F483057

General Info

Members Datasets Scaffolds Average Seq Length
840 492 713 279

Family's Representative Sequence

Representative Sequence 3300025295|Ga0209564_1000017|Ga0209564_100001742
Length 261
Sequence MSDAALPVAAAAPVRRSSARGESLGVRIALAAVFVEAAGKGWEAYRAAITEPDAQAAIRLTLLVAGIAVPFNIVVGIAAAWAIAKFEFRGKNLLISLIDLPFSVSPVISGLVFVLLFGAQGYFGPWLQAHDIKIVFALPGLILATVFVTFPFVARELIPHMQSLGTADEEAALTLGASPWRVFFWVTLAMGEFGAVAVVSGKIRGLTNTMPLHIEILYNEYMGAAAFAVASLLAGLALITLALKTFLEWRFGDEIAASRKH

Samples

Sample ID Description Type Environment
1 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
2 2509276019 Ensifer aridi TW10 Isolate Nodule
3 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
4 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
5 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
6 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
7 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
8 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
9 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
10 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
11 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
12 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
13 2554235283 Bacillus safensis VK Isolate Rhizosphere
14 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
15 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
16 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
17 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
18 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
19 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
20 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
21 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
22 2643221618 Ensifer sp. Root231 Isolate Unclassified
23 2643221626 Ensifer sp. Root31 Isolate Unclassified
24 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
25 2643221638 Duganella sp. Root336D2 Isolate Unclassified
26 2643221645 Massilia sp. Root351 Isolate Unclassified
27 2643221655 Ensifer sp. Root1252 Isolate Unclassified
28 2643221664 Massilia sp. Root418 Isolate Unclassified
29 2643221698 Ensifer sp. Root142 Isolate Unclassified
30 2643221735 Bacillus sp. Root920 Isolate Unclassified
31 2687453109 Bacillus pumilus SH-B11 Isolate Unclassified
32 2718217927 Rhizobium sp. N324 Isolate Nodule
33 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
34 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
35 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
36 2718218423 Rhizobium sp. N941 Isolate Nodule
37 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
38 2721755809 Rhizobium sp. N541 Isolate Nodule
39 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
40 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
41 2738541280 Massilia sp. GV090 Isolate Unclassified
42 2738541297 Duganella sp. GV083 Isolate Unclassified
43 2738541300 Massilia sp. GV016 Isolate Unclassified
44 2738541357 Duganella sp. GV053 Isolate Unclassified
45 2738543003 Duganella sp. GV066 Isolate Unclassified
46 2738543018 Massilia sp. GV045 Isolate Unclassified
47 2738543026 Duganella sp. GV089 Isolate Unclassified
48 2738543029 Duganella sp. GV039 Isolate Unclassified
49 2738543030 Massilia sp. GV097 Isolate Unclassified
50 2739367756 Asticcacaulis sp. CF398 Isolate Unclassified
51 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
52 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
53 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
54 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
55 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
56 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
57 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
58 2791355260 Rhizobium sp. L9 Isolate Nodule
59 2791355265 Rhizobium sp. H4 Isolate Nodule
60 2791355267 Rhizobium sp. L18 Isolate Nodule
61 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
62 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
63 2811994870 Bacillus sp. JB4 Isolate Unclassified
64 2816332336 Brevibacillus laterosporus ZQ2 Isolate Unclassified
65 2818991468 Bacillus safensis 3300 Isolate Rhizosphere
66 2821131069 Duganella sp. 1224 Isolate Unclassified
67 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
68 2823526263 Bacillus altitudinis P-10 Isolate Unclassified
69 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
70 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
71 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
72 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
73 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
74 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
75 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
76 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
77 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
78 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
79 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
80 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
81 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
82 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
83 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
84 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
85 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
86 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
87 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
88 2842711865 Duganella sp. R-73148 Isolate Unclassified
89 2844163670 Ensifer sp. 1H6 Isolate Unclassified
90 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
91 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
92 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
93 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
94 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
95 2857553236 Duganella sp. R-74557 Isolate Unclassified
96 2857558681 Duganella sp. R-74565 Isolate Unclassified
97 2857564685 Duganella sp. R-74599 Isolate Unclassified
98 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
99 2904424332 Duganella sp. 1411 Isolate Rhizosphere
100 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
101 2919093281 Bacillus safensis 1383 Isolate Rhizosphere
102 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
103 2919476304 Duganella sp. 3397 Isolate Unclassified
104 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
105 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere
106 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
107 2933599457 Rhizobium phaseoli M3 Isolate Nodule
108 2936381700 Rhizobium chutanense C16 Isolate Unclassified
109 2954773129 Bacillus sp. TBS-096 Isolate Rhizosphere
110 2996887358 Rhizobium sp. R711 Isolate Nodule
111 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
112 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
113 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
114 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
115 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
116 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
117 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
118 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
119 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
120 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
121 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
122 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
123 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
124 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
125 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
126 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
127 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
128 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
129 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
130 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
131 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
132 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
133 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
134 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
135 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
136 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
137 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
138 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
139 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
140 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
141 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
142 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
143 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
144 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
145 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
146 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
147 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
148 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
149 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
150 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
151 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
152 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
153 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
154 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
155 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
156 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
157 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
158 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
159 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
160 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
161 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
162 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
163 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
164 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
165 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
166 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
167 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
168 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
169 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
170 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
171 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
172 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
173 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
174 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
175 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
176 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
177 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
178 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
179 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
180 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
181 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
182 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
183 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
184 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
185 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
186 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
187 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
188 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
189 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
190 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
191 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
192 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
193 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
194 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
195 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
196 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
197 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
198 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
199 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
200 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
201 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
202 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
203 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
204 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
205 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
206 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
207 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
208 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
209 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
210 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
211 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
212 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
213 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
214 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
215 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
216 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
217 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
218 3300015684 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.2_F02 Metagenome Unclassified
219 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
220 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
221 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
222 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
223 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
224 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
225 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
226 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
227 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
228 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
229 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
230 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
231 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
232 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
233 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
234 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
235 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
236 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
237 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
238 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
239 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
240 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
241 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
242 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
243 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
244 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
245 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
246 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
247 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
248 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
249 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
250 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
251 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
252 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
253 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
254 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
255 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
256 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
257 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
258 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
259 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
260 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
261 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
262 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
263 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
264 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
265 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
266 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
267 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
268 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
269 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
270 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
271 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
272 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
273 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
274 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
275 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
276 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
277 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
278 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
279 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
280 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
281 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
282 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
283 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
284 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
285 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
286 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
287 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
288 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
289 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
290 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
291 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
292 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
293 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
294 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
295 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
296 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
297 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
298 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
299 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
300 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
301 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
302 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
303 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
304 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
305 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
306 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
307 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
308 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
309 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
310 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
311 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
312 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
313 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
314 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
315 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
316 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
317 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
318 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
319 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
320 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
321 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
322 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
323 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
324 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
325 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
326 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
327 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
328 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
329 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
330 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
331 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
332 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
333 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
334 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
335 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
336 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
337 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
338 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
339 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
340 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
341 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
342 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
343 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
344 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
345 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
346 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
347 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
348 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
349 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
350 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
351 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
352 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
353 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
354 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
355 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
356 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
357 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
358 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
359 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
360 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
361 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
362 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
363 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
364 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
365 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
366 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
367 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
368 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
369 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
370 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
371 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
372 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
373 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
374 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
375 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
376 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
377 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
378 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
379 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
380 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
381 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
382 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
383 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
384 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
385 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
386 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
387 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
388 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
389 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
390 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
391 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
392 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
393 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
394 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
395 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
396 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
397 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
398 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
399 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
400 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
401 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
402 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
403 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
404 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
405 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
406 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
407 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
408 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
409 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
410 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
411 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
412 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
413 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
414 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
415 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
416 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
417 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
418 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
419 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
420 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
421 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
422 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
423 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
424 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
425 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
426 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
427 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
428 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
429 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
430 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
431 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
432 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
433 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
434 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
435 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
436 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
437 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
438 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
439 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
440 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
441 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
442 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
443 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
444 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
445 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
446 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
447 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
448 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
449 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
450 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
451 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
452 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
453 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
454 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
455 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
456 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
457 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
458 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
459 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
460 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
461 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
462 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
463 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
464 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
465 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
466 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
467 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
468 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
469 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
470 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
471 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
472 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
473 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
474 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
475 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
476 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
477 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
478 8005258706 Rhizobium sp. R693 Isolate Nodule
479 8005275841 Rhizobium sp. N4311 Isolate Nodule
480 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
481 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
482 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
483 8005321885 Rhizobium sp. R72 Isolate Nodule
484 8005382845 Rhizobium sp. R634 Isolate Nodule
485 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
486 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
487 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
488 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
489 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
490 8024501048 Rhizobium sp. H4 Isolate Nodule
491 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified
492 8056375014 Rhizobium redzepovicii 18T Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 84.76
Metatranscriptomes 0.12
Isolates 15.12

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.07
Nodule 9.64
Rhizoplane 2.5
Rhizosphere 60
Stem 0
Stem Tuber 0
Unclassified 11.79

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1008774 3300001915 Bacteria 1891
2 JGI24740J21852_10003236 3300001979 Bacteria 7188
3 JGI24739J22299_10002034 3300001989 Bacteria 7743
4 JGI24737J22298_10001992 3300001990 Bacteria 7298
5 JGI24735J21928_10003090 3300002067 Bacteria 5701
6 JGI24735J21928_10047197 3300002067 Bacteria 1248
7 JGI24738J21930_10000645 3300002075 Bacteria 10062
8 JGI24034J26672_10001232 3300002239 Bacteria 3357
9 JGI25154J39366_1000581 3300002738 Bacteria 17734
10 JGI25152J39213_1004158 3300002773 Bacteria 4668
11 JGI25152J39213_1008220 3300002773 Bacteria 2608
12 JGI25152J39213_1011157 3300002773 Bacteria 2004
13 JGI25150J39212_1001021 3300002774 Bacteria 8642
14 JGI25150J39212_1003821 3300002774 Bacteria 3462
15 JGI25159J45721_1015701 3300002987 Bacteria 1646
16 JGI25151J46595_10000020 3300003187 Bacteria 233547
17 JGI25151J46595_10003913 3300003187 Bacteria 8039
18 JGI25153J46596_10009537 3300003215 Bacteria 4495
19 JGI25153J46596_10013565 3300003215 Bacteria 3436
20 JGI25160J50197_1005140 3300003354 Bacteria 5502
21 JGI25161J50226_1005994 3300003374 Bacteria 2260
22 Ga0006562J51391_1001282 3300003578 Bacteria 1460
23 Ga0055529_1000154 3300003763 Bacteria 94292
24 Ga0055526_1000225 3300003771 Bacteria 47943
25 Ga0055526_1000523 3300003771 Bacteria 30490
26 Ga0055526_1000525 3300003771 Bacteria 30396
27 Ga0055526_1004476 3300003771 Bacteria 8379
28 Ga0055526_1005066 3300003771 Bacteria 7693
29 Ga0055526_1005972 3300003771 Bacteria 6774
30 Ga0055526_1023398 3300003771 Bacteria 2063
31 Ga0055537_1000111 3300003773 Bacteria 61884
32 Ga0055537_1006130 3300003773 Bacteria 3100
33 Ga0055537_1011114 3300003773 Bacteria 1849
34 Ga0055524_1002727 3300003775 Bacteria 8919
35 Ga0055524_1009871 3300003775 Bacteria 3844
36 Ga0055524_1013258 3300003775 Bacteria 3116
37 Ga0055534_1000509 3300003784 Bacteria 21144
38 Ga0055528_1001577 3300003790 Bacteria 13583
39 Ga0055528_1004369 3300003790 Bacteria 6817
40 Ga0055528_1005582 3300003790 Bacteria 5822
41 Ga0055528_1012917 3300003790 Bacteria 3204
42 Ga0055528_1017372 3300003790 Bacteria 2498
43 Ga0055528_1021384 3300003790 Bacteria 2055
44 Ga0055530_10021896 3300003791 Bacteria 1873
45 Ga0055540_1000050 3300003792 Bacteria 145565
46 Ga0055540_1004822 3300003792 Bacteria 5924
47 Ga0055531_10029385 3300003794 Bacteria 1873
48 Ga0065715_10218643 3300005293 Bacteria 1282
49 Ga0065707_10004891 3300005295 Bacteria 3251
50 Ga0070658_10085663 3300005327 Bacteria 2591
51 Ga0070670_100101679 3300005331 Bacteria 2475
52 Ga0070670_100287224 3300005331 Bacteria 1437
53 Ga0070660_100001683 3300005339 Bacteria 15174
54 Ga0070660_100081724 3300005339 Bacteria 2537
55 Ga0070660_100512414 3300005339 Bacteria 998
56 Ga0070661_100363718 3300005344 Bacteria 1137
57 Ga0070668_100000062 3300005347 Bacteria 66612
58 Ga0070668_100270328 3300005347 Bacteria 1417
59 Ga0070669_100265167 3300005353 Bacteria 1372
60 Ga0070675_100218513 3300005354 Bacteria 1659
61 Ga0070671_100000590 3300005355 Bacteria 25915
62 Ga0070671_100003932 3300005355 Bacteria 11690
63 Ga0070671_100015564 3300005355 Bacteria 6145
64 Ga0070674_100029433 3300005356 Bacteria 3618
65 Ga0070674_100071499 3300005356 Bacteria 2454
66 Ga0070673_100218681 3300005364 Bacteria 1648
67 Ga0070659_100052683 3300005366 Bacteria 3201
68 Ga0070667_100506473 3300005367 Bacteria 1107
69 Ga0070708_100046600 3300005445 Bacteria 3826
70 Ga0070663_100023584 3300005455 Bacteria 4126
71 Ga0070663_100038760 3300005455 Bacteria 3326
72 Ga0070685_10065244 3300005466 Bacteria 2142
73 Ga0070706_100008439 3300005467 Bacteria 9595
74 Ga0070706_100224605 3300005467 Bacteria 1753
75 Ga0070698_100003217 3300005471 Bacteria 17999
76 Ga0070699_100014910 3300005518 Bacteria 6681
77 Ga0070699_100542669 3300005518 Bacteria 1058
78 Ga0070679_100017058 3300005530 Bacteria 7019
79 Ga0070697_100175205 3300005536 Bacteria 1817
80 Ga0070697_100203613 3300005536 Bacteria 1683
81 Ga0068853_100356925 3300005539 Bacteria 1361
82 Ga0070672_100025908 3300005543 Bacteria 4356
83 Ga0070696_100011533 3300005546 Bacteria 5921
84 Ga0070693_100219453 3300005547 Bacteria 1245
85 Ga0070665_100058176 3300005548 Bacteria 3875
86 Ga0070665_100127540 3300005548 Bacteria 2547
87 Ga0070665_100193325 3300005548 Bacteria 2035
88 Ga0068855_100129804 3300005563 Bacteria 2879
89 Ga0070664_100004468 3300005564 Bacteria 11228
90 Ga0068857_100043403 3300005577 Bacteria 3989
91 Ga0068854_100197905 3300005578 Bacteria 1578
92 Ga0068854_100235144 3300005578 Bacteria 1456
93 Ga0068856_100285460 3300005614 Bacteria 1667
94 Ga0068859_100314355 3300005617 Bacteria 1660
95 Ga0068859_100498424 3300005617 Bacteria 1313
96 Ga0068851_10071946 3300005834 Bacteria 1790
97 Ga0068863_100000011 3300005841 Bacteria 232287
98 Ga0068863_100071054 3300005841 Bacteria 3293
99 Ga0068858_100608840 3300005842 Bacteria 1060
100 Ga0068860_100149645 3300005843 Bacteria 2247
101 Ga0068860_100220814 3300005843 Bacteria 1840
102 Ga0068860_100549368 3300005843 Bacteria 1157
103 Ga0068862_100094053 3300005844 Bacteria 2614
104 Ga0068862_100159585 3300005844 Bacteria 2012
105 Ga0068862_100547560 3300005844 Bacteria 1104
106 Ga0081455_10002830 3300005937 Bacteria 20425
107 Ga0081455_10006544 3300005937 Bacteria 12468
108 Ga0081455_10092498 3300005937 Bacteria 2447
109 Ga0081540_1010180 3300005983 Bacteria 6391
110 Ga0081539_10025085 3300005985 Bacteria 3850
111 Ga0075368_10005369 3300006042 Bacteria 4406
112 Ga0075363_100117260 3300006048 Bacteria 1484
113 Ga0075364_10019701 3300006051 Bacteria 4237
114 Ga0075362_10028149 3300006177 Bacteria 2411
115 Ga0075367_10001045 3300006178 Bacteria 11428
116 Ga0075367_10004847 3300006178 Bacteria 6629
117 Ga0075370_10051555 3300006353 Bacteria 2334
118 Ga0075370_10061001 3300006353 Bacteria 2149
119 Ga0075370_10092541 3300006353 Bacteria 1745
120 Ga0075428_100572791 3300006844 Bacteria 1207
121 Ga0075433_10079939 3300006852 Bacteria 2881
122 Ga0075434_100197297 3300006871 Bacteria 2032
123 Ga0097620_100314366 3300006931 Bacteria 1660
124 Ga0097620_100498413 3300006931 Bacteria 1313
125 Ga0079104_1011251 3300006946 Bacteria 2888
126 Ga0099795_10043411 3300007788 Bacteria 1609
127 Ga0105251_10027431 3300009011 Bacteria 2887
128 Ga0105244_10002912 3300009036 Bacteria 12642
129 Ga0105244_10013090 3300009036 Bacteria 4864
130 Ga0105244_10058023 3300009036 Bacteria 1955
131 Ga0105240_10000801 3300009093 Bacteria 56966
132 Ga0105240_10002598 3300009093 Bacteria 28890
133 Ga0105240_10002841 3300009093 Bacteria 27371
134 Ga0105240_10011164 3300009093 Bacteria 12542
135 Ga0105240_10014613 3300009093 Bacteria 10713
136 Ga0105245_10003919 3300009098 Bacteria 13227
137 Ga0105245_10346276 3300009098 Bacteria 1471
138 Ga0114129_10225153 3300009147 Bacteria 2528
139 Ga0114129_10310753 3300009147 Bacteria 2098
140 Ga0105241_10209974 3300009174 Bacteria 1631
141 Ga0105241_10228278 3300009174 Bacteria 1568
142 Ga0105248_10012891 3300009177 Bacteria 9218
143 Ga0105248_10025660 3300009177 Bacteria 6554
144 Ga0105248_10739095 3300009177 Bacteria 1110
145 Ga0105237_10725085 3300009545 Bacteria 1001
146 Ga0105238_10001468 3300009551 Bacteria 23685
147 Ga0105238_10015716 3300009551 Bacteria 7662
148 Ga0105238_10217032 3300009551 Bacteria 1889
149 Ga0105249_10004580 3300009553 Bacteria 11946
150 Ga0123341_1000109 3300009765 Bacteria 36496
151 Ga0123342_1028378 3300009766 Bacteria 3028
152 Ga0099796_10088019 3300010159 Bacteria 1150
153 Ga0105239_10000902 3300010375 Bacteria 42239
154 Ga0105239_10162333 3300010375 Bacteria 2497
155 Ga0105239_10218134 3300010375 Bacteria 2139
156 Ga0105246_10037637 3300011119 Bacteria 3247
157 Ga0157370_10067943 3300013104 Bacteria 3369
158 Ga0157370_10070523 3300013104 Bacteria 3298
159 Ga0157370_10180329 3300013104 Bacteria 1963
160 Ga0157369_10097376 3300013105 Bacteria 3138
161 Ga0157369_10364755 3300013105 Bacteria 1500
162 Ga0157374_10029027 3300013296 Bacteria 5002
163 Ga0157374_10121398 3300013296 Bacteria 2522
164 Ga0157378_10006462 3300013297 Bacteria 10254
165 Ga0157378_10288927 3300013297 Bacteria 1583
166 Ga0163162_10050180 3300013306 Bacteria 4185
167 Ga0157372_10039562 3300013307 Bacteria 5204
168 Ga0157375_10003062 3300013308 Bacteria 14511
169 Ga0157375_10003788 3300013308 Bacteria 13106
170 Ga0163163_10400730 3300014325 Bacteria 1430
171 Ga0157380_10012262 3300014326 Bacteria 6211
172 Ga0157380_10233061 3300014326 Bacteria 1655
173 Ga0182008_10001294 3300014497 Bacteria 17091
174 Ga0182006_1000014 3300015261 Bacteria 340159
175 Ga0182006_1000369 3300015261 Bacteria 37352
176 Ga0182007_10000096 3300015262 Bacteria 62363
177 Ga0182005_1000018 3300015265 Bacteria 324307
178 Ga0183365_10006 3300015684 Bacteria 225936
179 Ga0183363_1056 3300015690 Bacteria 35540
180 Ga0214544_1000123 3300021320 Bacteria 110258
181 Ga0214544_1000646 3300021320 Bacteria 66087
182 Ga0214542_1000027 3300021321 Bacteria 175107
183 Ga0214542_1000141 3300021321 Bacteria 104386
184 Ga0214542_1025614 3300021321 Bacteria 3038
185 Ga0214543_1000025 3300021327 Bacteria 225351
186 Ga0214543_1000026 3300021327 Bacteria 220652
187 Ga0214543_1000047 3300021327 Bacteria 150894
188 Ga0213872_10000002 3300021361 Bacteria 554092
189 Ga0213872_10000427 3300021361 Bacteria 34434
190 Ga0213872_10001785 3300021361 Bacteria 13433
191 Ga0213872_10011283 3300021361 Bacteria 4231
192 Ga0213872_10027690 3300021361 Bacteria 2601
193 Ga0213872_10033045 3300021361 Bacteria 2371
194 Ga0213874_10001677 3300021377 Bacteria 4645
195 Ga0213876_10000341 3300021384 Bacteria 40559
196 Ga0213876_10004571 3300021384 Bacteria 7717
197 Ga0213875_10000460 3300021388 Bacteria 35213
198 Ga0213875_10146348 3300021388 Bacteria 1107
199 Ga0213871_10039646 3300021441 Bacteria 1261
200 Ga0209436_100185 3300025208 Bacteria 28976
201 Ga0209437_103210 3300025233 Bacteria 2992
202 Ga0209437_104899 3300025233 Bacteria 2321
203 Ga0207425_1000194 3300025245 Bacteria 48678
204 Ga0207425_1000551 3300025245 Bacteria 22377
205 Ga0207425_1008083 3300025245 Bacteria 2721
206 Ga0207425_1012470 3300025245 Bacteria 1993
207 Ga0209646_1000028 3300025246 Bacteria 387986
208 Ga0209129_1002872 3300025258 Bacteria 7945
209 Ga0209129_1003698 3300025258 Bacteria 6481
210 Ga0209233_1022421 3300025261 Bacteria 1616
211 Ga0209565_1000009 3300025263 Bacteria 751701
212 Ga0209565_1000567 3300025263 Bacteria 25399
213 Ga0209565_1008589 3300025263 Bacteria 2652
214 Ga0209455_1000049 3300025272 Bacteria 374414
215 Ga0209673_1000036 3300025273 Bacteria 323162
216 Ga0209673_1000132 3300025273 Bacteria 162349
217 Ga0209673_1001968 3300025273 Bacteria 16055
218 Ga0209673_1002729 3300025273 Bacteria 11649
219 Ga0209673_1002876 3300025273 Bacteria 10948
220 Ga0209673_1012814 3300025273 Bacteria 3351
221 Ga0209673_1023308 3300025273 Bacteria 2111
222 Ga0209130_1000641 3300025284 Bacteria 32728
223 Ga0209130_1003585 3300025284 Bacteria 6479
224 Ga0209675_1000013 3300025291 Bacteria 448220
225 Ga0209675_1000496 3300025291 Bacteria 29513
226 Ga0209675_1001691 3300025291 Bacteria 12232
227 Ga0209025_1000001 3300025294 Bacteria 1888151
228 Ga0209025_1000114 3300025294 Bacteria 218921
229 Ga0209025_1008678 3300025294 Bacteria 7263
230 Ga0209025_1012257 3300025294 Bacteria 5521
231 Ga0209025_1012300 3300025294 Bacteria 5507
232 Ga0209025_1062996 3300025294 Bacteria 1371
233 Ga0209564_1000006 3300025295 Bacteria 1100927
234 Ga0209564_1000017 3300025295 Bacteria 594063
235 Ga0209564_1000038 3300025295 Bacteria 414357
236 Ga0209564_1000122 3300025295 Bacteria 203709
237 Ga0209564_1002158 3300025295 Bacteria 16591
238 Ga0209564_1002441 3300025295 Bacteria 14707
239 Ga0209564_1022001 3300025295 Bacteria 2268
240 Ga0209564_1027071 3300025295 Bacteria 1872
241 Ga0209758_1000149 3300025297 Bacteria 163504
242 Ga0209758_1000712 3300025297 Bacteria 49095
243 Ga0209758_1000937 3300025297 Bacteria 39370
244 Ga0209758_1004308 3300025297 Bacteria 11994
245 Ga0209758_1007213 3300025297 Bacteria 7652
246 Ga0209758_1010720 3300025297 Bacteria 5438
247 Ga0209758_1020394 3300025297 Bacteria 3137
248 Ga0209050_1000334 3300025298 Bacteria 93637
249 Ga0209050_1002940 3300025298 Bacteria 13326
250 Ga0209050_1006906 3300025298 Bacteria 6569
251 Ga0209256_1000106 3300025299 Bacteria 187258
252 Ga0209256_1000146 3300025299 Bacteria 149440
253 Ga0209256_1000458 3300025299 Bacteria 61611
254 Ga0209256_1000867 3300025299 Bacteria 37536
255 Ga0209256_1003989 3300025299 Bacteria 9683
256 Ga0209256_1010331 3300025299 Bacteria 3930
257 Ga0209256_1019255 3300025299 Bacteria 2181
258 Ga0209256_1025460 3300025299 Bacteria 1722
259 Ga0207426_1000191 3300025302 Bacteria 151850
260 Ga0207426_1005948 3300025302 Bacteria 5414
261 Ga0207426_1015931 3300025302 Bacteria 2714
262 Ga0209051_1000062 3300025303 Bacteria 251081
263 Ga0209051_1003152 3300025303 Bacteria 11077
264 Ga0209051_1025528 3300025303 Bacteria 2401
265 Ga0209257_1000010 3300025304 Bacteria 1158682
266 Ga0209257_1001145 3300025304 Bacteria 33847
267 Ga0209257_1005235 3300025304 Bacteria 9278
268 Ga0209257_1011007 3300025304 Bacteria 4442
269 Ga0207656_10041741 3300025321 Bacteria 1950
270 Ga0207655_1012507 3300025728 Bacteria 4953
271 Ga0207680_10002109 3300025903 Bacteria 9306
272 Ga0207647_10004347 3300025904 Bacteria 10506
273 Ga0207705_10038813 3300025909 Bacteria 3411
274 Ga0207684_10001346 3300025910 Bacteria 26938
275 Ga0207684_10093142 3300025910 Bacteria 2569
276 Ga0207684_10165263 3300025910 Bacteria 1907
277 Ga0207684_10223740 3300025910 Bacteria 1624
278 Ga0207654_10001265 3300025911 Bacteria 13469
279 Ga0207654_10134583 3300025911 Bacteria 1568
280 Ga0207707_10154221 3300025912 Bacteria 2008
281 Ga0207695_10000100 3300025913 Bacteria 258626
282 Ga0207695_10002253 3300025913 Bacteria 28887
283 Ga0207695_10004342 3300025913 Bacteria 19417
284 Ga0207695_10010977 3300025913 Bacteria 11010
285 Ga0207695_10022068 3300025913 Bacteria 7243
286 Ga0207695_10026901 3300025913 Bacteria 6413
287 Ga0207695_10062140 3300025913 Bacteria 3857
288 Ga0207671_10271340 3300025914 Bacteria 1336
289 Ga0207657_10013278 3300025919 Bacteria 8081
290 Ga0207657_10045847 3300025919 Bacteria 3833
291 Ga0207681_10001139 3300025923 Bacteria 17152
292 Ga0207681_10141857 3300025923 Bacteria 1790
293 Ga0207694_10000494 3300025924 Bacteria 35746
294 Ga0207694_10005875 3300025924 Bacteria 9408
295 Ga0207694_10074998 3300025924 Bacteria 2648
296 Ga0207694_10125260 3300025924 Bacteria 2055
297 Ga0207650_10116541 3300025925 Bacteria 2074
298 Ga0207687_10001193 3300025927 Bacteria 17754
299 Ga0207687_10094149 3300025927 Bacteria 2191
300 Ga0207644_10000021 3300025931 Bacteria 165175
301 Ga0207644_10000426 3300025931 Bacteria 27342
302 Ga0207706_10049085 3300025933 Bacteria 3731
303 Ga0207669_10049403 3300025937 Bacteria 2507
304 Ga0207669_10217619 3300025937 Bacteria 1399
305 Ga0207691_10005325 3300025940 Bacteria 12422
306 Ga0207711_10010295 3300025941 Bacteria 7766
307 Ga0207711_10071074 3300025941 Bacteria 3019
308 Ga0207679_10102417 3300025945 Bacteria 2242
309 Ga0207667_10010207 3300025949 Bacteria 10997
310 Ga0207667_10044799 3300025949 Bacteria 4687
311 Ga0207667_10075108 3300025949 Bacteria 3510
312 Ga0207712_10098195 3300025961 Bacteria 2171
313 Ga0207668_10000083 3300025972 Bacteria 71561
314 Ga0207640_10086060 3300025981 Bacteria 2163
315 Ga0207703_10057161 3300026035 Bacteria 3180
316 Ga0207703_10575763 3300026035 Bacteria 1063
317 Ga0207703_10583023 3300026035 Bacteria 1057
318 Ga0207639_10023607 3300026041 Bacteria 4441
319 Ga0207678_10011901 3300026067 Bacteria 7639
320 Ga0207678_10055108 3300026067 Bacteria 3425
321 Ga0207678_10180384 3300026067 Bacteria 1803
322 Ga0207678_10315163 3300026067 Bacteria 1345
323 Ga0207702_10000462 3300026078 Bacteria 45995
324 Ga0207702_10272547 3300026078 Bacteria 1597
325 Ga0207641_10000028 3300026088 Bacteria 232451
326 Ga0207641_10063814 3300026088 Bacteria 3147
327 Ga0207641_10308179 3300026088 Bacteria 1498
328 Ga0207648_10014198 3300026089 Bacteria 7367
329 Ga0207674_10104173 3300026116 Bacteria 2816
330 Ga0207674_10111656 3300026116 Bacteria 2707
331 Ga0207698_10024215 3300026142 Bacteria 4257
332 Ga0209371_1005182 3300027312 Bacteria 5297
333 Ga0209983_1015098 3300027665 Bacteria 1592
334 Ga0207428_10000016 3300027907 Bacteria 327690
335 Ga0207428_10031452 3300027907 Bacteria 4376
336 Ga0207428_10129183 3300027907 Bacteria 1934
337 Ga0268266_10003139 3300028379 Bacteria 16791
338 Ga0268266_10012971 3300028379 Bacteria 7187
339 Ga0268266_10052984 3300028379 Bacteria 3485
340 Ga0268266_10162984 3300028379 Bacteria 2018
341 Ga0268265_10118470 3300028380 Bacteria 2177
342 Ga0268264_10006454 3300028381 Bacteria 9876
343 Ga0268264_10085987 3300028381 Bacteria 2700
344 Ga0268264_10525989 3300028381 Bacteria 1157
345 Ga0265337_1007536 3300028556 Bacteria 4065
346 Ga0265334_10010136 3300028573 Bacteria 3978
347 Ga0265334_10065939 3300028573 Bacteria 1356
348 Ga0265338_10046126 3300028800 Bacteria 3997
349 Ga0265338_10088262 3300028800 Bacteria 2574
350 Ga0265338_10117785 3300028800 Bacteria 2124
351 Ga0265338_10137792 3300028800 Bacteria 1915
352 Ga0268256_1004951 3300030500 Bacteria 5376
353 Ga0316181_1182530 3300030744 Bacteria 5448
354 Ga0316182_1008528 3300030745 Bacteria 1588
355 Ga0265330_10011254 3300031235 Bacteria 4201
356 Ga0265330_10020254 3300031235 Bacteria 3039
357 Ga0265330_10046224 3300031235 Bacteria 1918
358 Ga0265330_10071023 3300031235 Bacteria 1506
359 Ga0265328_10008414 3300031239 Bacteria 4256
360 Ga0265320_10036825 3300031240 Bacteria 2470
361 Ga0265325_10004033 3300031241 Bacteria 9377
362 Ga0265339_10001828 3300031249 Bacteria 15611
363 Ga0265339_10055515 3300031249 Bacteria 2148
364 Ga0265331_10000033 3300031250 Bacteria 203767
365 Ga0265331_10000178 3300031250 Bacteria 77277
366 Ga0265331_10009510 3300031250 Bacteria 5452
367 Ga0265331_10052905 3300031250 Bacteria 1938
368 Ga0265327_10002372 3300031251 Bacteria 20065
369 Ga0265327_10012156 3300031251 Bacteria 5840
370 Ga0265327_10110327 3300031251 Bacteria 1315
371 Ga0265316_10000641 3300031344 Bacteria 38988
372 Ga0265316_10002022 3300031344 Bacteria 21349
373 Ga0265316_10014895 3300031344 Bacteria 6820
374 Ga0265316_10025040 3300031344 Bacteria 4985
375 Ga0265316_10036418 3300031344 Bacteria 3979
376 Ga0265316_10115609 3300031344 Bacteria 2028
377 Ga0307513_10040412 3300031456 Bacteria 5158
378 Ga0307509_10060191 3300031507 Bacteria 4015
379 Ga0307408_100006036 3300031548 Bacteria 8058
380 Ga0307408_100035461 3300031548 Bacteria 3501
381 Ga0307408_100058237 3300031548 Bacteria 2808
382 Ga0265314_10000007 3300031711 Bacteria 491737
383 Ga0265314_10026699 3300031711 Bacteria 4334
384 Ga0265342_10004339 3300031712 Bacteria 11219
385 Ga0265342_10018496 3300031712 Bacteria 4513
386 Ga0265342_10022523 3300031712 Bacteria 4003
387 Ga0265342_10042643 3300031712 Bacteria 2740
388 Ga0307405_10001730 3300031731 Bacteria 9320
389 Ga0307405_10508448 3300031731 Bacteria 967
390 Ga0307410_10019021 3300031852 Bacteria 4167
391 Ga0307409_100011518 3300031995 Bacteria 5583
392 Ga0307409_100056148 3300031995 Bacteria 3044
393 Ga0307416_100008120 3300032002 Bacteria 6741
394 Ga0307416_100019732 3300032002 Bacteria 4788
395 Ga0307416_100039677 3300032002 Bacteria 3649
396 Ga0307411_10004105 3300032005 Bacteria 6908
397 Ga0307415_100124547 3300032126 Bacteria 1940
398 Ga0373950_0000004 3300034818 Bacteria 527382
399 Ga0373950_0000081 3300034818 Bacteria 32543
400 Ga0373923_0077063 3300035111 Bacteria 1441
401 Ga0373923_0163420 3300035111 Bacteria 1017
402 Ga0373932_0087824 3300035112 Bacteria 993
403 Ga0373941_0144820 3300035115 Bacteria 867
404 Ga0373953_0083494 3300035117 Bacteria 1331
405 Ga0373943_0026621 3300035170 Bacteria 2710
406 Ga0373955_0032133 3300035172 Bacteria 2753
407 Ga0373935_0168252 3300035692 Bacteria 1498
408 Ga0373933_0000433 3300035724 Bacteria 26255
409 Ga0373937_0180969 3300036401 Bacteria 1979
410 Ga0373937_0322753 3300036401 Bacteria 1461
411 Ga0395899_0001910 3300037312 Bacteria 17196
412 Ga0395899_0023469 3300037312 Bacteria 4671
413 Ga0395900_0015441 3300037418 Bacteria 7786
414 Ga0395900_0170630 3300037418 Bacteria 2215
415 Ga0395905_0001015 3300037471 Bacteria 35803
416 Ga0395905_0008044 3300037471 Bacteria 10417
417 Ga0395905_0011274 3300037471 Bacteria 8642
418 Ga0395905_0029071 3300037471 Bacteria 5208
419 Ga0395905_0105623 3300037471 Bacteria 2644
420 Ga0436364_0027492 3300037853 Bacteria 1648
421 Ga0436364_0043906 3300037853 Bacteria 35219
422 Ga0436364_1071482 3300037853 Bacteria 3223
423 Ga0395901_0008125 3300038443 Bacteria 10597
424 Ga0395901_0129787 3300038443 Bacteria 2648
425 Ga0436365_0742888 3300039437 Bacteria 55848
426 Ga0436365_1414019 3300039437 Bacteria 3237
427 Ga0436365_1702191 3300039437 Bacteria 116634
428 Ga0436360_0130330 3300039438 Bacteria 4642
429 Ga0436360_1157708 3300039438 Bacteria 1207
430 Ga0436361_0376382 3300039447 Bacteria 68820
431 Ga0436361_0684212 3300039447 Bacteria 74853
432 Ga0436361_0781398 3300039447 Bacteria 2507
433 Ga0436361_0914605 3300039447 Bacteria 7609
434 Ga0436361_1196357 3300039447 Bacteria 10171
435 Ga0436363_0602923 3300039450 Bacteria 5793
436 Ga0439461_0016024 3300041410 Bacteria 1442
437 Ga0451806_785562 3300041462 Bacteria 1820
438 Ga0451835_1159006 3300041492 Bacteria 1987
439 Ga0451851_0902098 3300041507 Bacteria 1085
440 Ga0439431_0008710 3300041997 Bacteria 2284
441 Ga0439448_0041547 3300042005 Bacteria 1488
442 Ga0439446_0003484 3300042156 Bacteria 3915
443 Ga0439434_0037836 3300042435 Bacteria 1478
444 Ga0439464_0100728 3300042439 Bacteria 878
445 Ga0451577_0001139 3300042876 Bacteria 37670
446 Ga0451577_0024140 3300042876 Bacteria 5532
447 Ga0451577_0093943 3300042876 Bacteria 2678
448 Ga0466969_0000233 3300044656 Bacteria 30390
449 Ga0466972_0000722 3300044658 Bacteria 15850
450 Ga0453683_0004754 3300044673 Bacteria 9573
451 Ga0466965_0074305 3300044683 Bacteria 1713
452 Ga0466966_0000394 3300044684 Bacteria 28289
453 Ga0466966_0027984 3300044684 Bacteria 3673
454 Ga0466966_0083748 3300044684 Bacteria 1984
455 Ga0466961_0002305 3300044693 Bacteria 11861
456 Ga0466963_0136803 3300044694 Bacteria 1695
457 Ga0466964_0003597 3300044706 Bacteria 5664
458 Ga0466964_0003808 3300044706 Bacteria 5531
459 Ga0453684_0000097 3300044712 Bacteria 377772
460 Ga0453684_0000539 3300044712 Bacteria 143526
461 Ga0453684_0019376 3300044712 Bacteria 10362
462 Ga0453684_0220885 3300044712 Bacteria 2195
463 Ga0466971_0001686 3300044719 Bacteria 9355
464 Ga0466968_0034669 3300044735 Bacteria 2107
465 Ga0466968_0096926 3300044735 Bacteria 1313
466 Ga0466970_0023173 3300044765 Bacteria 3241
467 Ga0466957_0001431 3300044842 Bacteria 12459
468 Ga0466960_0002467 3300044901 Bacteria 6958
469 Ga0466959_0000532 3300045049 Bacteria 22122
470 Ga0466959_0012403 3300045049 Bacteria 6158
471 Ga0451576_0012352 3300045051 Bacteria 9596
472 Ga0451576_0042648 3300045051 Bacteria 4790
473 Ga0451576_0077960 3300045051 Bacteria 3448
474 Ga0451576_0202891 3300045051 Bacteria 2071
475 Ga0466958_0001234 3300045836 Bacteria 11989
476 Ga0495617_000006 3300046452 Bacteria 398279
477 Ga0495617_047354 3300046452 Bacteria 1431
478 Ga0495627_000005 3300046453 Bacteria 630805
479 Ga0495590_0000052 3300046457 Bacteria 103480
480 Ga0495638_0000066 3300046460 Bacteria 168673
481 Ga0495651_0158707 3300046462 Bacteria 1623
482 Ga0495653_0000011 3300046463 Bacteria 272314
483 Ga0495650_0000506 3300046471 Bacteria 58187
484 Ga0495650_0000567 3300046471 Bacteria 51961
485 Ga0495650_0000694 3300046471 Bacteria 43425
486 Ga0495650_0012095 3300046471 Bacteria 4667
487 Ga0495650_0072000 3300046471 Bacteria 1354
488 Ga0495605_0000003 3300046474 Bacteria 491502
489 Ga0495605_0007637 3300046474 Bacteria 6132
490 Ga0495584_0000491 3300046491 Bacteria 27228
491 Ga0495585_0017515 3300046492 Bacteria 4139
492 Ga0495585_0039173 3300046492 Bacteria 2664
493 Ga0495585_0061949 3300046492 Bacteria 2055
494 Ga0495596_0022759 3300046500 Bacteria 2549
495 Ga0495607_0024662 3300046501 Bacteria 3745
496 Ga0495583_0000056 3300046506 Bacteria 200858
497 Ga0495583_0000320 3300046506 Bacteria 76050
498 Ga0495583_0052962 3300046506 Bacteria 1843
499 Ga0495606_0000024 3300046507 Bacteria 262080
500 Ga0495606_0000920 3300046507 Bacteria 43445
501 Ga0495606_0003205 3300046507 Bacteria 17641
502 Ga0495606_0038457 3300046507 Bacteria 3237
503 Ga0495610_0000004 3300046512 Bacteria 1006135
504 Ga0495610_0000913 3300046512 Bacteria 27469
505 Ga0495610_0021801 3300046512 Bacteria 3516
506 Ga0495610_0022741 3300046512 Bacteria 3422
507 Ga0495610_0077282 3300046512 Bacteria 1537
508 Ga0495610_0111064 3300046512 Bacteria 1214
509 Ga0495616_0010142 3300046513 Bacteria 5467
510 Ga0495616_0078074 3300046513 Bacteria 1588
511 Ga0495620_0036343 3300046515 Bacteria 2205
512 Ga0495620_0049605 3300046515 Bacteria 1795
513 Ga0495631_0071008 3300046518 Bacteria 1505
514 Ga0495632_0043818 3300046519 Bacteria 2235
515 Ga0495637_0000327 3300046520 Bacteria 36965
516 Ga0495637_0006099 3300046520 Bacteria 6069
517 Ga0495643_0000747 3300046522 Bacteria 36826
518 Ga0495643_0002987 3300046522 Bacteria 12778
519 Ga0495643_0013377 3300046522 Bacteria 4914
520 Ga0495643_0016075 3300046522 Bacteria 4404
521 Ga0495644_0001226 3300046523 Bacteria 10502
522 Ga0495644_0003414 3300046523 Bacteria 6285
523 Ga0495648_0000045 3300046524 Bacteria 172587
524 Ga0495648_0000534 3300046524 Bacteria 40983
525 Ga0495648_0010266 3300046524 Bacteria 7151
526 Ga0495648_0017548 3300046524 Bacteria 5112
527 Ga0495648_0085868 3300046524 Bacteria 1776
528 Ga0495654_0000004 3300046530 Bacteria 515304
529 Ga0495654_0023443 3300046530 Bacteria 3197
530 Ga0495654_0055950 3300046530 Bacteria 1908
531 Ga0495609_0001390 3300046538 Bacteria 16251
532 Ga0495609_0015963 3300046538 Bacteria 3505
533 Ga0495597_0001053 3300046542 Bacteria 21085
534 Ga0495597_0001374 3300046542 Bacteria 17598
535 Ga0495622_0000064 3300046557 Bacteria 93789
536 Ga0495633_0000504 3300046558 Bacteria 39318
537 Ga0495633_0001016 3300046558 Bacteria 22969
538 Ga0495633_0004925 3300046558 Bacteria 8343
539 Ga0495633_0007900 3300046558 Bacteria 6067
540 Ga0495656_0066150 3300046615 Bacteria 1591
541 Ga0495668_0000126 3300046616 Bacteria 114185
542 Ga0495668_0000810 3300046616 Bacteria 35815
543 Ga0495668_0004065 3300046616 Bacteria 10620
544 Ga0495625_0002773 3300046660 Bacteria 18494
545 Ga0495625_0002810 3300046660 Bacteria 18329
546 Ga0495625_0029580 3300046660 Bacteria 4094
547 Ga0495625_0088814 3300046660 Bacteria 2140
548 Ga0495625_0135131 3300046660 Bacteria 1668
549 Ga0495659_0000032 3300046664 Bacteria 65104
550 Ga0495659_0000445 3300046664 Bacteria 15457
551 Ga0495661_0086124 3300046665 Bacteria 1799
552 Ga0495588_0240663 3300046674 Bacteria 954
553 Ga0495599_0060805 3300046678 Bacteria 2362
554 Ga0495646_0248447 3300046680 Bacteria 954
555 Ga0495670_0001800 3300046691 Bacteria 10529
556 Ga0495671_0000001 3300046692 Bacteria 1169494
557 Ga0495671_0007128 3300046692 Bacteria 6404
558 Ga0495671_0007612 3300046692 Bacteria 6156
559 Ga0495649_0066728 3300046694 Bacteria 1931
560 Ga0495636_0077660 3300047318 Bacteria 1425
561 Ga0495672_0000045 3300047320 Bacteria 255145
562 Ga0495672_0002885 3300047320 Bacteria 15214
563 Ga0495672_0038367 3300047320 Bacteria 2922
564 Ga0495683_0008740 3300047323 Bacteria 5405
565 Ga0495687_000871 3300047443 Bacteria 32002
566 Ga0495687_053734 3300047443 Bacteria 1694
567 Ga0495677_0013967 3300047445 Bacteria 2923
568 Ga0495685_000942 3300047447 Bacteria 8806
569 Ga0495673_0000006 3300047469 Bacteria 908691
570 Ga0495673_0000014 3300047469 Bacteria 599202
571 Ga0495673_0000430 3300047469 Bacteria 47639
572 Ga0495673_0015711 3300047469 Bacteria 3894
573 Ga0495686_0000288 3300047472 Bacteria 88523
574 Ga0495686_0009312 3300047472 Bacteria 7086
575 Ga0495686_0113132 3300047472 Bacteria 1625
576 Ga0495626_0002799 3300048091 Bacteria 11701
577 Ga0496101_0089988 3300048904 Bacteria 2282
578 Ga0496102_0126102 3300048905 Bacteria 2393
579 Ga0496104_0001832 3300048907 Bacteria 18380
580 Ga0496104_0026152 3300048907 Bacteria 5384
581 Ga0496105_0007137 3300048908 Bacteria 8617
582 Ga0496106_0256743 3300048909 Bacteria 1398
583 Ga0496106_0305696 3300048909 Bacteria 1276
584 Ga0496107_0357745 3300048910 Bacteria 1086
585 Ga0496111_0124203 3300048914 Bacteria 1907
586 Ga0496111_0241356 3300048914 Bacteria 1342
587 Ga0496113_0205649 3300048916 Bacteria 1566
588 Ga0496114_0014908 3300048917 Bacteria 6247
589 Ga0496114_0020811 3300048917 Bacteria 5326
590 Ga0496114_0030221 3300048917 Bacteria 4457
591 Ga0496114_0059566 3300048917 Bacteria 3190
592 Ga0496114_0171012 3300048917 Bacteria 1894
593 Ga0496115_0000980 3300048918 Bacteria 20698
594 Ga0496115_0111922 3300048918 Bacteria 2243
595 Ga0496115_0166642 3300048918 Bacteria 1822
596 Ga0496115_0229599 3300048918 Bacteria 1531
597 Ga0496116_0000036 3300048919 Bacteria 388508
598 Ga0496116_0029678 3300048919 Bacteria 3938
599 Ga0496117_0000001 3300048920 Bacteria 2526244
600 Ga0496117_0006842 3300048920 Bacteria 11341
601 Ga0496117_0013917 3300048920 Bacteria 6974
602 Ga0496117_0159803 3300048920 Bacteria 1322
603 Ga0496118_0000008 3300048921 Bacteria 644537
604 Ga0496118_0002972 3300048921 Bacteria 21928
605 Ga0496118_0029704 3300048921 Bacteria 4578
606 Ga0496118_0036698 3300048921 Bacteria 3957
607 Ga0496118_0107234 3300048921 Bacteria 1866
608 Ga0496119_0000094 3300048922 Bacteria 130089
609 Ga0496119_0004735 3300048922 Bacteria 13373
610 Ga0496120_0000013 3300048923 Bacteria 331109
611 Ga0496120_0000183 3300048923 Bacteria 106937
612 Ga0496121_0000630 3300048924 Bacteria 65787
613 Ga0496121_0021640 3300048924 Bacteria 6288
614 Ga0496121_0047180 3300048924 Bacteria 3678
615 Ga0496121_0083231 3300048924 Bacteria 2526
616 Ga0496121_0290568 3300048924 Bacteria 1114
617 Ga0496122_0003395 3300048925 Bacteria 20970
618 Ga0496122_0013828 3300048925 Bacteria 7860
619 Ga0496123_0004226 3300048926 Bacteria 15322
620 Ga0496123_0015616 3300048926 Bacteria 6215
621 Ga0496123_0027291 3300048926 Bacteria 4256
622 Ga0496123_0106557 3300048926 Bacteria 1614
623 Ga0496124_0104233 3300048927 Bacteria 2293
624 Ga0496124_0158708 3300048927 Bacteria 1765
625 Ga0496124_0182330 3300048927 Bacteria 1614
626 Ga0496124_0252201 3300048927 Bacteria 1304
627 Ga0496125_0038861 3300048928 Bacteria 4109
628 Ga0496125_0147541 3300048928 Bacteria 1623
629 Ga0496126_0000301 3300048929 Bacteria 104981
630 Ga0496126_0015414 3300048929 Bacteria 7690
631 Ga0496126_0034111 3300048929 Bacteria 4784
632 Ga0496126_0107694 3300048929 Bacteria 2431
633 Ga0496126_0564880 3300048929 Bacteria 901
634 Ga0495678_000016 3300049459 Bacteria 303426
635 Ga0495678_000910 3300049459 Bacteria 25989
636 Ga0495678_005643 3300049459 Bacteria 6836
637 Ga0495682_0000351 3300049460 Bacteria 33719
638 Ga0495682_0001002 3300049460 Bacteria 16842
639 Ga0501298_008518 3300049521 Bacteria 1724
640 Ga0501299_006177 3300049522 Bacteria 1872
641 Ga0501033_0000973 3300049570 Bacteria 25988
642 Ga0501034_0000009 3300049571 Bacteria 336590
643 Ga0501034_0020542 3300049571 Bacteria 6745
644 Ga0501034_0058694 3300049571 Bacteria 3866
645 Ga0501034_0567959 3300049571 Bacteria 1042
646 Ga0501038_0069475 3300049574 Bacteria 2992
647 Ga0501043_0000619 3300049579 Bacteria 31331
648 Ga0501043_0049763 3300049579 Bacteria 3295
649 Ga0501046_0000219 3300049580 Bacteria 59638
650 Ga0501047_0000006 3300049581 Bacteria 455727
651 Ga0501047_0000516 3300049581 Bacteria 41760
652 Ga0501047_0019012 3300049581 Bacteria 6589
653 Ga0501047_0173789 3300049581 Bacteria 2023
654 Ga0501047_0259415 3300049581 Bacteria 1586
655 Ga0501048_0005237 3300049582 Bacteria 9880
656 Ga0501067_0000036 3300049583 Bacteria 83409
657 Ga0501067_0131552 3300049583 Bacteria 1393
658 Ga0501068_0023197 3300049584 Bacteria 3634
659 Ga0501068_0029913 3300049584 Bacteria 3229
660 Ga0501069_0222135 3300049585 Bacteria 1098
661 Ga0501070_0006007 3300049586 Bacteria 10340
662 Ga0501070_0173810 3300049586 Bacteria 1774
663 Ga0501072_0000204 3300049588 Bacteria 43316
664 Ga0501073_0000097 3300049589 Bacteria 55680
665 Ga0501073_0000398 3300049589 Bacteria 29572
666 Ga0501073_0061363 3300049589 Bacteria 2623
667 Ga0501073_0205551 3300049589 Bacteria 1361
668 Ga0501074_0004242 3300049590 Bacteria 10231
669 Ga0501074_0006021 3300049590 Bacteria 8755
670 Ga0501074_0131172 3300049590 Bacteria 1793
671 Ga0501076_0127402 3300049592 Bacteria 2064
672 Ga0501079_0000007 3300049741 Bacteria 76508
673 Ga0501080_0003701 3300049742 Bacteria 13497
674 Ga0501080_0004085 3300049742 Bacteria 12929
675 Ga0501080_0507692 3300049742 Bacteria 1077
676 Ga0501083_0000156 3300049744 Bacteria 45386
677 Ga0501083_0006625 3300049744 Bacteria 8219
678 Ga0501083_0021807 3300049744 Bacteria 4449
679 Ga0501083_0175125 3300049744 Bacteria 1402
680 Ga0501279_000757 3300049775 Bacteria 4224
681 Ga0501044_0010345 3300049823 Bacteria 10127
682 Ga0501044_0357705 3300049823 Bacteria 1378
683 nmdc:mga03n38_137779_c1 3300050490 Bacteria 1216
684 nmdc:mga00v17_15794_c1 3300050491 Bacteria 4245
685 nmdc:mga04h51_37250_c1 3300050495 Bacteria 1569
686 nmdc:mga07m45_5477_c1 3300050496 Bacteria 6321
687 nmdc:mga05p37_328178_c1 3300050507 Bacteria 1808
688 nmdc:mga08y16_211269_c1 3300050511 Bacteria 2010
689 nmdc:mga0n895_284360_c1 3300050512 Bacteria 1677
690 nmdc:mga0a205_62140_c1 3300050515 Bacteria 3608
691 Ga0495601_0114453 3300053077 Bacteria 1749
692 Ga0500635_0000378 3300053080 Bacteria 13748
693 Ga0500578_0035016 3300053086 Bacteria 3226
694 Ga0500643_020022 3300053087 Bacteria 2195
695 Ga0500562_016849 3300053108 Bacteria 1880
696 Ga0500595_009514 3300053119 Bacteria 3919
697 Ga0500608_000394 3300053122 Bacteria 16764
698 Ga0500618_002035 3300053125 Bacteria 8178
699 Ga0500658_0013777 3300053134 Bacteria 2990
700 Ga0500568_0000109 3300053139 Bacteria 76714
701 Ga0500616_0034527 3300053153 Bacteria 2754
702 Ga0500616_0036048 3300053153 Bacteria 2686
703 Ga0500616_0128134 3300053153 Bacteria 1202
704 Ga0500620_000059 3300053155 Bacteria 20299
705 Ga0500622_0002690 3300053156 Bacteria 12594
706 Ga0500627_0056769 3300053158 Bacteria 1716
707 Ga0500611_001955 3300053727 Bacteria 2385
708 Ga0500645_023462 3300053730 Bacteria 1891
709 Ga0501084_0000019 3300054114 Bacteria 146907
710 Ga0501082_0000310 3300060353 Bacteria 43373
711 Ga0466962_0001935 3300061719 Bacteria 9752
712 Ga0466962_0005534 3300061719 Bacteria 6064
713 Ga0466962_0036169 3300061719 Bacteria 2362

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300015690 Ga0183363_1056 Ga0183363_105627 240
2 3300046522 Ga0495643_0002987 Ga0495643_0002987_3574_4473 241
3 3300046542 Ga0495597_0001374 Ga0495597_0001374_8452_9351 241
4 3300047443 Ga0495687_053734 Ga0495687_053734_297_1196 241
5 3300047472 Ga0495686_0113132 Ga0495686_0113132_656_1570 241
6 3300053077 Ga0495601_0114453 Ga0495601_0114453_112_993 241
7 3300025294 Ga0209025_1012257 Ga0209025_10122572 242
8 3300044694 Ga0466963_0136803 Ga0466963_0136803_20_913 242
9 3300044706 Ga0466964_0003808 Ga0466964_0003808_495_1388 242
10 3300061719 Ga0466962_0036169 Ga0466962_0036169_42_935 242
11 3300009036 Ga0105244_10013090 Ga0105244_100130902 245
12 3300025728 Ga0207655_1012507 Ga0207655_10125072 245
13 3300027665 Ga0209983_1015098 Ga0209983_10150982 245
14 3300030744 Ga0316181_1182530 Ga0316181_11825302 245
15 3300046512 Ga0495610_0021801 Ga0495610_0021801_1036_1929 245
16 3300049579 Ga0501043_0049763 Ga0501043_0049763_1397_2284 245
17 3300049742 Ga0501080_0507692 Ga0501080_0507692_141_1028 245
18 3300003771 Ga0055526_1000225 Ga0055526_100022512 246
19 3300025295 Ga0209564_1000017 Ga0209564_100001742 246
20 3300003763 Ga0055529_1000154 Ga0055529_100015438 247
21 3300025233 Ga0209437_104899 Ga0209437_1048992 247
22 3300025261 Ga0209233_1022421 Ga0209233_10224212 247
23 3300025272 Ga0209455_1000049 Ga0209455_1000049185 247
24 3300046457 Ga0495590_0000052 Ga0495590_0000052_57705_58604 247
25 3300046460 Ga0495638_0000066 Ga0495638_0000066_67039_67938 247
26 3300046471 Ga0495650_0012095 Ga0495650_0012095_113_1012 247
27 3300046506 Ga0495583_0000320 Ga0495583_0000320_57749_58648 247
28 3300046524 Ga0495648_0000045 Ga0495648_0000045_122991_123890 247
29 3300046558 Ga0495633_0001016 Ga0495633_0001016_5116_6015 247
30 3300046616 Ga0495668_0000810 Ga0495668_0000810_10594_11493 247
31 3300046660 Ga0495625_0002810 Ga0495625_0002810_8141_9040 247
32 3300049775 Ga0501279_000757 Ga0501279_000757_1828_2727 247
33 3300021384 Ga0213876_10004571 Ga0213876_1000457111 248
34 3300025245 Ga0207425_1008083 Ga0207425_10080832 248
35 3300025294 Ga0209025_1008678 Ga0209025_10086788 248
36 3300025297 Ga0209758_1000712 Ga0209758_100071219 248
37 3300025297 Ga0209758_1000937 Ga0209758_100093710 248
38 3300039437 Ga0436365_0742888 Ga0436365_0742888_25328_26212 248
39 3300046491 Ga0495584_0000491 Ga0495584_0000491_345_1229 248
40 3300046530 Ga0495654_0055950 Ga0495654_0055950_297_1184 248
41 3300046664 Ga0495659_0000032 Ga0495659_0000032_50162_51049 248
42 3300046664 Ga0495659_0000445 Ga0495659_0000445_14138_15022 248
43 3300046692 Ga0495671_0007612 Ga0495671_0007612_1620_2507 248
44 3300047320 Ga0495672_0000045 Ga0495672_0000045_242897_243784 248
45 3300047320 Ga0495672_0038367 Ga0495672_0038367_529_1413 248
46 3300005353 Ga0070669_100265167 Ga0070669_1002651672 249
47 3300025258 Ga0209129_1002872 Ga0209129_10028728 249
48 3300025295 Ga0209564_1000006 Ga0209564_100000650 249
49 3300025297 Ga0209758_1004308 Ga0209758_10043084 249
50 3300025923 Ga0207681_10141857 Ga0207681_101418572 249
51 3300042156 Ga0439446_0003484 Ga0439446_0003484_590_1441 249
52 3300042435 Ga0439434_0037836 Ga0439434_0037836_120_974 249
53 3300045051 Ga0451576_0202891 Ga0451576_0202891_852_1721 249
54 3300046512 Ga0495610_0022741 Ga0495610_0022741_540_1427 249
55 3300046512 Ga0495610_0111064 Ga0495610_0111064_17_919 249
56 3300046522 Ga0495643_0000747 Ga0495643_0000747_18891_19793 249
57 3300046522 Ga0495643_0016075 Ga0495643_0016075_1382_2269 249
58 3300046524 Ga0495648_0017548 Ga0495648_0017548_1694_2596 249
59 3300046542 Ga0495597_0001053 Ga0495597_0001053_16349_17239 249
60 3300048920 Ga0496117_0159803 Ga0496117_0159803_92_979 249
61 3300048921 Ga0496118_0107234 Ga0496118_0107234_606_1493 249
62 3300048924 Ga0496121_0083231 Ga0496121_0083231_1239_2126 249
63 3300048925 Ga0496122_0013828 Ga0496122_0013828_5819_6706 249
64 3300048926 Ga0496123_0027291 Ga0496123_0027291_1252_2139 249
65 3300048927 Ga0496124_0104233 Ga0496124_0104233_85_972 249
66 3300048928 Ga0496125_0038861 Ga0496125_0038861_2877_3764 249
67 3300049459 Ga0495678_000910 Ga0495678_000910_17025_17927 249
68 3300049584 Ga0501068_0029913 Ga0501068_0029913_361_1209 249
69 3300053156 Ga0500622_0002690 Ga0500622_0002690_7672_8559 249
70 3300002773 JGI25152J39213_1004158 JGI25152J39213_10041583 250
71 3300003771 Ga0055526_1005972 Ga0055526_10059724 250
72 3300025233 Ga0209437_103210 Ga0209437_1032103 250
73 3300025273 Ga0209673_1002729 Ga0209673_10027294 250
74 3300025295 Ga0209564_1002441 Ga0209564_10024414 250
75 3300025299 Ga0209256_1003989 Ga0209256_10039894 250
76 3300046452 Ga0495617_047354 Ga0495617_047354_169_1053 250
77 3300046474 Ga0495605_0007637 Ga0495605_0007637_3596_4480 250
78 3300046501 Ga0495607_0024662 Ga0495607_0024662_2303_3187 250
79 3300046506 Ga0495583_0000056 Ga0495583_0000056_143642_144526 250
80 3300046513 Ga0495616_0078074 Ga0495616_0078074_112_996 250
81 3300046523 Ga0495644_0003414 Ga0495644_0003414_474_1358 250
82 3300046524 Ga0495648_0000534 Ga0495648_0000534_29610_30494 250
83 3300046538 Ga0495609_0015963 Ga0495609_0015963_1576_2460 250
84 3300046558 Ga0495633_0007900 Ga0495633_0007900_4745_5629 250
85 3300046615 Ga0495656_0066150 Ga0495656_0066150_269_1153 250
86 3300046660 Ga0495625_0029580 Ga0495625_0029580_2450_3334 250
87 3300047323 Ga0495683_0008740 Ga0495683_0008740_3489_4373 250
88 3300047443 Ga0495687_000871 Ga0495687_000871_10490_11374 250
89 3300047445 Ga0495677_0013967 Ga0495677_0013967_1147_2031 250
90 3300047447 Ga0495685_000942 Ga0495685_000942_6679_7563 250
91 3300047469 Ga0495673_0015711 Ga0495673_0015711_90_974 250
92 3300047472 Ga0495686_0000288 Ga0495686_0000288_33426_34328 250
93 3300048914 Ga0496111_0241356 Ga0496111_0241356_375_1259 250
94 3300049459 Ga0495678_005643 Ga0495678_005643_247_1131 250
95 3300049460 Ga0495682_0000351 Ga0495682_0000351_21481_22365 250
96 3300049460 Ga0495682_0001002 Ga0495682_0001002_6605_7489 250
97 3300021361 Ga0213872_10000427 Ga0213872_1000042714 251
98 3300039447 Ga0436361_0684212 Ga0436361_0684212_8272_9162 251
99 3300046492 Ga0495585_0039173 Ga0495585_0039173_286_1170 251
100 3300046523 Ga0495644_0001226 Ga0495644_0001226_2440_3324 251
101 3300048919 Ga0496116_0000036 Ga0496116_0000036_23291_24163 251
102 3300047469 Ga0495673_0000006 Ga0495673_0000006_166481_167371 252
103 3300048929 Ga0496126_0015414 Ga0496126_0015414_74_964 252
104 3300046500 Ga0495596_0022759 Ga0495596_0022759_317_1189 253
105 3300046557 Ga0495622_0000064 Ga0495622_0000064_62524_63429 253
106 3300049581 Ga0501047_0019012 Ga0501047_0019012_1933_2778 253
107 3300003775 Ga0055524_1009871 Ga0055524_10098713 254
108 3300003790 Ga0055528_1001577 Ga0055528_10015772 254
109 3300003790 Ga0055528_1004369 Ga0055528_10043693 254
110 3300005293 Ga0065715_10218643 Ga0065715_102186432 254
111 3300005367 Ga0070667_100506473 Ga0070667_1005064732 254
112 3300005578 Ga0068854_100197905 Ga0068854_1001979052 254
113 3300006852 Ga0075433_10079939 Ga0075433_100799393 254
114 3300006871 Ga0075434_100197297 Ga0075434_1001972973 254
115 3300009765 Ga0123341_1000109 Ga0123341_10001098 254
116 3300009766 Ga0123342_1028378 Ga0123342_10283782 254
117 3300010375 Ga0105239_10162333 Ga0105239_101623332 254
118 3300013297 Ga0157378_10288927 Ga0157378_102889272 254
119 3300025273 Ga0209673_1000132 Ga0209673_100013299 254
120 3300025299 Ga0209256_1000458 Ga0209256_100045831 254
121 3300025981 Ga0207640_10086060 Ga0207640_100860603 254
122 3300041410 Ga0439461_0016024 Ga0439461_0016024_616_1428 254
123 3300050507 nmdc:mga05p37_328178_c1 nmdc:mga05p37_328178_c1_218_1084 254
124 3300050512 nmdc:mga0n895_284360_c1 nmdc:mga0n895_284360_c1_478_1344 254
125 3300050515 nmdc:mga0a205_62140_c1 nmdc:mga0a205_62140_c1_654_1520 254
126 3300003771 Ga0055526_1004476 Ga0055526_10044762 255
127 3300003773 Ga0055537_1000111 Ga0055537_100011151 255
128 3300003775 Ga0055524_1013258 Ga0055524_10132582 255
129 3300003784 Ga0055534_1000509 Ga0055534_100050913 255
130 3300003790 Ga0055528_1005582 Ga0055528_10055824 255
131 3300003790 Ga0055528_1017372 Ga0055528_10173722 255
132 3300025263 Ga0209565_1000009 Ga0209565_1000009548 255
133 3300025273 Ga0209673_1000036 Ga0209673_1000036134 255
134 3300025273 Ga0209673_1002876 Ga0209673_10028769 255
135 3300025291 Ga0209675_1000013 Ga0209675_1000013134 255
136 3300025295 Ga0209564_1000122 Ga0209564_1000122134 255
137 3300025295 Ga0209564_1027071 Ga0209564_10270712 255
138 3300025299 Ga0209256_1000106 Ga0209256_100010641 255
139 3300025299 Ga0209256_1000146 Ga0209256_100014664 255
140 3300025299 Ga0209256_1019255 Ga0209256_10192552 255
141 3300046513 Ga0495616_0010142 Ga0495616_0010142_467_1351 255
142 3300046691 Ga0495670_0001800 Ga0495670_0001800_8522_9406 255
143 3300049823 Ga0501044_0357705 Ga0501044_0357705_285_1166 255
144 3300053087 Ga0500643_020022 Ga0500643_020022_1113_1997 255
145 3300003215 JGI25153J46596_10013565 JGI25153J46596_100135653 256
146 3300005563 Ga0068855_100129804 Ga0068855_1001298043 256
147 3300009147 Ga0114129_10225153 Ga0114129_102251532 256
148 3300025303 Ga0209051_1025528 Ga0209051_10255283 256
149 3300025949 Ga0207667_10075108 Ga0207667_100751083 256
150 3300031456 Ga0307513_10040412 Ga0307513_100404124 256
151 3300037471 Ga0395905_0105623 Ga0395905_0105623_1522_2385 256
152 3300041492 Ga0451835_1159006 Ga0451835_1159006_815_1687 256
153 3300042876 Ga0451577_0001139 Ga0451577_0001139_14856_15719 256
154 3300042876 Ga0451577_0024140 Ga0451577_0024140_3888_4793 256
155 3300042876 Ga0451577_0093943 Ga0451577_0093943_1405_2229 256
156 3300044712 Ga0453684_0000539 Ga0453684_0000539_69685_70509 256
157 3300045051 Ga0451576_0012352 Ga0451576_0012352_6202_7026 256
158 3300045051 Ga0451576_0077960 Ga0451576_0077960_1586_2491 256
159 3300046471 Ga0495650_0072000 Ga0495650_0072000_347_1219 256
160 3300046492 Ga0495585_0017515 Ga0495585_0017515_408_1280 256
161 3300046515 Ga0495620_0049605 Ga0495620_0049605_794_1666 256
162 3300046518 Ga0495631_0071008 Ga0495631_0071008_527_1399 256
163 3300046522 Ga0495643_0013377 Ga0495643_0013377_91_963 256
164 3300046660 Ga0495625_0088814 Ga0495625_0088814_1135_2007 256
165 3300046660 Ga0495625_0135131 Ga0495625_0135131_384_1268 256
166 3300046680 Ga0495646_0248447 Ga0495646_0248447_20_862 256
167 3300003790 Ga0055528_1021384 Ga0055528_10213842 257
168 3300005844 Ga0068862_100094053 Ga0068862_1000940532 257
169 3300021361 Ga0213872_10001785 Ga0213872_100017858 257
170 3300025245 Ga0207425_1012470 Ga0207425_10124702 257
171 3300025273 Ga0209673_1001968 Ga0209673_10019682 257
172 3300025297 Ga0209758_1007213 Ga0209758_10072136 257
173 3300028380 Ga0268265_10118470 Ga0268265_101184702 257
174 3300046519 Ga0495632_0043818 Ga0495632_0043818_598_1470 257
175 3300046674 Ga0495588_0240663 Ga0495588_0240663_119_940 257
176 3300047472 Ga0495686_0009312 Ga0495686_0009312_4268_5140 257
177 3300053086 Ga0500578_0035016 Ga0500578_0035016_978_1850 257
178 3300053153 Ga0500616_0034527 Ga0500616_0034527_835_1707 257
179 3300002738 JGI25154J39366_1000581 JGI25154J39366_10005819 258
180 3300003792 Ga0055540_1000050 Ga0055540_1000050131 258
181 3300006048 Ga0075363_100117260 Ga0075363_1001172602 258
182 3300014326 Ga0157380_10012262 Ga0157380_100122626 258
183 3300025246 Ga0209646_1000028 Ga0209646_1000028148 258
184 3300025298 Ga0209050_1006906 Ga0209050_10069062 258
185 3300025303 Ga0209051_1000062 Ga0209051_1000062196 258
186 3300025304 Ga0209257_1011007 Ga0209257_10110073 258
187 3300031250 Ga0265331_10009510 Ga0265331_100095104 258
188 3300031251 Ga0265327_10110327 Ga0265327_101103271 258
189 3300035115 Ga0373941_0144820 Ga0373941_0144820_16_825 258
190 3300047469 Ga0495673_0000014 Ga0495673_0000014_303651_304541 258
191 3300048910 Ga0496107_0357745 Ga0496107_0357745_107_973 258
192 3300048917 Ga0496114_0059566 Ga0496114_0059566_792_1658 258
193 3300048918 Ga0496115_0166642 Ga0496115_0166642_375_1241 258
194 3300005445 Ga0070708_100046600 Ga0070708_1000466003 259
195 3300005467 Ga0070706_100224605 Ga0070706_1002246052 259
196 3300005518 Ga0070699_100014910 Ga0070699_1000149104 259
197 3300005536 Ga0070697_100175205 Ga0070697_1001752052 259
198 3300021361 Ga0213872_10027690 Ga0213872_100276902 259
199 3300021361 Ga0213872_10033045 Ga0213872_100330453 259
200 3300025910 Ga0207684_10093142 Ga0207684_100931422 259
201 3300039447 Ga0436361_0914605 Ga0436361_0914605_6415_7287 259
202 3300046530 Ga0495654_0023443 Ga0495654_0023443_461_1339 259
203 3300005937 Ga0081455_10006544 Ga0081455_100065443 260
204 3300021320 Ga0214544_1000123 Ga0214544_100012334 260
205 3300021320 Ga0214544_1000646 Ga0214544_100064664 260
206 3300021321 Ga0214542_1000027 Ga0214542_100002769 260
207 3300021321 Ga0214542_1000141 Ga0214542_100014165 260
208 3300021321 Ga0214542_1025614 Ga0214542_10256141 260
209 3300021327 Ga0214543_1000025 Ga0214543_1000025137 260
210 3300021327 Ga0214543_1000026 Ga0214543_1000026166 260
211 3300021327 Ga0214543_1000047 Ga0214543_100004743 260
212 3300025299 Ga0209256_1025460 Ga0209256_10254602 260
213 3300028800 Ga0265338_10117785 Ga0265338_101177852 260
214 3300044712 Ga0453684_0019376 Ga0453684_0019376_1462_2295 260
215 3300047318 Ga0495636_0077660 Ga0495636_0077660_179_1051 260
216 3300048928 Ga0496125_0147541 Ga0496125_0147541_287_1207 260
217 3300049581 Ga0501047_0173789 Ga0501047_0173789_351_1196 260
218 3300049586 Ga0501070_0173810 Ga0501070_0173810_169_1014 260
219 3300049589 Ga0501073_0061363 Ga0501073_0061363_591_1520 260
220 3300049744 Ga0501083_0021807 Ga0501083_0021807_20_949 260
221 3300053108 Ga0500562_016849 Ga0500562_016849_200_1072 260
222 3300053134 Ga0500658_0013777 Ga0500658_0013777_1165_2037 260
223 3300053139 Ga0500568_0000109 Ga0500568_0000109_4289_5161 260
224 3300053153 Ga0500616_0036048 Ga0500616_0036048_970_1842 260
225 3300053158 Ga0500627_0056769 Ga0500627_0056769_141_1013 260
226 3300005983 Ga0081540_1010180 Ga0081540_10101802 261
227 3300031344 Ga0265316_10014895 Ga0265316_100148953 261
228 3300037418 Ga0395900_0170630 Ga0395900_0170630_524_1387 261
229 3300037471 Ga0395905_0011274 Ga0395905_0011274_3600_4463 261
230 3300044712 Ga0453684_0000097 Ga0453684_0000097_239254_240117 261
231 3300046520 Ga0495637_0006099 Ga0495637_0006099_4701_5591 261
232 3300053125 Ga0500618_002035 Ga0500618_002035_6252_7118 261
233 3300005364 Ga0070673_100218681 Ga0070673_1002186811 262
234 3300031249 Ga0265339_10001828 Ga0265339_1000182811 262
235 3300031711 Ga0265314_10026699 Ga0265314_100266993 262
236 3300031712 Ga0265342_10018496 Ga0265342_100184963 262
237 3300039438 Ga0436360_1157708 Ga0436360_1157708_291_1130 262
238 3300044658 Ga0466972_0000722 Ga0466972_0000722_9521_10366 262
239 3300044706 Ga0466964_0003597 Ga0466964_0003597_3931_4776 262
240 3300044735 Ga0466968_0096926 Ga0466968_0096926_149_994 262
241 3300044901 Ga0466960_0002467 Ga0466960_0002467_448_1293 262
242 3300046462 Ga0495651_0158707 Ga0495651_0158707_230_1108 262
243 3300046678 Ga0495599_0060805 Ga0495599_0060805_413_1291 262
244 3300049583 Ga0501067_0131552 Ga0501067_0131552_479_1333 262
245 3300049590 Ga0501074_0131172 Ga0501074_0131172_63_917 262
246 3300002774 JGI25150J39212_1003821 JGI25150J39212_10038214 263
247 3300003215 JGI25153J46596_10009537 JGI25153J46596_100095372 263
248 3300003771 Ga0055526_1000523 Ga0055526_100052312 263
249 3300003771 Ga0055526_1000525 Ga0055526_100052512 263
250 3300005577 Ga0068857_100043403 Ga0068857_1000434033 263
251 3300009036 Ga0105244_10002912 Ga0105244_100029126 263
252 3300025245 Ga0207425_1000551 Ga0207425_100055119 263
253 3300025294 Ga0209025_1012300 Ga0209025_10123003 263
254 3300025295 Ga0209564_1000038 Ga0209564_100003830 263
255 3300025297 Ga0209758_1000149 Ga0209758_1000149107 263
256 3300037312 Ga0395899_0023469 Ga0395899_0023469_330_1190 263
257 3300037471 Ga0395905_0029071 Ga0395905_0029071_1948_2808 263
258 3300038443 Ga0395901_0129787 Ga0395901_0129787_225_1085 263
259 3300039447 Ga0436361_1196357 Ga0436361_1196357_4169_5002 263
260 3300046452 Ga0495617_000006 Ga0495617_000006_362847_363737 263
261 3300046471 Ga0495650_0000506 Ga0495650_0000506_15680_16570 263
262 3300046471 Ga0495650_0000567 Ga0495650_0000567_33658_34548 263
263 3300046471 Ga0495650_0000694 Ga0495650_0000694_15716_16606 263
264 3300046474 Ga0495605_0000003 Ga0495605_0000003_346593_347483 263
265 3300046507 Ga0495606_0038457 Ga0495606_0038457_2102_3004 263
266 3300046512 Ga0495610_0000004 Ga0495610_0000004_363619_364509 263
267 3300046512 Ga0495610_0077282 Ga0495610_0077282_619_1521 263
268 3300046520 Ga0495637_0000327 Ga0495637_0000327_14903_15793 263
269 3300046524 Ga0495648_0010266 Ga0495648_0010266_5764_6654 263
270 3300046524 Ga0495648_0085868 Ga0495648_0085868_405_1295 263
271 3300046530 Ga0495654_0000004 Ga0495654_0000004_99702_100592 263
272 3300046616 Ga0495668_0004065 Ga0495668_0004065_9169_10059 263
273 3300046660 Ga0495625_0002773 Ga0495625_0002773_1850_2740 263
274 3300046692 Ga0495671_0000001 Ga0495671_0000001_1011362_1012252 263
275 3300046692 Ga0495671_0007128 Ga0495671_0007128_1956_2846 263
276 3300047469 Ga0495673_0000430 Ga0495673_0000430_30403_31293 263
277 3300048926 Ga0496123_0004226 Ga0496123_0004226_3899_4789 263
278 3300049823 Ga0501044_0010345 Ga0501044_0010345_4446_5303 263
279 3300035111 Ga0373923_0163420 Ga0373923_0163420_153_959 264
280 3300037312 Ga0395899_0001910 Ga0395899_0001910_10837_11739 264
281 3300039437 Ga0436365_1414019 Ga0436365_1414019_1845_2723 264
282 3300046463 Ga0495653_0000011 Ga0495653_0000011_239939_240838 264
283 3300046507 Ga0495606_0000024 Ga0495606_0000024_50785_51675 264
284 3300046507 Ga0495606_0000920 Ga0495606_0000920_26751_27650 264
285 3300046512 Ga0495610_0000913 Ga0495610_0000913_18410_19300 264
286 3300046558 Ga0495633_0004925 Ga0495633_0004925_5248_6138 264
287 3300046616 Ga0495668_0000126 Ga0495668_0000126_75955_76845 264
288 3300048909 Ga0496106_0305696 Ga0496106_0305696_76_924 264
289 3300049581 Ga0501047_0000516 Ga0501047_0000516_27620_28474 264
290 3300053155 Ga0500620_000059 Ga0500620_000059_18853_19737 264
291 3300002067 JGI24735J21928_10047197 JGI24735J21928_100471971 265
292 3300005339 Ga0070660_100081724 Ga0070660_1000817243 265
293 3300013104 Ga0157370_10067943 Ga0157370_100679433 265
294 3300013307 Ga0157372_10039562 Ga0157372_100395624 265
295 3300042439 Ga0439464_0100728 Ga0439464_0100728_13_816 265
296 3300044673 Ga0453683_0004754 Ga0453683_0004754_7526_8383 265
297 3300049571 Ga0501034_0567959 Ga0501034_0567959_16_900 265
298 3300049581 Ga0501047_0259415 Ga0501047_0259415_566_1450 265
299 3300005339 Ga0070660_100001683 Ga0070660_10000168310 266
300 3300013105 Ga0157369_10364755 Ga0157369_103647552 266
301 3300025914 Ga0207671_10271340 Ga0207671_102713401 266
302 3300025919 Ga0207657_10013278 Ga0207657_100132786 266
303 3300025949 Ga0207667_10044799 Ga0207667_100447993 266
304 3300026078 Ga0207702_10272547 Ga0207702_102725472 266
305 3300034818 Ga0373950_0000004 Ga0373950_0000004_280170_281018 266
306 3300035117 Ga0373953_0083494 Ga0373953_0083494_413_1222 266
307 3300037471 Ga0395905_0001015 Ga0395905_0001015_28520_29389 266
308 3300048918 Ga0496115_0111922 Ga0496115_0111922_1040_1849 266
309 3300048918 Ga0496115_0229599 Ga0496115_0229599_213_1022 266
310 3300049583 Ga0501067_0000036 Ga0501067_0000036_64711_65559 266
311 3300049589 Ga0501073_0000097 Ga0501073_0000097_27546_28394 266
312 3300053727 Ga0500611_001955 Ga0500611_001955_1053_1958 266
313 iso_pu_bacteria 2687453109 2687497695 266
314 3300002773 JGI25152J39213_1011157 JGI25152J39213_10111572 267
315 3300003771 Ga0055526_1005066 Ga0055526_10050665 267
316 3300003790 Ga0055528_1012917 Ga0055528_10129174 267
317 3300003792 Ga0055540_1004822 Ga0055540_10048223 267
318 3300005355 Ga0070671_100015564 Ga0070671_1000155645 267
319 3300006178 Ga0075367_10004847 Ga0075367_100048476 267
320 3300009011 Ga0105251_10027431 Ga0105251_100274312 267
321 3300009036 Ga0105244_10058023 Ga0105244_100580232 267
322 3300009177 Ga0105248_10739095 Ga0105248_107390952 267
323 3300025273 Ga0209673_1023308 Ga0209673_10233081 267
324 3300025294 Ga0209025_1062996 Ga0209025_10629962 267
325 3300025295 Ga0209564_1022001 Ga0209564_10220012 267
326 3300025297 Ga0209758_1020394 Ga0209758_10203942 267
327 3300025299 Ga0209256_1010331 Ga0209256_10103312 267
328 3300025302 Ga0207426_1005948 Ga0207426_10059482 267
329 3300025303 Ga0209051_1003152 Ga0209051_10031522 267
330 3300028573 Ga0265334_10010136 Ga0265334_100101362 267
331 3300028800 Ga0265338_10137792 Ga0265338_101377922 267
332 3300034818 Ga0373950_0000081 Ga0373950_0000081_30132_30944 267
333 3300035170 Ga0373943_0026621 Ga0373943_0026621_654_1466 267
334 3300035692 Ga0373935_0168252 Ga0373935_0168252_284_1096 267
335 3300044684 Ga0466966_0083748 Ga0466966_0083748_57_902 267
336 3300048917 Ga0496114_0030221 Ga0496114_0030221_961_1773 267
337 3300048927 Ga0496124_0158708 Ga0496124_0158708_464_1333 267
338 3300049571 Ga0501034_0000009 Ga0501034_0000009_296012_296824 267
339 3300049574 Ga0501038_0069475 Ga0501038_0069475_1752_2564 267
340 3300049579 Ga0501043_0000619 Ga0501043_0000619_30480_31292 267
341 3300049580 Ga0501046_0000219 Ga0501046_0000219_34423_35235 267
342 3300049581 Ga0501047_0000006 Ga0501047_0000006_38995_39807 267
343 3300049582 Ga0501048_0005237 Ga0501048_0005237_6707_7519 267
344 3300049584 Ga0501068_0023197 Ga0501068_0023197_2179_2991 267
345 3300049586 Ga0501070_0006007 Ga0501070_0006007_3884_4696 267
346 3300049588 Ga0501072_0000204 Ga0501072_0000204_5995_6807 267
347 3300049589 Ga0501073_0000398 Ga0501073_0000398_3757_4569 267
348 3300049590 Ga0501074_0004242 Ga0501074_0004242_3511_4323 267
349 3300049741 Ga0501079_0000007 Ga0501079_0000007_34449_35261 267
350 3300049742 Ga0501080_0004085 Ga0501080_0004085_9733_10545 267
351 3300049744 Ga0501083_0000156 Ga0501083_0000156_10152_10964 267
352 3300053119 Ga0500595_009514 Ga0500595_009514_101_940 267
353 3300054114 Ga0501084_0000019 Ga0501084_0000019_38979_39791 267
354 3300060353 Ga0501082_0000310 Ga0501082_0000310_38243_39055 267
355 3300002239 JGI24034J26672_10001232 JGI24034J26672_100012323 268
356 3300005331 Ga0070670_100101679 Ga0070670_1001016792 268
357 3300005347 Ga0070668_100000062 Ga0070668_10000006249 268
358 3300005355 Ga0070671_100003932 Ga0070671_10000393210 268
359 3300005543 Ga0070672_100025908 Ga0070672_1000259083 268
360 3300005617 Ga0068859_100314355 Ga0068859_1003143552 268
361 3300005841 Ga0068863_100000011 Ga0068863_10000001176 268
362 3300005841 Ga0068863_100071054 Ga0068863_1000710542 268
363 3300005842 Ga0068858_100608840 Ga0068858_1006088402 268
364 3300005843 Ga0068860_100220814 Ga0068860_1002208142 268
365 3300005985 Ga0081539_10025085 Ga0081539_100250852 268
366 3300006353 Ga0075370_10092541 Ga0075370_100925412 268
367 3300006931 Ga0097620_100314366 Ga0097620_1003143662 268
368 3300006946 Ga0079104_1011251 Ga0079104_10112512 268
369 3300009093 Ga0105240_10014613 Ga0105240_100146134 268
370 3300009545 Ga0105237_10725085 Ga0105237_107250851 268
371 3300009551 Ga0105238_10217032 Ga0105238_102170322 268
372 3300009553 Ga0105249_10004580 Ga0105249_100045806 268
373 3300013308 Ga0157375_10003788 Ga0157375_100037888 268
374 3300014325 Ga0163163_10400730 Ga0163163_104007302 268
375 3300014497 Ga0182008_10001294 Ga0182008_100012944 268
376 3300015261 Ga0182006_1000014 Ga0182006_1000014291 268
377 3300015261 Ga0182006_1000369 Ga0182006_100036921 268
378 3300015262 Ga0182007_10000096 Ga0182007_1000009645 268
379 3300015265 Ga0182005_1000018 Ga0182005_1000018264 268
380 3300025913 Ga0207695_10022068 Ga0207695_100220685 268
381 3300025924 Ga0207694_10074998 Ga0207694_100749982 268
382 3300025925 Ga0207650_10116541 Ga0207650_101165412 268
383 3300025931 Ga0207644_10000021 Ga0207644_1000002176 268
384 3300025940 Ga0207691_10005325 Ga0207691_100053252 268
385 3300025961 Ga0207712_10098195 Ga0207712_100981953 268
386 3300025972 Ga0207668_10000083 Ga0207668_1000008312 268
387 3300026035 Ga0207703_10575763 Ga0207703_105757632 268
388 3300026088 Ga0207641_10000028 Ga0207641_1000002876 268
389 3300026088 Ga0207641_10063814 Ga0207641_100638143 268
390 3300028379 Ga0268266_10012971 Ga0268266_100129714 268
391 3300028381 Ga0268264_10006454 Ga0268264_100064544 268
392 3300028556 Ga0265337_1007536 Ga0265337_10075364 268
393 3300030745 Ga0316182_1008528 Ga0316182_10085282 268
394 3300031235 Ga0265330_10011254 Ga0265330_100112543 268
395 3300031240 Ga0265320_10036825 Ga0265320_100368252 268
396 3300031241 Ga0265325_10004033 Ga0265325_100040334 268
397 3300031249 Ga0265339_10055515 Ga0265339_100555152 268
398 3300031250 Ga0265331_10052905 Ga0265331_100529052 268
399 3300031344 Ga0265316_10036418 Ga0265316_100364183 268
400 3300031548 Ga0307408_100006036 Ga0307408_1000060367 268
401 3300031711 Ga0265314_10000007 Ga0265314_1000000729 268
402 3300031712 Ga0265342_10004339 Ga0265342_100043393 268
403 3300031731 Ga0307405_10001730 Ga0307405_100017309 268
404 3300046453 Ga0495627_000005 Ga0495627_000005_55581_56474 268
405 3300046506 Ga0495583_0052962 Ga0495583_0052962_933_1805 268
406 3300046538 Ga0495609_0001390 Ga0495609_0001390_11633_12526 268
407 3300048917 Ga0496114_0020811 Ga0496114_0020811_4383_5255 268
408 3300048920 Ga0496117_0000001 Ga0496117_0000001_2230669_2231622 268
409 3300048921 Ga0496118_0000008 Ga0496118_0000008_348962_349915 268
410 3300048921 Ga0496118_0036698 Ga0496118_0036698_2191_3072 268
411 3300048924 Ga0496121_0047180 Ga0496121_0047180_2312_3265 268
412 3300048925 Ga0496122_0003395 Ga0496122_0003395_7864_8817 268
413 3300048926 Ga0496123_0015616 Ga0496123_0015616_1126_2079 268
414 3300048926 Ga0496123_0106557 Ga0496123_0106557_174_1055 268
415 3300048927 Ga0496124_0182330 Ga0496124_0182330_174_1055 268
416 3300048927 Ga0496124_0252201 Ga0496124_0252201_398_1273 268
417 3300048929 Ga0496126_0564880 Ga0496126_0564880_14_889 268
418 3300049459 Ga0495678_000016 Ga0495678_000016_25629_26519 268
419 3300002773 JGI25152J39213_1008220 JGI25152J39213_10082202 269
420 3300002774 JGI25150J39212_1001021 JGI25150J39212_10010218 269
421 3300003374 JGI25161J50226_1005994 JGI25161J50226_10059943 269
422 3300003771 Ga0055526_1023398 Ga0055526_10233982 269
423 3300003773 Ga0055537_1006130 Ga0055537_10061302 269
424 3300003773 Ga0055537_1011114 Ga0055537_10111141 269
425 3300003791 Ga0055530_10021896 Ga0055530_100218962 269
426 3300003794 Ga0055531_10029385 Ga0055531_100293852 269
427 3300005539 Ga0068853_100356925 Ga0068853_1003569252 269
428 3300005844 Ga0068862_100547560 Ga0068862_1005475602 269
429 3300025208 Ga0209436_100185 Ga0209436_10018517 269
430 3300025245 Ga0207425_1000194 Ga0207425_100019427 269
431 3300025258 Ga0209129_1003698 Ga0209129_10036984 269
432 3300025263 Ga0209565_1000567 Ga0209565_10005675 269
433 3300025263 Ga0209565_1008589 Ga0209565_10085892 269
434 3300025273 Ga0209673_1012814 Ga0209673_10128142 269
435 3300025284 Ga0209130_1003585 Ga0209130_10035853 269
436 3300025291 Ga0209675_1000496 Ga0209675_100049625 269
437 3300025291 Ga0209675_1001691 Ga0209675_10016914 269
438 3300025295 Ga0209564_1002158 Ga0209564_10021587 269
439 3300025298 Ga0209050_1000334 Ga0209050_100033469 269
440 3300025298 Ga0209050_1002940 Ga0209050_10029408 269
441 3300025299 Ga0209256_1000867 Ga0209256_100086715 269
442 3300025302 Ga0207426_1015931 Ga0207426_10159313 269
443 3300025304 Ga0209257_1000010 Ga0209257_10000101035 269
444 3300025304 Ga0209257_1001145 Ga0209257_100114512 269
445 3300025304 Ga0209257_1005235 Ga0209257_10052359 269
446 3300026089 Ga0207648_10014198 Ga0207648_100141986 269
447 3300046507 Ga0495606_0003205 Ga0495606_0003205_6302_7204 269
448 3300046515 Ga0495620_0036343 Ga0495620_0036343_96_971 269
449 3300046558 Ga0495633_0000504 Ga0495633_0000504_16539_17438 269
450 3300048091 Ga0495626_0002799 Ga0495626_0002799_6822_7736 269
451 3300048917 Ga0496114_0171012 Ga0496114_0171012_18_893 269
452 3300049744 Ga0501083_0175125 Ga0501083_0175125_219_1082 269
453 3300005455 Ga0070663_100023584 Ga0070663_1000235844 270
454 3300014326 Ga0157380_10233061 Ga0157380_102330611 270
455 3300021361 Ga0213872_10000002 Ga0213872_10000002214 270
456 3300021361 Ga0213872_10011283 Ga0213872_100112833 270
457 3300026067 Ga0207678_10180384 Ga0207678_101803842 270
458 3300027312 Ga0209371_1005182 Ga0209371_10051823 270
459 3300030500 Ga0268256_1004951 Ga0268256_10049513 270
460 3300031344 Ga0265316_10002022 Ga0265316_1000202215 270
461 3300031995 Ga0307409_100056148 Ga0307409_1000561482 270
462 3300032002 Ga0307416_100008120 Ga0307416_1000081206 270
463 3300035111 Ga0373923_0077063 Ga0373923_0077063_592_1413 270
464 3300035172 Ga0373955_0032133 Ga0373955_0032133_729_1550 270
465 3300035724 Ga0373933_0000433 Ga0373933_0000433_9796_10617 270
466 3300036401 Ga0373937_0180969 Ga0373937_0180969_275_1096 270
467 3300039447 Ga0436361_0376382 Ga0436361_0376382_16593_17486 270
468 3300049521 Ga0501298_008518 Ga0501298_008518_422_1276 270
469 3300049522 Ga0501299_006177 Ga0501299_006177_197_1051 270
470 3300061719 Ga0466962_0005534 Ga0466962_0005534_5203_6048 270
471 iso_pu_bacteria 8055431914 8055434641 270
472 3300003775 Ga0055524_1002727 Ga0055524_10027273 271
473 3300025913 Ga0207695_10062140 Ga0207695_100621402 271
474 3300031235 Ga0265330_10046224 Ga0265330_100462241 271
475 3300031235 Ga0265330_10071023 Ga0265330_100710232 271
476 3300031344 Ga0265316_10115609 Ga0265316_101156092 271
477 3300031712 Ga0265342_10042643 Ga0265342_100426433 271
478 3300035112 Ga0373932_0087824 Ga0373932_0087824_35_880 271
479 3300009098 Ga0105245_10003919 Ga0105245_1000391911 272
480 3300009174 Ga0105241_10228278 Ga0105241_102282782 272
481 3300009177 Ga0105248_10025660 Ga0105248_100256602 272
482 3300009551 Ga0105238_10015716 Ga0105238_100157162 272
483 3300011119 Ga0105246_10037637 Ga0105246_100376372 272
484 3300013296 Ga0157374_10029027 Ga0157374_100290272 272
485 3300013296 Ga0157374_10121398 Ga0157374_101213982 272
486 3300025911 Ga0207654_10134583 Ga0207654_101345831 272
487 3300025924 Ga0207694_10125260 Ga0207694_101252602 272
488 3300025927 Ga0207687_10001193 Ga0207687_1000119312 272
489 3300025941 Ga0207711_10071074 Ga0207711_100710743 272
490 3300026035 Ga0207703_10057161 Ga0207703_100571612 272
491 3300031239 Ga0265328_10008414 Ga0265328_100084143 272
492 3300031250 Ga0265331_10000033 Ga0265331_100000332 272
493 iso_pu_bacteria 2739367756 2739790423 272
494 3300027907 Ga0207428_10129183 Ga0207428_101291831 273
495 3300049590 Ga0501074_0006021 Ga0501074_0006021_6269_7195 273
496 3300049592 Ga0501076_0127402 Ga0501076_0127402_559_1434 273
497 3300050511 nmdc:mga08y16_211269_c1 nmdc:mga08y16_211269_c1_985_1830 273
498 3300005327 Ga0070658_10085663 Ga0070658_100856632 274
499 3300005548 Ga0070665_100058176 Ga0070665_1000581764 274
500 3300005937 Ga0081455_10092498 Ga0081455_100924982 274
501 3300006353 Ga0075370_10061001 Ga0075370_100610012 274
502 3300009551 Ga0105238_10001468 Ga0105238_1000146818 274
503 3300025924 Ga0207694_10000494 Ga0207694_1000049418 274
504 3300026088 Ga0207641_10308179 Ga0207641_103081792 274
505 3300027907 Ga0207428_10031452 Ga0207428_100314522 274
506 3300028379 Ga0268266_10003139 Ga0268266_1000313915 274
507 3300032126 Ga0307415_100124547 Ga0307415_1001245472 274
508 3300036401 Ga0373937_0322753 Ga0373937_0322753_377_1264 274
509 3300048929 Ga0496126_0107694 Ga0496126_0107694_938_1792 274
510 3300049742 Ga0501080_0003701 Ga0501080_0003701_12305_13153 274
511 3300049744 Ga0501083_0006625 Ga0501083_0006625_1001_1849 274
512 3300005331 Ga0070670_100287224 Ga0070670_1002872242 275
513 3300005347 Ga0070668_100270328 Ga0070668_1002703282 275
514 3300005355 Ga0070671_100000590 Ga0070671_1000005903 275
515 3300005455 Ga0070663_100038760 Ga0070663_1000387602 275
516 3300005843 Ga0068860_100149645 Ga0068860_1001496452 275
517 3300005844 Ga0068862_100159585 Ga0068862_1001595852 275
518 3300009093 Ga0105240_10000801 Ga0105240_1000080118 275
519 3300009093 Ga0105240_10002598 Ga0105240_1000259810 275
520 3300009177 Ga0105248_10012891 Ga0105248_100128913 275
521 3300010375 Ga0105239_10000902 Ga0105239_1000090210 275
522 3300013104 Ga0157370_10180329 Ga0157370_101803292 275
523 3300013306 Ga0163162_10050180 Ga0163162_100501803 275
524 3300015684 Ga0183365_10006 Ga0183365_10006123 275
525 3300025903 Ga0207680_10002109 Ga0207680_100021093 275
526 3300025910 Ga0207684_10165263 Ga0207684_101652632 275
527 3300025913 Ga0207695_10000100 Ga0207695_10000100186 275
528 3300025913 Ga0207695_10002253 Ga0207695_1000225317 275
529 3300025923 Ga0207681_10001139 Ga0207681_1000113920 275
530 3300025931 Ga0207644_10000426 Ga0207644_100004263 275
531 3300025941 Ga0207711_10010295 Ga0207711_100102953 275
532 3300026067 Ga0207678_10055108 Ga0207678_100551084 275
533 3300026116 Ga0207674_10104173 Ga0207674_101041733 275
534 3300028381 Ga0268264_10085987 Ga0268264_100859873 275
535 3300031507 Ga0307509_10060191 Ga0307509_100601912 275
536 3300031548 Ga0307408_100058237 Ga0307408_1000582372 275
537 3300032002 Ga0307416_100019732 Ga0307416_1000197322 275
538 3300032005 Ga0307411_10004105 Ga0307411_100041055 275
539 3300037418 Ga0395900_0015441 Ga0395900_0015441_2658_3494 275
540 3300037471 Ga0395905_0008044 Ga0395905_0008044_8505_9341 275
541 3300038443 Ga0395901_0008125 Ga0395901_0008125_4781_5617 275
542 3300041507 Ga0451851_0902098 Ga0451851_0902098_130_993 275
543 3300044656 Ga0466969_0000233 Ga0466969_0000233_12558_13403 275
544 3300044684 Ga0466966_0000394 Ga0466966_0000394_19449_20294 275
545 3300044684 Ga0466966_0027984 Ga0466966_0027984_1613_2449 275
546 3300044693 Ga0466961_0002305 Ga0466961_0002305_3822_4667 275
547 3300044719 Ga0466971_0001686 Ga0466971_0001686_3557_4402 275
548 3300044765 Ga0466970_0023173 Ga0466970_0023173_132_977 275
549 3300044842 Ga0466957_0001431 Ga0466957_0001431_2009_2854 275
550 3300045049 Ga0466959_0000532 Ga0466959_0000532_18456_19301 275
551 3300045049 Ga0466959_0012403 Ga0466959_0012403_4042_4878 275
552 3300045836 Ga0466958_0001234 Ga0466958_0001234_4730_5575 275
553 3300048904 Ga0496101_0089988 Ga0496101_0089988_943_1782 275
554 3300048905 Ga0496102_0126102 Ga0496102_0126102_828_1685 275
555 3300048907 Ga0496104_0001832 Ga0496104_0001832_15033_15890 275
556 3300048907 Ga0496104_0026152 Ga0496104_0026152_1347_2186 275
557 3300048908 Ga0496105_0007137 Ga0496105_0007137_5021_5860 275
558 3300048909 Ga0496106_0256743 Ga0496106_0256743_172_1029 275
559 3300048914 Ga0496111_0124203 Ga0496111_0124203_900_1739 275
560 3300048918 Ga0496115_0000980 Ga0496115_0000980_8083_8940 275
561 3300048919 Ga0496116_0029678 Ga0496116_0029678_826_1683 275
562 3300048920 Ga0496117_0006842 Ga0496117_0006842_939_1796 275
563 3300048920 Ga0496117_0013917 Ga0496117_0013917_2233_3090 275
564 3300048921 Ga0496118_0002972 Ga0496118_0002972_19056_19913 275
565 3300048921 Ga0496118_0029704 Ga0496118_0029704_2655_3512 275
566 3300048922 Ga0496119_0000094 Ga0496119_0000094_47270_48127 275
567 3300048922 Ga0496119_0004735 Ga0496119_0004735_11426_12283 275
568 3300048923 Ga0496120_0000013 Ga0496120_0000013_282939_283796 275
569 3300048923 Ga0496120_0000183 Ga0496120_0000183_21367_22224 275
570 3300048924 Ga0496121_0000630 Ga0496121_0000630_19345_20202 275
571 3300048924 Ga0496121_0021640 Ga0496121_0021640_482_1339 275
572 3300048929 Ga0496126_0000301 Ga0496126_0000301_11844_12701 275
573 3300049571 Ga0501034_0020542 Ga0501034_0020542_3825_4670 275
574 3300049571 Ga0501034_0058694 Ga0501034_0058694_1028_1873 275
575 3300049585 Ga0501069_0222135 Ga0501069_0222135_125_964 275
576 3300053080 Ga0500635_0000378 Ga0500635_0000378_2638_3483 275
577 3300053122 Ga0500608_000394 Ga0500608_000394_15875_16720 275
578 3300061719 Ga0466962_0001935 Ga0466962_0001935_3430_4275 275
579 iso_pu_bacteria 2816332336 2817616615 275
580 3300003187 JGI25151J46595_10000020 JGI25151J46595_10000020253 276
581 3300003578 Ga0006562J51391_1001282 Ga0006562J51391_10012822 276
582 3300005530 Ga0070679_100017058 Ga0070679_1000170583 276
583 3300005548 Ga0070665_100193325 Ga0070665_1001933253 276
584 3300005564 Ga0070664_100004468 Ga0070664_10000446812 276
585 3300006042 Ga0075368_10005369 Ga0075368_100053695 276
586 3300006051 Ga0075364_10019701 Ga0075364_100197015 276
587 3300006178 Ga0075367_10001045 Ga0075367_1000104510 276
588 3300006353 Ga0075370_10051555 Ga0075370_100515552 276
589 3300009093 Ga0105240_10002841 Ga0105240_1000284111 276
590 3300010375 Ga0105239_10218134 Ga0105239_102181342 276
591 3300021377 Ga0213874_10001677 Ga0213874_100016773 276
592 3300021384 Ga0213876_10000341 Ga0213876_1000034125 276
593 3300025294 Ga0209025_1000001 Ga0209025_10000011677 276
594 3300025912 Ga0207707_10154221 Ga0207707_101542212 276
595 3300025913 Ga0207695_10004342 Ga0207695_1000434216 276
596 3300025913 Ga0207695_10026901 Ga0207695_100269014 276
597 3300028379 Ga0268266_10162984 Ga0268266_101629842 276
598 3300028573 Ga0265334_10065939 Ga0265334_100659392 276
599 3300028800 Ga0265338_10046126 Ga0265338_100461264 276
600 3300028800 Ga0265338_10088262 Ga0265338_100882623 276
601 3300031235 Ga0265330_10020254 Ga0265330_100202542 276
602 3300031251 Ga0265327_10002372 Ga0265327_1000237216 276
603 3300031344 Ga0265316_10000641 Ga0265316_1000064127 276
604 3300031344 Ga0265316_10025040 Ga0265316_100250403 276
605 3300031712 Ga0265342_10022523 Ga0265342_100225234 276
606 3300031731 Ga0307405_10508448 Ga0307405_105084481 276
607 3300037853 Ga0436364_1071482 Ga0436364_1071482_417_1256 276
608 3300039437 Ga0436365_1702191 Ga0436365_1702191_66988_67827 276
609 3300039450 Ga0436363_0602923 Ga0436363_0602923_1082_1921 276
610 3300045051 Ga0451576_0042648 Ga0451576_0042648_3807_4646 276
611 3300047320 Ga0495672_0002885 Ga0495672_0002885_2688_3542 276
612 3300049589 Ga0501073_0205551 Ga0501073_0205551_306_1166 276
613 3300050490 nmdc:mga03n38_137779_c1 nmdc:mga03n38_137779_c1_131_979 276
614 3300050491 nmdc:mga00v17_15794_c1 nmdc:mga00v17_15794_c1_3217_4062 276
615 3300050495 nmdc:mga04h51_37250_c1 nmdc:mga04h51_37250_c1_673_1518 276
616 3300050496 nmdc:mga07m45_5477_c1 nmdc:mga07m45_5477_c1_4192_5040 276
617 iso_pu_bacteria 2554235283 2555470063 276
618 iso_pu_bacteria 2643221638 2644213741 276
619 iso_pu_bacteria 2643221645 2644253868 276
620 iso_pu_bacteria 2643221735 2644739551 276
621 iso_pu_bacteria 2738541280 2738742930 276
622 iso_pu_bacteria 2738541297 2738825129 276
623 iso_pu_bacteria 2738541300 2738844618 276
624 iso_pu_bacteria 2738541357 2739148926 276
625 iso_pu_bacteria 2738543003 2739190845 276
626 iso_pu_bacteria 2738543018 2739276142 276
627 iso_pu_bacteria 2738543026 2739317322 276
628 iso_pu_bacteria 2738543029 2739335563 276
629 iso_pu_bacteria 2738543030 2739345334 276
630 iso_pu_bacteria 2811994870 2812315572 276
631 iso_pu_bacteria 2818991468 2819724341 276
632 iso_pu_bacteria 2821131069 2821133727 276
633 iso_pu_bacteria 2823526263 2823527564 276
634 iso_pu_bacteria 2842711865 2842717210 276
635 iso_pu_bacteria 2857553236 2857553830 276
636 iso_pu_bacteria 2857558681 2857560378 276
637 iso_pu_bacteria 2857564685 2857565519 276
638 iso_pu_bacteria 2904424332 2904430575 276
639 iso_pu_bacteria 2919093281 2919093652 276
640 iso_pu_bacteria 2919476304 2919480454 276
641 iso_pu_bacteria 2954773129 2954774940 276
642 3300005467 Ga0070706_100008439 Ga0070706_1000084394 277
643 3300005471 Ga0070698_100003217 Ga0070698_1000032178 277
644 3300005518 Ga0070699_100542669 Ga0070699_1005426691 277
645 3300005536 Ga0070697_100203613 Ga0070697_1002036132 277
646 3300005548 Ga0070665_100127540 Ga0070665_1001275403 277
647 3300005937 Ga0081455_10002830 Ga0081455_1000283014 277
648 3300006177 Ga0075362_10028149 Ga0075362_100281493 277
649 3300007788 Ga0099795_10043411 Ga0099795_100434112 277
650 3300010159 Ga0099796_10088019 Ga0099796_100880192 277
651 3300021441 Ga0213871_10039646 Ga0213871_100396462 277
652 3300025910 Ga0207684_10001346 Ga0207684_100013465 277
653 3300025910 Ga0207684_10223740 Ga0207684_102237402 277
654 3300028379 Ga0268266_10052984 Ga0268266_100529843 277
655 3300039438 Ga0436360_0130330 Ga0436360_0130330_3125_3967 277
656 3300039447 Ga0436361_0781398 Ga0436361_0781398_864_1706 277
657 3300044683 Ga0466965_0074305 Ga0466965_0074305_335_1183 277
658 3300044712 Ga0453684_0220885 Ga0453684_0220885_656_1498 277
659 3300044735 Ga0466968_0034669 Ga0466968_0034669_456_1292 277
660 3300048929 Ga0496126_0034111 Ga0496126_0034111_2179_3021 277
661 iso_pu_bacteria 2509276033 2509448461 277
662 iso_pu_bacteria 2510461076 2510900230 277
663 iso_pu_bacteria 2513237084 2513569640 277
664 iso_pu_bacteria 2513237088 2513595056 277
665 iso_pu_bacteria 2513237162 2514018778 277
666 iso_pu_bacteria 2515154114 2515642481 277
667 iso_pu_bacteria 2515154116 2515658458 277
668 iso_pu_bacteria 2517287029 2517410843 277
669 iso_pu_bacteria 2524023209 2524457169 277
670 iso_pu_bacteria 2534681796 2535520006 277
671 iso_pu_bacteria 2582581299 2585229329 277
672 iso_pu_bacteria 2582581304 2585255310 277
673 iso_pu_bacteria 2582581867 2585401682 277
674 iso_pu_bacteria 2585427590 2585821377 277
675 iso_pu_bacteria 2615840624 2616295211 277
676 iso_pu_bacteria 2643221618 2644104280 277
677 iso_pu_bacteria 2643221626 2644151284 277
678 iso_pu_bacteria 2643221634 2644196312 277
679 iso_pu_bacteria 2643221655 2644313272 277
680 iso_pu_bacteria 2643221664 2644356641 277
681 iso_pu_bacteria 2643221698 2644547194 277
682 iso_pu_bacteria 2718217927 2719388445 277
683 iso_pu_bacteria 2718218233 2720616327 277
684 iso_pu_bacteria 2718218235 2720629402 277
685 iso_pu_bacteria 2718218269 2720771973 277
686 iso_pu_bacteria 2718218423 2721403068 277
687 iso_pu_bacteria 2721755685 2723571000 277
688 iso_pu_bacteria 2721755809 2724035425 277
689 iso_pu_bacteria 2721755819 2724086793 277
690 iso_pu_bacteria 2721755822 2724106951 277
691 iso_pu_bacteria 2775507266 2778174641 277
692 iso_pu_bacteria 2791355259 2793317205 277
693 iso_pu_bacteria 2791355260 2793324044 277
694 iso_pu_bacteria 2791355265 2793355465 277
695 iso_pu_bacteria 2791355267 2793366535 277
696 iso_pu_bacteria 2802429605 2805929056 277
697 iso_pu_bacteria 2802429606 2805937242 277
698 iso_pu_bacteria 2821443989 2821450150 277
699 iso_pu_bacteria 2838042994 2838045950 277
700 iso_pu_bacteria 2838068647 2838071813 277
701 iso_pu_bacteria 2838668709 2838671494 277
702 iso_pu_bacteria 2838701080 2838704239 277
703 iso_pu_bacteria 2841864319 2841869761 277
704 iso_pu_bacteria 2842146304 2842149143 277
705 iso_pu_bacteria 2842192696 2842195261 277
706 iso_pu_bacteria 2842250916 2842253690 277
707 iso_pu_bacteria 2842298080 2842299277 277
708 iso_pu_bacteria 2842311132 2842311762 277
709 iso_pu_bacteria 2842317721 2842319003 277
710 iso_pu_bacteria 2842341865 2842343999 277
711 iso_pu_bacteria 2842357229 2842358744 277
712 iso_pu_bacteria 2842363717 2842369689 277
713 iso_pu_bacteria 2842395702 2842396360 277
714 iso_pu_bacteria 2842422224 2842425446 277
715 iso_pu_bacteria 2842489311 2842491453 277
716 iso_pu_bacteria 2842495871 2842499521 277
717 iso_pu_bacteria 2844163670 2844170239 277
718 iso_pu_bacteria 2844533157 2844538525 277
719 iso_pu_bacteria 2857547612 2857547748 277
720 iso_pu_bacteria 2885080285 2885086198 277
721 iso_pu_bacteria 2933016740 2933017619 277
722 iso_pu_bacteria 2933599457 2933602608 277
723 iso_pu_bacteria 2936381700 2936384145 277
724 iso_pu_bacteria 2996887358 2996888646 277
725 iso_pu_bacteria 3005409236 3005416281 277
726 iso_pu_bacteria 8005258706 8005264422 277
727 iso_pu_bacteria 8005275841 8005277160 277
728 iso_pu_bacteria 8005282627 8005287831 277
729 iso_pu_bacteria 8005289223 8005290664 277
730 iso_pu_bacteria 8005301065 8005305014 277
731 iso_pu_bacteria 8005321885 8005323173 277
732 iso_pu_bacteria 8005382845 8005388470 277
733 iso_pu_bacteria 8005542996 8005547736 277
734 iso_pu_bacteria 8005626139 8005630624 277
735 iso_pu_bacteria 8005688590 8005689442 277
736 iso_pu_bacteria 8005695170 8005701928 277
737 iso_pu_bacteria 8018127388 8018130444 277
738 iso_pu_bacteria 8024501048 8024505586 277
739 iso_pu_bacteria 8056375014 8056375182 277
740 3300005295 Ga0065707_10004891 Ga0065707_100048914 278
741 3300005546 Ga0070696_100011533 Ga0070696_1000115333 278
742 3300006844 Ga0075428_100572791 Ga0075428_1005727912 278
743 3300009093 Ga0105240_10011164 Ga0105240_1001116410 278
744 3300009098 Ga0105245_10346276 Ga0105245_103462762 278
745 3300025913 Ga0207695_10010977 Ga0207695_100109778 278
746 3300025927 Ga0207687_10094149 Ga0207687_100941492 278
747 3300027907 Ga0207428_10000016 Ga0207428_10000016221 278
748 3300031548 Ga0307408_100035461 Ga0307408_1000354612 278
749 3300031852 Ga0307410_10019021 Ga0307410_100190212 278
750 3300031995 Ga0307409_100011518 Ga0307409_1000115185 278
751 3300032002 Ga0307416_100039677 Ga0307416_1000396771 278
752 3300037853 Ga0436364_0027492 Ga0436364_0027492_451_1335 278
753 3300048917 Ga0496114_0014908 Ga0496114_0014908_5279_6181 278
754 3300049570 Ga0501033_0000973 Ga0501033_0000973_10559_11425 278
755 3300005356 Ga0070674_100071499 Ga0070674_1000714993 279
756 3300005547 Ga0070693_100219453 Ga0070693_1002194532 279
757 3300005617 Ga0068859_100498424 Ga0068859_1004984242 279
758 3300005843 Ga0068860_100549368 Ga0068860_1005493682 279
759 3300006931 Ga0097620_100498413 Ga0097620_1004984132 279
760 3300025937 Ga0207669_10049403 Ga0207669_100494032 279
761 3300026035 Ga0207703_10583023 Ga0207703_105830232 279
762 3300026067 Ga0207678_10315163 Ga0207678_103151632 279
763 3300028381 Ga0268264_10525989 Ga0268264_105259892 279
764 3300041462 Ga0451806_785562 Ga0451806_785562_940_1785 279
765 3300042005 Ga0439448_0041547 Ga0439448_0041547_399_1244 279
766 3300046492 Ga0495585_0061949 Ga0495585_0061949_349_1221 279
767 3300046665 Ga0495661_0086124 Ga0495661_0086124_245_1117 279
768 3300048924 Ga0496121_0290568 Ga0496121_0290568_121_966 279
769 iso_pu_bacteria 2508501122 2509112282 279
770 iso_pu_bacteria 2509276019 2509379407 279
771 iso_pu_bacteria 2558860100 2558861464 279
772 iso_pu_bacteria 2582581298 2585221610 279
773 iso_pu_bacteria 2585427529 2585544220 279
774 iso_pu_bacteria 2751185821 2753459467 279
775 iso_pu_bacteria 2791355082 2792580476 279
776 iso_pu_bacteria 2791355091 2792619483 279
777 iso_pu_bacteria 2791355092 2792627254 279
778 iso_pu_bacteria 2791355094 2792639849 279
779 iso_pu_bacteria 2838074704 2838077735 279
780 iso_pu_bacteria 2848992105 2848997532 279
781 iso_pu_bacteria 2850079185 2850084568 279
782 iso_pu_bacteria 2855872281 2855874062 279
783 iso_pu_bacteria 2913295892 2913296778 279
784 iso_pu_bacteria 2919100787 2919103471 279
785 iso_pu_bacteria 2920760137 2920765011 279
786 iso_pu_bacteria 643692032 643823028 279
787 3300001915 JGI24741J21665_1008774 JGI24741J21665_10087742 280
788 3300001979 JGI24740J21852_10003236 JGI24740J21852_100032367 280
789 3300001989 JGI24739J22299_10002034 JGI24739J22299_100020347 280
790 3300001990 JGI24737J22298_10001992 JGI24737J22298_100019923 280
791 3300002067 JGI24735J21928_10003090 JGI24735J21928_100030902 280
792 3300002075 JGI24738J21930_10000645 JGI24738J21930_100006454 280
793 3300002987 JGI25159J45721_1015701 JGI25159J45721_10157012 280
794 3300003187 JGI25151J46595_10003913 JGI25151J46595_100039134 280
795 3300003354 JGI25160J50197_1005140 JGI25160J50197_10051402 280
796 3300005339 Ga0070660_100512414 Ga0070660_1005124141 280
797 3300005344 Ga0070661_100363718 Ga0070661_1003637181 280
798 3300005354 Ga0070675_100218513 Ga0070675_1002185132 280
799 3300005356 Ga0070674_100029433 Ga0070674_1000294333 280
800 3300005366 Ga0070659_100052683 Ga0070659_1000526832 280
801 3300005466 Ga0070685_10065244 Ga0070685_100652442 280
802 3300005578 Ga0068854_100235144 Ga0068854_1002351442 280
803 3300005614 Ga0068856_100285460 Ga0068856_1002854602 280
804 3300005834 Ga0068851_10071946 Ga0068851_100719462 280
805 3300009147 Ga0114129_10310753 Ga0114129_103107532 280
806 3300009174 Ga0105241_10209974 Ga0105241_102099742 280
807 3300013104 Ga0157370_10070523 Ga0157370_100705235 280
808 3300013105 Ga0157369_10097376 Ga0157369_100973762 280
809 3300013297 Ga0157378_10006462 Ga0157378_100064624 280
810 3300013308 Ga0157375_10003062 Ga0157375_1000306211 280
811 3300021388 Ga0213875_10000460 Ga0213875_1000046030 280
812 3300021388 Ga0213875_10146348 Ga0213875_101463482 280
813 3300025284 Ga0209130_1000641 Ga0209130_10006419 280
814 3300025294 Ga0209025_1000114 Ga0209025_10001146 280
815 3300025297 Ga0209758_1010720 Ga0209758_10107206 280
816 3300025302 Ga0207426_1000191 Ga0207426_100019118 280
817 3300025321 Ga0207656_10041741 Ga0207656_100417412 280
818 3300025904 Ga0207647_10004347 Ga0207647_100043479 280
819 3300025909 Ga0207705_10038813 Ga0207705_100388133 280
820 3300025911 Ga0207654_10001265 Ga0207654_1000126517 280
821 3300025919 Ga0207657_10045847 Ga0207657_100458473 280
822 3300025924 Ga0207694_10005875 Ga0207694_100058759 280
823 3300025933 Ga0207706_10049085 Ga0207706_100490852 280
824 3300025937 Ga0207669_10217619 Ga0207669_102176192 280
825 3300025945 Ga0207679_10102417 Ga0207679_101024172 280
826 3300025949 Ga0207667_10010207 Ga0207667_100102074 280
827 3300026041 Ga0207639_10023607 Ga0207639_100236074 280
828 3300026067 Ga0207678_10011901 Ga0207678_100119015 280
829 3300026078 Ga0207702_10000462 Ga0207702_100004629 280
830 3300026116 Ga0207674_10111656 Ga0207674_101116562 280
831 3300026142 Ga0207698_10024215 Ga0207698_100242152 280
832 3300031250 Ga0265331_10000178 Ga0265331_1000017836 280
833 3300031251 Ga0265327_10012156 Ga0265327_100121565 280
834 3300037853 Ga0436364_0043906 Ga0436364_0043906_16955_17812 280
835 3300041997 Ga0439431_0008710 Ga0439431_0008710_962_1852 280
836 3300046694 Ga0495649_0066728 Ga0495649_0066728_217_1107 280
837 3300048916 Ga0496113_0205649 Ga0496113_0205649_212_1102 280
838 3300053153 Ga0500616_0128134 Ga0500616_0128134_155_1048 280
839 3300053730 Ga0500645_023462 Ga0500645_023462_629_1519 280
840 iso_pu_bacteria 2932416698 2932419867 280

Structural Annotation

Top 5 Hits

ID Description Score Start End
3d31-assembly1.cif.gz_C modbc from methanosarcina acetivorans 0.9107 11 263
3d31-assembly1.cif.gz_C modbc from methanosarcina acetivorans 0.9004 11 263
2onk-assembly2.cif.gz_I abc transporter modbc in complex with its binding protein moda 0.892 12 267
2onk-assembly2.cif.gz_I abc transporter modbc in complex with its binding protein moda 0.8789 12 267
7cad-assembly1.cif.gz_A mycobacterium smegmatis sugabc complex 0.8706 13 266
ID Description Score Start End Superfamily
af_P0AEB0_20_277_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.976 17 270 1.10.3720.10
af_P0AEB0_20_277_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9575 17 270 1.10.3720.10
af_P71746_10_267_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9408 17 272 1.10.3720.10
af_P71745_27_277_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.936 18 270 1.10.3720.10
af_P16701_14_273_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9318 15 273 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A3S0KK22-F1-model_v4 Sulfate ABC transporter permease subunit CysW 0.9793 14 273 GO:0005886
GO:0015419
AF-A0A150UHH8-F1-model_v4 Sulfate/thiosulfate transporter permease subunit 0.9784 8 220 GO:0005886
GO:0015419
AF-A0A150P8Q5-F1-model_v4 Sulfate/thiosulfate transporter permease subunit 0.9771 30 274 GO:0005886
GO:0015419
AF-A0A379NCI9-F1-model_v4 deleted 0.9768 14 277
AF-A0A2J6MNT8-F1-model_v4 Sulfate ABC transporter permease subunit CysW 0.9762 7 270 GO:0005886
GO:0015419

Feature Viewer

pLDDT pTM Quality
87.27 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map