107738 | Ga0496113_0107738_15_272 | 85 |
| 768 | 3300048917 | Ga0496114_0023635 | Ga0496114_0023635_3856_4113 | 85 |
| 769 | 3300048917 | Ga0496114_0181650 | Ga0496114_0181650_923_1180 | 85 |
| 770 | 3300048917 | Ga0496114_0553668 | Ga0496114_0553668_78_335 | 85 |
| 771 | 3300048918 | Ga0496115_0033887 | Ga0496115_0033887_1970_2227 | 85 |
| 772 | 3300048918 | Ga0496115_0058473 | Ga0496115_0058473_1942_2199 | 85 |
| 773 | 3300048918 | Ga0496115_0487868 | Ga0496115_0487868_24_281 | 85 |
| 774 | 3300048919 | Ga0496116_0022531 | Ga0496116_0022531_1588_1845 | 85 |
| 775 | 3300048920 | Ga0496117_0000053 | Ga0496117_0000053_203976_204236 | 85 |
| 776 | 3300048920 | Ga0496117_0005856 | Ga0496117_0005856_5063_5320 | 85 |
| 777 | 3300048920 | Ga0496117_0019479 | Ga0496117_0019479_4573_4830 | 85 |
| 778 | 3300048920 | Ga0496117_0188220 | Ga0496117_0188220_123_383 | 85 |
| 779 | 3300048920 | Ga0496117_0319738 | Ga0496117_0319738_147_404 | 85 |
| 780 | 3300048921 | Ga0496118_0003938 | Ga0496118_0003938_12018_12275 | 85 |
| 781 | 3300048921 | Ga0496118_0277403 | Ga0496118_0277403_79_336 | 85 |
| 782 | 3300048921 | Ga0496118_0332049 | Ga0496118_0332049_532_789 | 85 |
| 783 | 3300048922 | Ga0496119_0002876 | Ga0496119_0002876_6086_6343 | 85 |
| 784 | 3300048922 | Ga0496119_0007344 | Ga0496119_0007344_3495_3755 | 85 |
| 785 | 3300048922 | Ga0496119_0099165 | Ga0496119_0099165_340_597 | 85 |
| 786 | 3300048923 | Ga0496120_0001606 | Ga0496120_0001606_22431_22691 | 85 |
| 787 | 3300048923 | Ga0496120_0005690 | Ga0496120_0005690_9520_9780 | 85 |
| 788 | 3300048923 | Ga0496120_0010747 | Ga0496120_0010747_2749_3006 | 85 |
| 789 | 3300048925 | Ga0496122_0000030 | Ga0496122_0000030_91960_92217 | 85 |
| 790 | 3300048925 | Ga0496122_0002826 | Ga0496122_0002826_5143_5403 | 85 |
| 791 | 3300048925 | Ga0496122_0024042 | Ga0496122_0024042_1201_1458 | 85 |
| 792 | 3300048925 | Ga0496122_0170148 | Ga0496122_0170148_758_1015 | 85 |
| 793 | 3300048926 | Ga0496123_0000024 | Ga0496123_0000024_91961_92218 | 85 |
| 794 | 3300048926 | Ga0496123_0003526 | Ga0496123_0003526_7759_8019 | 85 |
| 795 | 3300048926 | Ga0496123_0141416 | Ga0496123_0141416_805_1062 | 85 |
| 796 | 3300048926 | Ga0496123_0335998 | Ga0496123_0335998_103_360 | 85 |
| 797 | 3300048927 | Ga0496124_0003673 | Ga0496124_0003673_1216_1473 | 85 |
| 798 | 3300048927 | Ga0496124_0058865 | Ga0496124_0058865_1782_2042 | 85 |
| 799 | 3300048927 | Ga0496124_0227210 | Ga0496124_0227210_714_971 | 85 |
| 800 | 3300048928 | Ga0496125_0004043 | Ga0496125_0004043_16330_16590 | 85 |
| 801 | 3300048928 | Ga0496125_0004883 | Ga0496125_0004883_1413_1670 | 85 |
| 802 | 3300048928 | Ga0496125_0580132 | Ga0496125_0580132_223_480 | 85 |
| 803 | 3300048929 | Ga0496126_0004970 | Ga0496126_0004970_5138_5398 | 85 |
| 804 | 3300048929 | Ga0496126_0008058 | Ga0496126_0008058_6176_6433 | 85 |
| 805 | 3300048929 | Ga0496126_0466232 | Ga0496126_0466232_721_978 | 85 |
| 806 | 3300049127 | Ga0501306_055966 | Ga0501306_055966_18_281 | 85 |
| 807 | 3300049128 | Ga0501308_080432 | Ga0501308_080432_66_332 | 85 |
| 808 | 3300049161 | Ga0501305_048878 | Ga0501305_048878_20_280 | 85 |
| 809 | 3300049527 | Ga0501311_028365 | Ga0501311_028365_39_299 | 85 |
| 810 | 3300049527 | Ga0501311_053509 | Ga0501311_053509_19_282 | 85 |
| 811 | 3300049533 | Ga0501317_015058 | Ga0501317_015058_696_965 | 85 |
| 812 | 3300049533 | Ga0501317_033450 | Ga0501317_033450_19_282 | 85 |
| 813 | 3300049534 | Ga0501318_041901 | Ga0501318_041901_30_290 | 85 |
| 814 | 3300049537 | Ga0501321_016150 | Ga0501321_016150_602_874 | 85 |
| 815 | 3300049541 | Ga0501325_012740 | Ga0501325_012740_397_660 | 85 |
| 816 | 3300049572 | Ga0501036_0182437 | Ga0501036_0182437_614_874 | 85 |
| 817 | 3300049572 | Ga0501036_1024362 | Ga0501036_1024362_64_321 | 85 |
| 818 | 3300049573 | Ga0501037_0177813 | Ga0501037_0177813_153_410 | 85 |
| 819 | 3300049576 | Ga0501040_0541873 | Ga0501040_0541873_455_712 | 85 |
| 820 | 3300049578 | Ga0501042_0779368 | Ga0501042_0779368_247_504 | 85 |
| 821 | 3300049582 | Ga0501048_1228041 | Ga0501048_1228041_83_343 | 85 |
| 822 | 3300049585 | Ga0501069_0039598 | Ga0501069_0039598_1779_2036 | 85 |
| 823 | 3300049585 | Ga0501069_0110795 | Ga0501069_0110795_130_396 | 85 |
| 824 | 3300049586 | Ga0501070_0053511 | Ga0501070_0053511_2535_2801 | 85 |
| 825 | 3300049586 | Ga0501070_0059346 | Ga0501070_0059346_1629_1886 | 85 |
| 826 | 3300049587 | Ga0501071_1219130 | Ga0501071_1219130_114_371 | 85 |
| 827 | 3300049589 | Ga0501073_0440406 | Ga0501073_0440406_77_343 | 85 |
| 828 | 3300049590 | Ga0501074_0295009 | Ga0501074_0295009_546_812 | 85 |
| 829 | 3300049593 | Ga0501077_0796427 | Ga0501077_0796427_229_486 | 85 |
| 830 | 3300049741 | Ga0501079_0094252 | Ga0501079_0094252_1047_1307 | 85 |
| 831 | 3300049742 | Ga0501080_0155978 | Ga0501080_0155978_1331_1597 | 85 |
| 832 | 3300049743 | Ga0501081_0218466 | Ga0501081_0218466_426_686 | 85 |
| 833 | 3300050490 | nmdc:mga03n38_222569_c1 | nmdc:mga03n38_222569_c1_117_377 | 85 |
| 834 | 3300050491 | nmdc:mga00v17_114948_c1 | nmdc:mga00v17_114948_c1_921_1181 | 85 |
| 835 | 3300050491 | nmdc:mga00v17_173872_c1 | nmdc:mga00v17_173872_c1_598_855 | 85 |
| 836 | 3300050491 | nmdc:mga00v17_296205_c1 | nmdc:mga00v17_296205_c1_308_568 | 85 |
| 837 | 3300050491 | nmdc:mga00v17_310638_c1 | nmdc:mga00v17_310638_c1_540_803 | 85 |
| 838 | 3300050491 | nmdc:mga00v17_62442_c1 | nmdc:mga00v17_62442_c1_1140_1397 | 85 |
| 839 | 3300050491 | nmdc:mga00v17_971_c1 | nmdc:mga00v17_971_c1_12174_12437 | 85 |
| 840 | 3300050492 | nmdc:mga0yw44_114563_c1 | nmdc:mga0yw44_114563_c1_70_330 | 85 |
| 841 | 3300050492 | nmdc:mga0yw44_22559_c1 | nmdc:mga0yw44_22559_c1_460_717 | 85 |
| 842 | 3300050492 | nmdc:mga0yw44_289036_c1 | nmdc:mga0yw44_289036_c1_155_415 | 85 |
| 843 | 3300050492 | nmdc:mga0yw44_82211_c1 | nmdc:mga0yw44_82211_c1_839_1099 | 85 |
| 844 | 3300050493 | nmdc:mga0k408_872708_c1 | nmdc:mga0k408_872708_c1_74_331 | 85 |
| 845 | 3300050494 | nmdc:mga06z11_391110_c1 | nmdc:mga06z11_391110_c1_38_298 | 85 |
| 846 | 3300050494 | nmdc:mga06z11_4263_c1 | nmdc:mga06z11_4263_c1_2881_3138 | 85 |
| 847 | 3300050495 | nmdc:mga04h51_82785_c1 | nmdc:mga04h51_82785_c1_644_901 | 85 |
| 848 | 3300050496 | nmdc:mga07m45_16476_c1 | nmdc:mga07m45_16476_c1_3633_3890 | 85 |
| 849 | 3300050496 | nmdc:mga07m45_60779_c1 | nmdc:mga07m45_60779_c1_1489_1746 | 85 |
| 850 | 3300050496 | nmdc:mga07m45_657785_c1 | nmdc:mga07m45_657785_c1_136_399 | 85 |
| 851 | 3300050496 | nmdc:mga07m45_733198_c1 | nmdc:mga07m45_733198_c1_260_523 | 85 |
| 852 | 3300050516 | nmdc:mga0sz30_2151_c1 | nmdc:mga0sz30_2151_c1_2279_2542 | 85 |
| 853 | 3300050516 | nmdc:mga0sz30_4797_c2 | nmdc:mga0sz30_4797_c2_3005_3262 | 85 |
| 854 | 3300053085 | Ga0495619_0873288 | Ga0495619_0873288_44_301 | 85 |
| 855 | 3300053093 | Ga0500651_0001075 | Ga0500651_0001075_12494_12751 | 85 |
| 856 | 3300053096 | Ga0500641_0006257 | Ga0500641_0006257_1578_1841 | 85 |
| 857 | 3300053140 | Ga0500573_0323798 | Ga0500573_0323798_464_721 | 85 |
| 858 | 3300054114 | Ga0501084_0434284 | Ga0501084_0434284_667_927 | 85 |
| 859 | 3300059424 | Ga0590075_078126 | Ga0590075_078126_29_286 | 85 |
| 860 | 3300059478 | Ga0587093_048773 | Ga0587093_048773_10_267 | 85 |
| 861 | 3300059492 | Ga0587073_0124378 | Ga0587073_0124378_20_277 | 85 |
| 862 | 3300059492 | Ga0587073_0124825 | Ga0587073_0124825_103_369 | 85 |
| 863 | 3300059503 | Ga0587080_109638 | Ga0587080_109638_307_564 | 85 |
| 864 | 3300059504 | Ga0587082_049701 | Ga0587082_049701_427_684 | 85 |
| 865 | 3300059505 | Ga0587083_0074773 | Ga0587083_0074773_513_773 | 85 |
| 866 | 3300059508 | Ga0587088_054641 | Ga0587088_054641_173_430 | 85 |
| 867 | 3300059511 | Ga0587091_099077 | Ga0587091_099077_58_315 | 85 |
| 868 | 3300059605 | Ga0587106_051237 | Ga0587106_051237_455_712 | 85 |
| 869 | 3300059622 | Ga0587099_049749 | Ga0587099_049749_85_342 | 85 |
| 870 | 3300059626 | Ga0587115_009733 | Ga0587115_009733_542_820 | 85 |
| 871 | 3300059628 | Ga0587122_016159 | Ga0587122_016159_335_592 | 85 |
| 872 | 3300059630 | Ga0587128_023558 | Ga0587128_023558_426_683 | 85 |
| 873 | 3300059644 | Ga0587075_068341 | Ga0587075_068341_177_434 | 85 |
| 874 | 3300059655 | Ga0587114_017539 | Ga0587114_017539_432_689 | 85 |
| 875 | 3300060344 | Ga0587071_083584 | Ga0587071_083584_448_705 | 85 |
| 876 | 3300060353 | Ga0501082_0150864 | Ga0501082_0150864_878_1138 | 85 |
| 877 | 3300060353 | Ga0501082_0571534 | Ga0501082_0571534_248_505 | 85 |
| 878 | 3300061719 | Ga0466962_0043154 | Ga0466962_0043154_944_1201 | 85 |
| 879 | 3300061719 | Ga0466962_0178297 | Ga0466962_0178297_644_901 | 85 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6ywy-assembly1.cif.gz_R | the structure of the mitoribosome from neurospora crassa with bound trna at the p-site | 0.9003 | 19 | 81 |
| 1v8q-assembly1.cif.gz_A | crystal structure of ribosomal protein l27 from thermus thermophilus hb8 | 0.8986 | 20 | 83 |
| 6yws-assembly1.cif.gz_R | the structure of the large subunit of the mitoribosome from neurospora crassa | 0.897 | 19 | 81 |
| 7pkt-assembly1.cif.gz_u | large subunit of the chlamydomonas reinhardtii mitoribosome | 0.8931 | 23 | 84 |
| 6ywv-assembly1.cif.gz_R | the structure of the atp25 bound assembly intermediate of the mitoribosome from neurospora crassa | 0.8913 | 19 | 81 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1v8qA00 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.8986 | 20 | 83 | 2.40.50.100 |
| af_Q4DLT4_19_136_2.40.50.100 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.8662 | 23 | 82 | 2.40.50.100 |
| af_Q4DVL3_299_475_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8646 | 67 | 80 | 3.40.50.300 |
| 1v8qA00 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.8604 | 20 | 83 | 2.40.50.100 |
| af_Q95XD0_22_81_2.40.50.100 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.8225 | 27 | 85 | 2.40.50.100 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-I4M014-F1-model_v4 | Large ribosomal subunit protein bL27 (50S ribosomal protein L27) | 0.972 | 27 | 83 |
GO:0003735
GO:0006412 GO:0022625 |
| AF-I0R0V1-F1-model_v4 | Large ribosomal subunit protein bL27 (50S ribosomal protein L27) | 0.9663 | 23 | 83 |
GO:0003735
GO:0006412 GO:0022625 |
| AF-W4UE80-F1-model_v4 | deleted | 0.964 | 23 | 84 |
|
| AF-A0A421K8E4-F1-model_v4 | Large ribosomal subunit protein bL27 (50S ribosomal protein L27) | 0.9556 | 23 | 84 |
GO:0003735
GO:0005840 GO:0006412 GO:1990904 |
| AF-I4M014-F1-model_v4 | Large ribosomal subunit protein bL27 (50S ribosomal protein L27) | 0.9556 | 27 | 83 |
GO:0003735
GO:0006412 GO:0022625 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar