F483695

General Info

Members Datasets Scaffolds Average Seq Length
857 459 1714 127

Family's Representative Sequence

Representative Sequence 3300035113|Ga0373936_0026651|Ga0373936_0026651_599_1018
Length 139
Sequence MALTSGEGTLSVSRVAQRRALFIFALTSLVGTTCFVTETRAAGAFAIGKCGAYGRAYDYPAESAARAAALRQCQGGDCKTITMKRACAAFAVDMANPCGPHGYAVRPKISSSLNEATRECYKFGGKDCVIRAWACDAKG

Samples

Sample ID Description Type Environment
1 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
5 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
6 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
59 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
60 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
61 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
62 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
63 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
64 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
65 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
66 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
67 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
68 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
69 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
71 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
72 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
73 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
74 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
77 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
78 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
79 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
81 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
83 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
84 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
85 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
86 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
87 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
88 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
89 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
90 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
91 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
92 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
93 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
94 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
95 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
96 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
97 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
98 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
99 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
100 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
101 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
102 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
103 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
104 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
105 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
106 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
107 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
108 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
109 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
110 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
111 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
113 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
114 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
115 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
116 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
169 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
170 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
171 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
174 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
178 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
179 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
180 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
181 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
182 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
183 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
184 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
185 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
186 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
187 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
188 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
189 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
190 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
191 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
192 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
193 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
194 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
195 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
196 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
197 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
198 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
199 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
200 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
201 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
202 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
203 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
204 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
205 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
206 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
207 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
208 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
209 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
210 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
211 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
212 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
213 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
214 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
215 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
216 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
217 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
218 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
219 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
220 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
221 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
222 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
223 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
224 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
225 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
226 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
227 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
228 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
229 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
230 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
231 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
232 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
233 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
234 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
235 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
236 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
237 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
238 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
239 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
240 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
241 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
242 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
243 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
244 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
245 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
246 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
247 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
248 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
249 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
250 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
251 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
252 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
253 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
254 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
255 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
256 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
257 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
258 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
259 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
260 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
261 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
262 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
263 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
264 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
265 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
266 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
267 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
268 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
269 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
270 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
271 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
272 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
273 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
274 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
275 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
276 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
277 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
278 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
279 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
280 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
281 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
282 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
283 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
284 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
285 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
286 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
287 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
288 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
289 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
290 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
291 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
292 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
293 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
294 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
295 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
296 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
297 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
298 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
299 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
300 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
301 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
302 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
303 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
304 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
305 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
306 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
307 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
308 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
309 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
310 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
311 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
312 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
313 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
314 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
315 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
316 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
317 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
318 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
319 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
320 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
321 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
322 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
323 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
324 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
325 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
326 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
327 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
328 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
329 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
330 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
331 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
332 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
333 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
334 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
335 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
336 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
337 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
338 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
339 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
340 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
341 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
342 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
343 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
344 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
345 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
346 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
347 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
348 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
349 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
350 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
351 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
352 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
353 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
354 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
355 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
356 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
357 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
358 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
359 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
360 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
361 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
362 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
363 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
364 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
365 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
366 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
367 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
368 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
369 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
370 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
371 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
372 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
373 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
374 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
375 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
376 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
377 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
378 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
379 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
380 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
381 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
382 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
383 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
384 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
385 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
386 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
387 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
388 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
389 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
390 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
391 3300053097 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere Metagenome Endosphere
392 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
393 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
394 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
395 3300053114 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 endosphere Metagenome Endosphere
396 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
397 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
398 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
399 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
400 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
401 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
402 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
403 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
404 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
405 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
406 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
407 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
408 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
409 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
410 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
411 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
412 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
413 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
414 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
415 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
416 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
417 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
418 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
419 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
420 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
421 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
422 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
423 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
424 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
425 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
426 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
427 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
428 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
429 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
430 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
431 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
432 2791355199
433 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
434 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
435 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
436 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
437 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
438 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
439 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
440 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
441 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
442 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
443 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
444 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
445 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
446 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
447 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
448 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
449 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
450 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
451 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
452 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
453 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
454 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
455 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
456 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
457 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
458 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
459 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 95.79
Metatranscriptomes 0.12
Isolates 4.09

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.9
Nodule 3.03
Rhizoplane 5.6
Rhizosphere 70.36
Stem 0
Stem Tuber 0
Unclassified 0.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373936_0026651 3300035113 Bacteria 2264
2 JGI24740J21852_10003304 3300001979 Bacteria 7104
3 JGI25153J46596_10004014 3300003215 Bacteria 8026
4 JGI25153J46596_10016112 3300003215 Bacteria 3013
5 JGI25404J52841_10039217 3300003659 Bacteria 1004
6 Ga0055524_1016842 3300003775 Bacteria 2601
7 Ga0055531_10004813 3300003794 Bacteria 8062
8 Ga0065707_10039176 3300005295 Bacteria 984
9 Ga0070676_10214707 3300005328 Bacteria 1268
10 Ga0070676_10348190 3300005328 Bacteria 1018
11 Ga0070676_10411622 3300005328 Bacteria 943
12 Ga0070670_100796756 3300005331 Unclassified 853
13 Ga0068869_100126189 3300005334 Bacteria 1962
14 Ga0068869_100126741 3300005334 Bacteria 1958
15 Ga0068869_100218449 3300005334 Bacteria 1510
16 Ga0068868_100112158 3300005338 Bacteria 2217
17 Ga0070660_100305832 3300005339 Bacteria 1304
18 Ga0070660_101016212 3300005339 Bacteria 701
19 Ga0070689_100189346 3300005340 Bacteria 1675
20 Ga0070689_100490566 3300005340 Bacteria 1051
21 Ga0070661_100205307 3300005344 Bacteria 1507
22 Ga0070668_100124339 3300005347 Bacteria 2065
23 Ga0070668_100404214 3300005347 Bacteria 1166
24 Ga0070668_101255188 3300005347 Bacteria 672
25 Ga0070668_101703616 3300005347 Bacteria 579
26 Ga0070669_100662707 3300005353 Bacteria 879
27 Ga0070669_101355619 3300005353 Bacteria 617
28 Ga0070671_100267716 3300005355 Bacteria 1452
29 Ga0070674_100385643 3300005356 Bacteria 1141
30 Ga0070674_100994860 3300005356 Bacteria 736
31 Ga0070673_100215954 3300005364 Bacteria 1658
32 Ga0070659_100171612 3300005366 Bacteria 1777
33 Ga0070667_100576990 3300005367 Bacteria 1035
34 Ga0070667_100832495 3300005367 Bacteria 858
35 Ga0070709_10000431 3300005434 Bacteria 25383
36 Ga0070714_100034967 3300005435 Bacteria 4209
37 Ga0070713_100011005 3300005436 Bacteria 6566
38 Ga0070713_100058790 3300005436 Bacteria 3208
39 Ga0070713_102195980 3300005436 Bacteria 535
40 Ga0070710_10002535 3300005437 Bacteria 8668
41 Ga0070700_100289366 3300005441 Bacteria 1191
42 Ga0070694_101713999 3300005444 Bacteria 534
43 Ga0070663_100215710 3300005455 Bacteria 1505
44 Ga0070678_100130100 3300005456 Bacteria 1998
45 Ga0070662_100315386 3300005457 Bacteria 1274
46 Ga0070662_100425069 3300005457 Bacteria 1100
47 Ga0070681_10821534 3300005458 Bacteria 847
48 Ga0068867_100178136 3300005459 Bacteria 1688
49 Ga0070706_101450377 3300005467 Bacteria 628
50 Ga0070698_101111463 3300005471 Bacteria 739
51 Ga0070699_100525885 3300005518 Bacteria 1075
52 Ga0070699_100541718 3300005518 Bacteria 1059
53 Ga0070679_101080131 3300005530 Bacteria 747
54 Ga0070684_100037899 3300005535 Bacteria 4138
55 Ga0070684_100122428 3300005535 Bacteria 2341
56 Ga0068853_100273959 3300005539 Bacteria 1554
57 Ga0070672_100370482 3300005543 Bacteria 1224
58 Ga0070672_100519278 3300005543 Bacteria 1032
59 Ga0070695_100111158 3300005545 Bacteria 1860
60 Ga0070693_100345320 3300005547 Bacteria 1017
61 Ga0070665_100005984 3300005548 Bacteria 12447
62 Ga0070665_100184379 3300005548 Bacteria 2088
63 Ga0070665_100317274 3300005548 Bacteria 1563
64 Ga0070665_100839979 3300005548 Bacteria 931
65 Ga0070665_100901982 3300005548 Bacteria 897
66 Ga0070665_100952773 3300005548 Bacteria 871
67 Ga0070665_101589527 3300005548 Bacteria 662
68 Ga0070704_100219261 3300005549 Bacteria 1546
69 Ga0070704_102167579 3300005549 Bacteria 517
70 Ga0068855_100132169 3300005563 Bacteria 2849
71 Ga0070664_100333479 3300005564 Bacteria 1376
72 Ga0068854_100696460 3300005578 Bacteria 876
73 Ga0068856_100013112 3300005614 Bacteria 8029
74 Ga0068856_100482328 3300005614 Bacteria 1261
75 Ga0070702_101279450 3300005615 Bacteria 595
76 Ga0068852_100027381 3300005616 Bacteria 4645
77 Ga0068852_100051850 3300005616 Bacteria 3524
78 Ga0068852_100380496 3300005616 Bacteria 1385
79 Ga0068852_100695408 3300005616 Bacteria 1026
80 Ga0068859_100146495 3300005617 Bacteria 2436
81 Ga0068859_100252848 3300005617 Bacteria 1853
82 Ga0068864_100344511 3300005618 Bacteria 1405
83 Ga0068861_100023528 3300005719 Bacteria 4444
84 Ga0068861_100024258 3300005719 Bacteria 4385
85 Ga0068861_101376166 3300005719 Bacteria 689
86 Ga0068851_10068102 3300005834 Bacteria 1837
87 Ga0068863_100855093 3300005841 Bacteria 909
88 Ga0068863_101664037 3300005841 Bacteria 648
89 Ga0068858_100800413 3300005842 Bacteria 920
90 Ga0068858_100978564 3300005842 Bacteria 829
91 Ga0068858_101322160 3300005842 Bacteria 709
92 Ga0068860_100000240 3300005843 Bacteria 83866
93 Ga0068860_100594393 3300005843 Bacteria 1112
94 Ga0068860_101438487 3300005843 Bacteria 711
95 Ga0068862_100346384 3300005844 Bacteria 1377
96 Ga0068862_101078328 3300005844 Bacteria 797
97 Ga0068862_101560690 3300005844 Bacteria 666
98 Ga0081540_1001756 3300005983 Bacteria 18228
99 Ga0081540_1007693 3300005983 Bacteria 7640
100 Ga0081540_1008560 3300005983 Bacteria 7138
101 Ga0081540_1028981 3300005983 Bacteria 3095
102 Ga0081540_1031157 3300005983 Bacteria 2939
103 Ga0081540_1048878 3300005983 Bacteria 2115
104 Ga0081540_1313916 3300005983 Bacteria 538
105 Ga0070717_10161092 3300006028 Bacteria 1946
106 Ga0070717_10392450 3300006028 Bacteria 1246
107 Ga0070717_10963794 3300006028 Bacteria 777
108 Ga0070717_11425906 3300006028 Bacteria 629
109 Ga0075365_10054511 3300006038 Bacteria 2651
110 Ga0075365_10137769 3300006038 Bacteria 1693
111 Ga0075365_10191273 3300006038 Bacteria 1432
112 Ga0075365_10502707 3300006038 Bacteria 857
113 Ga0075365_10531373 3300006038 Bacteria 832
114 Ga0075368_10104541 3300006042 Bacteria 1165
115 Ga0075368_10254069 3300006042 Bacteria 751
116 Ga0075363_100693403 3300006048 Bacteria 615
117 Ga0075364_10236431 3300006051 Bacteria 1241
118 Ga0075364_10299355 3300006051 Bacteria 1095
119 Ga0070712_100018443 3300006175 Bacteria 4534
120 Ga0070712_101365335 3300006175 Bacteria 618
121 Ga0075362_10224121 3300006177 Bacteria 919
122 Ga0075367_10067984 3300006178 Bacteria 2136
123 Ga0075367_10291918 3300006178 Bacteria 1026
124 Ga0075367_10548908 3300006178 Bacteria 734
125 Ga0075369_10103088 3300006186 Bacteria 1281
126 Ga0075369_10127626 3300006186 Bacteria 1154
127 Ga0075369_10235546 3300006186 Bacteria 849
128 Ga0075366_10100140 3300006195 Bacteria 1739
129 Ga0075366_10226339 3300006195 Bacteria 1139
130 Ga0075366_10436992 3300006195 Bacteria 807
131 Ga0075366_10911614 3300006195 Bacteria 548
132 Ga0097621_100399129 3300006237 Bacteria 1231
133 Ga0075370_10060776 3300006353 Bacteria 2153
134 Ga0075370_10093541 3300006353 Bacteria 1735
135 Ga0068871_100222498 3300006358 Bacteria 1636
136 Ga0068871_100251089 3300006358 Bacteria 1541
137 Ga0068871_100763059 3300006358 Bacteria 890
138 Ga0075428_100204537 3300006844 Bacteria 2134
139 Ga0075428_100459440 3300006844 Bacteria 1363
140 Ga0075429_100818060 3300006880 Bacteria 816
141 Ga0068865_100101344 3300006881 Bacteria 2108
142 Ga0068865_100416227 3300006881 Bacteria 1104
143 Ga0097620_100146487 3300006931 Bacteria 2436
144 Ga0097620_100252830 3300006931 Bacteria 1853
145 Ga0099823_1008372 3300006944 Bacteria 10525
146 Ga0099795_10023161 3300007788 Bacteria 2058
147 Ga0099795_10200601 3300007788 Bacteria 841
148 Ga0105240_10462900 3300009093 Bacteria 1417
149 Ga0111539_10553309 3300009094 Bacteria 1340
150 Ga0111539_11065905 3300009094 Bacteria 939
151 Ga0105245_10098355 3300009098 Bacteria 2704
152 Ga0105245_11257311 3300009098 Bacteria 789
153 Ga0114129_10628777 3300009147 Bacteria 1388
154 Ga0114129_11097734 3300009147 Bacteria 996
155 Ga0105243_10082945 3300009148 Bacteria 2621
156 Ga0105243_10591114 3300009148 Bacteria 1067
157 Ga0105243_12872045 3300009148 Bacteria 522
158 Ga0105241_10509338 3300009174 Bacteria 1074
159 Ga0105241_12519848 3300009174 Bacteria 515
160 Ga0105242_10777178 3300009176 Bacteria 945
161 Ga0105242_10808790 3300009176 Bacteria 928
162 Ga0105248_11781972 3300009177 Bacteria 698
163 Ga0105237_10206777 3300009545 Bacteria 1963
164 Ga0105237_11385671 3300009545 Bacteria 709
165 Ga0105237_11466724 3300009545 Bacteria 689
166 Ga0105237_11612540 3300009545 Bacteria 656
167 Ga0105238_10784745 3300009551 Bacteria 968
168 Ga0105238_10825560 3300009551 Bacteria 943
169 Ga0105238_11021476 3300009551 Bacteria 848
170 Ga0105238_11536480 3300009551 Bacteria 695
171 Ga0105238_12176596 3300009551 Bacteria 589
172 Ga0105249_10176423 3300009553 Bacteria 2076
173 Ga0105249_10939938 3300009553 Bacteria 932
174 Ga0105249_11135415 3300009553 Bacteria 852
175 Ga0099796_10423544 3300010159 Bacteria 588
176 Ga0099796_10486102 3300010159 Bacteria 552
177 Ga0105239_10299129 3300010375 Bacteria 1812
178 Ga0105239_10357286 3300010375 Bacteria 1649
179 Ga0105239_10391909 3300010375 Bacteria 1571
180 Ga0105239_10489727 3300010375 Bacteria 1397
181 Ga0105239_11405759 3300010375 Bacteria 806
182 Ga0105239_11701603 3300010375 Bacteria 730
183 Ga0105246_10010537 3300011119 Bacteria 5725
184 Ga0105246_10301311 3300011119 Bacteria 1294
185 Ga0105246_11027532 3300011119 Bacteria 748
186 Ga0157370_11777741 3300013104 Bacteria 553
187 Ga0157369_10365061 3300013105 Bacteria 1499
188 Ga0157374_10080779 3300013296 Bacteria 3084
189 Ga0157378_10558386 3300013297 Bacteria 1151
190 Ga0157378_10588242 3300013297 Bacteria 1123
191 Ga0157378_11022760 3300013297 Bacteria 861
192 Ga0163162_10015868 3300013306 Bacteria 7361
193 Ga0163162_10638040 3300013306 Bacteria 1189
194 Ga0163162_10805032 3300013306 Bacteria 1057
195 Ga0163162_10935425 3300013306 Bacteria 978
196 Ga0163162_11034369 3300013306 Bacteria 929
197 Ga0163162_11319104 3300013306 Bacteria 820
198 Ga0157372_12725282 3300013307 Bacteria 567
199 Ga0157375_10094782 3300013308 Bacteria 3054
200 Ga0157375_10403354 3300013308 Bacteria 1534
201 Ga0157375_11882991 3300013308 Bacteria 710
202 Ga0157375_12529279 3300013308 Bacteria 613
203 Ga0163163_10270680 3300014325 Bacteria 1750
204 Ga0163163_11148303 3300014325 Bacteria 839
205 Ga0163163_11981680 3300014325 Bacteria 642
206 Ga0157380_10856408 3300014326 Bacteria 931
207 Ga0157380_10972842 3300014326 Bacteria 880
208 Ga0157379_10160192 3300014968 Bacteria 2031
209 Ga0157379_11000636 3300014968 Bacteria 797
210 Ga0157376_10044206 3300014969 Bacteria 3660
211 Ga0157376_10403762 3300014969 Bacteria 1322
212 Ga0157376_10964016 3300014969 Bacteria 874
213 Ga0157376_11189499 3300014969 Bacteria 790
214 Ga0163161_10008352 3300017792 Bacteria 7168
215 Ga0163161_10294577 3300017792 Bacteria 1276
216 Ga0163161_10649898 3300017792 Bacteria 874
217 Ga0163161_10883753 3300017792 Bacteria 756
218 Ga0214544_1000020 3300021320 Bacteria 178560
219 Ga0214542_1000024 3300021321 Bacteria 191218
220 Ga0214545_1000011 3300021324 Bacteria 190550
221 Ga0214543_1000033 3300021327 Bacteria 190419
222 Ga0213876_10006667 3300021384 Bacteria 6301
223 Ga0213871_10034825 3300021441 Bacteria 1329
224 Ga0209233_1001934 3300025261 Bacteria 7910
225 Ga0209455_1005724 3300025272 Bacteria 3784
226 Ga0209564_1021981 3300025295 Bacteria 2270
227 Ga0209758_1000065 3300025297 Bacteria 306288
228 Ga0209758_1003962 3300025297 Bacteria 12844
229 Ga0209758_1017237 3300025297 Bacteria 3611
230 Ga0209758_1033086 3300025297 Bacteria 2084
231 Ga0209256_1003626 3300025299 Bacteria 10573
232 Ga0207426_1017849 3300025302 Bacteria 2513
233 Ga0209257_1001031 3300025304 Bacteria 37368
234 Ga0207692_10000702 3300025898 Bacteria 11780
235 Ga0207692_11175770 3300025898 Bacteria 509
236 Ga0207642_10153268 3300025899 Bacteria 1229
237 Ga0207680_10819135 3300025903 Bacteria 667
238 Ga0207680_11073602 3300025903 Bacteria 576
239 Ga0207699_10001397 3300025906 Bacteria 11471
240 Ga0207699_10051036 3300025906 Bacteria 2443
241 Ga0207645_10290114 3300025907 Bacteria 1088
242 Ga0207645_10773675 3300025907 Bacteria 653
243 Ga0207684_10250030 3300025910 Bacteria 1530
244 Ga0207707_10234396 3300025912 Bacteria 1597
245 Ga0207707_11300733 3300025912 Bacteria 584
246 Ga0207671_10208195 3300025914 Bacteria 1529
247 Ga0207671_10874670 3300025914 Bacteria 711
248 Ga0207693_10016800 3300025915 Bacteria 5842
249 Ga0207693_10324864 3300025915 Bacteria 1204
250 Ga0207663_10659802 3300025916 Bacteria 826
251 Ga0207663_11362393 3300025916 Bacteria 571
252 Ga0207660_11301381 3300025917 Bacteria 590
253 Ga0207657_10273754 3300025919 Bacteria 1341
254 Ga0207657_10286112 3300025919 Bacteria 1308
255 Ga0207649_10342567 3300025920 Bacteria 1104
256 Ga0207652_10017746 3300025921 Bacteria 5829
257 Ga0207652_10798483 3300025921 Bacteria 838
258 Ga0207646_10243981 3300025922 Bacteria 1623
259 Ga0207681_10583636 3300025923 Bacteria 922
260 Ga0207681_10883777 3300025923 Bacteria 748
261 Ga0207681_10911881 3300025923 Bacteria 736
262 Ga0207694_10301730 3300025924 Bacteria 1319
263 Ga0207650_10602943 3300025925 Unclassified 924
264 Ga0207659_10148626 3300025926 Bacteria 1827
265 Ga0207687_10017165 3300025927 Bacteria 4760
266 Ga0207687_10575374 3300025927 Bacteria 947
267 Ga0207700_10057956 3300025928 Bacteria 2923
268 Ga0207700_10161061 3300025928 Bacteria 1863
269 Ga0207700_11082275 3300025928 Bacteria 717
270 Ga0207664_10031782 3300025929 Bacteria 4042
271 Ga0207690_10484019 3300025932 Bacteria 999
272 Ga0207706_10059280 3300025933 Bacteria 3371
273 Ga0207706_10703774 3300025933 Bacteria 863
274 Ga0207706_10939911 3300025933 Bacteria 729
275 Ga0207686_10098753 3300025934 Bacteria 1945
276 Ga0207686_11152153 3300025934 Bacteria 633
277 Ga0207709_10020195 3300025935 Bacteria 3755
278 Ga0207709_10433961 3300025935 Bacteria 1012
279 Ga0207709_11250260 3300025935 Bacteria 613
280 Ga0207670_10338685 3300025936 Bacteria 1188
281 Ga0207670_10398481 3300025936 Bacteria 1100
282 Ga0207669_10195160 3300025937 Bacteria 1464
283 Ga0207669_10495556 3300025937 Bacteria 976
284 Ga0207704_10851428 3300025938 Bacteria 764
285 Ga0207665_10004907 3300025939 Bacteria 8915
286 Ga0207665_10286403 3300025939 Bacteria 1228
287 Ga0207665_10465367 3300025939 Bacteria 972
288 Ga0207691_10139416 3300025940 Bacteria 2138
289 Ga0207691_10164821 3300025940 Bacteria 1943
290 Ga0207691_10892402 3300025940 Bacteria 744
291 Ga0207689_10008197 3300025942 Bacteria 9104
292 Ga0207689_10094058 3300025942 Bacteria 2462
293 Ga0207689_10294432 3300025942 Bacteria 1345
294 Ga0207689_10301630 3300025942 Bacteria 1328
295 Ga0207689_10325598 3300025942 Bacteria 1276
296 Ga0207661_10021041 3300025944 Bacteria 4885
297 Ga0207661_10333131 3300025944 Bacteria 1366
298 Ga0207679_10161057 3300025945 Bacteria 1837
299 Ga0207679_10276488 3300025945 Bacteria 1438
300 Ga0207667_10405142 3300025949 Bacteria 1388
301 Ga0207712_10390136 3300025961 Bacteria 1168
302 Ga0207712_11445724 3300025961 Bacteria 615
303 Ga0207668_10016501 3300025972 Bacteria 4611
304 Ga0207668_10387977 3300025972 Bacteria 1177
305 Ga0207668_11108881 3300025972 Bacteria 709
306 Ga0207668_11557531 3300025972 Bacteria 596
307 Ga0207640_10827774 3300025981 Bacteria 804
308 Ga0207658_10602743 3300025986 Bacteria 987
309 Ga0207658_11392120 3300025986 Bacteria 642
310 Ga0207677_10050895 3300026023 Bacteria 2805
311 Ga0207703_10252455 3300026035 Bacteria 1590
312 Ga0207703_10811604 3300026035 Bacteria 893
313 Ga0207639_10166709 3300026041 Bacteria 1862
314 Ga0207639_10492601 3300026041 Bacteria 1119
315 Ga0207639_10901582 3300026041 Bacteria 826
316 Ga0207678_10150260 3300026067 Bacteria 1988
317 Ga0207678_10281771 3300026067 Bacteria 1427
318 Ga0207678_11060565 3300026067 Bacteria 717
319 Ga0207678_11073932 3300026067 Bacteria 713
320 Ga0207708_10080292 3300026075 Bacteria 2507
321 Ga0207708_11102737 3300026075 Bacteria 692
322 Ga0207702_10397228 3300026078 Bacteria 1329
323 Ga0207641_10580934 3300026088 Bacteria 1095
324 Ga0207648_10116981 3300026089 Bacteria 2343
325 Ga0207676_10352837 3300026095 Bacteria 1361
326 Ga0207676_11189100 3300026095 Bacteria 755
327 Ga0207675_100186819 3300026118 Bacteria 1987
328 Ga0207675_100562567 3300026118 Bacteria 1140
329 Ga0207675_100812978 3300026118 Bacteria 948
330 Ga0207675_101308787 3300026118 Bacteria 745
331 Ga0207683_10119009 3300026121 Bacteria 2370
332 Ga0207683_10215271 3300026121 Bacteria 1749
333 Ga0207698_10032369 3300026142 Bacteria 3788
334 Ga0207698_10120249 3300026142 Bacteria 2221
335 Ga0207698_10515728 3300026142 Bacteria 1166
336 Ga0209389_1000011 3300027296 Bacteria 223265
337 Ga0209489_100017 3300027361 Bacteria 223265
338 Ga0209700_100027 3300027363 Bacteria 223462
339 Ga0209179_1009494 3300027512 Bacteria 1671
340 Ga0209588_1018692 3300027671 Bacteria 2158
341 Ga0209813_10506053 3300027866 Bacteria 502
342 Ga0268266_10039496 3300028379 Bacteria 4020
343 Ga0268266_10198684 3300028379 Bacteria 1834
344 Ga0268266_11261720 3300028379 Bacteria 714
345 Ga0268266_11467939 3300028379 Bacteria 657
346 Ga0268266_12355119 3300028379 Bacteria 503
347 Ga0268265_10053445 3300028380 Bacteria 3060
348 Ga0268265_10114404 3300028380 Bacteria 2209
349 Ga0268265_10871121 3300028380 Bacteria 882
350 Ga0268265_12062822 3300028380 Bacteria 577
351 Ga0268264_10152117 3300028381 Bacteria 2076
352 Ga0268264_10459060 3300028381 Bacteria 1235
353 Ga0307517_10154207 3300028786 Bacteria 1565
354 Ga0307515_10024241 3300028794 Bacteria 10582
355 Ga0265338_10767383 3300028800 Bacteria 662
356 Ga0307511_10236936 3300030521 Bacteria 895
357 Ga0265762_1108784 3300030760 Bacteria 622
358 Ga0265332_10033031 3300031238 Bacteria 2253
359 Ga0265325_10206399 3300031241 Bacteria 904
360 Ga0265325_10364218 3300031241 Bacteria 637
361 Ga0265340_10185434 3300031247 Bacteria 939
362 Ga0265339_10001453 3300031249 Bacteria 17549
363 Ga0265339_10048414 3300031249 Bacteria 2331
364 Ga0265339_10219171 3300031249 Bacteria 931
365 Ga0265339_10458467 3300031249 Bacteria 591
366 Ga0265339_10516933 3300031249 Bacteria 551
367 Ga0265331_10115901 3300031250 Bacteria 1227
368 Ga0265316_10270734 3300031344 Bacteria 1243
369 Ga0265316_10382631 3300031344 Bacteria 1015
370 Ga0265316_10923602 3300031344 Bacteria 609
371 Ga0307513_10457908 3300031456 Bacteria 999
372 Ga0307509_10296678 3300031507 Bacteria 1367
373 Ga0307509_10632804 3300031507 Bacteria 740
374 Ga0307509_10644738 3300031507 Bacteria 728
375 Ga0307408_100262817 3300031548 Bacteria 1429
376 Ga0265313_10224780 3300031595 Bacteria 773
377 Ga0307508_10118003 3300031616 Bacteria 2255
378 Ga0307508_10214248 3300031616 Bacteria 1526
379 Ga0307508_10215221 3300031616 Bacteria 1521
380 Ga0265314_10098586 3300031711 Bacteria 1885
381 Ga0265342_10002787 3300031712 Bacteria 14791
382 Ga0265342_10464735 3300031712 Bacteria 648
383 Ga0307516_10006057 3300031730 Bacteria 14287
384 Ga0307516_10012057 3300031730 Bacteria 9342
385 Ga0307516_10013764 3300031730 Bacteria 8592
386 Ga0307516_10215911 3300031730 Bacteria 1630
387 Ga0307516_10219148 3300031730 Bacteria 1613
388 Ga0307405_10449018 3300031731 Bacteria 1022
389 Ga0307405_10708531 3300031731 Bacteria 834
390 Ga0307405_10813585 3300031731 Bacteria 784
391 Ga0307406_10291129 3300031901 Bacteria 1250
392 Ga0307412_10518731 3300031911 Bacteria 995
393 Ga0307412_10888947 3300031911 Bacteria 780
394 Ga0307416_100226900 3300032002 Bacteria 1797
395 Ga0307416_100684786 3300032002 Bacteria 1113
396 Ga0307416_102968046 3300032002 Bacteria 568
397 Ga0307507_10015115 3300033179 Bacteria 9118
398 Ga0307507_10341436 3300033179 Bacteria 887
399 Ga0307510_10015656 3300033180 Bacteria 8972
400 Ga0307510_10064867 3300033180 Bacteria 3705
401 Ga0373926_0051256 3300035083 Bacteria 1489
402 Ga0373928_0110466 3300035084 Bacteria 727
403 Ga0373934_0376064 3300035086 Bacteria 592
404 Ga0373923_0013897 3300035111 Bacteria 3012
405 Ga0373923_0017058 3300035111 Bacteria 2771
406 Ga0373936_0038715 3300035113 Bacteria 1907
407 Ga0373936_0133186 3300035113 Bacteria 1069
408 Ga0373936_0322382 3300035113 Bacteria 700
409 Ga0373936_0387457 3300035113 Bacteria 640
410 Ga0373945_0019414 3300035116 Bacteria 2321
411 Ga0373945_0290831 3300035116 Bacteria 698
412 Ga0373953_0120401 3300035117 Bacteria 1114
413 Ga0373953_0283303 3300035117 Bacteria 722
414 Ga0373954_0001728 3300035118 Bacteria 8947
415 Ga0373954_0026593 3300035118 Bacteria 2653
416 Ga0373956_0000275 3300035119 Bacteria 20650
417 Ga0373956_0337695 3300035119 Bacteria 718
418 Ga0373957_0078329 3300035120 Bacteria 1301
419 Ga0373957_0318669 3300035120 Bacteria 661
420 Ga0373943_0002244 3300035170 Bacteria 8781
421 Ga0373943_0668045 3300035170 Bacteria 615
422 Ga0373946_0022256 3300035171 Bacteria 2465
423 Ga0373955_0000324 3300035172 Bacteria 19834
424 Ga0373955_0006204 3300035172 Bacteria 5438
425 Ga0373955_0085110 3300035172 Bacteria 1794
426 Ga0373962_0150534 3300035242 Bacteria 762
427 Ga0373962_0211165 3300035242 Bacteria 660
428 Ga0373924_0135036 3300035410 Bacteria 1074
429 Ga0373924_0176555 3300035410 Bacteria 939
430 Ga0373935_0000344 3300035692 Bacteria 23571
431 Ga0373935_0023762 3300035692 Bacteria 3766
432 Ga0373935_0145943 3300035692 Bacteria 1602
433 Ga0373935_0184033 3300035692 Bacteria 1436
434 Ga0373927_0000665 3300035695 Bacteria 26133
435 Ga0373927_0050823 3300035695 Bacteria 2681
436 Ga0373933_0000405 3300035724 Bacteria 27323
437 Ga0373933_0054071 3300035724 Bacteria 2405
438 Ga0373933_0066920 3300035724 Bacteria 2178
439 Ga0373933_0948325 3300035724 Bacteria 567
440 Ga0373947_0003567 3300035725 Bacteria 9185
441 Ga0373947_0691654 3300035725 Bacteria 696
442 Ga0373937_0108706 3300036401 Bacteria 2578
443 Ga0373937_0210744 3300036401 Bacteria 1828
444 Ga0373937_0308982 3300036401 Bacteria 1495
445 Ga0373937_0876073 3300036401 Bacteria 846
446 Ga0373925_0051507 3300037068 Bacteria 3073
447 Ga0373925_0723786 3300037068 Bacteria 820
448 Ga0395898_0037847 3300037466 Bacteria 4783
449 Ga0395905_0379340 3300037471 Bacteria 1307
450 Ga0436364_0374170 3300037853 Bacteria 1029
451 Ga0395901_0452341 3300038443 Bacteria 1313
452 Ga0436365_0722166 3300039437 Bacteria 4126
453 Ga0436365_1835290 3300039437 Bacteria 621
454 Ga0436360_0406636 3300039438 Bacteria 571
455 Ga0436361_0126094 3300039447 Bacteria 5267
456 Ga0436361_0885839 3300039447 Bacteria 750
457 Ga0436363_1696922 3300039450 Bacteria 977
458 Ga0436362_0204184 3300039453 Bacteria 859
459 Ga0439453_0004082 3300041408 Bacteria 2149
460 Ga0439465_0083249 3300041413 Bacteria 1087
461 Ga0451793_1037605 3300041452 Bacteria 535
462 Ga0451798_0485295 3300041458 Bacteria 707
463 Ga0451802_1873711 3300041460 Bacteria 1430
464 Ga0451833_0696686 3300041491 Bacteria 519
465 Ga0451839_1539857 3300041496 Bacteria 750
466 Ga0451841_0638029 3300041498 Bacteria 1011
467 Ga0451855_0963347 3300041511 Bacteria 653
468 Ga0439441_019832 3300042001 Bacteria 1227
469 Ga0439443_005100 3300042003 Bacteria 1744
470 Ga0450894_045803 3300042131 Bacteria 636
471 Ga0439435_0013804 3300042436 Bacteria 1985
472 Ga0466965_0018816 3300044683 Bacteria 3314
473 Ga0466964_0266467 3300044706 Bacteria 851
474 Ga0466968_0164168 3300044735 Bacteria 1026
475 Ga0466967_0054533 3300045976 Bacteria 3519
476 Ga0466967_0077104 3300045976 Bacteria 3000
477 Ga0495617_131465 3300046452 Bacteria 802
478 Ga0495592_0005358 3300046454 Bacteria 9468
479 Ga0495592_0036537 3300046454 Bacteria 3699
480 Ga0495592_0476396 3300046454 Bacteria 778
481 Ga0495603_0000094 3300046455 Bacteria 40636
482 Ga0495603_0008917 3300046455 Bacteria 6063
483 Ga0495590_0146057 3300046457 Bacteria 856
484 Ga0495629_0000612 3300046459 Bacteria 29083
485 Ga0495629_0001119 3300046459 Bacteria 21231
486 Ga0495629_0035842 3300046459 Bacteria 3505
487 Ga0495629_0720950 3300046459 Bacteria 661
488 Ga0495629_0734375 3300046459 Bacteria 654
489 Ga0495638_0021095 3300046460 Bacteria 4296
490 Ga0495641_0003738 3300046461 Bacteria 11192
491 Ga0495651_0055029 3300046462 Bacteria 3057
492 Ga0495651_0075905 3300046462 Bacteria 2547
493 Ga0495651_0083064 3300046462 Bacteria 2416
494 Ga0495651_0168934 3300046462 Bacteria 1559
495 Ga0495651_0361346 3300046462 Bacteria 957
496 Ga0495653_0000399 3300046463 Bacteria 34847
497 Ga0495653_0161772 3300046463 Bacteria 1553
498 Ga0495580_0002084 3300046472 Bacteria 17548
499 Ga0495582_0000256 3300046473 Bacteria 29694
500 Ga0495605_0202012 3300046474 Bacteria 866
501 Ga0495639_0000114 3300046475 Bacteria 40307
502 Ga0495639_0211485 3300046475 Bacteria 952
503 Ga0495662_0003498 3300046476 Bacteria 7946
504 Ga0495662_0277414 3300046476 Bacteria 825
505 Ga0495664_0016053 3300046477 Bacteria 4264
506 Ga0495664_0183039 3300046477 Bacteria 1270
507 Ga0495584_0117425 3300046491 Bacteria 1347
508 Ga0495584_0411534 3300046491 Bacteria 687
509 Ga0495584_0477840 3300046491 Bacteria 634
510 Ga0495585_0062294 3300046492 Bacteria 2049
511 Ga0495585_0209921 3300046492 Bacteria 987
512 Ga0495585_0215897 3300046492 Bacteria 970
513 Ga0495594_0000393 3300046499 Bacteria 22014
514 Ga0495594_0245845 3300046499 Bacteria 1019
515 Ga0495596_0105913 3300046500 Bacteria 1092
516 Ga0495596_0127524 3300046500 Bacteria 988
517 Ga0495596_0177103 3300046500 Bacteria 829
518 Ga0495607_0489806 3300046501 Bacteria 547
519 Ga0495583_0447718 3300046506 Bacteria 506
520 Ga0495606_0213338 3300046507 Bacteria 1092
521 Ga0495606_0298888 3300046507 Bacteria 873
522 Ga0495608_0042031 3300046511 Bacteria 3056
523 Ga0495610_0040945 3300046512 Bacteria 2330
524 Ga0495616_0241385 3300046513 Bacteria 779
525 Ga0495616_0328466 3300046513 Bacteria 641
526 Ga0495618_0066005 3300046514 Bacteria 2300
527 Ga0495620_0405611 3300046515 Bacteria 516
528 Ga0495628_0009019 3300046516 Bacteria 8533
529 Ga0495628_0021333 3300046516 Bacteria 5331
530 Ga0495630_0000459 3300046517 Bacteria 30805
531 Ga0495630_0120282 3300046517 Bacteria 1992
532 Ga0495631_0131115 3300046518 Bacteria 1077
533 Ga0495631_0188223 3300046518 Bacteria 884
534 Ga0495632_0224981 3300046519 Bacteria 848
535 Ga0495643_0126117 3300046522 Bacteria 1289
536 Ga0495644_0022033 3300046523 Bacteria 2429
537 Ga0495648_0161917 3300046524 Bacteria 1156
538 Ga0495648_0440496 3300046524 Bacteria 572
539 Ga0495666_0047291 3300046526 Bacteria 2072
540 Ga0495652_0040573 3300046529 Bacteria 4023
541 Ga0495652_0055427 3300046529 Bacteria 3371
542 Ga0495652_0527985 3300046529 Bacteria 814
543 Ga0495654_0195101 3300046530 Bacteria 870
544 Ga0495665_0000130 3300046531 Bacteria 35880
545 Ga0495640_0007646 3300046533 Bacteria 8498
546 Ga0495640_0026691 3300046533 Bacteria 4169
547 Ga0495640_0104373 3300046533 Bacteria 1857
548 Ga0495587_0523972 3300046536 Bacteria 654
549 Ga0495598_0093445 3300046537 Bacteria 984
550 Ga0495598_0384964 3300046537 Bacteria 546
551 Ga0495609_0447464 3300046538 Bacteria 513
552 Ga0495621_0166364 3300046539 Bacteria 874
553 Ga0495621_0504464 3300046539 Bacteria 522
554 Ga0495597_0147458 3300046542 Bacteria 967
555 Ga0495597_0263494 3300046542 Bacteria 675
556 Ga0495645_0011598 3300046543 Bacteria 6206
557 Ga0495622_0005481 3300046557 Bacteria 5885
558 Ga0495622_0015707 3300046557 Bacteria 3520
559 Ga0495622_0070154 3300046557 Bacteria 1618
560 Ga0495622_0348873 3300046557 Bacteria 641
561 Ga0495633_0157609 3300046558 Bacteria 1047
562 Ga0495667_0005133 3300046559 Bacteria 8844
563 Ga0495667_0007603 3300046559 Bacteria 7356
564 Ga0495667_0034502 3300046559 Bacteria 3383
565 Ga0495656_0217053 3300046615 Bacteria 955
566 Ga0495656_0220042 3300046615 Bacteria 949
567 Ga0495656_0425106 3300046615 Bacteria 697
568 Ga0495668_0022689 3300046616 Bacteria 3586
569 Ga0495668_0100592 3300046616 Bacteria 1582
570 Ga0495668_0524164 3300046616 Bacteria 653
571 Ga0495634_0002801 3300046642 Bacteria 14322
572 Ga0495634_0133318 3300046642 Bacteria 1582
573 Ga0495634_0229425 3300046642 Bacteria 1143
574 Ga0495634_0579393 3300046642 Bacteria 652
575 Ga0495625_0192670 3300046660 Bacteria 1349
576 Ga0495625_0873707 3300046660 Bacteria 517
577 Ga0495635_0000088 3300046663 Bacteria 54355
578 Ga0495635_0006280 3300046663 Bacteria 8276
579 Ga0495635_0627236 3300046663 Bacteria 700
580 Ga0495659_0075914 3300046664 Bacteria 1267
581 Ga0495659_0088773 3300046664 Bacteria 1184
582 Ga0495659_0522221 3300046664 Bacteria 522
583 Ga0495588_0004028 3300046674 Bacteria 6463
584 Ga0495588_0094977 3300046674 Bacteria 1563
585 Ga0495657_0008178 3300046675 Bacteria 8016
586 Ga0495657_0048583 3300046675 Bacteria 2861
587 Ga0495599_0001137 3300046678 Bacteria 15035
588 Ga0495599_0024026 3300046678 Bacteria 3811
589 Ga0495623_0149932 3300046679 Bacteria 1379
590 Ga0495623_0226508 3300046679 Bacteria 1062
591 Ga0495623_0272511 3300046679 Bacteria 944
592 Ga0495646_0016831 3300046680 Bacteria 4644
593 Ga0495646_0326324 3300046680 Bacteria 807
594 Ga0495647_0000070 3300046681 Bacteria 24847
595 Ga0495647_0314708 3300046681 Bacteria 708
596 Ga0495647_0440323 3300046681 Bacteria 602
597 Ga0495658_0007345 3300046683 Bacteria 5447
598 Ga0495658_0665269 3300046683 Bacteria 667
599 Ga0495669_0047832 3300046684 Bacteria 1912
600 Ga0495669_0094290 3300046684 Bacteria 1385
601 Ga0495669_0445227 3300046684 Bacteria 629
602 Ga0495613_0004685 3300046689 Bacteria 10263
603 Ga0495613_0115235 3300046689 Bacteria 1934
604 Ga0495624_0000079 3300046690 Bacteria 63196
605 Ga0495671_0167462 3300046692 Bacteria 1069
606 Ga0495649_0353328 3300046694 Bacteria 742
607 Ga0495589_0374413 3300046794 Bacteria 655
608 Ga0495600_0000484 3300046809 Bacteria 20528
609 Ga0495600_0444286 3300046809 Bacteria 802
610 Ga0495600_0465443 3300046809 Bacteria 780
611 Ga0495581_0000082 3300047315 Bacteria 38294
612 Ga0495604_0002253 3300047317 Bacteria 15447
613 Ga0495604_0040963 3300047317 Bacteria 3634
614 Ga0495604_0729245 3300047317 Bacteria 628
615 Ga0495604_0791733 3300047317 Bacteria 597
616 Ga0495636_0262172 3300047318 Bacteria 801
617 Ga0495674_0001729 3300047319 Bacteria 21443
618 Ga0495674_0010560 3300047319 Bacteria 8740
619 Ga0495672_0335608 3300047320 Bacteria 706
620 Ga0495676_0016546 3300047321 Bacteria 6540
621 Ga0495680_0020168 3300047322 Bacteria 5614
622 Ga0495680_0029180 3300047322 Bacteria 4518
623 Ga0495680_0581769 3300047322 Bacteria 751
624 Ga0495683_0335883 3300047323 Bacteria 641
625 Ga0495687_226617 3300047443 Bacteria 574
626 Ga0495675_0000977 3300047444 Bacteria 17351
627 Ga0495675_0064158 3300047444 Bacteria 2323
628 Ga0495677_0397204 3300047445 Bacteria 545
629 Ga0495679_073271 3300047446 Bacteria 983
630 Ga0495685_257558 3300047447 Bacteria 553
631 Ga0495673_0138032 3300047469 Bacteria 953
632 Ga0495673_0170030 3300047469 Bacteria 831
633 Ga0495681_0034438 3300047470 Bacteria 2524
634 Ga0495681_0324936 3300047470 Bacteria 590
635 Ga0495684_0018562 3300047471 Bacteria 5357
636 Ga0495684_0033131 3300047471 Bacteria 3965
637 Ga0495684_0101470 3300047471 Bacteria 2175
638 Ga0495686_0268208 3300047472 Bacteria 953
639 Ga0495686_0330415 3300047472 Bacteria 833
640 Ga0495593_0000206 3300047673 Bacteria 31187
641 Ga0495593_0000566 3300047673 Bacteria 21032
642 Ga0495593_0356233 3300047673 Bacteria 731
643 Ga0495593_0494328 3300047673 Bacteria 613
644 Ga0495602_0030317 3300048088 Bacteria 5132
645 Ga0495602_0309330 3300048088 Bacteria 1153
646 Ga0495602_0399637 3300048088 Bacteria 980
647 Ga0495614_0008940 3300048089 Bacteria 4444
648 Ga0495615_0159380 3300048090 Bacteria 677
649 Ga0495626_0399173 3300048091 Bacteria 532
650 Ga0496100_0693828 3300048903 Bacteria 794
651 Ga0496100_1038104 3300048903 Bacteria 645
652 Ga0496101_0005087 3300048904 Bacteria 8363
653 Ga0496101_0027265 3300048904 Bacteria 3978
654 Ga0496101_0491371 3300048904 Bacteria 969
655 Ga0496102_0010651 3300048905 Bacteria 7921
656 Ga0496102_0190183 3300048905 Bacteria 1934
657 Ga0496102_1770492 3300048905 Bacteria 535
658 Ga0496103_0081794 3300048906 Bacteria 2032
659 Ga0496103_0719688 3300048906 Bacteria 632
660 Ga0496103_0812785 3300048906 Bacteria 589
661 Ga0496104_0009468 3300048907 Bacteria 8667
662 Ga0496104_0022665 3300048907 Bacteria 5769
663 Ga0496104_0248960 3300048907 Bacteria 1690
664 Ga0496104_1052014 3300048907 Bacteria 718
665 Ga0496105_0007364 3300048908 Bacteria 8515
666 Ga0496106_0014808 3300048909 Bacteria 5767
667 Ga0496106_0192340 3300048909 Bacteria 1623
668 Ga0496106_0723371 3300048909 Bacteria 792
669 Ga0496107_0015171 3300048910 Bacteria 5397
670 Ga0496107_1205577 3300048910 Bacteria 544
671 Ga0496108_0123089 3300048911 Bacteria 2225
672 Ga0496109_0007049 3300048912 Bacteria 9483
673 Ga0496109_0095772 3300048912 Bacteria 2749
674 Ga0496109_0470281 3300048912 Bacteria 1187
675 Ga0496110_0005923 3300048913 Bacteria 9621
676 Ga0496110_0013109 3300048913 Bacteria 6842
677 Ga0496110_1168558 3300048913 Bacteria 678
678 Ga0496111_0022400 3300048914 Bacteria 4423
679 Ga0496111_0418224 3300048914 Bacteria 990
680 Ga0496112_0011247 3300048915 Bacteria 8163
681 Ga0496112_0025092 3300048915 Bacteria 5720
682 Ga0496112_0641669 3300048915 Bacteria 992
683 Ga0496112_0966645 3300048915 Bacteria 772
684 Ga0496112_1404686 3300048915 Bacteria 613
685 Ga0496113_0044790 3300048916 Bacteria 3279
686 Ga0496113_0482364 3300048916 Bacteria 996
687 Ga0496114_0024042 3300048917 Bacteria 4972
688 Ga0496114_1177943 3300048917 Bacteria 652
689 Ga0496114_1713105 3300048917 Bacteria 517
690 Ga0496115_0001214 3300048918 Bacteria 18485
691 Ga0496115_0029666 3300048918 Bacteria 4298
692 Ga0496115_0078197 3300048918 Bacteria 2691
693 Ga0496115_0184470 3300048918 Bacteria 1724
694 Ga0496115_0422746 3300048918 Bacteria 1079
695 Ga0496118_0258839 3300048921 Bacteria 984
696 Ga0496119_0291381 3300048922 Bacteria 808
697 Ga0496119_0302592 3300048922 Bacteria 788
698 Ga0496120_0011286 3300048923 Bacteria 6154
699 Ga0496120_0510229 3300048923 Bacteria 515
700 Ga0496121_0023253 3300048924 Bacteria 5976
701 Ga0496121_0024027 3300048924 Bacteria 5842
702 Ga0496121_0058439 3300048924 Bacteria 3189
703 Ga0496121_0067926 3300048924 Bacteria 2886
704 Ga0496121_0082919 3300048924 Bacteria 2532
705 Ga0496121_0083463 3300048924 Bacteria 2522
706 Ga0496121_0687956 3300048924 Bacteria 617
707 Ga0496123_0175056 3300048926 Bacteria 1127
708 Ga0496124_0064495 3300048927 Bacteria 3057
709 Ga0496124_0100876 3300048927 Bacteria 2339
710 Ga0496124_0147056 3300048927 Bacteria 1853
711 Ga0496124_0881075 3300048927 Bacteria 545
712 Ga0496125_0076874 3300048928 Bacteria 2576
713 Ga0496125_0127714 3300048928 Bacteria 1798
714 Ga0496125_0191880 3300048928 Bacteria 1348
715 Ga0496126_0002727 3300048929 Bacteria 23333
716 Ga0496126_0046873 3300048929 Bacteria 3960
717 Ga0496126_0052358 3300048929 Bacteria 3710
718 Ga0496126_0081842 3300048929 Bacteria 2853
719 Ga0496126_0113868 3300048929 Bacteria 2354
720 Ga0496126_0145323 3300048929 Bacteria 2037
721 Ga0496126_0206782 3300048929 Bacteria 1654
722 Ga0496126_0255373 3300048929 Bacteria 1459
723 Ga0496126_0300594 3300048929 Bacteria 1324
724 Ga0496126_0309971 3300048929 Bacteria 1300
725 Ga0496126_0460042 3300048929 Bacteria 1023
726 Ga0496126_1296441 3300048929 Bacteria 531
727 Ga0495678_255022 3300049459 Bacteria 520
728 Ga0501036_0420456 3300049572 Bacteria 1114
729 Ga0501036_1472809 3300049572 Bacteria 551
730 Ga0501069_0317947 3300049585 Bacteria 914
731 Ga0501071_1272592 3300049587 Unclassified 568
732 Ga0501076_0902364 3300049592 Bacteria 729
733 Ga0501079_0339469 3300049741 Bacteria 1177
734 Ga0501083_0318377 3300049744 Bacteria 1012
735 Ga0501083_0520419 3300049744 Bacteria 774
736 nmdc:mga03683_133072_c1 3300050489 Bacteria 1114
737 nmdc:mga03n38_638662_c1 3300050490 Bacteria 609
738 nmdc:mga00v17_633667_c1 3300050491 Bacteria 688
739 nmdc:mga00v17_68932_c1 3300050491 Bacteria 2187
740 nmdc:mga0yw44_111709_c1 3300050492 Bacteria 1752
741 nmdc:mga0yw44_1156971_c1 3300050492 Bacteria 522
742 nmdc:mga0yw44_169564_c1 3300050492 Bacteria 1433
743 nmdc:mga0yw44_71355_c1 3300050492 Bacteria 2156
744 nmdc:mga0yw44_988731_c1 3300050492 Bacteria 570
745 nmdc:mga0k408_311417_c1 3300050493 Bacteria 940
746 nmdc:mga0k408_340823_c1 3300050493 Bacteria 894
747 nmdc:mga0k408_706260_c1 3300050493 Bacteria 591
748 nmdc:mga06z11_256478_c1 3300050494 Bacteria 1031
749 nmdc:mga06z11_930160_c1 3300050494 Bacteria 530
750 nmdc:mga04h51_233251_c1 3300050495 Bacteria 733
751 nmdc:mga07m45_453289_c1 3300050496 Bacteria 744
752 nmdc:mga07m45_658387_c1 3300050496 Bacteria 603
753 nmdc:mga07m45_681228_c1 3300050496 Bacteria 592
754 nmdc:mga05p37_490029_c1 3300050507 Bacteria 1413
755 nmdc:mga09592_795253_c1 3300050508 Bacteria 800
756 nmdc:mga0qj67_1151682_c1 3300050509 Bacteria 604
757 nmdc:mga08y16_1272728_c1 3300050511 Bacteria 703
758 nmdc:mga08y16_375466_c2 3300050511 Bacteria 857
759 nmdc:mga0sz30_461101_c1 3300050516 Bacteria 571
760 Ga0495601_0123815 3300053077 Bacteria 1681
761 Ga0495601_0257916 3300053077 Bacteria 1138
762 Ga0495601_0535144 3300053077 Bacteria 754
763 Ga0495612_0354767 3300053078 Bacteria 662
764 Ga0500635_0018721 3300053080 Bacteria 2095
765 Ga0495655_0016749 3300053083 Bacteria 1585
766 Ga0495595_0004196 3300053084 Bacteria 5796
767 Ga0495595_0059256 3300053084 Bacteria 1789
768 Ga0495619_0000332 3300053085 Bacteria 33066
769 Ga0495619_0076013 3300053085 Bacteria 2254
770 Ga0495619_0104139 3300053085 Bacteria 1933
771 Ga0495619_0456127 3300053085 Bacteria 881
772 Ga0495619_0511746 3300053085 Bacteria 825
773 Ga0495619_0590016 3300053085 Bacteria 760
774 Ga0500647_0108382 3300053091 Bacteria 1322
775 Ga0500566_0000071 3300053094 Bacteria 49154
776 Ga0500566_0000537 3300053094 Bacteria 21255
777 Ga0500640_022899 3300053095 Bacteria 2703
778 Ga0500648_172464 3300053097 Bacteria 1124
779 Ga0500555_101712 3300053103 Bacteria 729
780 Ga0500562_128524 3300053108 Bacteria 690
781 Ga0500572_001322 3300053111 Bacteria 6910
782 Ga0500582_268913 3300053114 Bacteria 542
783 Ga0500591_162189 3300053115 Bacteria 843
784 Ga0500595_001734 3300053119 Bacteria 11379
785 Ga0500608_002586 3300053122 Bacteria 6618
786 Ga0500608_034265 3300053122 Bacteria 2418
787 Ga0500621_261597 3300053126 Bacteria 575
788 Ga0500642_0109236 3300053130 Bacteria 1291
789 Ga0500642_0442473 3300053130 Bacteria 559
790 Ga0500642_0501079 3300053130 Bacteria 513
791 Ga0500658_0133361 3300053134 Bacteria 1110
792 Ga0500658_0253225 3300053134 Bacteria 809
793 Ga0500559_0006520 3300053136 Bacteria 5268
794 Ga0500559_0275596 3300053136 Bacteria 791
795 Ga0500568_0264648 3300053139 Bacteria 625
796 Ga0500573_0005332 3300053140 Bacteria 6882
797 Ga0500588_0156820 3300053146 Bacteria 826
798 Ga0500590_130205 3300053148 Bacteria 1165
799 Ga0500590_272207 3300053148 Bacteria 657
800 Ga0500603_000166 3300053150 Bacteria 16600
801 Ga0500603_097047 3300053150 Bacteria 872
802 Ga0500620_250100 3300053155 Bacteria 590
803 Ga0500622_0001260 3300053156 Bacteria 20664
804 Ga0500627_0221209 3300053158 Bacteria 845
805 Ga0500630_006610 3300053159 Bacteria 5683
806 Ga0500638_099510 3300053162 Bacteria 1358
807 Ga0500638_367831 3300053162 Bacteria 527
808 Ga0500639_000166 3300053163 Bacteria 32001
809 Ga0500639_293187 3300053163 Bacteria 617
810 Ga0500636_0064862 3300053177 Bacteria 2126
811 Ga0500636_0122870 3300053177 Bacteria 1454
812 Ga0500637_0076295 3300053178 Bacteria 1933
813 Ga0500645_048981 3300053730 Bacteria 1236
814 Ga0500609_032166 3300053731 Bacteria 721
815 Ga0500552_013828 3300053733 Bacteria 1054
816 Ga0500596_006204 3300053735 Bacteria 2043
817 Ga0500601_000249 3300053737 Bacteria 10384
818 Ga0501082_0930483 3300060353 Bacteria 760
819 Ga0501082_1782911 3300060353 Bacteria 537
820 Ga0466962_0486630 3300061719 Bacteria 624
821 Ga0530510_0487851 3300061734 Bacteria 934
822 2513696934 2513237101 Bacteria 7952346
823 2513878122 2513237139 Bacteria 8737671
824 2513893309 2513237141 Bacteria 8496279
825 2514012582 2513237161 Bacteria 8871253
826 2524439058 2524023205 Bacteria 8918781
827 2617353078 2617270735 Bacteria 9163226
828 2617378951 2617270741 Bacteria 8201522
829 2745078829 2744054633 Bacteria 8678936
830 2793081134
831 2805920083 2802429603 Bacteria 8777136
832 2824605606 2824600985 Bacteria 8488197
833 2824609856 2824609381 Bacteria 8672835
834 2824698901 2824696289 Bacteria 8335049
835 2824781052 2824773399 Bacteria 8360218
836 2838127531 2838122688 Bacteria 8803140
837 2841941516 2841941048 Bacteria 8688029
838 2841952468 2841949485 Bacteria 8680857
839 2841967659 2841966195 Bacteria 8673214
840 2841982174 2841974524 Bacteria 8931498
841 2841986492 2841983080 Bacteria 8395090
842 2847934525 2847930680 Bacteria 9342022
843 2847945133 2847939898 Bacteria 8606328
844 2849080686 2849076700 Bacteria 7039503
845 2857509953 2857509624 Bacteria 7472071
846 2876766691 2876761206 Bacteria 10111113
847 2876811878 2876808645 Bacteria 8824342
848 2879089717 2879083081 Bacteria 8587928
849 2879118719 2879110137 Bacteria 8907982
850 2885414272 2885409591 Bacteria 9235467
851 2888423044 2888419890 Bacteria 7857137
852 2906649920 2906643746 Bacteria 8722424
853 2908778711 2908775508 Bacteria 8092255
854 3005508743 3005506211 Bacteria 6943378
855 3005589443 3005587118 Bacteria 7794411
856 8006991840 8006984368 Bacteria 9651211
857 8056676447 8056673599 Bacteria 7871253
858 Ga0373936_0026651
859 JGI24740J21852_10003304
860 JGI25153J46596_10004014
861 JGI25153J46596_10016112
862 JGI25404J52841_10039217
863 Ga0055524_1016842
864 Ga0055531_10004813
865 Ga0065707_10039176
866 Ga0070676_10214707
867 Ga0070676_10348190
868 Ga0070676_10411622
869 Ga0070670_100796756
870 Ga0068869_100126189
871 Ga0068869_100126741
872 Ga0068869_100218449
873 Ga0068868_100112158
874 Ga0070660_100305832
875 Ga0070660_101016212
876 Ga0070689_100189346
877 Ga0070689_100490566
878 Ga0070661_100205307
879 Ga0070668_100124339
880 Ga0070668_100404214
881 Ga0070668_101255188
882 Ga0070668_101703616
883 Ga0070669_100662707
884 Ga0070669_101355619
885 Ga0070671_100267716
886 Ga0070674_100385643
887 Ga0070674_100994860
888 Ga0070673_100215954
889 Ga0070659_100171612
890 Ga0070667_100576990
891 Ga0070667_100832495
892 Ga0070709_10000431
893 Ga0070714_100034967
894 Ga0070713_100011005
895 Ga0070713_100058790
896 Ga0070713_102195980
897 Ga0070710_10002535
898 Ga0070700_100289366
899 Ga0070694_101713999
900 Ga0070663_100215710
901 Ga0070678_100130100
902 Ga0070662_100315386
903 Ga0070662_100425069
904 Ga0070681_10821534
905 Ga0068867_100178136
906 Ga0070706_101450377
907 Ga0070698_101111463
908 Ga0070699_100525885
909 Ga0070699_100541718
910 Ga0070679_101080131
911 Ga0070684_100037899
912 Ga0070684_100122428
913 Ga0068853_100273959
914 Ga0070672_100370482
915 Ga0070672_100519278
916 Ga0070695_100111158
917 Ga0070693_100345320
918 Ga0070665_100005984
919 Ga0070665_100184379
920 Ga0070665_100317274
921 Ga0070665_100839979
922 Ga0070665_100901982
923 Ga0070665_100952773
924 Ga0070665_101589527
925 Ga0070704_100219261
926 Ga0070704_102167579
927 Ga0068855_100132169
928 Ga0070664_100333479
929 Ga0068854_100696460
930 Ga0068856_100013112
931 Ga0068856_100482328
932 Ga0070702_101279450
933 Ga0068852_100027381
934 Ga0068852_100051850
935 Ga0068852_100380496
936 Ga0068852_100695408
937 Ga0068859_100146495
938 Ga0068859_100252848
939 Ga0068864_100344511
940 Ga0068861_100023528
941 Ga0068861_100024258
942 Ga0068861_101376166
943 Ga0068851_10068102
944 Ga0068863_100855093
945 Ga0068863_101664037
946 Ga0068858_100800413
947 Ga0068858_100978564
948 Ga0068858_101322160
949 Ga0068860_100000240
950 Ga0068860_100594393
951 Ga0068860_101438487
952 Ga0068862_100346384
953 Ga0068862_101078328
954 Ga0068862_101560690
955 Ga0081540_1001756
956 Ga0081540_1007693
957 Ga0081540_1008560
958 Ga0081540_1028981
959 Ga0081540_1031157
960 Ga0081540_1048878
961 Ga0081540_1313916
962 Ga0070717_10161092
963 Ga0070717_10392450
964 Ga0070717_10963794
965 Ga0070717_11425906
966 Ga0075365_10054511
967 Ga0075365_10137769
968 Ga0075365_10191273
969 Ga0075365_10502707
970 Ga0075365_10531373
971 Ga0075368_10104541
972 Ga0075368_10254069
973 Ga0075363_100693403
974 Ga0075364_10236431
975 Ga0075364_10299355
976 Ga0070712_100018443
977 Ga0070712_101365335
978 Ga0075362_10224121
979 Ga0075367_10067984
980 Ga0075367_10291918
981 Ga0075367_10548908
982 Ga0075369_10103088
983 Ga0075369_10127626
984 Ga0075369_10235546
985 Ga0075366_10100140
986 Ga0075366_10226339
987 Ga0075366_10436992
988 Ga0075366_10911614
989 Ga0097621_100399129
990 Ga0075370_10060776
991 Ga0075370_10093541
992 Ga0068871_100222498
993 Ga0068871_100251089
994 Ga0068871_100763059
995 Ga0075428_100204537
996 Ga0075428_100459440
997 Ga0075429_100818060
998 Ga0068865_100101344
999 Ga0068865_100416227
1000 Ga0097620_100146487
1001 Ga0097620_100252830
1002 Ga0099823_1008372
1003 Ga0099795_10023161
1004 Ga0099795_10200601
1005 Ga0105240_10462900
1006 Ga0111539_10553309
1007 Ga0111539_11065905
1008 Ga0105245_10098355
1009 Ga0105245_11257311
1010 Ga0114129_10628777
1011 Ga0114129_11097734
1012 Ga0105243_10082945
1013 Ga0105243_10591114
1014 Ga0105243_12872045
1015 Ga0105241_10509338
1016 Ga0105241_12519848
1017 Ga0105242_10777178
1018 Ga0105242_10808790
1019 Ga0105248_11781972
1020 Ga0105237_10206777
1021 Ga0105237_11385671
1022 Ga0105237_11466724
1023 Ga0105237_11612540
1024 Ga0105238_10784745
1025 Ga0105238_10825560
1026 Ga0105238_11021476
1027 Ga0105238_11536480
1028 Ga0105238_12176596
1029 Ga0105249_10176423
1030 Ga0105249_10939938
1031 Ga0105249_11135415
1032 Ga0099796_10423544
1033 Ga0099796_10486102
1034 Ga0105239_10299129
1035 Ga0105239_10357286
1036 Ga0105239_10391909
1037 Ga0105239_10489727
1038 Ga0105239_11405759
1039 Ga0105239_11701603
1040 Ga0105246_10010537
1041 Ga0105246_10301311
1042 Ga0105246_11027532
1043 Ga0157370_11777741
1044 Ga0157369_10365061
1045 Ga0157374_10080779
1046 Ga0157378_10558386
1047 Ga0157378_10588242
1048 Ga0157378_11022760
1049 Ga0163162_10015868
1050 Ga0163162_10638040
1051 Ga0163162_10805032
1052 Ga0163162_10935425
1053 Ga0163162_11034369
1054 Ga0163162_11319104
1055 Ga0157372_12725282
1056 Ga0157375_10094782
1057 Ga0157375_10403354
1058 Ga0157375_11882991
1059 Ga0157375_12529279
1060 Ga0163163_10270680
1061 Ga0163163_11148303
1062 Ga0163163_11981680
1063 Ga0157380_10856408
1064 Ga0157380_10972842
1065 Ga0157379_10160192
1066 Ga0157379_11000636
1067 Ga0157376_10044206
1068 Ga0157376_10403762
1069 Ga0157376_10964016
1070 Ga0157376_11189499
1071 Ga0163161_10008352
1072 Ga0163161_10294577
1073 Ga0163161_10649898
1074 Ga0163161_10883753
1075 Ga0214544_1000020
1076 Ga0214542_1000024
1077 Ga0214545_1000011
1078 Ga0214543_1000033
1079 Ga0213876_10006667
1080 Ga0213871_10034825
1081 Ga0209233_1001934
1082 Ga0209455_1005724
1083 Ga0209564_1021981
1084 Ga0209758_1000065
1085 Ga0209758_1003962
1086 Ga0209758_1017237
1087 Ga0209758_1033086
1088 Ga0209256_1003626
1089 Ga0207426_1017849
1090 Ga0209257_1001031
1091 Ga0207692_10000702
1092 Ga0207692_11175770
1093 Ga0207642_10153268
1094 Ga0207680_10819135
1095 Ga0207680_11073602
1096 Ga0207699_10001397
1097 Ga0207699_10051036
1098 Ga0207645_10290114
1099 Ga0207645_10773675
1100 Ga0207684_10250030
1101 Ga0207707_10234396
1102 Ga0207707_11300733
1103 Ga0207671_10208195
1104 Ga0207671_10874670
1105 Ga0207693_10016800
1106 Ga0207693_10324864
1107 Ga0207663_10659802
1108 Ga0207663_11362393
1109 Ga0207660_11301381
1110 Ga0207657_10273754
1111 Ga0207657_10286112
1112 Ga0207649_10342567
1113 Ga0207652_10017746
1114 Ga0207652_10798483
1115 Ga0207646_10243981
1116 Ga0207681_10583636
1117 Ga0207681_10883777
1118 Ga0207681_10911881
1119 Ga0207694_10301730
1120 Ga0207650_10602943
1121 Ga0207659_10148626
1122 Ga0207687_10017165
1123 Ga0207687_10575374
1124 Ga0207700_10057956
1125 Ga0207700_10161061
1126 Ga0207700_11082275
1127 Ga0207664_10031782
1128 Ga0207690_10484019
1129 Ga0207706_10059280
1130 Ga0207706_10703774
1131 Ga0207706_10939911
1132 Ga0207686_10098753
1133 Ga0207686_11152153
1134 Ga0207709_10020195
1135 Ga0207709_10433961
1136 Ga0207709_11250260
1137 Ga0207670_10338685
1138 Ga0207670_10398481
1139 Ga0207669_10195160
1140 Ga0207669_10495556
1141 Ga0207704_10851428
1142 Ga0207665_10004907
1143 Ga0207665_10286403
1144 Ga0207665_10465367
1145 Ga0207691_10139416
1146 Ga0207691_10164821
1147 Ga0207691_10892402
1148 Ga0207689_10008197
1149 Ga0207689_10094058
1150 Ga0207689_10294432
1151 Ga0207689_10301630
1152 Ga0207689_10325598
1153 Ga0207661_10021041
1154 Ga0207661_10333131
1155 Ga0207679_10161057
1156 Ga0207679_10276488
1157 Ga0207667_10405142
1158 Ga0207712_10390136
1159 Ga0207712_11445724
1160 Ga0207668_10016501
1161 Ga0207668_10387977
1162 Ga0207668_11108881
1163 Ga0207668_11557531
1164 Ga0207640_10827774
1165 Ga0207658_10602743
1166 Ga0207658_11392120
1167 Ga0207677_10050895
1168 Ga0207703_10252455
1169 Ga0207703_10811604
1170 Ga0207639_10166709
1171 Ga0207639_10492601
1172 Ga0207639_10901582
1173 Ga0207678_10150260
1174 Ga0207678_10281771
1175 Ga0207678_11060565
1176 Ga0207678_11073932
1177 Ga0207708_10080292
1178 Ga0207708_11102737
1179 Ga0207702_10397228
1180 Ga0207641_10580934
1181 Ga0207648_10116981
1182 Ga0207676_10352837
1183 Ga0207676_11189100
1184 Ga0207675_100186819
1185 Ga0207675_100562567
1186 Ga0207675_100812978
1187 Ga0207675_101308787
1188 Ga0207683_10119009
1189 Ga0207683_10215271
1190 Ga0207698_10032369
1191 Ga0207698_10120249
1192 Ga0207698_10515728
1193 Ga0209389_1000011
1194 Ga0209489_100017
1195 Ga0209700_100027
1196 Ga0209179_1009494
1197 Ga0209588_1018692
1198 Ga0209813_10506053
1199 Ga0268266_10039496
1200 Ga0268266_10198684
1201 Ga0268266_11261720
1202 Ga0268266_11467939
1203 Ga0268266_12355119
1204 Ga0268265_10053445
1205 Ga0268265_10114404
1206 Ga0268265_10871121
1207 Ga0268265_12062822
1208 Ga0268264_10152117
1209 Ga0268264_10459060
1210 Ga0307517_10154207
1211 Ga0307515_10024241
1212 Ga0265338_10767383
1213 Ga0307511_10236936
1214 Ga0265762_1108784
1215 Ga0265332_10033031
1216 Ga0265325_10206399
1217 Ga0265325_10364218
1218 Ga0265340_10185434
1219 Ga0265339_10001453
1220 Ga0265339_10048414
1221 Ga0265339_10219171
1222 Ga0265339_10458467
1223 Ga0265339_10516933
1224 Ga0265331_10115901
1225 Ga0265316_10270734
1226 Ga0265316_10382631
1227 Ga0265316_10923602
1228 Ga0307513_10457908
1229 Ga0307509_10296678
1230 Ga0307509_10632804
1231 Ga0307509_10644738
1232 Ga0307408_100262817
1233 Ga0265313_10224780
1234 Ga0307508_10118003
1235 Ga0307508_10214248
1236 Ga0307508_10215221
1237 Ga0265314_10098586
1238 Ga0265342_10002787
1239 Ga0265342_10464735
1240 Ga0307516_10006057
1241 Ga0307516_10012057
1242 Ga0307516_10013764
1243 Ga0307516_10215911
1244 Ga0307516_10219148
1245 Ga0307405_10449018
1246 Ga0307405_10708531
1247 Ga0307405_10813585
1248 Ga0307406_10291129
1249 Ga0307412_10518731
1250 Ga0307412_10888947
1251 Ga0307416_100226900
1252 Ga0307416_100684786
1253 Ga0307416_102968046
1254 Ga0307507_10015115
1255 Ga0307507_10341436
1256 Ga0307510_10015656
1257 Ga0307510_10064867
1258 Ga0373926_0051256
1259 Ga0373928_0110466
1260 Ga0373934_0376064
1261 Ga0373923_0013897
1262 Ga0373923_0017058
1263 Ga0373936_0038715
1264 Ga0373936_0133186
1265 Ga0373936_0322382
1266 Ga0373936_0387457
1267 Ga0373945_0019414
1268 Ga0373945_0290831
1269 Ga0373953_0120401
1270 Ga0373953_0283303
1271 Ga0373954_0001728
1272 Ga0373954_0026593
1273 Ga0373956_0000275
1274 Ga0373956_0337695
1275 Ga0373957_0078329
1276 Ga0373957_0318669
1277 Ga0373943_0002244
1278 Ga0373943_0668045
1279 Ga0373946_0022256
1280 Ga0373955_0000324
1281 Ga0373955_0006204
1282 Ga0373955_0085110
1283 Ga0373962_0150534
1284 Ga0373962_0211165
1285 Ga0373924_0135036
1286 Ga0373924_0176555
1287 Ga0373935_0000344
1288 Ga0373935_0023762
1289 Ga0373935_0145943
1290 Ga0373935_0184033
1291 Ga0373927_0000665
1292 Ga0373927_0050823
1293 Ga0373933_0000405
1294 Ga0373933_0054071
1295 Ga0373933_0066920
1296 Ga0373933_0948325
1297 Ga0373947_0003567
1298 Ga0373947_0691654
1299 Ga0373937_0108706
1300 Ga0373937_0210744
1301 Ga0373937_0308982
1302 Ga0373937_0876073
1303 Ga0373925_0051507
1304 Ga0373925_0723786
1305 Ga0395898_0037847
1306 Ga0395905_0379340
1307 Ga0436364_0374170
1308 Ga0395901_0452341
1309 Ga0436365_0722166
1310 Ga0436365_1835290
1311 Ga0436360_0406636
1312 Ga0436361_0126094
1313 Ga0436361_0885839
1314 Ga0436363_1696922
1315 Ga0436362_0204184
1316 Ga0439453_0004082
1317 Ga0439465_0083249
1318 Ga0451793_1037605
1319 Ga0451798_0485295
1320 Ga0451802_1873711
1321 Ga0451833_0696686
1322 Ga0451839_1539857
1323 Ga0451841_0638029
1324 Ga0451855_0963347
1325 Ga0439441_019832
1326 Ga0439443_005100
1327 Ga0450894_045803
1328 Ga0439435_0013804
1329 Ga0466965_0018816
1330 Ga0466964_0266467
1331 Ga0466968_0164168
1332 Ga0466967_0054533
1333 Ga0466967_0077104
1334 Ga0495617_131465
1335 Ga0495592_0005358
1336 Ga0495592_0036537
1337 Ga0495592_0476396
1338 Ga0495603_0000094
1339 Ga0495603_0008917
1340 Ga0495590_0146057
1341 Ga0495629_0000612
1342 Ga0495629_0001119
1343 Ga0495629_0035842
1344 Ga0495629_0720950
1345 Ga0495629_0734375
1346 Ga0495638_0021095
1347 Ga0495641_0003738
1348 Ga0495651_0055029
1349 Ga0495651_0075905
1350 Ga0495651_0083064
1351 Ga0495651_0168934
1352 Ga0495651_0361346
1353 Ga0495653_0000399
1354 Ga0495653_0161772
1355 Ga0495580_0002084
1356 Ga0495582_0000256
1357 Ga0495605_0202012
1358 Ga0495639_0000114
1359 Ga0495639_0211485
1360 Ga0495662_0003498
1361 Ga0495662_0277414
1362 Ga0495664_0016053
1363 Ga0495664_0183039
1364 Ga0495584_0117425
1365 Ga0495584_0411534
1366 Ga0495584_0477840
1367 Ga0495585_0062294
1368 Ga0495585_0209921
1369 Ga0495585_0215897
1370 Ga0495594_0000393
1371 Ga0495594_0245845
1372 Ga0495596_0105913
1373 Ga0495596_0127524
1374 Ga0495596_0177103
1375 Ga0495607_0489806
1376 Ga0495583_0447718
1377 Ga0495606_0213338
1378 Ga0495606_0298888
1379 Ga0495608_0042031
1380 Ga0495610_0040945
1381 Ga0495616_0241385
1382 Ga0495616_0328466
1383 Ga0495618_0066005
1384 Ga0495620_0405611
1385 Ga0495628_0009019
1386 Ga0495628_0021333
1387 Ga0495630_0000459
1388 Ga0495630_0120282
1389 Ga0495631_0131115
1390 Ga0495631_0188223
1391 Ga0495632_0224981
1392 Ga0495643_0126117
1393 Ga0495644_0022033
1394 Ga0495648_0161917
1395 Ga0495648_0440496
1396 Ga0495666_0047291
1397 Ga0495652_0040573
1398 Ga0495652_0055427
1399 Ga0495652_0527985
1400 Ga0495654_0195101
1401 Ga0495665_0000130
1402 Ga0495640_0007646
1403 Ga0495640_0026691
1404 Ga0495640_0104373
1405 Ga0495587_0523972
1406 Ga0495598_0093445
1407 Ga0495598_0384964
1408 Ga0495609_0447464
1409 Ga0495621_0166364
1410 Ga0495621_0504464
1411 Ga0495597_0147458
1412 Ga0495597_0263494
1413 Ga0495645_0011598
1414 Ga0495622_0005481
1415 Ga0495622_0015707
1416 Ga0495622_0070154
1417 Ga0495622_0348873
1418 Ga0495633_0157609
1419 Ga0495667_0005133
1420 Ga0495667_0007603
1421 Ga0495667_0034502
1422 Ga0495656_0217053
1423 Ga0495656_0220042
1424 Ga0495656_0425106
1425 Ga0495668_0022689
1426 Ga0495668_0100592
1427 Ga0495668_0524164
1428 Ga0495634_0002801
1429 Ga0495634_0133318
1430 Ga0495634_0229425
1431 Ga0495634_0579393
1432 Ga0495625_0192670
1433 Ga0495625_0873707
1434 Ga0495635_0000088
1435 Ga0495635_0006280
1436 Ga0495635_0627236
1437 Ga0495659_0075914
1438 Ga0495659_0088773
1439 Ga0495659_0522221
1440 Ga0495588_0004028
1441 Ga0495588_0094977
1442 Ga0495657_0008178
1443 Ga0495657_0048583
1444 Ga0495599_0001137
1445 Ga0495599_0024026
1446 Ga0495623_0149932
1447 Ga0495623_0226508
1448 Ga0495623_0272511
1449 Ga0495646_0016831
1450 Ga0495646_0326324
1451 Ga0495647_0000070
1452 Ga0495647_0314708
1453 Ga0495647_0440323
1454 Ga0495658_0007345
1455 Ga0495658_0665269
1456 Ga0495669_0047832
1457 Ga0495669_0094290
1458 Ga0495669_0445227
1459 Ga0495613_0004685
1460 Ga0495613_0115235
1461 Ga0495624_0000079
1462 Ga0495671_0167462
1463 Ga0495649_0353328
1464 Ga0495589_0374413
1465 Ga0495600_0000484
1466 Ga0495600_0444286
1467 Ga0495600_0465443
1468 Ga0495581_0000082
1469 Ga0495604_0002253
1470 Ga0495604_0040963
1471 Ga0495604_0729245
1472 Ga0495604_0791733
1473 Ga0495636_0262172
1474 Ga0495674_0001729
1475 Ga0495674_0010560
1476 Ga0495672_0335608
1477 Ga0495676_0016546
1478 Ga0495680_0020168
1479 Ga0495680_0029180
1480 Ga0495680_0581769
1481 Ga0495683_0335883
1482 Ga0495687_226617
1483 Ga0495675_0000977
1484 Ga0495675_0064158
1485 Ga0495677_0397204
1486 Ga0495679_073271
1487 Ga0495685_257558
1488 Ga0495673_0138032
1489 Ga0495673_0170030
1490 Ga0495681_0034438
1491 Ga0495681_0324936
1492 Ga0495684_0018562
1493 Ga0495684_0033131
1494 Ga0495684_0101470
1495 Ga0495686_0268208
1496 Ga0495686_0330415
1497 Ga0495593_0000206
1498 Ga0495593_0000566
1499 Ga0495593_0356233
1500 Ga0495593_0494328
1501 Ga0495602_0030317
1502 Ga0495602_0309330
1503 Ga0495602_0399637
1504 Ga0495614_0008940
1505 Ga0495615_0159380
1506 Ga0495626_0399173
1507 Ga0496100_0693828
1508 Ga0496100_1038104
1509 Ga0496101_0005087
1510 Ga0496101_0027265
1511 Ga0496101_0491371
1512 Ga0496102_0010651
1513 Ga0496102_0190183
1514 Ga0496102_1770492
1515 Ga0496103_0081794
1516 Ga0496103_0719688
1517 Ga0496103_0812785
1518 Ga0496104_0009468
1519 Ga0496104_0022665
1520 Ga0496104_0248960
1521 Ga0496104_1052014
1522 Ga0496105_0007364
1523 Ga0496106_0014808
1524 Ga0496106_0192340
1525 Ga0496106_0723371
1526 Ga0496107_0015171
1527 Ga0496107_1205577
1528 Ga0496108_0123089
1529 Ga0496109_0007049
1530 Ga0496109_0095772
1531 Ga0496109_0470281
1532 Ga0496110_0005923
1533 Ga0496110_0013109
1534 Ga0496110_1168558
1535 Ga0496111_0022400
1536 Ga0496111_0418224
1537 Ga0496112_0011247
1538 Ga0496112_0025092
1539 Ga0496112_0641669
1540 Ga0496112_0966645
1541 Ga0496112_1404686
1542 Ga0496113_0044790
1543 Ga0496113_0482364
1544 Ga0496114_0024042
1545 Ga0496114_1177943
1546 Ga0496114_1713105
1547 Ga0496115_0001214
1548 Ga0496115_0029666
1549 Ga0496115_0078197
1550 Ga0496115_0184470
1551 Ga0496115_0422746
1552 Ga0496118_0258839
1553 Ga0496119_0291381
1554 Ga0496119_0302592
1555 Ga0496120_0011286
1556 Ga0496120_0510229
1557 Ga0496121_0023253
1558 Ga0496121_0024027
1559 Ga0496121_0058439
1560 Ga0496121_0067926
1561 Ga0496121_0082919
1562 Ga0496121_0083463
1563 Ga0496121_0687956
1564 Ga0496123_0175056
1565 Ga0496124_0064495
1566 Ga0496124_0100876
1567 Ga0496124_0147056
1568 Ga0496124_0881075
1569 Ga0496125_0076874
1570 Ga0496125_0127714
1571 Ga0496125_0191880
1572 Ga0496126_0002727
1573 Ga0496126_0046873
1574 Ga0496126_0052358
1575 Ga0496126_0081842
1576 Ga0496126_0113868
1577 Ga0496126_0145323
1578 Ga0496126_0206782
1579 Ga0496126_0255373
1580 Ga0496126_0300594
1581 Ga0496126_0309971
1582 Ga0496126_0460042
1583 Ga0496126_1296441
1584 Ga0495678_255022
1585 Ga0501036_0420456
1586 Ga0501036_1472809
1587 Ga0501069_0317947
1588 Ga0501071_1272592
1589 Ga0501076_0902364
1590 Ga0501079_0339469
1591 Ga0501083_0318377
1592 Ga0501083_0520419
1593 nmdc:mga03683_133072_c1
1594 nmdc:mga03n38_638662_c1
1595 nmdc:mga00v17_633667_c1
1596 nmdc:mga00v17_68932_c1
1597 nmdc:mga0yw44_111709_c1
1598 nmdc:mga0yw44_1156971_c1
1599 nmdc:mga0yw44_169564_c1
1600 nmdc:mga0yw44_71355_c1
1601 nmdc:mga0yw44_988731_c1
1602 nmdc:mga0k408_311417_c1
1603 nmdc:mga0k408_340823_c1
1604 nmdc:mga0k408_706260_c1
1605 nmdc:mga06z11_256478_c1
1606 nmdc:mga06z11_930160_c1
1607 nmdc:mga04h51_233251_c1
1608 nmdc:mga07m45_453289_c1
1609 nmdc:mga07m45_658387_c1
1610 nmdc:mga07m45_681228_c1
1611 nmdc:mga05p37_490029_c1
1612 nmdc:mga09592_795253_c1
1613 nmdc:mga0qj67_1151682_c1
1614 nmdc:mga08y16_1272728_c1
1615 nmdc:mga08y16_375466_c2
1616 nmdc:mga0sz30_461101_c1
1617 Ga0495601_0123815
1618 Ga0495601_0257916
1619 Ga0495601_0535144
1620 Ga0495612_0354767
1621 Ga0500635_0018721
1622 Ga0495655_0016749
1623 Ga0495595_0004196
1624 Ga0495595_0059256
1625 Ga0495619_0000332
1626 Ga0495619_0076013
1627 Ga0495619_0104139
1628 Ga0495619_0456127
1629 Ga0495619_0511746
1630 Ga0495619_0590016
1631 Ga0500647_0108382
1632 Ga0500566_0000071
1633 Ga0500566_0000537
1634 Ga0500640_022899
1635 Ga0500648_172464
1636 Ga0500555_101712
1637 Ga0500562_128524
1638 Ga0500572_001322
1639 Ga0500582_268913
1640 Ga0500591_162189
1641 Ga0500595_001734
1642 Ga0500608_002586
1643 Ga0500608_034265
1644 Ga0500621_261597
1645 Ga0500642_0109236
1646 Ga0500642_0442473
1647 Ga0500642_0501079
1648 Ga0500658_0133361
1649 Ga0500658_0253225
1650 Ga0500559_0006520
1651 Ga0500559_0275596
1652 Ga0500568_0264648
1653 Ga0500573_0005332
1654 Ga0500588_0156820
1655 Ga0500590_130205
1656 Ga0500590_272207
1657 Ga0500603_000166
1658 Ga0500603_097047
1659 Ga0500620_250100
1660 Ga0500622_0001260
1661 Ga0500627_0221209
1662 Ga0500630_006610
1663 Ga0500638_099510
1664 Ga0500638_367831
1665 Ga0500639_000166
1666 Ga0500639_293187
1667 Ga0500636_0064862
1668 Ga0500636_0122870
1669 Ga0500637_0076295
1670 Ga0500645_048981
1671 Ga0500609_032166
1672 Ga0500552_013828
1673 Ga0500596_006204
1674 Ga0500601_000249
1675 Ga0501082_0930483
1676 Ga0501082_1782911
1677 Ga0466962_0486630
1678 Ga0530510_0487851
1679 2513696934
1680 2513878122
1681 2513893309
1682 2514012582
1683 2524439058
1684 2617353078
1685 2617378951
1686 2745078829
1687 2793081134
1688 2805920083
1689 2824605606
1690 2824609856
1691 2824698901
1692 2824781052
1693 2838127531
1694 2841941516
1695 2841952468
1696 2841967659
1697 2841982174
1698 2841986492
1699 2847934525
1700 2847945133
1701 2849080686
1702 2857509953
1703 2876766691
1704 2876811878
1705 2879089717
1706 2879118719
1707 2885414272
1708 2888423044
1709 2906649920
1710 2908778711
1711 3005508743
1712 3005589443
1713 8006991840
1714 8056676447

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13827

DUF4189

Domain of unknown function (DUF4189)

42

135

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
7nhz-assembly1.cif.gz_A nmr structure of rv1813c from mycobacterium tuberculosis 0.7712 32 126
7nhz-assembly1.cif.gz_A nmr structure of rv1813c from mycobacterium tuberculosis 0.5978 32 126
7cq4-assembly1.cif.gz_A crystal structure of slx1-slx4 in complex with 5'flap dna 0.4411 77 124
7ohp-assembly1.cif.gz_S nog1-tap associated immature ribosomal particles from s. cerevisiae after rpl25 expression shut down, population a 0.3667 33 124
7p7t-assembly1.cif.gz_f poxta-eq2 antibiotic resistance abcf bound to e. faecalis 70s ribosome, state iii 0.3174 35 122
ID Description Score Start End Superfamily
af_Q5N890_523_594_3.30.160.20 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.8888 93 113 3.30.160.20
af_Q25815_90_159_3.30.160.20 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.8535 90 122 3.30.160.20
af_P93014_138_208_3.30.160.20 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.8056 91 120 3.30.160.20
af_Q54CA5_1734_1797_3.30.160.20 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.7526 91 120 3.30.160.20
af_P9WM45_39_123_3.30.1660.10 Alpha Beta;2-Layer Sandwich;Dodecin subunit-like;Flavin-binding protein dodecin 0.7003 35 126 3.30.1660.10
ID Description Score Start End GO Terms
AF-A0A161SN49-F1-model_v4 DUF4189 domain-containing protein 0.9848 31 130
AF-Q6N3A0-F1-model_v4 DUF4189 domain-containing protein 0.9794 31 130
AF-A0A418VHE4-F1-model_v4 DUF4189 domain-containing protein 0.9649 38 130
AF-A0A1M2ZSA4-F1-model_v4 deleted 0.9487 31 130
AF-A0A418VHE4-F1-model_v4 DUF4189 domain-containing protein 0.9451 38 130

Map