F484465

General Info

Members Datasets Scaffolds Average Seq Length
879 456 825 85

Family's Representative Sequence

Representative Sequence 3300032004|Ga0307414_10147875|Ga0307414_101478752
Length 98
Sequence MAHKKGASSSRNGRDSNAQRLGVKRFGGQIVKAGEIIVRQRGTHFHPGTNVGRGGDDTLFATAPGAVTFGTKRGRKTISVLRPSASGLDVAAGAAPKA

Samples

Sample ID Description Type Environment
1 2643221546 Microbacterium sp. Root53 Isolate Unclassified
2 2643221566 Microbacterium sp. Root166 Isolate Unclassified
3 2643221572 Leifsonia sp. Root60 Isolate Unclassified
4 2643221597 Microbacterium sp. Root180 Isolate Unclassified
5 2643221635 Yonghaparkia sp. Root332 Isolate Unclassified
6 2643221669 Leifsonia sp. Root1293 Isolate Unclassified
7 2643221681 Aeromicrobium sp. Root472D3 Isolate Unclassified
8 2643221961 Aeromicrobium sp. Root236 Isolate Unclassified
9 2643221962 Aeromicrobium sp. Root344 Isolate Unclassified
10 2751185788 Curtobacterium pusillum AA3 Isolate Unclassified
11 2757320536 Microbacterium sp. NFIX05 Isolate Unclassified
12 2758568522 Promicromonospora thailandica SAI-039 Isolate Unclassified
13 2773857758 Microbacterium chocolatum 1320 Isolate Unclassified
14 2773857759 Microbacterium sp. 1294 Isolate Unclassified
15 2808606439 Nocardioides sp. SLBN-172 Isolate Unclassified
16 2808606447 Microbacterium sp. HAR-UPW-R2A-48 Isolate Unclassified
17 2808606700 Arthrobacter agilis UMCV2 Isolate Rhizosphere
18 2811994872 Microbacterium sp. MU4Y-5-1 Isolate Unclassified
19 2811994880 Cellulomonas sp. SLBN-39 Isolate Unclassified
20 2833709550 Microbacterium sp. 3290 Isolate Rhizosphere
21 2852632344 Microbacterium sp. AK009 Isolate Rhizosphere
22 2857720070 Microbacterium sp. R-72113 Isolate Unclassified
23 2857729791 Plantibacter sp. R-72288 Isolate Unclassified
24 2857733635 Salinibacterium sp. R-73062 Isolate Unclassified
25 2870628048 Microbacterium thalassium DSM 12511 Isolate Rhizosphere
26 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified
27 2895660088 Leifsonia flava SYP-B2174 Isolate Rhizosphere
28 2904430863 Curtobacterium oceanosedimentum 1519 Isolate Rhizosphere
29 2904501621 Curtobacterium sp. 1909 Isolate Unclassified
30 2904509784 Microbacterium sp. 1676 Isolate Rhizosphere
31 2905926851 Arthrobacter sedimenti MIC A30 Isolate Rhizosphere
32 2906799679 Microbacterium karelineae TRM80801 Isolate Unclassified
33 2908674828 Curtobacterium sp. 1517 Isolate Rhizosphere
34 2908678064 Microbacterium sp. 1518 Isolate Rhizosphere
35 2909074476 Curtobacterium sp. 1310 Isolate Rhizosphere
36 2919039151 Curtobacterium sp. 260 Isolate Rhizosphere
37 2919042368 Curtobacterium sp. 320 Isolate Rhizosphere
38 2919069694 Microbacterium sp. 1154 Isolate Unclassified
39 2928090899 Microbacterium sp. 1262 Isolate Rhizosphere
40 2928104781 Curtobacterium sp. 1544 Isolate Rhizosphere
41 2928121344 Plantibacter flavus 1756 Isolate Rhizosphere
42 2928500415 Curtobacterium oceanosedimentum 1257 Isolate Rhizosphere
43 2946003308 Arthrobacter agilis W3I6 Isolate Rhizosphere
44 2974294766 Microbacterium proteolyticum SORGH_AS 209 Isolate Unclassified
45 2974324384 Microbacterium sp. SORGH_AS 344 Isolate Unclassified
46 2977228692 Microbacterium sp. SORGH_AS 421 Isolate Unclassified
47 2977236895 Microbacterium testaceum SORGH_AS 426 Isolate Unclassified
48 2977264416 Microbacterium testaceum SORGH_AS 594 Isolate Unclassified
49 2984542743 Microbacterium sp. SORGH_AS454 Isolate Aerial Root
50 2984551494 Curtobacterium sp. SORGH_AS776 Isolate Aerial Root
51 2984580707 Microbacterium paludicola SORGH_AS919 Isolate Aerial Root
52 2984592036 Aeromicrobium sp. SORGH_AS981 Isolate Aerial Root
53 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
54 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
55 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
56 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
57 3300003162 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
58 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
59 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
60 3300003559 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_43 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
61 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
62 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
63 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
64 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
65 3300004785 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-1 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
66 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
67 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
68 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
69 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
70 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
71 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
72 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
73 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
74 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
75 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
76 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
77 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
78 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
79 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
80 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
81 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
82 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
83 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
84 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
85 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
86 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
87 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
88 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
89 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
90 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
91 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
92 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
93 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
94 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
95 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
96 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
97 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
98 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
99 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
100 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
101 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
102 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
103 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
104 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
105 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
106 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
107 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
108 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
109 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
110 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
111 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
112 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
113 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
114 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
115 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
116 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
117 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
118 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
119 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
120 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
121 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
122 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
123 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
124 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
125 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
126 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
127 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
128 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
129 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
130 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
131 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
132 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
133 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
134 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
135 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
136 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
137 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
138 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
139 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
140 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
141 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
142 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
143 3300009987 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG Metagenome Rhizosphere
144 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
145 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
146 3300012478 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.9.old.080610 Metagenome Rhizosphere
147 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
148 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
149 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
150 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
151 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
152 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
153 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
154 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
155 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
156 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
157 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
158 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
159 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
160 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
161 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
162 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
163 3300020071 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
164 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
165 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
166 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
167 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
168 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
169 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
170 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
171 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
172 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
173 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
174 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
175 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
176 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
229 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
233 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
234 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
235 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
236 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
237 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
238 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
239 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
240 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
241 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
242 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
243 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
244 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
245 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
246 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
247 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
248 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
249 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
250 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
251 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
252 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
253 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
254 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
255 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
256 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
257 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
258 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
259 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
260 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
261 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
262 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
263 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
264 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
265 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
266 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
267 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
268 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
269 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
270 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
271 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
272 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
273 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
274 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
275 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
276 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
277 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
278 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
279 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
280 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
281 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
282 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
283 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
284 3300041444 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaT Metatranscriptome Rhizoplane
285 3300041450 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaT Metatranscriptome Rhizoplane
286 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
287 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
288 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
289 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
290 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
291 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
292 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
293 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
294 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
295 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
296 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
297 3300041502 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaT Metatranscriptome Unclassified
298 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
299 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
300 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
301 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
302 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
303 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
304 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
305 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
306 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
307 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
308 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
309 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
310 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
311 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
312 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
313 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
314 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
315 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
316 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
317 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
318 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
319 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
320 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
321 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
322 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
323 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
324 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
325 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
326 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
327 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
328 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
329 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
330 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
331 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
332 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
333 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
334 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
335 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
336 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
337 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
338 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
339 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
340 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
341 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
342 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
343 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
344 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
345 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
346 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
347 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
348 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
349 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
350 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
351 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
352 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
353 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
354 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
355 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
356 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
357 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
358 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
359 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
360 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
361 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
362 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
363 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
364 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
365 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
366 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
367 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
368 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
369 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
370 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
371 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
372 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
373 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
374 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
375 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
376 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
377 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
378 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
379 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
380 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
381 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
382 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
383 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
384 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
385 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
386 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
387 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
388 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
389 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
390 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
391 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
392 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
393 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
394 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
395 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
396 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
397 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
398 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
399 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
400 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
401 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
402 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
403 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
404 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
405 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
406 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
407 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
408 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
409 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
410 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
411 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
412 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
413 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
414 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
415 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
416 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
417 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
418 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
419 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
420 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
421 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
422 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
423 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
424 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
425 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
426 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
427 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
428 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
429 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
430 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
431 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
432 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
433 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
434 3300059509 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
435 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
436 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
437 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
438 3300059608 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 166R_SD_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
439 3300059622 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
440 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
441 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
442 3300059628 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 160R_AD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
443 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
444 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
445 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
446 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
447 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
448 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
449 3300059650 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 69R_SD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
450 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
451 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
452 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
453 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
454 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
455 8004212874 Microbacterium sp. NC79 Isolate Rhizosphere
456 8045830549 Microbacterium yannicii DSM 23203 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 78.95
Metatranscriptomes 14.9
Isolates 6.14

Biome Distribution

Category Percentage (%)
Aerial Root 0.46
Bulb 0
Endosphere 6.48
Nodule 0
Rhizoplane 7.05
Rhizosphere 72.81
Stem 0
Stem Tuber 0
Unclassified 13.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10073607 3300001989 Bacteria 1060
2 JGI24743J22301_10010175 3300001991 Bacteria 1675
3 JGI24735J21928_10084376 3300002067 Bacteria 910
4 JGI25154J39366_1001284 3300002738 Bacteria 9360
5 Ga0006778J45830_1015710 3300003162 Bacteria 568
6 JGI25407J50210_10045377 3300003373 Bacteria 1120
7 JGI25407J50210_10190372 3300003373 Bacteria 506
8 Ga0007417J51691_1012460 3300003544 Bacteria 776
9 Ga0007427J51700_111594 3300003559 Bacteria 664
10 Ga0007410J51695_1024883 3300003574 Bacteria 564
11 Ga0007410J51695_1028109 3300003574 Bacteria 537
12 Ga0006562J51391_1077031 3300003578 Bacteria 636
13 Ga0032354_1026694 3300003693 Bacteria 557
14 Ga0055542_1006658 3300003762 Bacteria 2442
15 Ga0058858_1426826 3300004785 Bacteria 719
16 Ga0058859_11241572 3300004798 Bacteria 678
17 Ga0058863_11633219 3300004799 Bacteria 722
18 Ga0058861_11584081 3300004800 Bacteria 798
19 Ga0058860_12151711 3300004801 Bacteria 837
20 Ga0065715_10795225 3300005293 Bacteria 607
21 Ga0070658_10029253 3300005327 Bacteria 4426
22 Ga0070658_10047629 3300005327 Bacteria 3469
23 Ga0070658_10069192 3300005327 Bacteria 2887
24 Ga0070677_10882910 3300005333 Bacteria 516
25 Ga0068869_100115301 3300005334 Bacteria 2048
26 Ga0070682_100259104 3300005337 Bacteria 1258
27 Ga0070682_100570786 3300005337 Bacteria 888
28 Ga0068868_100150079 3300005338 Bacteria 1919
29 Ga0070660_100596074 3300005339 Bacteria 924
30 Ga0070660_100831217 3300005339 Bacteria 777
31 Ga0070687_100394995 3300005343 Bacteria 905
32 Ga0070661_100023380 3300005344 Bacteria 4429
33 Ga0070661_100067572 3300005344 Bacteria 2627
34 Ga0070668_100483203 3300005347 Bacteria 1070
35 Ga0070668_100770527 3300005347 Bacteria 853
36 Ga0070671_100207927 3300005355 Bacteria 1660
37 Ga0070674_100407309 3300005356 Bacteria 1113
38 Ga0070674_100796350 3300005356 Bacteria 816
39 Ga0070688_100167655 3300005365 Bacteria 1513
40 Ga0070659_100013488 3300005366 Bacteria 6082
41 Ga0070667_100096421 3300005367 Bacteria 2550
42 Ga0070667_100181210 3300005367 Bacteria 1863
43 Ga0070667_100587386 3300005367 Bacteria 1026
44 Ga0070713_100193100 3300005436 Bacteria 1836
45 Ga0070700_100858929 3300005441 Bacteria 735
46 Ga0070663_100255275 3300005455 Bacteria 1389
47 Ga0070663_100300989 3300005455 Bacteria 1284
48 Ga0070663_100393866 3300005455 Bacteria 1131
49 Ga0070663_101184557 3300005455 Bacteria 671
50 Ga0070678_100231487 3300005456 Bacteria 1541
51 Ga0070662_100789224 3300005457 Bacteria 807
52 Ga0070662_101528167 3300005457 Bacteria 576
53 Ga0070681_10546975 3300005458 Bacteria 1071
54 Ga0070681_10850130 3300005458 Bacteria 830
55 Ga0070685_10047048 3300005466 Bacteria 2479
56 Ga0070685_10559517 3300005466 Bacteria 817
57 Ga0070706_101630657 3300005467 Bacteria 588
58 Ga0070679_101993241 3300005530 Bacteria 530
59 Ga0070697_100121856 3300005536 Bacteria 2182
60 Ga0068853_100028090 3300005539 Bacteria 4731
61 Ga0068853_100052946 3300005539 Bacteria 3495
62 Ga0068853_102058853 3300005539 Bacteria 553
63 Ga0068853_102248699 3300005539 Bacteria 528
64 Ga0070672_100207081 3300005543 Bacteria 1642
65 Ga0070695_100147064 3300005545 Bacteria 1640
66 Ga0070696_100044500 3300005546 Bacteria 3073
67 Ga0070693_100150524 3300005547 Bacteria 1473
68 Ga0070665_100027879 3300005548 Bacteria 5687
69 Ga0070704_100119640 3300005549 Bacteria 2020
70 Ga0068855_100030427 3300005563 Bacteria 6458
71 Ga0068855_100031330 3300005563 Bacteria 6350
72 Ga0068855_100056300 3300005563 Bacteria 4615
73 Ga0068855_100501765 3300005563 Bacteria 1318
74 Ga0070664_100683268 3300005564 Bacteria 955
75 Ga0068857_100021798 3300005577 Bacteria 5639
76 Ga0068857_100249321 3300005577 Bacteria 1627
77 Ga0068854_100102323 3300005578 Bacteria 2149
78 Ga0068854_100405067 3300005578 Bacteria 1130
79 Ga0068854_100660295 3300005578 Bacteria 899
80 Ga0068856_100344429 3300005614 Bacteria 1509
81 Ga0068856_101781922 3300005614 Bacteria 627
82 Ga0068856_101823740 3300005614 Bacteria 620
83 Ga0068856_102531017 3300005614 Bacteria 520
84 Ga0070702_101405681 3300005615 Bacteria 571
85 Ga0068852_100017671 3300005616 Bacteria 5601
86 Ga0068852_100066070 3300005616 Bacteria 3158
87 Ga0068859_100052312 3300005617 Bacteria 4106
88 Ga0068864_100148152 3300005618 Bacteria 2123
89 Ga0068851_10000174 3300005834 Bacteria 32729
90 Ga0068870_11008324 3300005840 Bacteria 594
91 Ga0068870_11415049 3300005840 Bacteria 510
92 Ga0068863_100056137 3300005841 Bacteria 3728
93 Ga0068863_100252035 3300005841 Bacteria 1705
94 Ga0068863_101873710 3300005841 Bacteria 610
95 Ga0068860_100001180 3300005843 Bacteria 28624
96 Ga0068860_100086873 3300005843 Bacteria 2977
97 Ga0068860_100424812 3300005843 Bacteria 1318
98 Ga0081455_10003134 3300005937 Bacteria 19237
99 Ga0081455_10014161 3300005937 Bacteria 7835
100 Ga0081538_10000991 3300005981 Bacteria 30132
101 Ga0081538_10048190 3300005981 Bacteria 2602
102 Ga0070717_10109999 3300006028 Bacteria 2349
103 Ga0070717_10887028 3300006028 Bacteria 812
104 Ga0075365_10111041 3300006038 Bacteria 1884
105 Ga0075365_10262019 3300006038 Bacteria 1215
106 Ga0075365_10579281 3300006038 Bacteria 794
107 Ga0075368_10101365 3300006042 Bacteria 1182
108 Ga0075368_10359718 3300006042 Bacteria 635
109 Ga0075363_100011874 3300006048 Bacteria 4183
110 Ga0075363_100272113 3300006048 Bacteria 978
111 Ga0075363_100990878 3300006048 Bacteria 517
112 Ga0075364_10028577 3300006051 Bacteria 3570
113 Ga0075364_10217284 3300006051 Bacteria 1296
114 Ga0075364_10759428 3300006051 Bacteria 661
115 Ga0070715_10828491 3300006163 Bacteria 564
116 Ga0070716_101514141 3300006173 Bacteria 549
117 Ga0075367_10000695 3300006178 Bacteria 12946
118 Ga0075367_10192528 3300006178 Bacteria 1272
119 Ga0075369_10000991 3300006186 Bacteria 9469
120 Ga0075369_10013993 3300006186 Bacteria 3197
121 Ga0075369_10639133 3300006186 Bacteria 511
122 Ga0075366_10569042 3300006195 Bacteria 702
123 Ga0097621_101678718 3300006237 Bacteria 605
124 Ga0075370_10004480 3300006353 Bacteria 6789
125 Ga0075370_10188480 3300006353 Bacteria 1215
126 Ga0075370_10504242 3300006353 Bacteria 730
127 Ga0075370_10819922 3300006353 Bacteria 568
128 Ga0068865_101940892 3300006881 Bacteria 534
129 Ga0097620_100052313 3300006931 Bacteria 4106
130 Ga0105251_10087257 3300009011 Bacteria 1436
131 Ga0105251_10257942 3300009011 Bacteria 786
132 Ga0105244_10056209 3300009036 Bacteria 1993
133 Ga0105244_10102657 3300009036 Bacteria 1397
134 Ga0105240_10005074 3300009093 Bacteria 19737
135 Ga0105240_10078100 3300009093 Bacteria 4077
136 Ga0105240_11267102 3300009093 Bacteria 779
137 Ga0105240_11791100 3300009093 Bacteria 640
138 Ga0111539_11700456 3300009094 Bacteria 732
139 Ga0105245_10032365 3300009098 Bacteria 4629
140 Ga0105247_10377835 3300009101 Bacteria 1004
141 Ga0105247_11733047 3300009101 Bacteria 518
142 Ga0105243_11176410 3300009148 Bacteria 779
143 Ga0105241_10010709 3300009174 Bacteria 6729
144 Ga0105241_10320648 3300009174 Bacteria 1336
145 Ga0105241_10345131 3300009174 Bacteria 1291
146 Ga0105241_10902309 3300009174 Bacteria 821
147 Ga0105242_10703009 3300009176 Bacteria 989
148 Ga0105237_10000660 3300009545 Bacteria 47919
149 Ga0105237_10061574 3300009545 Bacteria 3752
150 Ga0105237_10108611 3300009545 Bacteria 2766
151 Ga0105237_10182819 3300009545 Bacteria 2096
152 Ga0105237_11649273 3300009545 Bacteria 648
153 Ga0105238_10006538 3300009551 Bacteria 11608
154 Ga0105238_10141262 3300009551 Bacteria 2385
155 Ga0105249_12375663 3300009553 Bacteria 603
156 Ga0105030_113292 3300009987 Bacteria 719
157 Ga0105239_10230657 3300010375 Bacteria 2077
158 Ga0105239_10627199 3300010375 Bacteria 1227
159 Ga0105239_11108833 3300010375 Bacteria 911
160 Ga0105246_10092415 3300011119 Bacteria 2183
161 Ga0105246_10734437 3300011119 Bacteria 869
162 Ga0157328_1005549 3300012478 Bacteria 741
163 Ga0157342_1068135 3300012507 Bacteria 536
164 Ga0157370_10032625 3300013104 Bacteria 5084
165 Ga0157370_10056334 3300013104 Bacteria 3741
166 Ga0157370_10312667 3300013104 Bacteria 1449
167 Ga0157369_10042192 3300013105 Bacteria 4977
168 Ga0157369_10330001 3300013105 Bacteria 1585
169 Ga0157369_10488439 3300013105 Bacteria 1274
170 Ga0157369_10751155 3300013105 Bacteria 1003
171 Ga0157369_10906875 3300013105 Bacteria 904
172 Ga0171462_1003 3300013250 Bacteria 853796
173 Ga0157374_11406583 3300013296 Bacteria 720
174 Ga0157374_11948036 3300013296 Bacteria 614
175 Ga0163162_10010190 3300013306 Bacteria 9129
176 Ga0163162_10140160 3300013306 Bacteria 2531
177 Ga0163162_10425353 3300013306 Bacteria 1460
178 Ga0163162_11130635 3300013306 Bacteria 888
179 Ga0157372_10716384 3300013307 Bacteria 1164
180 Ga0157372_11232771 3300013307 Bacteria 864
181 Ga0157372_11595936 3300013307 Bacteria 751
182 Ga0157375_11348787 3300013308 Bacteria 839
183 Ga0157375_11617684 3300013308 Bacteria 766
184 Ga0163163_10027908 3300014325 Bacteria 5412
185 Ga0157380_10027310 3300014326 Bacteria 4340
186 Ga0157380_11512147 3300014326 Bacteria 725
187 Ga0157380_13187689 3300014326 Bacteria 524
188 Ga0157377_10132403 3300014745 Bacteria 1525
189 Ga0157377_10663261 3300014745 Bacteria 752
190 Ga0157379_10017319 3300014968 Bacteria 6349
191 Ga0157379_10023926 3300014968 Bacteria 5422
192 Ga0157379_12544100 3300014968 Bacteria 512
193 Ga0157376_10365935 3300014969 Bacteria 1384
194 Ga0157376_10510567 3300014969 Bacteria 1183
195 Ga0157376_11190019 3300014969 Bacteria 790
196 Ga0163161_10754691 3300017792 Bacteria 814
197 Ga0197907_10326987 3300020069 Bacteria 677
198 Ga0197907_10854447 3300020069 Bacteria 872
199 Ga0197907_10912036 3300020069 Bacteria 741
200 Ga0197907_10935291 3300020069 Bacteria 679
201 Ga0206356_10978583 3300020070 Bacteria 780
202 Ga0206356_11078444 3300020070 Bacteria 701
203 Ga0206356_11307403 3300020070 Bacteria 1172
204 Ga0206356_11376106 3300020070 Bacteria 1124
205 Ga0206348_109438 3300020071 Bacteria 661
206 Ga0206349_1061883 3300020075 Bacteria 770
207 Ga0206349_1634353 3300020075 Bacteria 1044
208 Ga0206349_1930185 3300020075 Bacteria 1379
209 Ga0206355_1014107 3300020076 Bacteria 723
210 Ga0206355_1167418 3300020076 Bacteria 808
211 Ga0206355_1276013 3300020076 Bacteria 1622
212 Ga0206355_1492312 3300020076 Bacteria 538
213 Ga0206355_1665678 3300020076 Bacteria 836
214 Ga0206355_1716449 3300020076 Bacteria 578
215 Ga0206351_10093022 3300020077 Bacteria 792
216 Ga0206351_10773028 3300020077 Bacteria 716
217 Ga0206351_10924608 3300020077 Bacteria 635
218 Ga0206352_10090527 3300020078 Bacteria 728
219 Ga0206352_10675540 3300020078 Bacteria 1079
220 Ga0206352_10998634 3300020078 Bacteria 843
221 Ga0206350_10430210 3300020080 Bacteria 824
222 Ga0206350_11165638 3300020080 Bacteria 692
223 Ga0206350_11217244 3300020080 Bacteria 958
224 Ga0206350_11364143 3300020080 Bacteria 733
225 Ga0206350_11438219 3300020080 Bacteria 718
226 Ga0206354_10160236 3300020081 Bacteria 1036
227 Ga0206354_10402436 3300020081 Bacteria 685
228 Ga0206354_10565015 3300020081 Bacteria 849
229 Ga0206354_10694027 3300020081 Bacteria 510
230 Ga0206354_11544819 3300020081 Bacteria 644
231 Ga0206353_10903616 3300020082 Bacteria 510
232 Ga0206353_11635006 3300020082 Bacteria 925
233 Ga0154015_1053277 3300020610 Bacteria 973
234 Ga0154015_1157237 3300020610 Bacteria 615
235 Ga0154015_1239016 3300020610 Bacteria 839
236 Ga0154015_1250307 3300020610 Bacteria 1094
237 Ga0154015_1266277 3300020610 Bacteria 571
238 Ga0154015_1310473 3300020610 Bacteria 688
239 Ga0154015_1416389 3300020610 Bacteria 584
240 Ga0213872_10356248 3300021361 Bacteria 599
241 Ga0224712_10148613 3300022467 Bacteria 1036
242 Ga0224712_10189565 3300022467 Bacteria 930
243 Ga0224712_10352643 3300022467 Bacteria 695
244 Ga0224712_10369055 3300022467 Bacteria 680
245 Ga0224712_10369422 3300022467 Bacteria 680
246 Ga0209646_1000071 3300025246 Bacteria 228702
247 Ga0209148_1000624 3300025254 Bacteria 31386
248 Ga0207656_10000002 3300025321 Bacteria 792178
249 Ga0207655_1003360 3300025728 Bacteria 11974
250 Ga0207713_1099531 3300025735 Bacteria 1006
251 Ga0207682_10470612 3300025893 Bacteria 595
252 Ga0207692_10028262 3300025898 Bacteria 2650
253 Ga0207710_10032300 3300025900 Bacteria 2293
254 Ga0207710_10169267 3300025900 Bacteria 1068
255 Ga0207710_10257946 3300025900 Bacteria 873
256 Ga0207685_10807095 3300025905 Bacteria 517
257 Ga0207643_10464632 3300025908 Bacteria 806
258 Ga0207643_10926238 3300025908 Bacteria 564
259 Ga0207705_10054040 3300025909 Bacteria 2895
260 Ga0207705_10426787 3300025909 Bacteria 1027
261 Ga0207705_11112833 3300025909 Bacteria 608
262 Ga0207684_11283800 3300025910 Bacteria 603
263 Ga0207654_10000001 3300025911 Bacteria 1816198
264 Ga0207654_11260105 3300025911 Bacteria 539
265 Ga0207707_11371392 3300025912 Bacteria 565
266 Ga0207695_10021351 3300025913 Bacteria 7388
267 Ga0207695_10022892 3300025913 Bacteria 7077
268 Ga0207695_10173790 3300025913 Bacteria 2078
269 Ga0207695_10720620 3300025913 Bacteria 878
270 Ga0207671_10000002 3300025914 Bacteria 1144816
271 Ga0207671_10044467 3300025914 Bacteria 3284
272 Ga0207693_10033430 3300025915 Bacteria 4058
273 Ga0207663_10321275 3300025916 Bacteria 1163
274 Ga0207660_11139543 3300025917 Bacteria 635
275 Ga0207660_11169074 3300025917 Bacteria 626
276 Ga0207662_10251634 3300025918 Bacteria 1160
277 Ga0207662_11299709 3300025918 Bacteria 517
278 Ga0207657_10010777 3300025919 Bacteria 9101
279 Ga0207657_11379855 3300025919 Bacteria 530
280 Ga0207649_10032826 3300025920 Bacteria 3097
281 Ga0207652_11793600 3300025921 Bacteria 519
282 Ga0207694_10000153 3300025924 Bacteria 71753
283 Ga0207694_10040322 3300025924 Bacteria 3594
284 Ga0207694_10084470 3300025924 Bacteria 2497
285 Ga0207650_10831746 3300025925 Bacteria 783
286 Ga0207659_10906264 3300025926 Bacteria 758
287 Ga0207687_10020899 3300025927 Bacteria 4345
288 Ga0207687_10029146 3300025927 Bacteria 3711
289 Ga0207700_10356705 3300025928 Bacteria 1274
290 Ga0207700_10976598 3300025928 Bacteria 758
291 Ga0207664_10393745 3300025929 Bacteria 1231
292 Ga0207664_11170215 3300025929 Bacteria 686
293 Ga0207644_10119010 3300025931 Bacteria 2008
294 Ga0207690_10020759 3300025932 Bacteria 4063
295 Ga0207686_10863071 3300025934 Bacteria 729
296 Ga0207709_10885638 3300025935 Bacteria 725
297 Ga0207709_11013473 3300025935 Bacteria 679
298 Ga0207669_10657570 3300025937 Bacteria 858
299 Ga0207704_10853159 3300025938 Bacteria 763
300 Ga0207691_10217438 3300025940 Bacteria 1658
301 Ga0207691_10881571 3300025940 Bacteria 750
302 Ga0207711_10063716 3300025941 Bacteria 3183
303 Ga0207711_10260653 3300025941 Bacteria 1593
304 Ga0207667_10054976 3300025949 Bacteria 4186
305 Ga0207667_10110945 3300025949 Bacteria 2829
306 Ga0207667_10189711 3300025949 Bacteria 2109
307 Ga0207667_10266651 3300025949 Bacteria 1751
308 Ga0207667_10483383 3300025949 Bacteria 1257
309 Ga0207667_11098447 3300025949 Bacteria 779
310 Ga0207651_10300070 3300025960 Bacteria 1335
311 Ga0207668_10858252 3300025972 Bacteria 806
312 Ga0207668_11187525 3300025972 Bacteria 685
313 Ga0207640_10433669 3300025981 Bacteria 1079
314 Ga0207658_10020806 3300025986 Bacteria 4545
315 Ga0207658_10380954 3300025986 Bacteria 1235
316 Ga0207658_10491206 3300025986 Bacteria 1092
317 Ga0207677_10020605 3300026023 Bacteria 4007
318 Ga0207677_10079415 3300026023 Bacteria 2346
319 Ga0207677_10124572 3300026023 Bacteria 1945
320 Ga0207703_10000031 3300026035 Bacteria 196940
321 Ga0207703_10248429 3300026035 Bacteria 1602
322 Ga0207639_10022174 3300026041 Bacteria 4572
323 Ga0207678_10001249 3300026067 Bacteria 23448
324 Ga0207678_10450075 3300026067 Bacteria 1119
325 Ga0207678_10623151 3300026067 Bacteria 947
326 Ga0207708_10424430 3300026075 Bacteria 1103
327 Ga0207702_10053773 3300026078 Bacteria 3410
328 Ga0207702_10093978 3300026078 Bacteria 2631
329 Ga0207702_10354150 3300026078 Bacteria 1405
330 Ga0207641_10044128 3300026088 Bacteria 3748
331 Ga0207641_10253188 3300026088 Bacteria 1645
332 Ga0207641_12452901 3300026088 Bacteria 520
333 Ga0207648_12021970 3300026089 Bacteria 537
334 Ga0207676_10107667 3300026095 Bacteria 2325
335 Ga0207674_10059775 3300026116 Bacteria 3856
336 Ga0207674_10229669 3300026116 Bacteria 1803
337 Ga0207683_10021780 3300026121 Bacteria 5494
338 Ga0207683_10128823 3300026121 Bacteria 2275
339 Ga0207698_10140748 3300026142 Bacteria 2078
340 Ga0207698_10640032 3300026142 Bacteria 1052
341 Ga0209813_10136791 3300027866 Bacteria 866
342 Ga0209813_10482102 3300027866 Bacteria 512
343 Ga0268266_10087579 3300028379 Bacteria 2725
344 Ga0268266_10306749 3300028379 Bacteria 1482
345 Ga0268266_11383849 3300028379 Bacteria 679
346 Ga0268265_10884593 3300028380 Bacteria 876
347 Ga0268264_10000987 3300028381 Bacteria 29098
348 Ga0268264_10137202 3300028381 Bacteria 2176
349 Ga0268264_10511587 3300028381 Bacteria 1172
350 Ga0268264_11402415 3300028381 Bacteria 709
351 Ga0265334_10007622 3300028573 Bacteria 4637
352 Ga0307515_10446720 3300028794 Bacteria 909
353 Ga0307515_10483612 3300028794 Bacteria 850
354 Ga0307511_10316414 3300030521 Bacteria 693
355 Ga0314311_1122579 3300030733 Bacteria 927
356 Ga0316181_1252750 3300030744 Bacteria 1754
357 Ga0316182_1109466 3300030745 Bacteria 3392
358 Ga0307513_10907350 3300031456 Bacteria 589
359 Ga0307509_10536258 3300031507 Bacteria 850
360 Ga0307408_100270314 3300031548 Bacteria 1411
361 Ga0307408_101175431 3300031548 Bacteria 715
362 Ga0307514_10383541 3300031649 Bacteria 728
363 Ga0316575_10002481 3300031665 Bacteria 6207
364 Ga0316579_10030946 3300031691 Bacteria 2447
365 Ga0316579_10079621 3300031691 Bacteria 1559
366 Ga0316579_10121107 3300031691 Bacteria 1257
367 Ga0316576_10006347 3300031727 Bacteria 7349
368 Ga0316576_10039257 3300031727 Bacteria 3397
369 Ga0316576_10046810 3300031727 Bacteria 3132
370 Ga0316576_10083058 3300031727 Bacteria 2379
371 Ga0316578_10025525 3300031728 Bacteria 3323
372 Ga0316578_10040601 3300031728 Bacteria 2691
373 Ga0316578_10050930 3300031728 Bacteria 2424
374 Ga0307405_10579826 3300031731 Bacteria 912
375 Ga0307405_11055901 3300031731 Bacteria 696
376 Ga0307405_11752215 3300031731 Bacteria 551
377 Ga0307405_11761025 3300031731 Bacteria 550
378 Ga0316577_10037186 3300031733 Bacteria 2722
379 Ga0316577_10150171 3300031733 Bacteria 1313
380 Ga0316577_10303288 3300031733 Bacteria 905
381 Ga0307413_10352090 3300031824 Bacteria 1137
382 Ga0307410_10099134 3300031852 Bacteria 2085
383 Ga0307410_10852134 3300031852 Bacteria 778
384 Ga0307410_11872070 3300031852 Bacteria 534
385 Ga0307406_10014155 3300031901 Bacteria 4584
386 Ga0307406_10492598 3300031901 Bacteria 992
387 Ga0307406_10983925 3300031901 Bacteria 723
388 Ga0307407_10031786 3300031903 Bacteria 2863
389 Ga0307407_10485365 3300031903 Bacteria 903
390 Ga0307412_10226887 3300031911 Bacteria 1436
391 Ga0307409_100039407 3300031995 Bacteria 3506
392 Ga0307409_100114010 3300031995 Bacteria 2273
393 Ga0307409_100455060 3300031995 Bacteria 1236
394 Ga0307416_100114623 3300032002 Bacteria 2385
395 Ga0307416_100284593 3300032002 Bacteria 1632
396 Ga0307416_101076555 3300032002 Bacteria 908
397 Ga0307414_10147875 3300032004 Bacteria 1849
398 Ga0307414_11262500 3300032004 Bacteria 685
399 Ga0307414_12025678 3300032004 Bacteria 537
400 Ga0307411_10276741 3300032005 Bacteria 1334
401 Ga0307415_100393359 3300032126 Bacteria 1181
402 Ga0316583_10006503 3300032133 Bacteria 4197
403 Ga0316583_10157169 3300032133 Bacteria 791
404 Ga0316585_10008208 3300032137 Bacteria 3024
405 Ga0316580_10037842 3300032139 Bacteria 1491
406 Ga0316580_10083811 3300032139 Bacteria 975
407 Ga0316593_10004078 3300032168 Bacteria 3705
408 Ga0316593_10036808 3300032168 Bacteria 1615
409 Ga0316593_10116587 3300032168 Bacteria 956
410 Ga0316592_1040494 3300033524 Bacteria 1030
411 Ga0316592_1100203 3300033524 Bacteria 666
412 Ga0316586_1059785 3300033527 Bacteria 691
413 Ga0316588_1066174 3300033528 Bacteria 885
414 Ga0316588_1143549 3300033528 Bacteria 611
415 Ga0316588_1157459 3300033528 Bacteria 584
416 Ga0316596_1000246 3300033541 Bacteria 8300
417 Ga0316596_1030137 3300033541 Bacteria 1406
418 Ga0316596_1070862 3300033541 Bacteria 933
419 Ga0316596_1185114 3300033541 Bacteria 577
420 Ga0316596_1202893 3300033541 Unclassified 552
421 Ga0316574_0009952 3300035398 Bacteria 5350
422 Ga0316574_0030284 3300035398 Bacteria 3276
423 Ga0316574_0136834 3300035398 Bacteria 1577
424 Ga0316574_0170914 3300035398 Bacteria 1399
425 Ga0316582_0299072 3300036647 Bacteria 1105
426 Ga0316582_0442099 3300036647 Bacteria 896
427 Ga0316582_0673026 3300036647 Bacteria 711
428 Ga0316584_0001267 3300036712 Bacteria 14951
429 Ga0316584_0045469 3300036712 Bacteria 3277
430 Ga0316584_0080072 3300036712 Bacteria 2447
431 Ga0316584_0950130 3300036712 Bacteria 576
432 Ga0395899_0381370 3300037312 Bacteria 937
433 Ga0395900_0017198 3300037418 Bacteria 7380
434 Ga0395900_0127340 3300037418 Bacteria 2611
435 Ga0395900_1424141 3300037418 Bacteria 606
436 Ga0395900_1502563 3300037418 Bacteria 586
437 Ga0395898_0287877 3300037466 Bacteria 1567
438 Ga0395898_0346737 3300037466 Bacteria 1416
439 Ga0395898_1424394 3300037466 Bacteria 620
440 Ga0395898_1907993 3300037466 Bacteria 514
441 Ga0316581_0000149 3300037588 Bacteria 10812
442 Ga0395901_0778705 3300038443 Bacteria 947
443 Ga0400485_19729 3300038735 Bacteria 13426
444 Ga0400486_32646 3300038742 Bacteria 15037
445 Ga0400489_87014 3300039093 Bacteria 1317
446 Ga0436365_1513875 3300039437 Bacteria 1120
447 Ga0436361_0965496 3300039447 Bacteria 1300
448 Ga0436362_1249237 3300039453 Bacteria 570
449 Ga0439439_0110793 3300041406 Bacteria 761
450 Ga0439466_0114319 3300041411 Bacteria 836
451 Ga0439466_0161318 3300041411 Bacteria 686
452 Ga0439465_0048243 3300041413 Bacteria 1389
453 Ga0439465_0090100 3300041413 Bacteria 1048
454 Ga0439465_0123823 3300041413 Bacteria 908
455 Ga0451789_0231381 3300041443 Bacteria 669
456 Ga0451789_0396782 3300041443 Bacteria 1311
457 Ga0451790_30891 3300041444 Bacteria 581
458 Ga0451796_10591 3300041450 Bacteria 716
459 Ga0451793_0715769 3300041452 Bacteria 780
460 Ga0451793_0789263 3300041452 Bacteria 2434
461 Ga0451797_1218952 3300041453 Bacteria 507
462 Ga0451797_1255051 3300041453 Bacteria 544
463 Ga0451795_0292788 3300041456 Bacteria 580
464 Ga0451795_0294527 3300041456 Bacteria 640
465 Ga0451795_0902187 3300041456 Bacteria 845
466 Ga0451800_1058039 3300041459 Bacteria 694
467 Ga0451800_1401438 3300041459 Bacteria 634
468 Ga0451802_0085081 3300041460 Bacteria 751
469 Ga0451802_0143883 3300041460 Bacteria 616
470 Ga0451802_0800214 3300041460 Bacteria 558
471 Ga0451807_1553210 3300041486 Bacteria 649
472 Ga0451807_1667980 3300041486 Bacteria 627
473 Ga0451807_2621320 3300041486 Bacteria 537
474 Ga0451833_0276161 3300041491 Bacteria 4559
475 Ga0451837_0160140 3300041494 Bacteria 681
476 Ga0451837_0210431 3300041494 Bacteria 814
477 Ga0451837_0949823 3300041494 Bacteria 558
478 Ga0451837_1052852 3300041494 Bacteria 3865
479 Ga0451839_0010674 3300041496 Bacteria 2785
480 Ga0451841_0315296 3300041498 Bacteria 551
481 Ga0451841_0963788 3300041498 Bacteria 1753
482 Ga0451845_0086215 3300041501 Bacteria 1298
483 Ga0451846_47497 3300041502 Bacteria 581
484 Ga0451843_0176465 3300041509 Bacteria 743
485 Ga0451843_0390362 3300041509 Bacteria 552
486 Ga0451843_1649887 3300041509 Bacteria 618
487 Ga0451843_1745894 3300041509 Bacteria 638
488 Ga0451855_1387741 3300041511 Bacteria 578
489 Ga0451853_0057221 3300041512 Bacteria 7174
490 Ga0451853_0407957 3300041512 Bacteria 569
491 Ga0451853_2386619 3300041512 Bacteria 1746
492 Ga0451853_2624360 3300041512 Bacteria 504
493 Ga0439445_0027772 3300042004 Bacteria 1455
494 Ga0439432_056326 3300042006 Bacteria 1218
495 Ga0439446_0094568 3300042156 Bacteria 939
496 Ga0439459_0112591 3300042438 Bacteria 678
497 Ga0466969_0017660 3300044656 Bacteria 3723
498 Ga0466969_0062150 3300044656 Bacteria 1813
499 Ga0466969_0248751 3300044656 Bacteria 806
500 Ga0466972_0037579 3300044658 Bacteria 2367
501 Ga0466972_0168960 3300044658 Bacteria 1027
502 Ga0466972_0213221 3300044658 Bacteria 903
503 Ga0466972_0217083 3300044658 Bacteria 895
504 Ga0466972_0402998 3300044658 Bacteria 641
505 Ga0466965_0161261 3300044683 Bacteria 1176
506 Ga0466965_0238911 3300044683 Bacteria 972
507 Ga0466965_0406016 3300044683 Bacteria 753
508 Ga0466965_0422065 3300044683 Bacteria 739
509 Ga0466965_0474493 3300044683 Bacteria 699
510 Ga0466965_0894244 3300044683 Bacteria 518
511 Ga0466966_0098303 3300044684 Bacteria 1812
512 Ga0466966_0131941 3300044684 Bacteria 1529
513 Ga0466966_0398987 3300044684 Bacteria 826
514 Ga0466961_0041554 3300044693 Bacteria 2948
515 Ga0466961_0067005 3300044693 Bacteria 2280
516 Ga0466961_0109310 3300044693 Bacteria 1740
517 Ga0466961_0426426 3300044693 Bacteria 804
518 Ga0466961_0904767 3300044693 Bacteria 525
519 Ga0466963_0239166 3300044694 Bacteria 1273
520 Ga0466964_0023349 3300044706 Bacteria 2405
521 Ga0453684_0837163 3300044712 Bacteria 990
522 Ga0466971_0246736 3300044719 Bacteria 850
523 Ga0466968_0088816 3300044735 Bacteria 1367
524 Ga0466968_0090654 3300044735 Bacteria 1354
525 Ga0466970_0005900 3300044765 Bacteria 6101
526 Ga0466970_0058962 3300044765 Bacteria 2055
527 Ga0466970_0193928 3300044765 Bacteria 1129
528 Ga0466970_0369744 3300044765 Bacteria 815
529 Ga0466970_0864876 3300044765 Bacteria 531
530 Ga0466957_0101812 3300044842 Bacteria 1811
531 Ga0466957_0536768 3300044842 Bacteria 814
532 Ga0466957_0693127 3300044842 Bacteria 718
533 Ga0466957_0980112 3300044842 Bacteria 606
534 Ga0466960_0250145 3300044901 Bacteria 984
535 Ga0466960_0977053 3300044901 Bacteria 519
536 Ga0466959_0143603 3300045049 Bacteria 1685
537 Ga0466959_0190525 3300045049 Bacteria 1431
538 Ga0466959_0391539 3300045049 Bacteria 945
539 Ga0466958_0327777 3300045836 Bacteria 984
540 Ga0466958_0981194 3300045836 Bacteria 551
541 Ga0466967_0305278 3300045976 Bacteria 1532
542 Ga0466967_0484939 3300045976 Bacteria 1211
543 Ga0466967_0832639 3300045976 Bacteria 917
544 Ga0466967_0987869 3300045976 Bacteria 838
545 Ga0466967_1835973 3300045976 Bacteria 603
546 Ga0466967_2177912 3300045976 Bacteria 550
547 Ga0495627_097854 3300046453 Bacteria 840
548 Ga0495591_122499 3300046458 Bacteria 634
549 Ga0495638_0135324 3300046460 Bacteria 1444
550 Ga0495650_0010799 3300046471 Bacteria 5065
551 Ga0495650_0024978 3300046471 Bacteria 2812
552 Ga0495639_0171620 3300046475 Bacteria 1053
553 Ga0495620_0275483 3300046515 Bacteria 640
554 Ga0495631_0349853 3300046518 Bacteria 629
555 Ga0495643_0142616 3300046522 Bacteria 1193
556 Ga0495654_0032925 3300046530 Bacteria 2626
557 Ga0495609_0049279 3300046538 Bacteria 1880
558 Ga0495656_0251254 3300046615 Bacteria 893
559 Ga0495625_0142695 3300046660 Bacteria 1615
560 Ga0495657_0334786 3300046675 Bacteria 898
561 Ga0495647_0407478 3300046681 Bacteria 625
562 Ga0495671_0229100 3300046692 Bacteria 899
563 Ga0495649_0078152 3300046694 Bacteria 1771
564 Ga0495672_0245464 3300047320 Bacteria 872
565 Ga0495672_0428121 3300047320 Bacteria 601
566 Ga0495686_0187319 3300047472 Bacteria 1195
567 Ga0495626_0211333 3300048091 Bacteria 791
568 Ga0496100_0018960 3300048903 Bacteria 4095
569 Ga0496100_0209265 3300048903 Bacteria 1426
570 Ga0496100_0231191 3300048903 Bacteria 1360
571 Ga0496101_0006334 3300048904 Bacteria 7616
572 Ga0496102_0022739 3300048905 Bacteria 5557
573 Ga0496102_0217530 3300048905 Bacteria 1801
574 Ga0496102_0346625 3300048905 Bacteria 1398
575 Ga0496102_1780292 3300048905 Bacteria 533
576 Ga0496103_0011718 3300048906 Bacteria 5201
577 Ga0496104_0005777 3300048907 Bacteria 10829
578 Ga0496104_0121240 3300048907 Bacteria 2510
579 Ga0496104_0202754 3300048907 Bacteria 1895
580 Ga0496105_0002712 3300048908 Bacteria 12913
581 Ga0496105_0053232 3300048908 Bacteria 3342
582 Ga0496105_0133027 3300048908 Bacteria 2049
583 Ga0496106_0020578 3300048909 Bacteria 4898
584 Ga0496107_0004317 3300048910 Bacteria 9625
585 Ga0496107_0065388 3300048910 Bacteria 2636
586 Ga0496108_0010564 3300048911 Bacteria 7495
587 Ga0496108_0035480 3300048911 Bacteria 4146
588 Ga0496108_0211667 3300048911 Bacteria 1683
589 Ga0496109_0008423 3300048912 Bacteria 8766
590 Ga0496109_0033739 3300048912 Bacteria 4606
591 Ga0496110_1716588 3300048913 Bacteria 538
592 Ga0496111_0001311 3300048914 Bacteria 13958
593 Ga0496111_0174980 3300048914 Bacteria 1595
594 Ga0496111_0685254 3300048914 Bacteria 746
595 Ga0496111_0762851 3300048914 Bacteria 701
596 Ga0496112_0031543 3300048915 Bacteria 5142
597 Ga0496112_0040203 3300048915 Bacteria 4572
598 Ga0496112_0212811 3300048915 Bacteria 1890
599 Ga0496112_1614501 3300048915 Bacteria 562
600 Ga0496113_0049454 3300048916 Bacteria 3130
601 Ga0496113_0107738 3300048916 Bacteria 2165
602 Ga0496114_0023635 3300048917 Bacteria 5016
603 Ga0496114_0063976 3300048917 Bacteria 3080
604 Ga0496114_0181650 3300048917 Bacteria 1837
605 Ga0496114_0553668 3300048917 Bacteria 1016
606 Ga0496114_1141878 3300048917 Bacteria 664
607 Ga0496114_1271347 3300048917 Bacteria 622
608 Ga0496115_0033887 3300048918 Bacteria 4034
609 Ga0496115_0058473 3300048918 Bacteria 3102
610 Ga0496115_0487868 3300048918 Bacteria 991
611 Ga0496116_0022531 3300048919 Bacteria 4717
612 Ga0496117_0000053 3300048920 Bacteria 279396
613 Ga0496117_0002379 3300048920 Bacteria 23971
614 Ga0496117_0005856 3300048920 Bacteria 12723
615 Ga0496117_0019479 3300048920 Bacteria 5570
616 Ga0496117_0034093 3300048920 Bacteria 3842
617 Ga0496117_0188220 3300048920 Bacteria 1179
618 Ga0496117_0319738 3300048920 Bacteria 814
619 Ga0496118_0000134 3300048921 Bacteria 130991
620 Ga0496118_0003938 3300048921 Bacteria 18160
621 Ga0496118_0277403 3300048921 Bacteria 935
622 Ga0496118_0332049 3300048921 Bacteria 819
623 Ga0496118_0454331 3300048921 Bacteria 649
624 Ga0496119_0002876 3300048922 Bacteria 18371
625 Ga0496119_0002920 3300048922 Bacteria 18233
626 Ga0496119_0007344 3300048922 Bacteria 9964
627 Ga0496119_0033701 3300048922 Bacteria 3389
628 Ga0496119_0099165 3300048922 Bacteria 1639
629 Ga0496119_0106653 3300048922 Bacteria 1563
630 Ga0496120_0001606 3300048923 Bacteria 26223
631 Ga0496120_0002418 3300048923 Bacteria 18940
632 Ga0496120_0005690 3300048923 Bacteria 9839
633 Ga0496120_0010747 3300048923 Bacteria 6347
634 Ga0496120_0018423 3300048923 Bacteria 4502
635 Ga0496120_0026291 3300048923 Bacteria 3596
636 Ga0496120_0060529 3300048923 Bacteria 2118
637 Ga0496120_0149235 3300048923 Bacteria 1177
638 Ga0496122_0000030 3300048925 Bacteria 331586
639 Ga0496122_0001750 3300048925 Bacteria 33455
640 Ga0496122_0002826 3300048925 Bacteria 23793
641 Ga0496122_0024042 3300048925 Bacteria 5344
642 Ga0496122_0170148 3300048925 Bacteria 1315
643 Ga0496123_0000024 3300048926 Bacteria 331587
644 Ga0496123_0003526 3300048926 Bacteria 17426
645 Ga0496123_0003716 3300048926 Bacteria 16787
646 Ga0496123_0141416 3300048926 Bacteria 1315
647 Ga0496123_0335998 3300048926 Bacteria 708
648 Ga0496124_0000256 3300048927 Bacteria 102144
649 Ga0496124_0003673 3300048927 Bacteria 18552
650 Ga0496124_0058865 3300048927 Bacteria 3229
651 Ga0496124_0227210 3300048927 Bacteria 1398
652 Ga0496124_0490252 3300048927 Bacteria 827
653 Ga0496124_0493084 3300048927 Bacteria 823
654 Ga0496125_0004043 3300048928 Bacteria 17191
655 Ga0496125_0004883 3300048928 Bacteria 15211
656 Ga0496125_0580132 3300048928 Bacteria 616
657 Ga0496126_0004970 3300048929 Bacteria 15509
658 Ga0496126_0008058 3300048929 Bacteria 11419
659 Ga0496126_0083076 3300048929 Bacteria 2828
660 Ga0496126_0466232 3300048929 Bacteria 1014
661 Ga0501306_055966 3300049127 Bacteria 642
662 Ga0501308_080432 3300049128 Bacteria 518
663 Ga0501305_048878 3300049161 Bacteria 705
664 Ga0501311_028365 3300049527 Bacteria 799
665 Ga0501311_053509 3300049527 Bacteria 638
666 Ga0501317_015058 3300049533 Bacteria 988
667 Ga0501317_033450 3300049533 Bacteria 757
668 Ga0501317_036146 3300049533 Bacteria 737
669 Ga0501317_061733 3300049533 Bacteria 616
670 Ga0501318_041901 3300049534 Bacteria 657
671 Ga0501321_016150 3300049537 Bacteria 886
672 Ga0501325_012740 3300049541 Bacteria 796
673 Ga0501031_0005342 3300049568 Bacteria 8367
674 Ga0501032_0068474 3300049569 Bacteria 2369
675 Ga0501032_0095790 3300049569 Bacteria 1967
676 Ga0501032_0161073 3300049569 Bacteria 1473
677 Ga0501033_0072472 3300049570 Bacteria 2529
678 Ga0501033_0717353 3300049570 Bacteria 679
679 Ga0501034_0037990 3300049571 Bacteria 4876
680 Ga0501034_0970943 3300049571 Bacteria 734
681 Ga0501034_1714836 3300049571 Bacteria 500
682 Ga0501036_0087292 3300049572 Bacteria 2636
683 Ga0501036_0158878 3300049572 Bacteria 1906
684 Ga0501036_0182437 3300049572 Bacteria 1767
685 Ga0501036_1024362 3300049572 Bacteria 675
686 Ga0501037_0025811 3300049573 Bacteria 4339
687 Ga0501037_0034216 3300049573 Bacteria 3749
688 Ga0501037_0053602 3300049573 Bacteria 2950
689 Ga0501037_0177813 3300049573 Bacteria 1511
690 Ga0501038_0014449 3300049574 Bacteria 7196
691 Ga0501038_0284053 3300049574 Bacteria 1302
692 Ga0501039_0011177 3300049575 Bacteria 6840
693 Ga0501039_0086806 3300049575 Bacteria 2437
694 Ga0501040_0541873 3300049576 Bacteria 840
695 Ga0501041_0942164 3300049577 Bacteria 555
696 Ga0501042_0095433 3300049578 Bacteria 2136
697 Ga0501042_0779368 3300049578 Bacteria 696
698 Ga0501042_1051445 3300049578 Bacteria 593
699 Ga0501043_0010788 3300049579 Bacteria 7155
700 Ga0501043_0115130 3300049579 Bacteria 2110
701 Ga0501043_0178628 3300049579 Bacteria 1654
702 Ga0501046_0010145 3300049580 Bacteria 8108
703 Ga0501046_0771402 3300049580 Bacteria 675
704 Ga0501047_0245072 3300049581 Bacteria 1641
705 Ga0501047_0266290 3300049581 Bacteria 1560
706 Ga0501047_0958811 3300049581 Bacteria 669
707 Ga0501048_0023082 3300049582 Bacteria 4548
708 Ga0501048_0591621 3300049582 Bacteria 796
709 Ga0501048_1228041 3300049582 Bacteria 539
710 Ga0501067_0083654 3300049583 Bacteria 1770
711 Ga0501067_0153901 3300049583 Bacteria 1281
712 Ga0501067_0502075 3300049583 Bacteria 679
713 Ga0501068_0182487 3300049584 Bacteria 1327
714 Ga0501068_0277994 3300049584 Bacteria 1070
715 Ga0501069_0018628 3300049585 Bacteria 3748
716 Ga0501069_0039598 3300049585 Bacteria 2604
717 Ga0501069_0110795 3300049585 Bacteria 1563
718 Ga0501070_0053511 3300049586 Bacteria 3348
719 Ga0501070_0059346 3300049586 Bacteria 3171
720 Ga0501070_0180838 3300049586 Bacteria 1735
721 Ga0501071_0478029 3300049587 Bacteria 955
722 Ga0501071_1219130 3300049587 Bacteria 581
723 Ga0501073_0027393 3300049589 Bacteria 4075
724 Ga0501073_0354250 3300049589 Bacteria 1013
725 Ga0501073_0440406 3300049589 Bacteria 901
726 Ga0501074_0295009 3300049590 Bacteria 1152
727 Ga0501074_1259389 3300049590 Bacteria 518
728 Ga0501076_0431158 3300049592 Bacteria 1085
729 Ga0501077_0796427 3300049593 Bacteria 608
730 Ga0501079_0094252 3300049741 Bacteria 2320
731 Ga0501079_0111553 3300049741 Bacteria 2125
732 Ga0501080_0021682 3300049742 Bacteria 5948
733 Ga0501080_0155978 3300049742 Bacteria 2109
734 Ga0501081_0218466 3300049743 Bacteria 1386
735 Ga0501081_0316629 3300049743 Bacteria 1146
736 Ga0501035_0215456 3300049822 Bacteria 1641
737 Ga0501035_0467071 3300049822 Bacteria 1042
738 Ga0501035_1376757 3300049822 Bacteria 541
739 Ga0501044_0042949 3300049823 Bacteria 4698
740 Ga0501044_1628706 3300049823 Bacteria 510
741 Ga0501045_0473750 3300049824 Bacteria 930
742 nmdc:mga03n38_222569_c1 3300050490 Bacteria 986
743 nmdc:mga00v17_114948_c1 3300050491 Bacteria 1710
744 nmdc:mga00v17_173872_c1 3300050491 Bacteria 1389
745 nmdc:mga00v17_296205_c1 3300050491 Bacteria 1051
746 nmdc:mga00v17_310638_c1 3300050491 Bacteria 1024
747 nmdc:mga00v17_62442_c1 3300050491 Bacteria 2292
748 nmdc:mga00v17_971_c1 3300050491 Bacteria 15352
749 nmdc:mga0yw44_114563_c1 3300050492 Bacteria 1731
750 nmdc:mga0yw44_22559_c1 3300050492 Bacteria 3532
751 nmdc:mga0yw44_289036_c1 3300050492 Bacteria 1097
752 nmdc:mga0yw44_82211_c1 3300050492 Bacteria 2020
753 nmdc:mga0k408_872708_c1 3300050493 Bacteria 522
754 nmdc:mga06z11_391110_c1 3300050494 Bacteria 836
755 nmdc:mga06z11_4263_c1 3300050494 Bacteria 5614
756 nmdc:mga04h51_82785_c1 3300050495 Bacteria 1142
757 nmdc:mga07m45_16476_c1 3300050496 Bacteria 3957
758 nmdc:mga07m45_60779_c1 3300050496 Bacteria 2139
759 nmdc:mga07m45_657785_c1 3300050496 Bacteria 604
760 nmdc:mga07m45_733198_c1 3300050496 Bacteria 568
761 nmdc:mga0sz30_2151_c1 3300050516 Bacteria 7038
762 nmdc:mga0sz30_4797_c2 3300050516 Bacteria 3699
763 Ga0495619_0873288 3300053085 Bacteria 606
764 Ga0500643_000174 3300053087 Bacteria 63222
765 Ga0500651_0001075 3300053093 Bacteria 13493
766 Ga0500641_0006257 3300053096 Bacteria 4224
767 Ga0500556_0000001 3300053104 Bacteria 1135060
768 Ga0500559_0016386 3300053136 Bacteria 3128
769 Ga0500568_0000006 3300053139 Bacteria 522235
770 Ga0500573_0000023 3300053140 Bacteria 152268
771 Ga0500573_0323798 3300053140 Bacteria 760
772 Ga0500573_0369953 3300053140 Bacteria 689
773 Ga0500616_0000221 3300053153 Bacteria 88983
774 Ga0500620_000031 3300053155 Bacteria 27977
775 Ga0501084_0434284 3300054114 Bacteria 1110
776 Ga0501084_0476250 3300054114 Bacteria 1055
777 Ga0590075_078126 3300059424 Bacteria 857
778 Ga0587093_048773 3300059478 Bacteria 663
779 Ga0587066_073211 3300059490 Bacteria 726
780 Ga0587066_080776 3300059490 Bacteria 704
781 Ga0587070_056282 3300059491 Bacteria 800
782 Ga0587073_0124378 3300059492 Bacteria 700
783 Ga0587073_0124825 3300059492 Bacteria 699
784 Ga0587073_0242641 3300059492 Bacteria 561
785 Ga0587077_102352 3300059493 Bacteria 690
786 Ga0587080_109638 3300059503 Bacteria 600
787 Ga0587082_049701 3300059504 Bacteria 796
788 Ga0587083_0074773 3300059505 Bacteria 794
789 Ga0587086_015905 3300059507 Bacteria 977
790 Ga0587088_031686 3300059508 Bacteria 949
791 Ga0587088_054641 3300059508 Bacteria 792
792 Ga0587089_042758 3300059509 Bacteria 706
793 Ga0587089_109428 3300059509 Bacteria 509
794 Ga0587091_026687 3300059511 Bacteria 1054
795 Ga0587091_099077 3300059511 Bacteria 681
796 Ga0587098_034335 3300059604 Bacteria 712
797 Ga0587106_035625 3300059605 Bacteria 821
798 Ga0587106_051237 3300059605 Bacteria 732
799 Ga0587106_149983 3300059605 Bacteria 518
800 Ga0587129_023990 3300059608 Bacteria 557
801 Ga0587099_049749 3300059622 Bacteria 557
802 Ga0587101_039922 3300059623 Bacteria 770
803 Ga0587101_106997 3300059623 Bacteria 563
804 Ga0587115_009733 3300059626 Bacteria 1185
805 Ga0587115_042285 3300059626 Bacteria 716
806 Ga0587122_016159 3300059628 Bacteria 769
807 Ga0587128_023558 3300059630 Bacteria 966
808 Ga0587128_085130 3300059630 Bacteria 639
809 Ga0587068_073356 3300059641 Bacteria 679
810 Ga0587069_024639 3300059642 Bacteria 930
811 Ga0587075_068341 3300059644 Bacteria 655
812 Ga0587078_089476 3300059646 Bacteria 503
813 Ga0587079_051091 3300059647 Bacteria 868
814 Ga0587079_076662 3300059647 Bacteria 756
815 Ga0587104_009990 3300059650 Bacteria 691
816 Ga0587114_017539 3300059655 Bacteria 972
817 Ga0587071_040609 3300060344 Bacteria 931
818 Ga0587071_083584 3300060344 Bacteria 715
819 Ga0587111_0096733 3300060346 Bacteria 729
820 Ga0501082_0150864 3300060353 Bacteria 2019
821 Ga0501082_0571534 3300060353 Bacteria 989
822 Ga0501082_0706465 3300060353 Bacteria 882
823 Ga0466962_0043154 3300061719 Bacteria 2158
824 Ga0466962_0178297 3300061719 Bacteria 1036
825 Ga0466962_0590282 3300061719 Bacteria 566

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300003373 JGI25407J50210_10045377 JGI25407J50210_100453773 79
2 3300005981 Ga0081538_10000991 Ga0081538_1000099120 79
3 iso_pu_bacteria 2751185788 2753301336 79
4 iso_pu_bacteria 2857733635 2857733678 79
5 iso_pu_bacteria 2904430863 2904433443 79
6 iso_pu_bacteria 2904501621 2904503690 79
7 iso_pu_bacteria 2908674828 2908675330 79
8 iso_pu_bacteria 2909074476 2909075347 79
9 iso_pu_bacteria 2919039151 2919040014 79
10 iso_pu_bacteria 2919042368 2919044963 79
11 iso_pu_bacteria 2928104781 2928106751 79
12 iso_pu_bacteria 2928500415 2928501355 79
13 iso_pu_bacteria 2984551494 2984553523 79
14 iso_pu_bacteria 8004212874 8004214050 79
15 iso_pu_bacteria 2643221546 2643753461 80
16 iso_pu_bacteria 2643221635 2644198464 80
17 iso_pu_bacteria 2808606447 2809227500 80
18 iso_pu_bacteria 2811994880 2812364754 80
19 iso_pu_bacteria 2852632344 2852634262 80
20 iso_pu_bacteria 2984592036 2984594183 80
21 3300031691 Ga0316579_10079621 Ga0316579_100796212 81
22 3300031727 Ga0316576_10083058 Ga0316576_100830582 81
23 3300031728 Ga0316578_10050930 Ga0316578_100509303 81
24 3300032139 Ga0316580_10083811 Ga0316580_100838113 81
25 3300035398 Ga0316574_0170914 Ga0316574_0170914_344_595 81
26 3300036647 Ga0316582_0442099 Ga0316582_0442099_611_862 81
27 iso_pu_bacteria 2643221566 2643848163 81
28 iso_pu_bacteria 2643221572 2643875189 81
29 iso_pu_bacteria 2643221597 2643995665 81
30 iso_pu_bacteria 2643221669 2644382245 81
31 iso_pu_bacteria 2643221681 2644456396 81
32 iso_pu_bacteria 2643221961 2645723000 81
33 iso_pu_bacteria 2643221962 2645725955 81
34 iso_pu_bacteria 2757320536 2758226058 81
35 iso_pu_bacteria 2758568522 2760306592 81
36 iso_pu_bacteria 2773857758 2774380297 81
37 iso_pu_bacteria 2773857759 2774384586 81
38 iso_pu_bacteria 2808606439 2809195363 81
39 iso_pu_bacteria 2808606700 2810363920 81
40 iso_pu_bacteria 2811994872 2812323272 81
41 iso_pu_bacteria 2833709550 2833711030 81
42 iso_pu_bacteria 2857720070 2857720236 81
43 iso_pu_bacteria 2857729791 2857730044 81
44 iso_pu_bacteria 2870628048 2870630427 81
45 iso_pu_bacteria 2891968417 2891972140 81
46 iso_pu_bacteria 2895660088 2895661316 81
47 iso_pu_bacteria 2904509784 2904511925 81
48 iso_pu_bacteria 2905926851 2905926929 81
49 iso_pu_bacteria 2906799679 2906800636 81
50 iso_pu_bacteria 2908678064 2908680838 81
51 iso_pu_bacteria 2919069694 2919071612 81
52 iso_pu_bacteria 2928090899 2928091926 81
53 iso_pu_bacteria 2928121344 2928123269 81
54 iso_pu_bacteria 2946003308 2946004207 81
55 iso_pu_bacteria 2974294766 2974297254 81
56 iso_pu_bacteria 2974324384 2974326511 81
57 iso_pu_bacteria 2977228692 2977231491 81
58 iso_pu_bacteria 2977236895 2977240265 81
59 iso_pu_bacteria 2977264416 2977266705 81
60 iso_pu_bacteria 2984542743 2984545457 81
61 iso_pu_bacteria 2984580707 2984581307 81
62 iso_pu_bacteria 8045830549 8045831660 81
63 3300031456 Ga0307513_10907350 Ga0307513_109073502 82
64 3300031727 Ga0316576_10006347 Ga0316576_1000634710 82
65 3300031728 Ga0316578_10040601 Ga0316578_100406012 82
66 3300031733 Ga0316577_10303288 Ga0316577_103032883 82
67 3300032168 Ga0316593_10036808 Ga0316593_100368082 82
68 3300033528 Ga0316588_1143549 Ga0316588_11435492 82
69 3300033541 Ga0316596_1070862 Ga0316596_10708622 82
70 3300035398 Ga0316574_0009952 Ga0316574_0009952_2640_2888 82
71 3300036712 Ga0316584_0045469 Ga0316584_0045469_867_1115 82
72 3300047472 Ga0495686_0187319 Ga0495686_0187319_923_1171 82
73 3300053104 Ga0500556_0000001 Ga0500556_0000001_550040_550288 82
74 3300053139 Ga0500568_0000006 Ga0500568_0000006_144355_144603 82
75 3300003578 Ga0006562J51391_1077031 Ga0006562J51391_10770312 83
76 3300009011 Ga0105251_10257942 Ga0105251_102579422 83
77 3300020076 Ga0206355_1167418 Ga0206355_11674182 83
78 3300025900 Ga0207710_10257946 Ga0207710_102579462 83
79 3300030521 Ga0307511_10316414 Ga0307511_103164142 83
80 3300031824 Ga0307413_10352090 Ga0307413_103520901 83
81 3300031852 Ga0307410_10852134 Ga0307410_108521342 83
82 3300036712 Ga0316584_0950130 Ga0316584_0950130_185_442 83
83 3300041460 Ga0451802_0143883 Ga0451802_0143883_138_389 83
84 3300044656 Ga0466969_0062150 Ga0466969_0062150_903_1154 83
85 3300044658 Ga0466972_0402998 Ga0466972_0402998_156_407 83
86 3300044735 Ga0466968_0088816 Ga0466968_0088816_352_603 83
87 3300044765 Ga0466970_0005900 Ga0466970_0005900_4332_4583 83
88 3300046518 Ga0495631_0349853 Ga0495631_0349853_175_426 83
89 3300046538 Ga0495609_0049279 Ga0495609_0049279_584_835 83
90 3300048091 Ga0495626_0211333 Ga0495626_0211333_26_277 83
91 3300048903 Ga0496100_0209265 Ga0496100_0209265_811_1062 83
92 3300048905 Ga0496102_0346625 Ga0496102_0346625_601_852 83
93 3300048913 Ga0496110_1716588 Ga0496110_1716588_143_394 83
94 3300048920 Ga0496117_0002379 Ga0496117_0002379_13239_13490 83
95 3300048921 Ga0496118_0000134 Ga0496118_0000134_57145_57396 83
96 3300048922 Ga0496119_0033701 Ga0496119_0033701_1349_1600 83
97 3300048923 Ga0496120_0060529 Ga0496120_0060529_897_1148 83
98 3300048927 Ga0496124_0000256 Ga0496124_0000256_66557_66808 83
99 3300048927 Ga0496124_0490252 Ga0496124_0490252_13_264 83
100 3300048927 Ga0496124_0493084 Ga0496124_0493084_73_324 83
101 3300053087 Ga0500643_000174 Ga0500643_000174_52139_52390 83
102 3300053140 Ga0500573_0000023 Ga0500573_0000023_99423_99674 83
103 3300053153 Ga0500616_0000221 Ga0500616_0000221_53389_53640 83
104 3300059630 Ga0587128_085130 Ga0587128_085130_371_622 83
105 3300003762 Ga0055542_1006658 Ga0055542_10066582 84
106 3300005327 Ga0070658_10029253 Ga0070658_100292533 84
107 3300005327 Ga0070658_10047629 Ga0070658_100476292 84
108 3300005327 Ga0070658_10069192 Ga0070658_100691925 84
109 3300005338 Ga0068868_100150079 Ga0068868_1001500792 84
110 3300005339 Ga0070660_100831217 Ga0070660_1008312172 84
111 3300005344 Ga0070661_100023380 Ga0070661_1000233805 84
112 3300005355 Ga0070671_100207927 Ga0070671_1002079272 84
113 3300005366 Ga0070659_100013488 Ga0070659_1000134885 84
114 3300005367 Ga0070667_100096421 Ga0070667_1000964213 84
115 3300005436 Ga0070713_100193100 Ga0070713_1001931003 84
116 3300005455 Ga0070663_100393866 Ga0070663_1003938663 84
117 3300005457 Ga0070662_100789224 Ga0070662_1007892241 84
118 3300005466 Ga0070685_10559517 Ga0070685_105595172 84
119 3300005530 Ga0070679_101993241 Ga0070679_1019932411 84
120 3300005539 Ga0068853_100028090 Ga0068853_1000280904 84
121 3300005539 Ga0068853_102248699 Ga0068853_1022486991 84
122 3300005543 Ga0070672_100207081 Ga0070672_1002070813 84
123 3300005563 Ga0068855_100031330 Ga0068855_1000313305 84
124 3300005563 Ga0068855_100501765 Ga0068855_1005017653 84
125 3300005577 Ga0068857_100021798 Ga0068857_1000217982 84
126 3300005577 Ga0068857_100249321 Ga0068857_1002493212 84
127 3300005578 Ga0068854_100405067 Ga0068854_1004050672 84
128 3300005614 Ga0068856_100344429 Ga0068856_1003444291 84
129 3300005614 Ga0068856_101781922 Ga0068856_1017819221 84
130 3300005615 Ga0070702_101405681 Ga0070702_1014056811 84
131 3300005616 Ga0068852_100017671 Ga0068852_1000176712 84
132 3300005616 Ga0068852_100066070 Ga0068852_1000660702 84
133 3300005617 Ga0068859_100052312 Ga0068859_1000523124 84
134 3300005834 Ga0068851_10000174 Ga0068851_100001748 84
135 3300005841 Ga0068863_100252035 Ga0068863_1002520352 84
136 3300005841 Ga0068863_101873710 Ga0068863_1018737102 84
137 3300005937 Ga0081455_10003134 Ga0081455_1000313411 84
138 3300005937 Ga0081455_10014161 Ga0081455_100141612 84
139 3300006028 Ga0070717_10887028 Ga0070717_108870282 84
140 3300006038 Ga0075365_10579281 Ga0075365_105792812 84
141 3300006173 Ga0070716_101514141 Ga0070716_1015141412 84
142 3300006931 Ga0097620_100052313 Ga0097620_1000523134 84
143 3300009093 Ga0105240_10005074 Ga0105240_1000507422 84
144 3300009093 Ga0105240_11267102 Ga0105240_112671022 84
145 3300009098 Ga0105245_10032365 Ga0105245_100323655 84
146 3300009101 Ga0105247_10377835 Ga0105247_103778352 84
147 3300009101 Ga0105247_11733047 Ga0105247_117330471 84
148 3300009148 Ga0105243_11176410 Ga0105243_111764102 84
149 3300009174 Ga0105241_10010709 Ga0105241_100107096 84
150 3300009174 Ga0105241_10345131 Ga0105241_103451313 84
151 3300009545 Ga0105237_10000660 Ga0105237_1000066048 84
152 3300009545 Ga0105237_10182819 Ga0105237_101828192 84
153 3300009545 Ga0105237_11649273 Ga0105237_116492732 84
154 3300009551 Ga0105238_10006538 Ga0105238_100065389 84
155 3300009553 Ga0105249_12375663 Ga0105249_123756631 84
156 3300010375 Ga0105239_10230657 Ga0105239_102306575 84
157 3300010375 Ga0105239_11108833 Ga0105239_111088332 84
158 3300011119 Ga0105246_10734437 Ga0105246_107344373 84
159 3300013104 Ga0157370_10312667 Ga0157370_103126672 84
160 3300013105 Ga0157369_10488439 Ga0157369_104884392 84
161 3300013105 Ga0157369_10751155 Ga0157369_107511551 84
162 3300013296 Ga0157374_11406583 Ga0157374_114065832 84
163 3300013296 Ga0157374_11948036 Ga0157374_119480362 84
164 3300013306 Ga0163162_11130635 Ga0163162_111306352 84
165 3300013307 Ga0157372_11232771 Ga0157372_112327712 84
166 3300014325 Ga0163163_10027908 Ga0163163_100279086 84
167 3300014326 Ga0157380_11512147 Ga0157380_115121472 84
168 3300014968 Ga0157379_10023926 Ga0157379_100239262 84
169 3300014969 Ga0157376_10510567 Ga0157376_105105672 84
170 3300020069 Ga0197907_10326987 Ga0197907_103269872 84
171 3300020069 Ga0197907_10854447 Ga0197907_108544471 84
172 3300020069 Ga0197907_10912036 Ga0197907_109120361 84
173 3300020069 Ga0197907_10935291 Ga0197907_109352912 84
174 3300020070 Ga0206356_10978583 Ga0206356_109785831 84
175 3300020076 Ga0206355_1014107 Ga0206355_10141072 84
176 3300020076 Ga0206355_1276013 Ga0206355_12760132 84
177 3300020076 Ga0206355_1665678 Ga0206355_16656782 84
178 3300020077 Ga0206351_10773028 Ga0206351_107730281 84
179 3300020077 Ga0206351_10924608 Ga0206351_109246082 84
180 3300020078 Ga0206352_10090527 Ga0206352_100905272 84
181 3300020080 Ga0206350_10430210 Ga0206350_104302101 84
182 3300020080 Ga0206350_11165638 Ga0206350_111656382 84
183 3300020080 Ga0206350_11364143 Ga0206350_113641431 84
184 3300020080 Ga0206350_11438219 Ga0206350_114382192 84
185 3300020081 Ga0206354_10694027 Ga0206354_106940271 84
186 3300020082 Ga0206353_10903616 Ga0206353_109036162 84
187 3300020610 Ga0154015_1053277 Ga0154015_10532772 84
188 3300020610 Ga0154015_1157237 Ga0154015_11572372 84
189 3300020610 Ga0154015_1250307 Ga0154015_12503073 84
190 3300020610 Ga0154015_1310473 Ga0154015_13104732 84
191 3300020610 Ga0154015_1416389 Ga0154015_14163892 84
192 3300022467 Ga0224712_10369055 Ga0224712_103690551 84
193 3300022467 Ga0224712_10369422 Ga0224712_103694221 84
194 3300025254 Ga0209148_1000624 Ga0209148_100062423 84
195 3300025321 Ga0207656_10000002 Ga0207656_10000002243 84
196 3300025900 Ga0207710_10169267 Ga0207710_101692672 84
197 3300025909 Ga0207705_10054040 Ga0207705_100540402 84
198 3300025909 Ga0207705_10426787 Ga0207705_104267872 84
199 3300025909 Ga0207705_11112833 Ga0207705_111128331 84
200 3300025911 Ga0207654_10000001 Ga0207654_100000011612 84
201 3300025911 Ga0207654_11260105 Ga0207654_112601051 84
202 3300025913 Ga0207695_10021351 Ga0207695_100213515 84
203 3300025913 Ga0207695_10022892 Ga0207695_100228922 84
204 3300025913 Ga0207695_10720620 Ga0207695_107206201 84
205 3300025914 Ga0207671_10000002 Ga0207671_10000002537 84
206 3300025914 Ga0207671_10044467 Ga0207671_100444675 84
207 3300025919 Ga0207657_10010777 Ga0207657_100107773 84
208 3300025920 Ga0207649_10032826 Ga0207649_100328265 84
209 3300025924 Ga0207694_10000153 Ga0207694_1000015344 84
210 3300025924 Ga0207694_10040322 Ga0207694_100403225 84
211 3300025926 Ga0207659_10906264 Ga0207659_109062642 84
212 3300025927 Ga0207687_10020899 Ga0207687_100208992 84
213 3300025927 Ga0207687_10029146 Ga0207687_100291462 84
214 3300025928 Ga0207700_10976598 Ga0207700_109765982 84
215 3300025932 Ga0207690_10020759 Ga0207690_100207595 84
216 3300025935 Ga0207709_10885638 Ga0207709_108856382 84
217 3300025938 Ga0207704_10853159 Ga0207704_108531592 84
218 3300025940 Ga0207691_10217438 Ga0207691_102174382 84
219 3300025941 Ga0207711_10063716 Ga0207711_100637165 84
220 3300025949 Ga0207667_10054976 Ga0207667_100549765 84
221 3300025949 Ga0207667_10189711 Ga0207667_101897113 84
222 3300025949 Ga0207667_10266651 Ga0207667_102666511 84
223 3300025986 Ga0207658_10020806 Ga0207658_100208063 84
224 3300026023 Ga0207677_10020605 Ga0207677_100206053 84
225 3300026023 Ga0207677_10124572 Ga0207677_101245723 84
226 3300026035 Ga0207703_10000031 Ga0207703_10000031118 84
227 3300026041 Ga0207639_10022174 Ga0207639_100221741 84
228 3300026067 Ga0207678_10623151 Ga0207678_106231512 84
229 3300026078 Ga0207702_10053773 Ga0207702_100537732 84
230 3300026088 Ga0207641_10253188 Ga0207641_102531881 84
231 3300026088 Ga0207641_12452901 Ga0207641_124529012 84
232 3300026116 Ga0207674_10059775 Ga0207674_100597752 84
233 3300026116 Ga0207674_10229669 Ga0207674_102296692 84
234 3300026142 Ga0207698_10140748 Ga0207698_101407482 84
235 3300026142 Ga0207698_10640032 Ga0207698_106400322 84
236 3300028381 Ga0268264_11402415 Ga0268264_114024152 84
237 3300028794 Ga0307515_10483612 Ga0307515_104836123 84
238 3300031691 Ga0316579_10121107 Ga0316579_101211072 84
239 3300031727 Ga0316576_10046810 Ga0316576_100468103 84
240 3300031733 Ga0316577_10150171 Ga0316577_101501713 84
241 3300032004 Ga0307414_11262500 Ga0307414_112625002 84
242 3300032133 Ga0316583_10157169 Ga0316583_101571691 84
243 3300032168 Ga0316593_10116587 Ga0316593_101165872 84
244 3300033524 Ga0316592_1100203 Ga0316592_11002032 84
245 3300033528 Ga0316588_1157459 Ga0316588_11574591 84
246 3300033541 Ga0316596_1030137 Ga0316596_10301373 84
247 3300035398 Ga0316574_0136834 Ga0316574_0136834_685_945 84
248 3300036647 Ga0316582_0673026 Ga0316582_0673026_423_683 84
249 3300036712 Ga0316584_0001267 Ga0316584_0001267_2435_2695 84
250 3300037418 Ga0395900_0017198 Ga0395900_0017198_3299_3553 84
251 3300037466 Ga0395898_0346737 Ga0395898_0346737_452_706 84
252 3300041459 Ga0451800_1058039 Ga0451800_1058039_236_490 84
253 3300041486 Ga0451807_2621320 Ga0451807_2621320_93_347 84
254 3300041494 Ga0451837_0160140 Ga0451837_0160140_100_354 84
255 3300041498 Ga0451841_0315296 Ga0451841_0315296_92_346 84
256 3300041509 Ga0451843_0176465 Ga0451843_0176465_136_390 84
257 3300041509 Ga0451843_1745894 Ga0451843_1745894_190_444 84
258 3300041512 Ga0451853_0057221 Ga0451853_0057221_2803_3057 84
259 3300041512 Ga0451853_2624360 Ga0451853_2624360_91_345 84
260 3300044683 Ga0466965_0161261 Ga0466965_0161261_257_511 84
261 3300044683 Ga0466965_0422065 Ga0466965_0422065_352_606 84
262 3300044712 Ga0453684_0837163 Ga0453684_0837163_94_348 84
263 3300044719 Ga0466971_0246736 Ga0466971_0246736_268_522 84
264 3300044901 Ga0466960_0977053 Ga0466960_0977053_58_312 84
265 3300045976 Ga0466967_0987869 Ga0466967_0987869_266_520 84
266 3300046471 Ga0495650_0024978 Ga0495650_0024978_649_909 84
267 3300048914 Ga0496111_0685254 Ga0496111_0685254_98_352 84
268 3300048915 Ga0496112_1614501 Ga0496112_1614501_282_536 84
269 3300048917 Ga0496114_0063976 Ga0496114_0063976_2682_2936 84
270 3300048917 Ga0496114_1141878 Ga0496114_1141878_266_520 84
271 3300048917 Ga0496114_1271347 Ga0496114_1271347_229_483 84
272 3300048920 Ga0496117_0034093 Ga0496117_0034093_3397_3651 84
273 3300048921 Ga0496118_0454331 Ga0496118_0454331_207_461 84
274 3300048922 Ga0496119_0002920 Ga0496119_0002920_11705_11959 84
275 3300048922 Ga0496119_0106653 Ga0496119_0106653_904_1158 84
276 3300048923 Ga0496120_0002418 Ga0496120_0002418_14442_14696 84
277 3300048923 Ga0496120_0018423 Ga0496120_0018423_1068_1322 84
278 3300048923 Ga0496120_0026291 Ga0496120_0026291_1267_1521 84
279 3300048923 Ga0496120_0149235 Ga0496120_0149235_136_390 84
280 3300048925 Ga0496122_0001750 Ga0496122_0001750_27663_27917 84
281 3300048926 Ga0496123_0003716 Ga0496123_0003716_8086_8340 84
282 3300048929 Ga0496126_0083076 Ga0496126_0083076_1988_2242 84
283 3300049533 Ga0501317_036146 Ga0501317_036146_466_720 84
284 3300049533 Ga0501317_061733 Ga0501317_061733_351_605 84
285 3300049568 Ga0501031_0005342 Ga0501031_0005342_1105_1359 84
286 3300049569 Ga0501032_0068474 Ga0501032_0068474_2041_2295 84
287 3300049569 Ga0501032_0095790 Ga0501032_0095790_434_688 84
288 3300049569 Ga0501032_0161073 Ga0501032_0161073_75_329 84
289 3300049570 Ga0501033_0072472 Ga0501033_0072472_673_927 84
290 3300049570 Ga0501033_0717353 Ga0501033_0717353_330_584 84
291 3300049571 Ga0501034_0037990 Ga0501034_0037990_306_560 84
292 3300049571 Ga0501034_0970943 Ga0501034_0970943_13_267 84
293 3300049571 Ga0501034_1714836 Ga0501034_1714836_172_426 84
294 3300049572 Ga0501036_0087292 Ga0501036_0087292_47_301 84
295 3300049572 Ga0501036_0158878 Ga0501036_0158878_1579_1833 84
296 3300049573 Ga0501037_0025811 Ga0501037_0025811_219_473 84
297 3300049573 Ga0501037_0034216 Ga0501037_0034216_3436_3690 84
298 3300049573 Ga0501037_0053602 Ga0501037_0053602_702_956 84
299 3300049574 Ga0501038_0014449 Ga0501038_0014449_2198_2452 84
300 3300049574 Ga0501038_0284053 Ga0501038_0284053_931_1185 84
301 3300049575 Ga0501039_0011177 Ga0501039_0011177_6446_6700 84
302 3300049575 Ga0501039_0086806 Ga0501039_0086806_1223_1477 84
303 3300049577 Ga0501041_0942164 Ga0501041_0942164_223_477 84
304 3300049578 Ga0501042_0095433 Ga0501042_0095433_769_1023 84
305 3300049578 Ga0501042_1051445 Ga0501042_1051445_65_319 84
306 3300049579 Ga0501043_0010788 Ga0501043_0010788_6834_7088 84
307 3300049579 Ga0501043_0115130 Ga0501043_0115130_1513_1767 84
308 3300049579 Ga0501043_0178628 Ga0501043_0178628_1349_1603 84
309 3300049580 Ga0501046_0010145 Ga0501046_0010145_4107_4361 84
310 3300049580 Ga0501046_0771402 Ga0501046_0771402_215_469 84
311 3300049581 Ga0501047_0245072 Ga0501047_0245072_75_329 84
312 3300049581 Ga0501047_0266290 Ga0501047_0266290_1232_1486 84
313 3300049581 Ga0501047_0958811 Ga0501047_0958811_295_549 84
314 3300049582 Ga0501048_0023082 Ga0501048_0023082_1840_2094 84
315 3300049582 Ga0501048_0591621 Ga0501048_0591621_111_365 84
316 3300049583 Ga0501067_0083654 Ga0501067_0083654_726_983 84
317 3300049583 Ga0501067_0153901 Ga0501067_0153901_274_528 84
318 3300049583 Ga0501067_0502075 Ga0501067_0502075_313_567 84
319 3300049584 Ga0501068_0182487 Ga0501068_0182487_287_541 84
320 3300049584 Ga0501068_0277994 Ga0501068_0277994_77_334 84
321 3300049585 Ga0501069_0018628 Ga0501069_0018628_1985_2239 84
322 3300049586 Ga0501070_0180838 Ga0501070_0180838_1373_1627 84
323 3300049587 Ga0501071_0478029 Ga0501071_0478029_177_431 84
324 3300049589 Ga0501073_0027393 Ga0501073_0027393_3634_3888 84
325 3300049589 Ga0501073_0354250 Ga0501073_0354250_26_280 84
326 3300049590 Ga0501074_1259389 Ga0501074_1259389_92_346 84
327 3300049592 Ga0501076_0431158 Ga0501076_0431158_379_633 84
328 3300049741 Ga0501079_0111553 Ga0501079_0111553_983_1237 84
329 3300049742 Ga0501080_0021682 Ga0501080_0021682_1242_1496 84
330 3300049743 Ga0501081_0316629 Ga0501081_0316629_364_618 84
331 3300049822 Ga0501035_0215456 Ga0501035_0215456_75_329 84
332 3300049822 Ga0501035_0467071 Ga0501035_0467071_311_565 84
333 3300049822 Ga0501035_1376757 Ga0501035_1376757_213_467 84
334 3300049823 Ga0501044_0042949 Ga0501044_0042949_4370_4624 84
335 3300049823 Ga0501044_1628706 Ga0501044_1628706_100_354 84
336 3300049824 Ga0501045_0473750 Ga0501045_0473750_106_360 84
337 3300053136 Ga0500559_0016386 Ga0500559_0016386_1382_1636 84
338 3300053140 Ga0500573_0369953 Ga0500573_0369953_132_386 84
339 3300053155 Ga0500620_000031 Ga0500620_000031_12395_12649 84
340 3300054114 Ga0501084_0476250 Ga0501084_0476250_299_553 84
341 3300059490 Ga0587066_073211 Ga0587066_073211_19_273 84
342 3300059490 Ga0587066_080776 Ga0587066_080776_166_420 84
343 3300059491 Ga0587070_056282 Ga0587070_056282_92_346 84
344 3300059492 Ga0587073_0242641 Ga0587073_0242641_127_381 84
345 3300059493 Ga0587077_102352 Ga0587077_102352_29_283 84
346 3300059507 Ga0587086_015905 Ga0587086_015905_392_646 84
347 3300059508 Ga0587088_031686 Ga0587088_031686_55_309 84
348 3300059509 Ga0587089_042758 Ga0587089_042758_427_681 84
349 3300059509 Ga0587089_109428 Ga0587089_109428_226_480 84
350 3300059511 Ga0587091_026687 Ga0587091_026687_414_668 84
351 3300059604 Ga0587098_034335 Ga0587098_034335_18_272 84
352 3300059605 Ga0587106_035625 Ga0587106_035625_409_663 84
353 3300059605 Ga0587106_149983 Ga0587106_149983_126_380 84
354 3300059608 Ga0587129_023990 Ga0587129_023990_209_463 84
355 3300059623 Ga0587101_039922 Ga0587101_039922_87_341 84
356 3300059623 Ga0587101_106997 Ga0587101_106997_218_472 84
357 3300059626 Ga0587115_042285 Ga0587115_042285_282_536 84
358 3300059641 Ga0587068_073356 Ga0587068_073356_21_275 84
359 3300059642 Ga0587069_024639 Ga0587069_024639_285_539 84
360 3300059646 Ga0587078_089476 Ga0587078_089476_92_346 84
361 3300059647 Ga0587079_051091 Ga0587079_051091_169_423 84
362 3300059647 Ga0587079_076662 Ga0587079_076662_477_731 84
363 3300059650 Ga0587104_009990 Ga0587104_009990_405_659 84
364 3300060344 Ga0587071_040609 Ga0587071_040609_282_536 84
365 3300060346 Ga0587111_0096733 Ga0587111_0096733_95_349 84
366 3300060353 Ga0501082_0706465 Ga0501082_0706465_516_770 84
367 3300061719 Ga0466962_0590282 Ga0466962_0590282_54_308 84
368 3300001989 JGI24739J22299_10073607 JGI24739J22299_100736073 85
369 3300001991 JGI24743J22301_10010175 JGI24743J22301_100101753 85
370 3300002067 JGI24735J21928_10084376 JGI24735J21928_100843761 85
371 3300002738 JGI25154J39366_1001284 JGI25154J39366_100128410 85
372 3300003162 Ga0006778J45830_1015710 Ga0006778J45830_10157102 85
373 3300003373 JGI25407J50210_10190372 JGI25407J50210_101903722 85
374 3300003544 Ga0007417J51691_1012460 Ga0007417J51691_10124602 85
375 3300003559 Ga0007427J51700_111594 Ga0007427J51700_1115942 85
376 3300003574 Ga0007410J51695_1024883 Ga0007410J51695_10248832 85
377 3300003574 Ga0007410J51695_1028109 Ga0007410J51695_10281092 85
378 3300003693 Ga0032354_1026694 Ga0032354_10266942 85
379 3300004785 Ga0058858_1426826 Ga0058858_14268262 85
380 3300004798 Ga0058859_11241572 Ga0058859_112415721 85
381 3300004799 Ga0058863_11633219 Ga0058863_116332191 85
382 3300004800 Ga0058861_11584081 Ga0058861_115840811 85
383 3300004801 Ga0058860_12151711 Ga0058860_121517111 85
384 3300005293 Ga0065715_10795225 Ga0065715_107952251 85
385 3300005333 Ga0070677_10882910 Ga0070677_108829101 85
386 3300005334 Ga0068869_100115301 Ga0068869_1001153011 85
387 3300005337 Ga0070682_100259104 Ga0070682_1002591042 85
388 3300005337 Ga0070682_100570786 Ga0070682_1005707861 85
389 3300005339 Ga0070660_100596074 Ga0070660_1005960742 85
390 3300005343 Ga0070687_100394995 Ga0070687_1003949952 85
391 3300005344 Ga0070661_100067572 Ga0070661_1000675723 85
392 3300005347 Ga0070668_100483203 Ga0070668_1004832032 85
393 3300005347 Ga0070668_100770527 Ga0070668_1007705272 85
394 3300005356 Ga0070674_100407309 Ga0070674_1004073092 85
395 3300005356 Ga0070674_100796350 Ga0070674_1007963501 85
396 3300005365 Ga0070688_100167655 Ga0070688_1001676551 85
397 3300005367 Ga0070667_100181210 Ga0070667_1001812102 85
398 3300005367 Ga0070667_100587386 Ga0070667_1005873862 85
399 3300005441 Ga0070700_100858929 Ga0070700_1008589291 85
400 3300005455 Ga0070663_100255275 Ga0070663_1002552752 85
401 3300005455 Ga0070663_100300989 Ga0070663_1003009892 85
402 3300005455 Ga0070663_101184557 Ga0070663_1011845571 85
403 3300005456 Ga0070678_100231487 Ga0070678_1002314872 85
404 3300005457 Ga0070662_101528167 Ga0070662_1015281671 85
405 3300005458 Ga0070681_10546975 Ga0070681_105469751 85
406 3300005458 Ga0070681_10850130 Ga0070681_108501301 85
407 3300005466 Ga0070685_10047048 Ga0070685_100470483 85
408 3300005467 Ga0070706_101630657 Ga0070706_1016306571 85
409 3300005536 Ga0070697_100121856 Ga0070697_1001218564 85
410 3300005539 Ga0068853_100052946 Ga0068853_1000529462 85
411 3300005539 Ga0068853_102058853 Ga0068853_1020588531 85
412 3300005545 Ga0070695_100147064 Ga0070695_1001470642 85
413 3300005546 Ga0070696_100044500 Ga0070696_1000445002 85
414 3300005547 Ga0070693_100150524 Ga0070693_1001505241 85
415 3300005548 Ga0070665_100027879 Ga0070665_1000278795 85
416 3300005549 Ga0070704_100119640 Ga0070704_1001196402 85
417 3300005563 Ga0068855_100030427 Ga0068855_1000304272 85
418 3300005563 Ga0068855_100056300 Ga0068855_1000563004 85
419 3300005564 Ga0070664_100683268 Ga0070664_1006832683 85
420 3300005578 Ga0068854_100102323 Ga0068854_1001023233 85
421 3300005578 Ga0068854_100660295 Ga0068854_1006602952 85
422 3300005614 Ga0068856_101823740 Ga0068856_1018237402 85
423 3300005614 Ga0068856_102531017 Ga0068856_1025310171 85
424 3300005618 Ga0068864_100148152 Ga0068864_1001481524 85
425 3300005840 Ga0068870_11008324 Ga0068870_110083241 85
426 3300005840 Ga0068870_11415049 Ga0068870_114150491 85
427 3300005841 Ga0068863_100056137 Ga0068863_1000561373 85
428 3300005843 Ga0068860_100001180 Ga0068860_10000118019 85
429 3300005843 Ga0068860_100086873 Ga0068860_1000868734 85
430 3300005843 Ga0068860_100424812 Ga0068860_1004248122 85
431 3300005981 Ga0081538_10048190 Ga0081538_100481901 85
432 3300006028 Ga0070717_10109999 Ga0070717_101099992 85
433 3300006038 Ga0075365_10111041 Ga0075365_101110413 85
434 3300006038 Ga0075365_10262019 Ga0075365_102620192 85
435 3300006042 Ga0075368_10101365 Ga0075368_101013653 85
436 3300006042 Ga0075368_10359718 Ga0075368_103597182 85
437 3300006048 Ga0075363_100011874 Ga0075363_1000118741 85
438 3300006048 Ga0075363_100272113 Ga0075363_1002721131 85
439 3300006048 Ga0075363_100990878 Ga0075363_1009908781 85
440 3300006051 Ga0075364_10028577 Ga0075364_100285773 85
441 3300006051 Ga0075364_10217284 Ga0075364_102172842 85
442 3300006051 Ga0075364_10759428 Ga0075364_107594282 85
443 3300006163 Ga0070715_10828491 Ga0070715_108284912 85
444 3300006178 Ga0075367_10000695 Ga0075367_100006959 85
445 3300006178 Ga0075367_10192528 Ga0075367_101925282 85
446 3300006186 Ga0075369_10000991 Ga0075369_100009917 85
447 3300006186 Ga0075369_10013993 Ga0075369_100139933 85
448 3300006186 Ga0075369_10639133 Ga0075369_106391331 85
449 3300006195 Ga0075366_10569042 Ga0075366_105690422 85
450 3300006237 Ga0097621_101678718 Ga0097621_1016787181 85
451 3300006353 Ga0075370_10004480 Ga0075370_100044807 85
452 3300006353 Ga0075370_10188480 Ga0075370_101884801 85
453 3300006353 Ga0075370_10504242 Ga0075370_105042422 85
454 3300006353 Ga0075370_10819922 Ga0075370_108199222 85
455 3300006881 Ga0068865_101940892 Ga0068865_1019408922 85
456 3300009011 Ga0105251_10087257 Ga0105251_100872572 85
457 3300009036 Ga0105244_10056209 Ga0105244_100562092 85
458 3300009036 Ga0105244_10102657 Ga0105244_101026572 85
459 3300009093 Ga0105240_10078100 Ga0105240_100781005 85
460 3300009093 Ga0105240_11791100 Ga0105240_117911002 85
461 3300009094 Ga0111539_11700456 Ga0111539_117004562 85
462 3300009174 Ga0105241_10320648 Ga0105241_103206482 85
463 3300009174 Ga0105241_10902309 Ga0105241_109023092 85
464 3300009176 Ga0105242_10703009 Ga0105242_107030092 85
465 3300009545 Ga0105237_10061574 Ga0105237_100615742 85
466 3300009545 Ga0105237_10108611 Ga0105237_101086114 85
467 3300009551 Ga0105238_10141262 Ga0105238_101412624 85
468 3300009987 Ga0105030_113292 Ga0105030_1132921 85
469 3300010375 Ga0105239_10627199 Ga0105239_106271993 85
470 3300011119 Ga0105246_10092415 Ga0105246_100924154 85
471 3300012478 Ga0157328_1005549 Ga0157328_10055492 85
472 3300012507 Ga0157342_1068135 Ga0157342_10681351 85
473 3300013104 Ga0157370_10032625 Ga0157370_100326252 85
474 3300013104 Ga0157370_10056334 Ga0157370_100563343 85
475 3300013105 Ga0157369_10042192 Ga0157369_100421926 85
476 3300013105 Ga0157369_10330001 Ga0157369_103300012 85
477 3300013105 Ga0157369_10906875 Ga0157369_109068752 85
478 3300013250 Ga0171462_1003 Ga0171462_1003330 85
479 3300013306 Ga0163162_10010190 Ga0163162_1001019010 85
480 3300013306 Ga0163162_10140160 Ga0163162_101401603 85
481 3300013306 Ga0163162_10425353 Ga0163162_104253534 85
482 3300013307 Ga0157372_10716384 Ga0157372_107163842 85
483 3300013307 Ga0157372_11595936 Ga0157372_115959362 85
484 3300013308 Ga0157375_11348787 Ga0157375_113487872 85
485 3300013308 Ga0157375_11617684 Ga0157375_116176841 85
486 3300014326 Ga0157380_10027310 Ga0157380_100273103 85
487 3300014326 Ga0157380_13187689 Ga0157380_131876891 85
488 3300014745 Ga0157377_10132403 Ga0157377_101324033 85
489 3300014745 Ga0157377_10663261 Ga0157377_106632612 85
490 3300014968 Ga0157379_10017319 Ga0157379_100173194 85
491 3300014968 Ga0157379_12544100 Ga0157379_125441001 85
492 3300014969 Ga0157376_10365935 Ga0157376_103659352 85
493 3300014969 Ga0157376_11190019 Ga0157376_111900192 85
494 3300017792 Ga0163161_10754691 Ga0163161_107546911 85
495 3300020070 Ga0206356_11078444 Ga0206356_110784442 85
496 3300020070 Ga0206356_11307403 Ga0206356_113074032 85
497 3300020070 Ga0206356_11376106 Ga0206356_113761062 85
498 3300020071 Ga0206348_109438 Ga0206348_1094381 85
499 3300020075 Ga0206349_1061883 Ga0206349_10618832 85
500 3300020075 Ga0206349_1634353 Ga0206349_16343532 85
501 3300020075 Ga0206349_1930185 Ga0206349_19301851 85
502 3300020076 Ga0206355_1492312 Ga0206355_14923122 85
503 3300020076 Ga0206355_1716449 Ga0206355_17164492 85
504 3300020077 Ga0206351_10093022 Ga0206351_100930222 85
505 3300020078 Ga0206352_10675540 Ga0206352_106755402 85
506 3300020078 Ga0206352_10998634 Ga0206352_109986342 85
507 3300020080 Ga0206350_11217244 Ga0206350_112172442 85
508 3300020081 Ga0206354_10160236 Ga0206354_101602362 85
509 3300020081 Ga0206354_10402436 Ga0206354_104024362 85
510 3300020081 Ga0206354_10565015 Ga0206354_105650151 85
511 3300020081 Ga0206354_11544819 Ga0206354_115448192 85
512 3300020082 Ga0206353_11635006 Ga0206353_116350062 85
513 3300020610 Ga0154015_1239016 Ga0154015_12390161 85
514 3300020610 Ga0154015_1266277 Ga0154015_12662771 85
515 3300021361 Ga0213872_10356248 Ga0213872_103562482 85
516 3300022467 Ga0224712_10148613 Ga0224712_101486132 85
517 3300022467 Ga0224712_10189565 Ga0224712_101895652 85
518 3300022467 Ga0224712_10352643 Ga0224712_103526431 85
519 3300025246 Ga0209646_1000071 Ga0209646_1000071121 85
520 3300025728 Ga0207655_1003360 Ga0207655_10033609 85
521 3300025735 Ga0207713_1099531 Ga0207713_10995312 85
522 3300025893 Ga0207682_10470612 Ga0207682_104706122 85
523 3300025898 Ga0207692_10028262 Ga0207692_100282622 85
524 3300025900 Ga0207710_10032300 Ga0207710_100323003 85
525 3300025905 Ga0207685_10807095 Ga0207685_108070952 85
526 3300025908 Ga0207643_10464632 Ga0207643_104646322 85
527 3300025908 Ga0207643_10926238 Ga0207643_109262381 85
528 3300025910 Ga0207684_11283800 Ga0207684_112838002 85
529 3300025912 Ga0207707_11371392 Ga0207707_113713922 85
530 3300025913 Ga0207695_10173790 Ga0207695_101737902 85
531 3300025915 Ga0207693_10033430 Ga0207693_100334304 85
532 3300025916 Ga0207663_10321275 Ga0207663_103212752 85
533 3300025917 Ga0207660_11139543 Ga0207660_111395432 85
534 3300025917 Ga0207660_11169074 Ga0207660_111690742 85
535 3300025918 Ga0207662_10251634 Ga0207662_102516343 85
536 3300025918 Ga0207662_11299709 Ga0207662_112997092 85
537 3300025919 Ga0207657_11379855 Ga0207657_113798552 85
538 3300025921 Ga0207652_11793600 Ga0207652_117936001 85
539 3300025924 Ga0207694_10084470 Ga0207694_100844702 85
540 3300025925 Ga0207650_10831746 Ga0207650_108317461 85
541 3300025928 Ga0207700_10356705 Ga0207700_103567051 85
542 3300025929 Ga0207664_10393745 Ga0207664_103937452 85
543 3300025929 Ga0207664_11170215 Ga0207664_111702152 85
544 3300025931 Ga0207644_10119010 Ga0207644_101190104 85
545 3300025934 Ga0207686_10863071 Ga0207686_108630712 85
546 3300025935 Ga0207709_11013473 Ga0207709_110134732 85
547 3300025937 Ga0207669_10657570 Ga0207669_106575702 85
548 3300025940 Ga0207691_10881571 Ga0207691_108815712 85
549 3300025941 Ga0207711_10260653 Ga0207711_102606533 85
550 3300025949 Ga0207667_10110945 Ga0207667_101109452 85
551 3300025949 Ga0207667_10483383 Ga0207667_104833832 85
552 3300025949 Ga0207667_11098447 Ga0207667_110984472 85
553 3300025960 Ga0207651_10300070 Ga0207651_103000702 85
554 3300025972 Ga0207668_10858252 Ga0207668_108582522 85
555 3300025972 Ga0207668_11187525 Ga0207668_111875252 85
556 3300025981 Ga0207640_10433669 Ga0207640_104336692 85
557 3300025986 Ga0207658_10380954 Ga0207658_103809542 85
558 3300025986 Ga0207658_10491206 Ga0207658_104912062 85
559 3300026023 Ga0207677_10079415 Ga0207677_100794152 85
560 3300026035 Ga0207703_10248429 Ga0207703_102484293 85
561 3300026067 Ga0207678_10001249 Ga0207678_1000124910 85
562 3300026067 Ga0207678_10450075 Ga0207678_104500752 85
563 3300026075 Ga0207708_10424430 Ga0207708_104244302 85
564 3300026078 Ga0207702_10093978 Ga0207702_100939782 85
565 3300026078 Ga0207702_10354150 Ga0207702_103541502 85
566 3300026088 Ga0207641_10044128 Ga0207641_100441283 85
567 3300026089 Ga0207648_12021970 Ga0207648_120219701 85
568 3300026095 Ga0207676_10107667 Ga0207676_101076673 85
569 3300026121 Ga0207683_10021780 Ga0207683_100217803 85
570 3300026121 Ga0207683_10128823 Ga0207683_101288232 85
571 3300027866 Ga0209813_10136791 Ga0209813_101367912 85
572 3300027866 Ga0209813_10482102 Ga0209813_104821021 85
573 3300028379 Ga0268266_10087579 Ga0268266_100875792 85
574 3300028379 Ga0268266_10306749 Ga0268266_103067492 85
575 3300028379 Ga0268266_11383849 Ga0268266_113838492 85
576 3300028380 Ga0268265_10884593 Ga0268265_108845933 85
577 3300028381 Ga0268264_10000987 Ga0268264_100009879 85
578 3300028381 Ga0268264_10137202 Ga0268264_101372023 85
579 3300028381 Ga0268264_10511587 Ga0268264_105115873 85
580 3300028573 Ga0265334_10007622 Ga0265334_100076222 85
581 3300028794 Ga0307515_10446720 Ga0307515_104467202 85
582 3300030733 Ga0314311_1122579 Ga0314311_11225793 85
583 3300030744 Ga0316181_1252750 Ga0316181_12527502 85
584 3300030745 Ga0316182_1109466 Ga0316182_11094663 85
585 3300031507 Ga0307509_10536258 Ga0307509_105362582 85
586 3300031548 Ga0307408_100270314 Ga0307408_1002703142 85
587 3300031548 Ga0307408_101175431 Ga0307408_1011754312 85
588 3300031649 Ga0307514_10383541 Ga0307514_103835412 85
589 3300031665 Ga0316575_10002481 Ga0316575_100024815 85
590 3300031691 Ga0316579_10030946 Ga0316579_100309462 85
591 3300031727 Ga0316576_10039257 Ga0316576_100392572 85
592 3300031728 Ga0316578_10025525 Ga0316578_100255252 85
593 3300031731 Ga0307405_10579826 Ga0307405_105798262 85
594 3300031731 Ga0307405_11055901 Ga0307405_110559011 85
595 3300031731 Ga0307405_11752215 Ga0307405_117522151 85
596 3300031731 Ga0307405_11761025 Ga0307405_117610252 85
597 3300031733 Ga0316577_10037186 Ga0316577_100371863 85
598 3300031852 Ga0307410_10099134 Ga0307410_100991343 85
599 3300031852 Ga0307410_11872070 Ga0307410_118720702 85
600 3300031901 Ga0307406_10014155 Ga0307406_100141551 85
601 3300031901 Ga0307406_10492598 Ga0307406_104925982 85
602 3300031901 Ga0307406_10983925 Ga0307406_109839252 85
603 3300031903 Ga0307407_10031786 Ga0307407_100317862 85
604 3300031903 Ga0307407_10485365 Ga0307407_104853652 85
605 3300031911 Ga0307412_10226887 Ga0307412_102268872 85
606 3300031995 Ga0307409_100039407 Ga0307409_1000394074 85
607 3300031995 Ga0307409_100114010 Ga0307409_1001140103 85
608 3300031995 Ga0307409_100455060 Ga0307409_1004550603 85
609 3300032002 Ga0307416_100114623 Ga0307416_1001146232 85
610 3300032002 Ga0307416_100284593 Ga0307416_1002845932 85
611 3300032002 Ga0307416_101076555 Ga0307416_1010765552 85
612 3300032004 Ga0307414_10147875 Ga0307414_101478752 85
613 3300032004 Ga0307414_12025678 Ga0307414_120256781 85
614 3300032005 Ga0307411_10276741 Ga0307411_102767412 85
615 3300032126 Ga0307415_100393359 Ga0307415_1003933593 85
616 3300032133 Ga0316583_10006503 Ga0316583_100065033 85
617 3300032137 Ga0316585_10008208 Ga0316585_100082082 85
618 3300032139 Ga0316580_10037842 Ga0316580_100378422 85
619 3300032168 Ga0316593_10004078 Ga0316593_100040783 85
620 3300033524 Ga0316592_1040494 Ga0316592_10404942 85
621 3300033527 Ga0316586_1059785 Ga0316586_10597852 85
622 3300033528 Ga0316588_1066174 Ga0316588_10661742 85
623 3300033541 Ga0316596_1000246 Ga0316596_10002463 85
624 3300033541 Ga0316596_1185114 Ga0316596_11851141 85
625 3300033541 Ga0316596_1202893 Ga0316596_12028932 85
626 3300035398 Ga0316574_0030284 Ga0316574_0030284_1994_2254 85
627 3300036647 Ga0316582_0299072 Ga0316582_0299072_806_1066 85
628 3300036712 Ga0316584_0080072 Ga0316584_0080072_1946_2206 85
629 3300037312 Ga0395899_0381370 Ga0395899_0381370_596_862 85
630 3300037418 Ga0395900_0127340 Ga0395900_0127340_876_1142 85
631 3300037418 Ga0395900_1424141 Ga0395900_1424141_112_372 85
632 3300037418 Ga0395900_1502563 Ga0395900_1502563_169_426 85
633 3300037466 Ga0395898_0287877 Ga0395898_0287877_313_579 85
634 3300037466 Ga0395898_1424394 Ga0395898_1424394_194_451 85
635 3300037466 Ga0395898_1907993 Ga0395898_1907993_21_278 85
636 3300037588 Ga0316581_0000149 Ga0316581_0000149_2471_2731 85
637 3300038443 Ga0395901_0778705 Ga0395901_0778705_364_630 85
638 3300038735 Ga0400485_19729 Ga0400485_19729_8815_9072 85
639 3300038742 Ga0400486_32646 Ga0400486_32646_9281_9538 85
640 3300039093 Ga0400489_87014 Ga0400489_87014_89_346 85
641 3300039437 Ga0436365_1513875 Ga0436365_1513875_557_823 85
642 3300039447 Ga0436361_0965496 Ga0436361_0965496_810_1076 85
643 3300039453 Ga0436362_1249237 Ga0436362_1249237_200_457 85
644 3300041406 Ga0439439_0110793 Ga0439439_0110793_309_566 85
645 3300041411 Ga0439466_0114319 Ga0439466_0114319_499_756 85
646 3300041411 Ga0439466_0161318 Ga0439466_0161318_82_339 85
647 3300041413 Ga0439465_0048243 Ga0439465_0048243_727_984 85
648 3300041413 Ga0439465_0090100 Ga0439465_0090100_699_956 85
649 3300041413 Ga0439465_0123823 Ga0439465_0123823_279_545 85
650 3300041443 Ga0451789_0231381 Ga0451789_0231381_289_546 85
651 3300041443 Ga0451789_0396782 Ga0451789_0396782_474_737 85
652 3300041444 Ga0451790_30891 Ga0451790_30891_296_553 85
653 3300041450 Ga0451796_10591 Ga0451796_10591_421_684 85
654 3300041452 Ga0451793_0715769 Ga0451793_0715769_22_279 85
655 3300041452 Ga0451793_0789263 Ga0451793_0789263_828_1085 85
656 3300041453 Ga0451797_1218952 Ga0451797_1218952_231_488 85
657 3300041453 Ga0451797_1255051 Ga0451797_1255051_218_475 85
658 3300041456 Ga0451795_0292788 Ga0451795_0292788_258_521 85
659 3300041456 Ga0451795_0294527 Ga0451795_0294527_261_518 85
660 3300041456 Ga0451795_0902187 Ga0451795_0902187_67_324 85
661 3300041459 Ga0451800_1401438 Ga0451800_1401438_140_400 85
662 3300041460 Ga0451802_0085081 Ga0451802_0085081_110_367 85
663 3300041460 Ga0451802_0800214 Ga0451802_0800214_101_364 85
664 3300041486 Ga0451807_1553210 Ga0451807_1553210_132_389 85
665 3300041486 Ga0451807_1667980 Ga0451807_1667980_58_321 85
666 3300041491 Ga0451833_0276161 Ga0451833_0276161_974_1231 85
667 3300041494 Ga0451837_0210431 Ga0451837_0210431_199_462 85
668 3300041494 Ga0451837_0949823 Ga0451837_0949823_19_276 85
669 3300041494 Ga0451837_1052852 Ga0451837_1052852_1640_1897 85
670 3300041496 Ga0451839_0010674 Ga0451839_0010674_2274_2531 85
671 3300041498 Ga0451841_0963788 Ga0451841_0963788_793_1050 85
672 3300041501 Ga0451845_0086215 Ga0451845_0086215_377_634 85
673 3300041502 Ga0451846_47497 Ga0451846_47497_292_549 85
674 3300041509 Ga0451843_0390362 Ga0451843_0390362_101_364 85
675 3300041509 Ga0451843_1649887 Ga0451843_1649887_237_494 85
676 3300041511 Ga0451855_1387741 Ga0451855_1387741_26_283 85
677 3300041512 Ga0451853_0407957 Ga0451853_0407957_188_445 85
678 3300041512 Ga0451853_2386619 Ga0451853_2386619_382_645 85
679 3300042004 Ga0439445_0027772 Ga0439445_0027772_339_596 85
680 3300042006 Ga0439432_056326 Ga0439432_056326_908_1165 85
681 3300042156 Ga0439446_0094568 Ga0439446_0094568_236_493 85
682 3300042438 Ga0439459_0112591 Ga0439459_0112591_281_538 85
683 3300044656 Ga0466969_0017660 Ga0466969_0017660_3388_3645 85
684 3300044656 Ga0466969_0248751 Ga0466969_0248751_365_622 85
685 3300044658 Ga0466972_0037579 Ga0466972_0037579_622_879 85
686 3300044658 Ga0466972_0168960 Ga0466972_0168960_20_289 85
687 3300044658 Ga0466972_0213221 Ga0466972_0213221_439_696 85
688 3300044658 Ga0466972_0217083 Ga0466972_0217083_315_572 85
689 3300044683 Ga0466965_0238911 Ga0466965_0238911_255_512 85
690 3300044683 Ga0466965_0406016 Ga0466965_0406016_12_272 85
691 3300044683 Ga0466965_0474493 Ga0466965_0474493_133_390 85
692 3300044683 Ga0466965_0894244 Ga0466965_0894244_166_432 85
693 3300044684 Ga0466966_0098303 Ga0466966_0098303_1048_1305 85
694 3300044684 Ga0466966_0131941 Ga0466966_0131941_772_1038 85
695 3300044684 Ga0466966_0398987 Ga0466966_0398987_166_423 85
696 3300044693 Ga0466961_0041554 Ga0466961_0041554_358_615 85
697 3300044693 Ga0466961_0067005 Ga0466961_0067005_525_791 85
698 3300044693 Ga0466961_0109310 Ga0466961_0109310_979_1236 85
699 3300044693 Ga0466961_0426426 Ga0466961_0426426_384_641 85
700 3300044693 Ga0466961_0904767 Ga0466961_0904767_236_493 85
701 3300044694 Ga0466963_0239166 Ga0466963_0239166_368_634 85
702 3300044706 Ga0466964_0023349 Ga0466964_0023349_1368_1625 85
703 3300044735 Ga0466968_0090654 Ga0466968_0090654_811_1077 85
704 3300044765 Ga0466970_0058962 Ga0466970_0058962_196_453 85
705 3300044765 Ga0466970_0193928 Ga0466970_0193928_755_1021 85
706 3300044765 Ga0466970_0369744 Ga0466970_0369744_432_701 85
707 3300044765 Ga0466970_0864876 Ga0466970_0864876_157_414 85
708 3300044842 Ga0466957_0101812 Ga0466957_0101812_847_1104 85
709 3300044842 Ga0466957_0536768 Ga0466957_0536768_524_790 85
710 3300044842 Ga0466957_0693127 Ga0466957_0693127_155_421 85
711 3300044842 Ga0466957_0980112 Ga0466957_0980112_36_305 85
712 3300044901 Ga0466960_0250145 Ga0466960_0250145_317_574 85
713 3300045049 Ga0466959_0143603 Ga0466959_0143603_87_353 85
714 3300045049 Ga0466959_0190525 Ga0466959_0190525_520_786 85
715 3300045049 Ga0466959_0391539 Ga0466959_0391539_246_503 85
716 3300045836 Ga0466958_0327777 Ga0466958_0327777_380_649 85
717 3300045836 Ga0466958_0981194 Ga0466958_0981194_207_464 85
718 3300045976 Ga0466967_0305278 Ga0466967_0305278_166_423 85
719 3300045976 Ga0466967_0484939 Ga0466967_0484939_414_671 85
720 3300045976 Ga0466967_0832639 Ga0466967_0832639_306_575 85
721 3300045976 Ga0466967_1835973 Ga0466967_1835973_118_375 85
722 3300045976 Ga0466967_2177912 Ga0466967_2177912_227_484 85
723 3300046453 Ga0495627_097854 Ga0495627_097854_42_299 85
724 3300046458 Ga0495591_122499 Ga0495591_122499_285_542 85
725 3300046460 Ga0495638_0135324 Ga0495638_0135324_656_913 85
726 3300046471 Ga0495650_0010799 Ga0495650_0010799_1519_1782 85
727 3300046475 Ga0495639_0171620 Ga0495639_0171620_149_406 85
728 3300046515 Ga0495620_0275483 Ga0495620_0275483_228_485 85
729 3300046522 Ga0495643_0142616 Ga0495643_0142616_514_771 85
730 3300046530 Ga0495654_0032925 Ga0495654_0032925_177_434 85
731 3300046615 Ga0495656_0251254 Ga0495656_0251254_477_734 85
732 3300046660 Ga0495625_0142695 Ga0495625_0142695_1227_1484 85
733 3300046675 Ga0495657_0334786 Ga0495657_0334786_76_339 85
734 3300046681 Ga0495647_0407478 Ga0495647_0407478_208_465 85
735 3300046692 Ga0495671_0229100 Ga0495671_0229100_632_889 85
736 3300046694 Ga0495649_0078152 Ga0495649_0078152_1400_1657 85
737 3300047320 Ga0495672_0245464 Ga0495672_0245464_380_637 85
738 3300047320 Ga0495672_0428121 Ga0495672_0428121_30_287 85
739 3300048903 Ga0496100_0018960 Ga0496100_0018960_3099_3356 85
740 3300048903 Ga0496100_0231191 Ga0496100_0231191_654_911 85
741 3300048904 Ga0496101_0006334 Ga0496101_0006334_2261_2518 85
742 3300048905 Ga0496102_0022739 Ga0496102_0022739_1505_1762 85
743 3300048905 Ga0496102_0217530 Ga0496102_0217530_800_1060 85
744 3300048905 Ga0496102_1780292 Ga0496102_1780292_124_381 85
745 3300048906 Ga0496103_0011718 Ga0496103_0011718_250_507 85
746 3300048907 Ga0496104_0005777 Ga0496104_0005777_2223_2480 85
747 3300048907 Ga0496104_0121240 Ga0496104_0121240_1828_2085 85
748 3300048907 Ga0496104_0202754 Ga0496104_0202754_261_518 85
749 3300048908 Ga0496105_0002712 Ga0496105_0002712_4862_5119 85
750 3300048908 Ga0496105_0053232 Ga0496105_0053232_776_1033 85
751 3300048908 Ga0496105_0133027 Ga0496105_0133027_944_1201 85
752 3300048909 Ga0496106_0020578 Ga0496106_0020578_3954_4211 85
753 3300048910 Ga0496107_0004317 Ga0496107_0004317_1635_1892 85
754 3300048910 Ga0496107_0065388 Ga0496107_0065388_996_1253 85
755 3300048911 Ga0496108_0010564 Ga0496108_0010564_4139_4396 85
756 3300048911 Ga0496108_0035480 Ga0496108_0035480_271_528 85
757 3300048911 Ga0496108_0211667 Ga0496108_0211667_981_1238 85
758 3300048912 Ga0496109_0008423 Ga0496109_0008423_3874_4131 85
759 3300048912 Ga0496109_0033739 Ga0496109_0033739_2410_2667 85
760 3300048914 Ga0496111_0001311 Ga0496111_0001311_5032_5289 85
761 3300048914 Ga0496111_0174980 Ga0496111_0174980_575_832 85
762 3300048914 Ga0496111_0762851 Ga0496111_0762851_63_320 85
763 3300048915 Ga0496112_0031543 Ga0496112_0031543_2152_2409 85
764 3300048915 Ga0496112_0040203 Ga0496112_0040203_867_1124 85
765 3300048915 Ga0496112_0212811 Ga0496112_0212811_1368_1625 85
766 3300048916 Ga0496113_0049454 Ga0496113_0049454_1745_2002 85
767 3300048916 Ga0496113_0107738 Ga0496113_0107738_15_272 85
768 3300048917 Ga0496114_0023635 Ga0496114_0023635_3856_4113 85
769 3300048917 Ga0496114_0181650 Ga0496114_0181650_923_1180 85
770 3300048917 Ga0496114_0553668 Ga0496114_0553668_78_335 85
771 3300048918 Ga0496115_0033887 Ga0496115_0033887_1970_2227 85
772 3300048918 Ga0496115_0058473 Ga0496115_0058473_1942_2199 85
773 3300048918 Ga0496115_0487868 Ga0496115_0487868_24_281 85
774 3300048919 Ga0496116_0022531 Ga0496116_0022531_1588_1845 85
775 3300048920 Ga0496117_0000053 Ga0496117_0000053_203976_204236 85
776 3300048920 Ga0496117_0005856 Ga0496117_0005856_5063_5320 85
777 3300048920 Ga0496117_0019479 Ga0496117_0019479_4573_4830 85
778 3300048920 Ga0496117_0188220 Ga0496117_0188220_123_383 85
779 3300048920 Ga0496117_0319738 Ga0496117_0319738_147_404 85
780 3300048921 Ga0496118_0003938 Ga0496118_0003938_12018_12275 85
781 3300048921 Ga0496118_0277403 Ga0496118_0277403_79_336 85
782 3300048921 Ga0496118_0332049 Ga0496118_0332049_532_789 85
783 3300048922 Ga0496119_0002876 Ga0496119_0002876_6086_6343 85
784 3300048922 Ga0496119_0007344 Ga0496119_0007344_3495_3755 85
785 3300048922 Ga0496119_0099165 Ga0496119_0099165_340_597 85
786 3300048923 Ga0496120_0001606 Ga0496120_0001606_22431_22691 85
787 3300048923 Ga0496120_0005690 Ga0496120_0005690_9520_9780 85
788 3300048923 Ga0496120_0010747 Ga0496120_0010747_2749_3006 85
789 3300048925 Ga0496122_0000030 Ga0496122_0000030_91960_92217 85
790 3300048925 Ga0496122_0002826 Ga0496122_0002826_5143_5403 85
791 3300048925 Ga0496122_0024042 Ga0496122_0024042_1201_1458 85
792 3300048925 Ga0496122_0170148 Ga0496122_0170148_758_1015 85
793 3300048926 Ga0496123_0000024 Ga0496123_0000024_91961_92218 85
794 3300048926 Ga0496123_0003526 Ga0496123_0003526_7759_8019 85
795 3300048926 Ga0496123_0141416 Ga0496123_0141416_805_1062 85
796 3300048926 Ga0496123_0335998 Ga0496123_0335998_103_360 85
797 3300048927 Ga0496124_0003673 Ga0496124_0003673_1216_1473 85
798 3300048927 Ga0496124_0058865 Ga0496124_0058865_1782_2042 85
799 3300048927 Ga0496124_0227210 Ga0496124_0227210_714_971 85
800 3300048928 Ga0496125_0004043 Ga0496125_0004043_16330_16590 85
801 3300048928 Ga0496125_0004883 Ga0496125_0004883_1413_1670 85
802 3300048928 Ga0496125_0580132 Ga0496125_0580132_223_480 85
803 3300048929 Ga0496126_0004970 Ga0496126_0004970_5138_5398 85
804 3300048929 Ga0496126_0008058 Ga0496126_0008058_6176_6433 85
805 3300048929 Ga0496126_0466232 Ga0496126_0466232_721_978 85
806 3300049127 Ga0501306_055966 Ga0501306_055966_18_281 85
807 3300049128 Ga0501308_080432 Ga0501308_080432_66_332 85
808 3300049161 Ga0501305_048878 Ga0501305_048878_20_280 85
809 3300049527 Ga0501311_028365 Ga0501311_028365_39_299 85
810 3300049527 Ga0501311_053509 Ga0501311_053509_19_282 85
811 3300049533 Ga0501317_015058 Ga0501317_015058_696_965 85
812 3300049533 Ga0501317_033450 Ga0501317_033450_19_282 85
813 3300049534 Ga0501318_041901 Ga0501318_041901_30_290 85
814 3300049537 Ga0501321_016150 Ga0501321_016150_602_874 85
815 3300049541 Ga0501325_012740 Ga0501325_012740_397_660 85
816 3300049572 Ga0501036_0182437 Ga0501036_0182437_614_874 85
817 3300049572 Ga0501036_1024362 Ga0501036_1024362_64_321 85
818 3300049573 Ga0501037_0177813 Ga0501037_0177813_153_410 85
819 3300049576 Ga0501040_0541873 Ga0501040_0541873_455_712 85
820 3300049578 Ga0501042_0779368 Ga0501042_0779368_247_504 85
821 3300049582 Ga0501048_1228041 Ga0501048_1228041_83_343 85
822 3300049585 Ga0501069_0039598 Ga0501069_0039598_1779_2036 85
823 3300049585 Ga0501069_0110795 Ga0501069_0110795_130_396 85
824 3300049586 Ga0501070_0053511 Ga0501070_0053511_2535_2801 85
825 3300049586 Ga0501070_0059346 Ga0501070_0059346_1629_1886 85
826 3300049587 Ga0501071_1219130 Ga0501071_1219130_114_371 85
827 3300049589 Ga0501073_0440406 Ga0501073_0440406_77_343 85
828 3300049590 Ga0501074_0295009 Ga0501074_0295009_546_812 85
829 3300049593 Ga0501077_0796427 Ga0501077_0796427_229_486 85
830 3300049741 Ga0501079_0094252 Ga0501079_0094252_1047_1307 85
831 3300049742 Ga0501080_0155978 Ga0501080_0155978_1331_1597 85
832 3300049743 Ga0501081_0218466 Ga0501081_0218466_426_686 85
833 3300050490 nmdc:mga03n38_222569_c1 nmdc:mga03n38_222569_c1_117_377 85
834 3300050491 nmdc:mga00v17_114948_c1 nmdc:mga00v17_114948_c1_921_1181 85
835 3300050491 nmdc:mga00v17_173872_c1 nmdc:mga00v17_173872_c1_598_855 85
836 3300050491 nmdc:mga00v17_296205_c1 nmdc:mga00v17_296205_c1_308_568 85
837 3300050491 nmdc:mga00v17_310638_c1 nmdc:mga00v17_310638_c1_540_803 85
838 3300050491 nmdc:mga00v17_62442_c1 nmdc:mga00v17_62442_c1_1140_1397 85
839 3300050491 nmdc:mga00v17_971_c1 nmdc:mga00v17_971_c1_12174_12437 85
840 3300050492 nmdc:mga0yw44_114563_c1 nmdc:mga0yw44_114563_c1_70_330 85
841 3300050492 nmdc:mga0yw44_22559_c1 nmdc:mga0yw44_22559_c1_460_717 85
842 3300050492 nmdc:mga0yw44_289036_c1 nmdc:mga0yw44_289036_c1_155_415 85
843 3300050492 nmdc:mga0yw44_82211_c1 nmdc:mga0yw44_82211_c1_839_1099 85
844 3300050493 nmdc:mga0k408_872708_c1 nmdc:mga0k408_872708_c1_74_331 85
845 3300050494 nmdc:mga06z11_391110_c1 nmdc:mga06z11_391110_c1_38_298 85
846 3300050494 nmdc:mga06z11_4263_c1 nmdc:mga06z11_4263_c1_2881_3138 85
847 3300050495 nmdc:mga04h51_82785_c1 nmdc:mga04h51_82785_c1_644_901 85
848 3300050496 nmdc:mga07m45_16476_c1 nmdc:mga07m45_16476_c1_3633_3890 85
849 3300050496 nmdc:mga07m45_60779_c1 nmdc:mga07m45_60779_c1_1489_1746 85
850 3300050496 nmdc:mga07m45_657785_c1 nmdc:mga07m45_657785_c1_136_399 85
851 3300050496 nmdc:mga07m45_733198_c1 nmdc:mga07m45_733198_c1_260_523 85
852 3300050516 nmdc:mga0sz30_2151_c1 nmdc:mga0sz30_2151_c1_2279_2542 85
853 3300050516 nmdc:mga0sz30_4797_c2 nmdc:mga0sz30_4797_c2_3005_3262 85
854 3300053085 Ga0495619_0873288 Ga0495619_0873288_44_301 85
855 3300053093 Ga0500651_0001075 Ga0500651_0001075_12494_12751 85
856 3300053096 Ga0500641_0006257 Ga0500641_0006257_1578_1841 85
857 3300053140 Ga0500573_0323798 Ga0500573_0323798_464_721 85
858 3300054114 Ga0501084_0434284 Ga0501084_0434284_667_927 85
859 3300059424 Ga0590075_078126 Ga0590075_078126_29_286 85
860 3300059478 Ga0587093_048773 Ga0587093_048773_10_267 85
861 3300059492 Ga0587073_0124378 Ga0587073_0124378_20_277 85
862 3300059492 Ga0587073_0124825 Ga0587073_0124825_103_369 85
863 3300059503 Ga0587080_109638 Ga0587080_109638_307_564 85
864 3300059504 Ga0587082_049701 Ga0587082_049701_427_684 85
865 3300059505 Ga0587083_0074773 Ga0587083_0074773_513_773 85
866 3300059508 Ga0587088_054641 Ga0587088_054641_173_430 85
867 3300059511 Ga0587091_099077 Ga0587091_099077_58_315 85
868 3300059605 Ga0587106_051237 Ga0587106_051237_455_712 85
869 3300059622 Ga0587099_049749 Ga0587099_049749_85_342 85
870 3300059626 Ga0587115_009733 Ga0587115_009733_542_820 85
871 3300059628 Ga0587122_016159 Ga0587122_016159_335_592 85
872 3300059630 Ga0587128_023558 Ga0587128_023558_426_683 85
873 3300059644 Ga0587075_068341 Ga0587075_068341_177_434 85
874 3300059655 Ga0587114_017539 Ga0587114_017539_432_689 85
875 3300060344 Ga0587071_083584 Ga0587071_083584_448_705 85
876 3300060353 Ga0501082_0150864 Ga0501082_0150864_878_1138 85
877 3300060353 Ga0501082_0571534 Ga0501082_0571534_248_505 85
878 3300061719 Ga0466962_0043154 Ga0466962_0043154_944_1201 85
879 3300061719 Ga0466962_0178297 Ga0466962_0178297_644_901 85

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01016

Ribosomal_L27

Ribosomal L27 protein

2

80

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
6ywy-assembly1.cif.gz_R the structure of the mitoribosome from neurospora crassa with bound trna at the p-site 0.9003 19 81
1v8q-assembly1.cif.gz_A crystal structure of ribosomal protein l27 from thermus thermophilus hb8 0.8986 20 83
6yws-assembly1.cif.gz_R the structure of the large subunit of the mitoribosome from neurospora crassa 0.897 19 81
7pkt-assembly1.cif.gz_u large subunit of the chlamydomonas reinhardtii mitoribosome 0.8931 23 84
6ywv-assembly1.cif.gz_R the structure of the atp25 bound assembly intermediate of the mitoribosome from neurospora crassa 0.8913 19 81
ID Description Score Start End Superfamily
1v8qA00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.8986 20 83 2.40.50.100
af_Q4DLT4_19_136_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.8662 23 82 2.40.50.100
af_Q4DVL3_299_475_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8646 67 80 3.40.50.300
1v8qA00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.8604 20 83 2.40.50.100
af_Q95XD0_22_81_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.8225 27 85 2.40.50.100
ID Description Score Start End GO Terms
AF-I4M014-F1-model_v4 Large ribosomal subunit protein bL27 (50S ribosomal protein L27) 0.972 27 83 GO:0003735
GO:0006412
GO:0022625
AF-I0R0V1-F1-model_v4 Large ribosomal subunit protein bL27 (50S ribosomal protein L27) 0.9663 23 83 GO:0003735
GO:0006412
GO:0022625
AF-W4UE80-F1-model_v4 deleted 0.964 23 84
AF-A0A421K8E4-F1-model_v4 Large ribosomal subunit protein bL27 (50S ribosomal protein L27) 0.9556 23 84 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-I4M014-F1-model_v4 Large ribosomal subunit protein bL27 (50S ribosomal protein L27) 0.9556 27 83 GO:0003735
GO:0006412
GO:0022625

Feature Viewer

pLDDT pTM Quality
83.86 0.68 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map