F482398

General Info

Members Datasets Scaffolds Average Seq Length
824 409 798 284

Family's Representative Sequence

Representative Sequence 3300042015|Ga0439462_0007287|Ga0439462_0007287_1797_2642
Length 281
Sequence MFRKTYHATHPDMMVGASNDQLRERYLIDGLFVPGQVVLNYSHNERFVIGGAAPTTAPVSLPQQTEPASAAGKPFLERRELGIVNVGAGTGTVTVDGASFTLAPKDGLYVPMGSSDVQFASNDAATPAKFYLASTPAHARFEAKHISIAQAVPLERGALETSNERTIYQYIVPATCKSCQLLLGLTVLKTGSVWNTMPPHLHDRRSEVYFYFDLGDQSVMHFMGEPADMRHLVIRNDEAVVSPPWSIHMGSGTRNYCFIWAMGGENLDYTDMHQLDLCQLK

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2582581280 Caulobacter henricii CF287 Isolate Rhizosphere
3 2582581293 Caulobacter henricii YR570 Isolate Rhizosphere
4 2643221552 Caulobacter sp. Root1472 Isolate Unclassified
5 2643221559 Lysobacter sp. Root559 Isolate Unclassified
6 2643221573 Lysobacter sp. Root604 Isolate Unclassified
7 2643221583 Caulobacter sp. Root655 Isolate Unclassified
8 2643221584 Caulobacter sp. Root656 Isolate Unclassified
9 2643221586 Lysobacter sp. Root667 Isolate Unclassified
10 2643221612 Lysobacter sp. Root76 Isolate Unclassified
11 2643221691 Caulobacter sp. Root487D2Y Isolate Unclassified
12 2643221720 Lysobacter sp. Root916 Isolate Unclassified
13 2643221727 Lysobacter sp. Root96 Isolate Unclassified
14 2643221728 Lysobacter sp. Root983 Isolate Unclassified
15 2739367756 Asticcacaulis sp. CF398 Isolate Unclassified
16 2747842501 Xanthomonas sp. WCS2014-23 Isolate Unclassified
17 2818991435 Caulobacter henricii 536 Isolate Unclassified
18 2818991454 Caulobacter rhizosphaerae 3260 Isolate Rhizosphere
19 2818991457 Xanthomonas translucens 569 Isolate Unclassified
20 2852684882 Xanthomonas sp. JAI131 Isolate Rhizosphere
21 2919130084 Xanthomonas sp. 1678 Isolate Rhizosphere
22 2928972540 Brevundimonas sp. 1080 Isolate Rhizosphere
23 2929195423 Xanthomonas sp. R-73098 Hybrid assembly Isolate Unclassified
24 2977240413 Brevundimonas vesicularis SORGH_AS 431 Isolate Unclassified
25 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
26 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
27 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
28 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
29 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
30 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
31 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
32 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
33 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
34 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
35 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
36 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
37 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
38 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
39 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
40 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
41 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
42 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
43 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
44 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
45 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
46 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
47 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
48 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
49 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
50 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
51 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
52 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
53 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
54 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
55 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
56 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
57 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
58 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
59 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
60 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
61 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
62 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
63 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
64 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
65 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
66 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
67 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
68 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
69 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
70 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
71 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
72 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
73 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
74 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
75 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
76 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
77 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
78 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
79 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
80 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
81 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
82 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
83 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
84 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
85 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
86 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
87 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
88 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
89 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
90 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
91 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
92 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
93 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
94 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
95 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
96 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
97 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
98 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
99 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
100 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
101 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
102 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
103 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
104 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
105 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
106 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
107 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
108 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
109 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
110 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
111 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
112 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
113 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
114 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
115 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
116 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
117 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
118 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
119 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
120 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
121 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
122 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
123 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
124 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
125 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
126 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
127 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
128 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
129 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
130 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
131 3300015684 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.2_F02 Metagenome Unclassified
132 3300015689 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 Metagenome Rhizosphere
133 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
134 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
135 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
136 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
138 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
139 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
140 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
141 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
142 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
143 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
144 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
145 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
146 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
147 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
148 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
149 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
150 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
151 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
152 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
153 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
154 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
155 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
192 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
193 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
194 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
195 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
199 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
200 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
201 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
202 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
203 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
204 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
205 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
206 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
207 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
208 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
209 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
210 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
211 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
212 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
213 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
214 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
215 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
216 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
217 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
218 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
219 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
220 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
221 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
222 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
223 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
224 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
225 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
226 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
227 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
228 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
229 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
230 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
231 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
232 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
233 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
234 3300039145 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 Metagenome Unclassified
235 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
236 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
237 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
238 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
239 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
240 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
241 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
242 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
243 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
244 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
245 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
246 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
247 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
248 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
249 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
250 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
251 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
252 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
253 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
254 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
255 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
256 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
257 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
258 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
259 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
260 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
261 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
262 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
263 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
264 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
265 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
266 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
267 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
268 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
269 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
270 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
271 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
272 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
273 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
274 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
275 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
276 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
277 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
278 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
279 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
280 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
281 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
282 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
283 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
284 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
285 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
286 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
287 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
288 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
289 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
290 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
291 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
292 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
293 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
294 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
295 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
296 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
297 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
298 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
299 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
300 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
301 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
302 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
303 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
304 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
305 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
306 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
307 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
308 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
309 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
310 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
311 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
312 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
313 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
314 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
315 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
316 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
317 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
318 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
319 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
320 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
321 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
322 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
323 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
324 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
325 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
326 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
327 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
328 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
329 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
330 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
331 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
332 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
333 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
334 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
335 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
336 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
337 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
338 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
339 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
340 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
341 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
342 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
343 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
344 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
345 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
346 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
347 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
348 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
349 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
350 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
351 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
352 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
353 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
354 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
355 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
356 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
357 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
358 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
359 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
360 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
361 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
362 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
363 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
364 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
365 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
366 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
367 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
368 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
369 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
370 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
371 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
372 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
373 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
374 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
375 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
376 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
377 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
378 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
379 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
380 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
381 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
382 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
383 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
384 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
385 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
386 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
387 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
388 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
389 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
390 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
391 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
392 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
393 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
394 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
395 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
396 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
397 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
398 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
399 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
400 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
401 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
402 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
403 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
404 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
405 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
406 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
407 8002869464 Pseudoxanthomonas helianthi 110414 Isolate Unclassified
408 8021622325 Xanthomonas sp. LMG12462 Isolate Rhizosphere
409 8021648035 Xanthomonas sp. LMG 12461 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.72
Metatranscriptomes 0.12
Isolates 3.16

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.6
Nodule 0.24
Rhizoplane 2.79
Rhizosphere 71.72
Stem 0
Stem Tuber 0
Unclassified 7.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2926702 2162886007 Bacteria 9446
2 JGI25158J39367_1003149 3300002739 Bacteria 2584
3 JGI25152J39213_1000004 3300002773 Bacteria 191383
4 JGI25152J39213_1000188 3300002773 Bacteria 41653
5 JGI25150J39212_1000338 3300002774 Bacteria 23091
6 JGI25150J39212_1001502 3300002774 Bacteria 6443
7 JGI25150J39212_1014869 3300002774 Bacteria 1310
8 JGI25159J45721_1004310 3300002987 Bacteria 4756
9 JGI25159J45721_1012739 3300002987 Bacteria 1985
10 JGI25151J46595_10000010 3300003187 Bacteria 277507
11 JGI25153J46596_10000013 3300003215 Bacteria 303690
12 rootL2_10027242 3300003322 Bacteria 30675
13 rootL2_10188467 3300003322 Bacteria 1471
14 JGI25160J50197_1019420 3300003354 Bacteria 2083
15 Ga0007409J51694_1027346 3300003575 Bacteria 996
16 Ga0055525_1000008 3300003759 Bacteria 604287
17 Ga0055529_1000421 3300003763 Bacteria 43457
18 Ga0055526_1000025 3300003771 Bacteria 154279
19 Ga0055526_1001631 3300003771 Bacteria 15752
20 Ga0055526_1001917 3300003771 Bacteria 14393
21 Ga0055526_1002815 3300003771 Bacteria 11518
22 Ga0055526_1004482 3300003771 Bacteria 8370
23 Ga0055526_1029113 3300003771 Bacteria 1650
24 Ga0055537_1000004 3300003773 Bacteria 167383
25 Ga0055537_1000340 3300003773 Bacteria 31969
26 Ga0055524_1001695 3300003775 Bacteria 12278
27 Ga0055524_1004092 3300003775 Bacteria 6845
28 Ga0055524_1027176 3300003775 Bacteria 1744
29 Ga0055534_1000069 3300003784 Bacteria 80193
30 Ga0055534_1000216 3300003784 Bacteria 42623
31 Ga0055528_1000141 3300003790 Bacteria 58279
32 Ga0055528_1000203 3300003790 Bacteria 50129
33 Ga0055530_10000166 3300003791 Bacteria 59932
34 Ga0055530_10001740 3300003791 Bacteria 15262
35 Ga0055530_10021404 3300003791 Bacteria 1907
36 Ga0055530_10021642 3300003791 Bacteria 1889
37 Ga0055530_10032757 3300003791 Bacteria 1348
38 Ga0055531_10000053 3300003794 Bacteria 124623
39 Ga0055531_10005918 3300003794 Bacteria 7038
40 Ga0055531_10009486 3300003794 Bacteria 4968
41 Ga0055531_10009495 3300003794 Bacteria 4965
42 Ga0055531_10014313 3300003794 Bacteria 3579
43 Ga0055531_10044908 3300003794 Bacteria 1232
44 Ga0058692_1000118 3300003856 Bacteria 51072
45 Ga0055543_1001580 3300004625 Bacteria 8792
46 Ga0055543_1026194 3300004625 Bacteria 1037
47 Ga0055543_1026202 3300004625 Bacteria 1037
48 Ga0065165_1000003 3300005262 Bacteria 390701
49 Ga0065165_1001826 3300005262 Bacteria 20836
50 Ga0065165_1060666 3300005262 Bacteria 1037
51 Ga0065165_1060668 3300005262 Bacteria 1037
52 Ga0065704_10070417 3300005289 Bacteria 25844
53 Ga0065704_10070983 3300005289 Bacteria 14054
54 Ga0065715_10032639 3300005293 Bacteria 1557
55 Ga0070658_10197790 3300005327 Bacteria 1695
56 Ga0070676_10101877 3300005328 Bacteria 1775
57 Ga0070683_100168049 3300005329 Bacteria 2081
58 Ga0070690_100010591 3300005330 Bacteria 5370
59 Ga0070670_100000769 3300005331 Bacteria 24932
60 Ga0070670_100055571 3300005331 Bacteria 3398
61 Ga0068869_100279216 3300005334 Bacteria 1343
62 Ga0070680_100037517 3300005336 Bacteria 3916
63 Ga0070660_100015374 3300005339 Bacteria 5523
64 Ga0070660_100028787 3300005339 Bacteria 4159
65 Ga0070689_100008730 3300005340 Bacteria 7153
66 Ga0070689_100257008 3300005340 Bacteria 1443
67 Ga0070661_100007078 3300005344 Bacteria 7738
68 Ga0070661_100012297 3300005344 Bacteria 5985
69 Ga0070668_100604702 3300005347 Bacteria 959
70 Ga0070669_100166503 3300005353 Bacteria 1716
71 Ga0070671_100086877 3300005355 Bacteria 2617
72 Ga0070671_100132780 3300005355 Bacteria 2097
73 Ga0070674_100090274 3300005356 Bacteria 2210
74 Ga0070673_100284811 3300005364 Bacteria 1450
75 Ga0070673_100302315 3300005364 Unclassified 1409
76 Ga0070688_100442259 3300005365 Bacteria 970
77 Ga0070659_100010441 3300005366 Bacteria 6830
78 Ga0070667_100118327 3300005367 Bacteria 2303
79 Ga0070667_100125929 3300005367 Bacteria 2232
80 Ga0070701_10002132 3300005438 Bacteria 7527
81 Ga0070700_100045227 3300005441 Bacteria 2715
82 Ga0070694_100036163 3300005444 Bacteria 3270
83 Ga0070678_100191696 3300005456 Bacteria 1681
84 Ga0070662_100009401 3300005457 Bacteria 6389
85 Ga0070681_10015337 3300005458 Bacteria 7624
86 Ga0070681_10230494 3300005458 Bacteria 1766
87 Ga0068867_100009154 3300005459 Bacteria 6988
88 Ga0068867_100210020 3300005459 Bacteria 1563
89 Ga0070685_10122820 3300005466 Bacteria 1614
90 Ga0068853_100013970 3300005539 Bacteria 6568
91 Ga0068853_100290588 3300005539 Bacteria 1509
92 Ga0070672_100002346 3300005543 Bacteria 11965
93 Ga0070686_100048146 3300005544 Bacteria 2700
94 Ga0070695_100040608 3300005545 Bacteria 2946
95 Ga0070693_100032117 3300005547 Bacteria 2884
96 Ga0070665_100003266 3300005548 Bacteria 17393
97 Ga0070704_100002860 3300005549 Bacteria 9785
98 Ga0068855_100113810 3300005563 Bacteria 3103
99 Ga0068855_100131602 3300005563 Bacteria 2857
100 Ga0070664_100055995 3300005564 Bacteria 3350
101 Ga0070664_100092967 3300005564 Bacteria 2612
102 Ga0070664_100239646 3300005564 Unclassified 1628
103 Ga0070664_100461462 3300005564 Bacteria 1167
104 Ga0068857_100462902 3300005577 Bacteria 1187
105 Ga0068852_100093242 3300005616 Bacteria 2699
106 Ga0068852_100162637 3300005616 Bacteria 2085
107 Ga0068852_100749505 3300005616 Bacteria 989
108 Ga0068859_100137172 3300005617 Bacteria 2520
109 Ga0068859_100153093 3300005617 Bacteria 2382
110 Ga0068864_100020869 3300005618 Bacteria 5483
111 Ga0068864_100143407 3300005618 Bacteria 2157
112 Ga0068864_100282600 3300005618 Bacteria 1549
113 Ga0068866_10322072 3300005718 Bacteria 973
114 Ga0068861_100095476 3300005719 Bacteria 2355
115 Ga0068863_100028480 3300005841 Bacteria 5334
116 Ga0068863_100082400 3300005841 Bacteria 3049
117 Ga0068863_100128359 3300005841 Bacteria 2420
118 Ga0068863_100312509 3300005841 Unclassified 1525
119 Ga0068858_100054049 3300005842 Bacteria 3714
120 Ga0068858_100059362 3300005842 Bacteria 3535
121 Ga0068858_100295151 3300005842 Bacteria 1545
122 Ga0068860_100007275 3300005843 Bacteria 11073
123 Ga0068860_100035180 3300005843 Unclassified 4805
124 Ga0068860_100603133 3300005843 Unclassified 1103
125 Ga0068862_100005471 3300005844 Bacteria 10615
126 Ga0068862_100026878 3300005844 Bacteria 4841
127 Ga0068862_100464386 3300005844 Bacteria 1195
128 Ga0075363_100131301 3300006048 Bacteria 1405
129 Ga0075366_10001034 3300006195 Bacteria 13655
130 Ga0075366_10225749 3300006195 Bacteria 1141
131 Ga0097621_100093228 3300006237 Bacteria 2523
132 Ga0097621_100126129 3300006237 Bacteria 2174
133 Ga0075370_10029360 3300006353 Bacteria 3063
134 Ga0068871_100326300 3300006358 Bacteria 1353
135 Ga0068871_100344332 3300006358 Bacteria 1317
136 Ga0075428_100023051 3300006844 Bacteria 6889
137 Ga0075428_100026890 3300006844 Bacteria 6371
138 Ga0075428_100027193 3300006844 Bacteria 6333
139 Ga0075428_100064300 3300006844 Bacteria 4017
140 Ga0075430_100000781 3300006846 Bacteria 24618
141 Ga0075430_100011325 3300006846 Bacteria 7564
142 Ga0075431_100008277 3300006847 Bacteria 10399
143 Ga0075431_100024236 3300006847 Bacteria 6215
144 Ga0075429_100015188 3300006880 Bacteria 6674
145 Ga0075429_100026571 3300006880 Bacteria 5027
146 Ga0075429_100134837 3300006880 Bacteria 2161
147 Ga0068865_100008656 3300006881 Bacteria 6296
148 Ga0097620_100137164 3300006931 Bacteria 2520
149 Ga0097620_100153090 3300006931 Bacteria 2382
150 Ga0099826_10000001 3300006948 Bacteria 1155201
151 Ga0075435_100113822 3300007076 Bacteria 2252
152 Ga0105251_10000412 3300009011 Bacteria 41518
153 Ga0105240_10030317 3300009093 Bacteria 7030
154 Ga0105240_10186742 3300009093 Bacteria 2441
155 Ga0111539_10015945 3300009094 Bacteria 9336
156 Ga0111539_10061984 3300009094 Bacteria 4428
157 Ga0111539_10173374 3300009094 Bacteria 2520
158 Ga0105245_10318188 3300009098 Bacteria 1532
159 Ga0114129_10003559 3300009147 Bacteria 21928
160 Ga0105243_10000196 3300009148 Bacteria 71069
161 Ga0105241_10040937 3300009174 Bacteria 3499
162 Ga0105241_10150068 3300009174 Bacteria 1906
163 Ga0105241_10182348 3300009174 Bacteria 1742
164 Ga0105242_10083793 3300009176 Bacteria 2670
165 Ga0105242_10230971 3300009176 Bacteria 1658
166 Ga0105248_10254465 3300009177 Bacteria 1977
167 Ga0105248_10509512 3300009177 Bacteria 1357
168 Ga0105237_10080817 3300009545 Bacteria 3241
169 Ga0105237_10106776 3300009545 Bacteria 2792
170 Ga0105237_10461892 3300009545 Bacteria 1276
171 Ga0105238_10449427 3300009551 Bacteria 1286
172 Ga0105249_10061830 3300009553 Bacteria 3437
173 Ga0105249_10386510 3300009553 Bacteria 1427
174 Ga0105249_10726625 3300009553 Unclassified 1054
175 Ga0105249_10765058 3300009553 Bacteria 1028
176 Ga0105239_10058037 3300010375 Bacteria 4246
177 Ga0105239_10076657 3300010375 Bacteria 3677
178 Ga0105239_10147561 3300010375 Bacteria 2624
179 Ga0157370_10003641 3300013104 Bacteria 18012
180 Ga0157370_10037845 3300013104 Bacteria 4671
181 Ga0157370_10142068 3300013104 Bacteria 2237
182 Ga0157369_10025010 3300013105 Bacteria 6632
183 Ga0157369_10131297 3300013105 Bacteria 2654
184 Ga0157374_10202494 3300013296 Bacteria 1944
185 Ga0157378_10085334 3300013297 Bacteria 2860
186 Ga0157378_10368827 3300013297 Bacteria 1407
187 Ga0157378_10502211 3300013297 Bacteria 1212
188 Ga0163162_10000016 3300013306 Bacteria 250836
189 Ga0163162_10023966 3300013306 Bacteria 6022
190 Ga0163162_10205197 3300013306 Bacteria 2100
191 Ga0163162_10268198 3300013306 Bacteria 1839
192 Ga0157372_10044386 3300013307 Bacteria 4925
193 Ga0157372_10317329 3300013307 Bacteria 1814
194 Ga0157375_10020927 3300013308 Bacteria 5987
195 Ga0157375_10094077 3300013308 Bacteria 3064
196 Ga0157375_10139277 3300013308 Bacteria 2552
197 Ga0157375_10175623 3300013308 Bacteria 2291
198 Ga0157375_10188956 3300013308 Bacteria 2214
199 Ga0163163_10246282 3300014325 Bacteria 1837
200 Ga0157379_10110043 3300014968 Bacteria 2474
201 Ga0157376_10223042 3300014969 Bacteria 1747
202 Ga0182007_10000117 3300015262 Bacteria 54576
203 Ga0182005_1000220 3300015265 Bacteria 37719
204 Ga0183365_10001 3300015684 Bacteria 2090444
205 Ga0183360_10001 3300015689 Bacteria 3943671
206 Ga0213872_10001690 3300021361 Bacteria 13881
207 Ga0213872_10003254 3300021361 Bacteria 9065
208 Ga0213872_10023069 3300021361 Bacteria 2863
209 Ga0213876_10000119 3300021384 Bacteria 85523
210 Ga0213876_10000246 3300021384 Bacteria 51765
211 Ga0209436_100176 3300025208 Bacteria 30384
212 Ga0209436_107040 3300025208 Bacteria 2400
213 Ga0209563_100003 3300025230 Bacteria 1932942
214 Ga0207425_1000015 3300025245 Bacteria 466368
215 Ga0207425_1000125 3300025245 Bacteria 72177
216 Ga0207425_1000357 3300025245 Bacteria 31681
217 Ga0209677_105361 3300025253 Bacteria 3368
218 Ga0209148_1000933 3300025254 Bacteria 19249
219 Ga0209129_1000074 3300025258 Bacteria 205648
220 Ga0209129_1004558 3300025258 Bacteria 5343
221 Ga0209565_1000018 3300025263 Bacteria 460940
222 Ga0209565_1000033 3300025263 Bacteria 313960
223 Ga0209565_1001039 3300025263 Bacteria 14093
224 Ga0209565_1005044 3300025263 Bacteria 3903
225 Ga0209455_1000026 3300025272 Bacteria 653778
226 Ga0209673_1000062 3300025273 Bacteria 260727
227 Ga0209673_1000090 3300025273 Bacteria 202223
228 Ga0209673_1025985 3300025273 Bacteria 1934
229 Ga0209673_1058763 3300025273 Bacteria 971
230 Ga0209130_1000036 3300025284 Bacteria 284111
231 Ga0209130_1002048 3300025284 Bacteria 10961
232 Ga0209130_1005135 3300025284 Bacteria 4651
233 Ga0209130_1015427 3300025284 Bacteria 1883
234 Ga0209675_1000005 3300025291 Bacteria 849192
235 Ga0209675_1000018 3300025291 Bacteria 377481
236 Ga0209675_1003025 3300025291 Bacteria 8251
237 Ga0209676_1000031 3300025292 Bacteria 478976
238 Ga0209676_1000052 3300025292 Bacteria 371539
239 Ga0209676_1000095 3300025292 Bacteria 245393
240 Ga0209676_1001677 3300025292 Bacteria 19224
241 Ga0209676_1001964 3300025292 Bacteria 16439
242 Ga0209025_1000002 3300025294 Bacteria 1393142
243 Ga0209025_1001683 3300025294 Bacteria 27024
244 Ga0209025_1010456 3300025294 Bacteria 6283
245 Ga0209564_1000027 3300025295 Bacteria 518458
246 Ga0209564_1000078 3300025295 Bacteria 275766
247 Ga0209564_1000637 3300025295 Bacteria 53200
248 Ga0209564_1001694 3300025295 Bacteria 20890
249 Ga0209564_1004422 3300025295 Bacteria 8609
250 Ga0209564_1004530 3300025295 Bacteria 8445
251 Ga0209758_1000003 3300025297 Bacteria 1398533
252 Ga0209758_1001071 3300025297 Bacteria 35617
253 Ga0209758_1001141 3300025297 Bacteria 34057
254 Ga0209758_1058238 3300025297 Bacteria 1293
255 Ga0209050_1000087 3300025298 Bacteria 261460
256 Ga0209050_1000320 3300025298 Bacteria 96836
257 Ga0209050_1009864 3300025298 Bacteria 4805
258 Ga0209050_1009917 3300025298 Bacteria 4782
259 Ga0209050_1012124 3300025298 Bacteria 3994
260 Ga0209256_1000601 3300025299 Bacteria 49925
261 Ga0209256_1001003 3300025299 Bacteria 33521
262 Ga0207426_1001256 3300025302 Bacteria 22166
263 Ga0207426_1066773 3300025302 Bacteria 1015
264 Ga0209051_1001827 3300025303 Bacteria 16837
265 Ga0209051_1010153 3300025303 Bacteria 4787
266 Ga0209051_1019763 3300025303 Bacteria 2927
267 Ga0209257_1000010 3300025304 Bacteria 1158682
268 Ga0209257_1000046 3300025304 Bacteria 477765
269 Ga0209257_1000050 3300025304 Bacteria 439325
270 Ga0209257_1000136 3300025304 Bacteria 204863
271 Ga0209257_1000153 3300025304 Bacteria 189177
272 Ga0209257_1000261 3300025304 Bacteria 121357
273 Ga0209257_1000548 3300025304 Bacteria 64548
274 Ga0209257_1001489 3300025304 Bacteria 27496
275 Ga0209257_1002549 3300025304 Bacteria 17822
276 Ga0209257_1008476 3300025304 Bacteria 5831
277 Ga0209257_1010260 3300025304 Bacteria 4785
278 Ga0207655_1013138 3300025728 Bacteria 4774
279 Ga0207655_1015127 3300025728 Bacteria 4311
280 Ga0207713_1000385 3300025735 Bacteria 47906
281 Ga0207713_1004235 3300025735 Bacteria 9378
282 Ga0207710_10068171 3300025900 Unclassified 1627
283 Ga0207688_10015900 3300025901 Bacteria 4081
284 Ga0207643_10065422 3300025908 Bacteria 2083
285 Ga0207654_10032083 3300025911 Bacteria 2898
286 Ga0207707_10012317 3300025912 Bacteria 7432
287 Ga0207707_10189362 3300025912 Bacteria 1795
288 Ga0207695_10013070 3300025913 Bacteria 9910
289 Ga0207695_10188865 3300025913 Bacteria 1978
290 Ga0207671_10216961 3300025914 Bacteria 1498
291 Ga0207657_10002453 3300025919 Bacteria 20036
292 Ga0207650_10008931 3300025925 Bacteria 6848
293 Ga0207650_10055501 3300025925 Bacteria 2941
294 Ga0207659_10126747 3300025926 Bacteria 1964
295 Ga0207690_10039847 3300025932 Bacteria 3067
296 Ga0207706_10004937 3300025933 Bacteria 12457
297 Ga0207706_10262663 3300025933 Bacteria 1507
298 Ga0207706_10391533 3300025933 Bacteria 1205
299 Ga0207686_10062107 3300025934 Bacteria 2371
300 Ga0207709_10000504 3300025935 Bacteria 34671
301 Ga0207670_10014543 3300025936 Bacteria 4675
302 Ga0207670_10072490 3300025936 Bacteria 2385
303 Ga0207669_10098411 3300025937 Bacteria 1926
304 Ga0207669_10286246 3300025937 Bacteria 1246
305 Ga0207704_10025489 3300025938 Bacteria 3227
306 Ga0207691_10014770 3300025940 Bacteria 7442
307 Ga0207691_10372510 3300025940 Bacteria 1220
308 Ga0207711_10087686 3300025941 Bacteria 2731
309 Ga0207689_10107680 3300025942 Bacteria 2290
310 Ga0207689_10315296 3300025942 Bacteria 1297
311 Ga0207679_10313986 3300025945 Bacteria 1355
312 Ga0207679_10630670 3300025945 Bacteria 968
313 Ga0207667_10046098 3300025949 Bacteria 4616
314 Ga0207712_10039699 3300025961 Bacteria 3226
315 Ga0207677_10102195 3300026023 Unclassified 2113
316 Ga0207677_10213404 3300026023 Bacteria 1543
317 Ga0207703_10155527 3300026035 Bacteria 1998
318 Ga0207703_10180792 3300026035 Bacteria 1861
319 Ga0207639_10086407 3300026041 Bacteria 2497
320 Ga0207639_10302238 3300026041 Bacteria 1415
321 Ga0207708_10023681 3300026075 Bacteria 4642
322 Ga0207702_10104122 3300026078 Bacteria 2511
323 Ga0207641_10086807 3300026088 Bacteria 2729
324 Ga0207641_10117884 3300026088 Bacteria 2364
325 Ga0207641_10142337 3300026088 Bacteria 2165
326 Ga0207648_10010182 3300026089 Bacteria 8941
327 Ga0207676_10468578 3300026095 Bacteria 1191
328 Ga0207674_10524150 3300026116 Bacteria 1145
329 Ga0207675_100003322 3300026118 Bacteria 15751
330 Ga0207675_100003896 3300026118 Bacteria 14508
331 Ga0207683_10010779 3300026121 Bacteria 7794
332 Ga0207683_10053241 3300026121 Bacteria 3548
333 Ga0209371_1000332 3300027312 Bacteria 51427
334 Ga0209282_1000001 3300027666 Bacteria 2450367
335 Ga0209966_1003002 3300027695 Bacteria 2830
336 Ga0207428_10096658 3300027907 Bacteria 2287
337 Ga0268266_10001411 3300028379 Bacteria 28670
338 Ga0268265_10002277 3300028380 Bacteria 14624
339 Ga0268265_10022305 3300028380 Bacteria 4446
340 Ga0268265_10204253 3300028380 Bacteria 1716
341 Ga0268264_10008154 3300028381 Bacteria 8706
342 Ga0268264_10015656 3300028381 Bacteria 6210
343 Ga0268264_10104266 3300028381 Unclassified 2471
344 Ga0268264_10130613 3300028381 Bacteria 2226
345 Ga0268264_10256730 3300028381 Bacteria 1626
346 Ga0307515_10046926 3300028794 Bacteria 6587
347 Ga0265338_10004919 3300028800 Bacteria 17766
348 Ga0265338_10022222 3300028800 Bacteria 6576
349 Ga0265338_10049015 3300028800 Bacteria 3834
350 Ga0268256_1000285 3300030500 Bacteria 52251
351 Ga0316177_1189032 3300030731 Bacteria 4597
352 Ga0316183_1141288 3300030742 Bacteria 3037
353 Ga0316182_1235230 3300030745 Bacteria 2409
354 Ga0265330_10038918 3300031235 Bacteria 2113
355 Ga0265332_10056130 3300031238 Bacteria 1687
356 Ga0265340_10000072 3300031247 Bacteria 48524
357 Ga0265340_10018477 3300031247 Bacteria 3595
358 Ga0265339_10125700 3300031249 Bacteria 1315
359 Ga0265327_10000039 3300031251 Bacteria 292334
360 Ga0265327_10098827 3300031251 Bacteria 1411
361 Ga0265316_10043250 3300031344 Bacteria 3592
362 Ga0265316_10057899 3300031344 Bacteria 3020
363 Ga0265316_10125186 3300031344 Bacteria 1938
364 Ga0307513_10012392 3300031456 Bacteria 10530
365 Ga0307513_10097214 3300031456 Bacteria 2980
366 Ga0307408_100000618 3300031548 Bacteria 30213
367 Ga0307408_100001729 3300031548 Bacteria 15977
368 Ga0307408_100002147 3300031548 Bacteria 14113
369 Ga0307408_100007999 3300031548 Bacteria 6991
370 Ga0307408_100016004 3300031548 Bacteria 5001
371 Ga0307408_100303217 3300031548 Bacteria 1339
372 Ga0307408_100493011 3300031548 Bacteria 1071
373 Ga0265314_10011526 3300031711 Bacteria 7284
374 Ga0265314_10076430 3300031711 Bacteria 2225
375 Ga0265342_10027636 3300031712 Bacteria 3541
376 Ga0265342_10071229 3300031712 Bacteria 2026
377 Ga0307516_10029535 3300031730 Bacteria 5542
378 Ga0307516_10041993 3300031730 Bacteria 4540
379 Ga0307405_10003199 3300031731 Bacteria 7460
380 Ga0307413_10000617 3300031824 Bacteria 11980
381 Ga0307410_10232651 3300031852 Bacteria 1424
382 Ga0307406_10004595 3300031901 Bacteria 7513
383 Ga0307406_10067913 3300031901 Bacteria 2326
384 Ga0307407_10003220 3300031903 Bacteria 6632
385 Ga0307412_10095811 3300031911 Bacteria 2087
386 Ga0307409_100006208 3300031995 Bacteria 6993
387 Ga0307409_100012834 3300031995 Bacteria 5359
388 Ga0307409_100529500 3300031995 Bacteria 1153
389 Ga0307416_100718177 3300032002 Bacteria 1090
390 Ga0307414_10073765 3300032004 Bacteria 2470
391 Ga0307414_10244180 3300032004 Bacteria 1488
392 Ga0307414_10317538 3300032004 Bacteria 1324
393 Ga0307411_10001591 3300032005 Bacteria 9425
394 Ga0307411_10136718 3300032005 Bacteria 1801
395 Ga0307415_100067617 3300032126 Bacteria 2498
396 Ga0307415_100624907 3300032126 Bacteria 962
397 Ga0307507_10182699 3300033179 Bacteria 1494
398 Ga0307507_10184722 3300033179 Bacteria 1481
399 Ga0307510_10071530 3300033180 Bacteria 3453
400 Ga0395899_0000003 3300037312 Bacteria 1232684
401 Ga0395899_0000012 3300037312 Bacteria 517561
402 Ga0395899_0073557 3300037312 Bacteria 2498
403 Ga0395900_0000028 3300037418 Bacteria 285042
404 Ga0395900_0002683 3300037418 Bacteria 19454
405 Ga0395900_0012863 3300037418 Bacteria 8549
406 Ga0395900_0014052 3300037418 Bacteria 8175
407 Ga0395900_0054335 3300037418 Bacteria 4124
408 Ga0395900_0064343 3300037418 Bacteria 3769
409 Ga0395898_0019762 3300037466 Bacteria 6850
410 Ga0395905_0000022 3300037471 Bacteria 321527
411 Ga0395905_0044068 3300037471 Bacteria 4186
412 Ga0395901_0000076 3300038443 Bacteria 138169
413 Ga0395901_0151064 3300038443 Bacteria 2440
414 Ga0395901_0260964 3300038443 Bacteria 1803
415 Ga0395901_0398871 3300038443 Bacteria 1413
416 Ga0395901_0538581 3300038443 Bacteria 1184
417 Ga0237819_00007 3300038705 Bacteria 74520
418 Ga0237816_00241 3300039145 Bacteria 4567
419 Ga0436365_0213934 3300039437 Bacteria 51788
420 Ga0436365_1476328 3300039437 Bacteria 212791
421 Ga0436361_0142459 3300039447 Bacteria 45175
422 Ga0436361_0166535 3300039447 Bacteria 1094
423 Ga0436361_0243746 3300039447 Bacteria 16129
424 Ga0436361_0663918 3300039447 Bacteria 2238
425 Ga0436361_0909588 3300039447 Bacteria 2279
426 Ga0436361_1221194 3300039447 Bacteria 3910
427 Ga0439465_0056709 3300041413 Bacteria 1291
428 Ga0451791_0321965 3300041451 Bacteria 1944
429 Ga0451791_0753430 3300041451 Bacteria 1315
430 Ga0451797_1321202 3300041453 Bacteria 2178
431 Ga0451798_1100220 3300041458 Bacteria 1197
432 Ga0451800_0742652 3300041459 Bacteria 12172
433 Ga0451802_0228891 3300041460 Bacteria 10583
434 Ga0451806_158657 3300041462 Bacteria 6549
435 Ga0451804_0269081 3300041463 Bacteria 4201
436 Ga0451807_0617128 3300041486 Bacteria 1586
437 Ga0451807_2291444 3300041486 Bacteria 9755
438 Ga0451841_1039072 3300041498 Bacteria 1755
439 Ga0451849_0981658 3300041505 Bacteria 2425
440 Ga0451851_0837399 3300041507 Bacteria 1039
441 Ga0451843_0711483 3300041509 Bacteria 2102
442 Ga0439431_0076158 3300041997 Bacteria 900
443 Ga0439441_006718 3300042001 Bacteria 1834
444 Ga0439448_0001122 3300042005 Bacteria 6753
445 Ga0439448_0024166 3300042005 Bacteria 1899
446 Ga0439449_0000020 3300042007 Bacteria 46206
447 Ga0439449_0005395 3300042007 Bacteria 4899
448 Ga0439450_021695 3300042008 Bacteria 1381
449 Ga0439455_0015456 3300042012 Bacteria 1755
450 Ga0439462_0007287 3300042015 Bacteria 2765
451 Ga0450905_003641 3300042142 Bacteria 2027
452 Ga0439446_0014462 3300042156 Bacteria 2179
453 Ga0451577_0002991 3300042876 Bacteria 19272
454 Ga0466969_0038583 3300044656 Bacteria 2402
455 Ga0466969_0073091 3300044656 Bacteria 1646
456 Ga0466969_0137000 3300044656 Bacteria 1133
457 Ga0466969_0145177 3300044656 Bacteria 1095
458 Ga0466972_0042178 3300044658 Bacteria 2220
459 Ga0466965_0022517 3300044683 Bacteria 3037
460 Ga0466965_0063752 3300044683 Bacteria 1844
461 Ga0466965_0089841 3300044683 Bacteria 1562
462 Ga0466965_0213851 3300044683 Bacteria 1026
463 Ga0466966_0000485 3300044684 Bacteria 25510
464 Ga0466966_0001407 3300044684 Bacteria 15484
465 Ga0466966_0001440 3300044684 Bacteria 15301
466 Ga0466966_0008459 3300044684 Bacteria 6813
467 Ga0466966_0024383 3300044684 Bacteria 3957
468 Ga0466966_0088665 3300044684 Bacteria 1922
469 Ga0466966_0164455 3300044684 Bacteria 1350
470 Ga0466961_0041956 3300044693 Bacteria 2933
471 Ga0466961_0053821 3300044693 Bacteria 2567
472 Ga0466961_0309010 3300044693 Bacteria 965
473 Ga0466963_0063269 3300044694 Bacteria 2476
474 Ga0466963_0105135 3300044694 Bacteria 1935
475 Ga0466964_0000150 3300044706 Bacteria 18826
476 Ga0466964_0000506 3300044706 Bacteria 12145
477 Ga0466964_0039462 3300044706 Bacteria 1902
478 Ga0453684_0184554 3300044712 Bacteria 2446
479 Ga0466971_0181499 3300044719 Bacteria 989
480 Ga0466968_0003732 3300044735 Bacteria 5647
481 Ga0466968_0153620 3300044735 Bacteria 1059
482 Ga0466957_0000034 3300044842 Bacteria 48746
483 Ga0466957_0011693 3300044842 Bacteria 5073
484 Ga0466957_0089264 3300044842 Bacteria 1929
485 Ga0466960_0037123 3300044901 Bacteria 2285
486 Ga0466959_0000096 3300045049 Bacteria 55797
487 Ga0466959_0004407 3300045049 Bacteria 9423
488 Ga0466959_0017396 3300045049 Bacteria 5269
489 Ga0466959_0131816 3300045049 Bacteria 1771
490 Ga0466958_0003281 3300045836 Bacteria 8372
491 Ga0466958_0027005 3300045836 Bacteria 3395
492 Ga0466958_0244519 3300045836 Bacteria 1147
493 Ga0466967_0027232 3300045976 Bacteria 4752
494 Ga0466967_0064392 3300045976 Bacteria 3260
495 Ga0466967_0360582 3300045976 Bacteria 1408
496 Ga0495627_000015 3300046453 Bacteria 320787
497 Ga0495627_000464 3300046453 Bacteria 35052
498 Ga0495638_0000198 3300046460 Bacteria 86199
499 Ga0495638_0000528 3300046460 Bacteria 44566
500 Ga0495638_0002732 3300046460 Bacteria 14178
501 Ga0495638_0003082 3300046460 Bacteria 13218
502 Ga0495638_0005851 3300046460 Bacteria 9042
503 Ga0495638_0007341 3300046460 Bacteria 7912
504 Ga0495650_0000577 3300046471 Bacteria 51317
505 Ga0495582_0036642 3300046473 Bacteria 2698
506 Ga0495605_0000112 3300046474 Bacteria 104223
507 Ga0495605_0001495 3300046474 Bacteria 15232
508 Ga0495605_0002051 3300046474 Bacteria 12706
509 Ga0495584_0008989 3300046491 Bacteria 5162
510 Ga0495584_0030374 3300046491 Bacteria 2737
511 Ga0495585_0019583 3300046492 Bacteria 3901
512 Ga0495596_0000088 3300046500 Bacteria 64229
513 Ga0495596_0003086 3300046500 Bacteria 8602
514 Ga0495607_0001299 3300046501 Bacteria 22284
515 Ga0495607_0001443 3300046501 Bacteria 21163
516 Ga0495607_0035808 3300046501 Bacteria 2998
517 Ga0495607_0118720 3300046501 Bacteria 1391
518 Ga0495583_0000029 3300046506 Bacteria 255536
519 Ga0495583_0000253 3300046506 Bacteria 88398
520 Ga0495583_0000265 3300046506 Bacteria 86085
521 Ga0495583_0005424 3300046506 Bacteria 8664
522 Ga0495583_0014108 3300046506 Bacteria 4421
523 Ga0495606_0005061 3300046507 Bacteria 12825
524 Ga0495606_0025238 3300046507 Bacteria 4260
525 Ga0495610_0000040 3300046512 Bacteria 165165
526 Ga0495610_0000176 3300046512 Bacteria 71110
527 Ga0495610_0001501 3300046512 Bacteria 20517
528 Ga0495610_0004463 3300046512 Bacteria 10334
529 Ga0495610_0011821 3300046512 Bacteria 5304
530 Ga0495616_0000016 3300046513 Bacteria 182686
531 Ga0495616_0000283 3300046513 Bacteria 41076
532 Ga0495616_0000572 3300046513 Bacteria 27802
533 Ga0495616_0001503 3300046513 Bacteria 16105
534 Ga0495616_0005078 3300046513 Bacteria 8184
535 Ga0495616_0025050 3300046513 Bacteria 3192
536 Ga0495616_0025258 3300046513 Bacteria 3176
537 Ga0495616_0029452 3300046513 Bacteria 2898
538 Ga0495616_0095276 3300046513 Bacteria 1403
539 Ga0495631_0003199 3300046518 Bacteria 9017
540 Ga0495631_0010788 3300046518 Bacteria 4515
541 Ga0495632_0000597 3300046519 Bacteria 33515
542 Ga0495632_0009670 3300046519 Bacteria 5790
543 Ga0495632_0016087 3300046519 Bacteria 4171
544 Ga0495637_0015323 3300046520 Bacteria 3596
545 Ga0495643_0000106 3300046522 Bacteria 138657
546 Ga0495643_0000621 3300046522 Bacteria 42290
547 Ga0495643_0001053 3300046522 Bacteria 27815
548 Ga0495643_0006828 3300046522 Bacteria 7455
549 Ga0495643_0012735 3300046522 Bacteria 5061
550 Ga0495643_0050938 3300046522 Bacteria 2229
551 Ga0495644_0006644 3300046523 Bacteria 4481
552 Ga0495644_0017977 3300046523 Bacteria 2700
553 Ga0495648_0000087 3300046524 Bacteria 116394
554 Ga0495648_0000238 3300046524 Bacteria 63006
555 Ga0495648_0005883 3300046524 Bacteria 10084
556 Ga0495663_0000769 3300046525 Bacteria 10989
557 Ga0495663_0024921 3300046525 Bacteria 1741
558 Ga0495663_0062151 3300046525 Bacteria 1176
559 Ga0495666_0040795 3300046526 Bacteria 2250
560 Ga0495642_0000126 3300046528 Bacteria 43613
561 Ga0495642_0002587 3300046528 Bacteria 7305
562 Ga0495642_0005083 3300046528 Bacteria 5065
563 Ga0495642_0005528 3300046528 Bacteria 4857
564 Ga0495654_0016427 3300046530 Bacteria 3915
565 Ga0495654_0026485 3300046530 Bacteria 2980
566 Ga0495586_0010495 3300046535 Bacteria 4926
567 Ga0495609_0000001 3300046538 Bacteria 1060094
568 Ga0495609_0000241 3300046538 Bacteria 52185
569 Ga0495609_0000420 3300046538 Bacteria 35497
570 Ga0495609_0003048 3300046538 Bacteria 9853
571 Ga0495609_0024711 3300046538 Bacteria 2754
572 Ga0495609_0026119 3300046538 Bacteria 2674
573 Ga0495609_0049273 3300046538 Bacteria 1880
574 Ga0495609_0118781 3300046538 Bacteria 1138
575 Ga0495597_0000119 3300046542 Bacteria 71150
576 Ga0495645_0126180 3300046543 Bacteria 1798
577 Ga0495622_0000084 3300046557 Bacteria 83759
578 Ga0495633_0000187 3300046558 Bacteria 80958
579 Ga0495633_0005872 3300046558 Bacteria 7383
580 Ga0495633_0012294 3300046558 Bacteria 4563
581 Ga0495633_0037894 3300046558 Bacteria 2305
582 Ga0495633_0041303 3300046558 Bacteria 2194
583 Ga0495656_0005629 3300046615 Bacteria 4335
584 Ga0495656_0025112 3300046615 Bacteria 2359
585 Ga0495656_0047249 3300046615 Bacteria 1825
586 Ga0495668_0000239 3300046616 Bacteria 78426
587 Ga0495668_0000715 3300046616 Bacteria 39968
588 Ga0495668_0002001 3300046616 Bacteria 17817
589 Ga0495668_0008395 3300046616 Bacteria 6455
590 Ga0495668_0009316 3300046616 Bacteria 6035
591 Ga0495668_0021485 3300046616 Bacteria 3700
592 Ga0495668_0038810 3300046616 Bacteria 2660
593 Ga0495668_0176551 3300046616 Bacteria 1170
594 Ga0495611_0000226 3300046648 Bacteria 39543
595 Ga0495625_0000038 3300046660 Bacteria 211808
596 Ga0495625_0000099 3300046660 Bacteria 140467
597 Ga0495625_0000800 3300046660 Bacteria 43543
598 Ga0495625_0001311 3300046660 Bacteria 31043
599 Ga0495625_0001665 3300046660 Bacteria 26013
600 Ga0495625_0010857 3300046660 Bacteria 7486
601 Ga0495625_0018893 3300046660 Bacteria 5365
602 Ga0495625_0075315 3300046660 Bacteria 2361
603 Ga0495625_0255681 3300046660 Bacteria 1135
604 Ga0495625_0275782 3300046660 Bacteria 1083
605 Ga0495659_0000550 3300046664 Bacteria 13871
606 Ga0495659_0001060 3300046664 Bacteria 9607
607 Ga0495661_0000069 3300046665 Bacteria 125790
608 Ga0495661_0000181 3300046665 Bacteria 72564
609 Ga0495661_0002091 3300046665 Bacteria 15672
610 Ga0495661_0007418 3300046665 Bacteria 7645
611 Ga0495661_0010282 3300046665 Bacteria 6391
612 Ga0495661_0068928 3300046665 Bacteria 2074
613 Ga0495588_0000041 3300046674 Bacteria 377896
614 Ga0495657_0165041 3300046675 Bacteria 1368
615 Ga0495658_0078222 3300046683 Bacteria 1935
616 Ga0495669_0000341 3300046684 Bacteria 24536
617 Ga0495669_0003613 3300046684 Bacteria 6366
618 Ga0495670_0000114 3300046691 Bacteria 35822
619 Ga0495670_0047159 3300046691 Bacteria 2153
620 Ga0495671_0008482 3300046692 Bacteria 5778
621 Ga0495671_0020050 3300046692 Bacteria 3527
622 Ga0495649_0000263 3300046694 Bacteria 46744
623 Ga0495649_0006606 3300046694 Bacteria 7212
624 Ga0495649_0037609 3300046694 Bacteria 2656
625 Ga0495589_0000061 3300046794 Bacteria 104649
626 Ga0495589_0000165 3300046794 Bacteria 60337
627 Ga0495589_0007854 3300046794 Bacteria 5585
628 Ga0495589_0011973 3300046794 Bacteria 4497
629 Ga0495660_0000104 3300046810 Bacteria 90778
630 Ga0495660_0000450 3300046810 Bacteria 34288
631 Ga0495660_0002266 3300046810 Bacteria 12378
632 Ga0495660_0002391 3300046810 Bacteria 11979
633 Ga0495660_0002719 3300046810 Bacteria 11167
634 Ga0495660_0011168 3300046810 Bacteria 5214
635 Ga0495660_0063322 3300046810 Bacteria 1981
636 Ga0495660_0098847 3300046810 Bacteria 1505
637 Ga0495581_0107833 3300047315 Bacteria 1619
638 Ga0495636_0000720 3300047318 Bacteria 12107
639 Ga0495636_0016558 3300047318 Bacteria 2946
640 Ga0495674_0257315 3300047319 Bacteria 1435
641 Ga0495672_0000141 3300047320 Bacteria 106630
642 Ga0495672_0000214 3300047320 Bacteria 82882
643 Ga0495672_0000264 3300047320 Bacteria 72738
644 Ga0495672_0002375 3300047320 Bacteria 17376
645 Ga0495672_0018604 3300047320 Bacteria 4605
646 Ga0495683_0003920 3300047323 Bacteria 8558
647 Ga0495683_0021841 3300047323 Bacteria 3297
648 Ga0495683_0029748 3300047323 Bacteria 2790
649 Ga0495687_000027 3300047443 Bacteria 299689
650 Ga0495687_000062 3300047443 Bacteria 176135
651 Ga0495687_000254 3300047443 Bacteria 71880
652 Ga0495687_000477 3300047443 Bacteria 48508
653 Ga0495687_003359 3300047443 Bacteria 11679
654 Ga0495687_005981 3300047443 Bacteria 7583
655 Ga0495687_008705 3300047443 Bacteria 5767
656 Ga0495677_0000001 3300047445 Bacteria 715000
657 Ga0495677_0032369 3300047445 Bacteria 1904
658 Ga0495677_0040336 3300047445 Bacteria 1707
659 Ga0495677_0083918 3300047445 Bacteria 1196
660 Ga0495679_008042 3300047446 Bacteria 4328
661 Ga0495679_030531 3300047446 Bacteria 1748
662 Ga0495685_000658 3300047447 Bacteria 10556
663 Ga0495685_037386 3300047447 Bacteria 1664
664 Ga0495673_0000056 3300047469 Bacteria 245918
665 Ga0495673_0000785 3300047469 Bacteria 29990
666 Ga0495681_0005660 3300047470 Bacteria 8322
667 Ga0495686_0087287 3300047472 Bacteria 1897
668 Ga0495686_0253113 3300047472 Bacteria 989
669 Ga0495615_0060260 3300048090 Bacteria 1000
670 Ga0495626_0000101 3300048091 Bacteria 110322
671 Ga0495626_0000135 3300048091 Bacteria 93280
672 Ga0495626_0000745 3300048091 Bacteria 30039
673 Ga0496100_0190941 3300048903 Bacteria 1487
674 Ga0496100_0254821 3300048903 Bacteria 1299
675 Ga0496102_0046604 3300048905 Bacteria 3937
676 Ga0496103_0229792 3300048906 Bacteria 1193
677 Ga0496104_0262415 3300048907 Unclassified 1640
678 Ga0496105_0035928 3300048908 Bacteria 4081
679 Ga0496106_0006892 3300048909 Bacteria 8407
680 Ga0496107_0000095 3300048910 Bacteria 42594
681 Ga0496107_0014761 3300048910 Bacteria 5470
682 Ga0496107_0136204 3300048910 Bacteria 1814
683 Ga0496107_0343847 3300048910 Bacteria 1110
684 Ga0496110_0463667 3300048913 Bacteria 1154
685 Ga0496114_0000254 3300048917 Bacteria 38642
686 Ga0496116_0001111 3300048919 Bacteria 32190
687 Ga0496116_0086580 3300048919 Bacteria 1921
688 Ga0496117_0001300 3300048920 Bacteria 36745
689 Ga0496118_0000703 3300048921 Bacteria 54182
690 Ga0496118_0028073 3300048921 Bacteria 4748
691 Ga0496119_0000301 3300048922 Bacteria 69339
692 Ga0496120_0000402 3300048923 Bacteria 69322
693 Ga0496121_0001883 3300048924 Bacteria 33669
694 Ga0496121_0129712 3300048924 Bacteria 1889
695 Ga0496122_0001165 3300048925 Bacteria 44919
696 Ga0496122_0029671 3300048925 Bacteria 4605
697 Ga0496123_0000933 3300048926 Bacteria 45679
698 Ga0496123_0046819 3300048926 Bacteria 2929
699 Ga0496124_0000009 3300048927 Bacteria 734820
700 Ga0496124_0001841 3300048927 Bacteria 29280
701 Ga0496124_0010055 3300048927 Bacteria 9650
702 Ga0496124_0015900 3300048927 Bacteria 7185
703 Ga0496124_0030252 3300048927 Bacteria 4809
704 Ga0496124_0224003 3300048927 Bacteria 1412
705 Ga0496125_0003869 3300048928 Bacteria 17713
706 Ga0496125_0036606 3300048928 Bacteria 4281
707 Ga0496125_0049747 3300048928 Bacteria 3478
708 Ga0496125_0072611 3300048928 Bacteria 2680
709 Ga0496126_0001069 3300048929 Bacteria 46093
710 Ga0495678_000101 3300049459 Bacteria 104596
711 Ga0495678_000663 3300049459 Bacteria 31565
712 Ga0495678_002168 3300049459 Bacteria 13848
713 Ga0495678_005468 3300049459 Bacteria 7002
714 Ga0495678_016807 3300049459 Bacteria 3333
715 Ga0495682_0000208 3300049460 Bacteria 47163
716 Ga0495682_0004343 3300049460 Bacteria 6090
717 Ga0501290_006438 3300049513 Bacteria 1471
718 Ga0501300_006036 3300049523 Bacteria 1785
719 Ga0501031_0074753 3300049568 Bacteria 2207
720 Ga0501033_0002089 3300049570 Bacteria 17310
721 Ga0501033_0215834 3300049570 Bacteria 1367
722 Ga0501033_0247093 3300049570 Bacteria 1265
723 Ga0501034_0000941 3300049571 Bacteria 42237
724 Ga0501034_0022534 3300049571 Bacteria 6418
725 Ga0501034_0037613 3300049571 Bacteria 4901
726 Ga0501034_0041427 3300049571 Bacteria 4659
727 Ga0501034_0506354 3300049571 Bacteria 1121
728 Ga0501036_0170755 3300049572 Bacteria 1832
729 Ga0501037_0008198 3300049573 Bacteria 7659
730 Ga0501037_0119238 3300049573 Bacteria 1898
731 Ga0501038_0383623 3300049574 Bacteria 1090
732 Ga0501043_0003380 3300049579 Bacteria 13138
733 Ga0501043_0288261 3300049579 Bacteria 1257
734 Ga0501046_0037641 3300049580 Bacteria 3887
735 Ga0501047_0188715 3300049581 Bacteria 1926
736 Ga0501047_0195530 3300049581 Bacteria 1885
737 Ga0501067_0000227 3300049583 Bacteria 31300
738 Ga0501068_0000343 3300049584 Bacteria 23405
739 Ga0501073_0000004 3300049589 Bacteria 261794
740 Ga0501077_0000008 3300049593 Bacteria 106496
741 Ga0501227_011098 3300049665 Bacteria 1959
742 Ga0501225_0000492 3300049705 Bacteria 12311
743 Ga0501080_0009522 3300049742 Bacteria 8865
744 Ga0501265_000739 3300049762 Bacteria 3576
745 Ga0501269_000056 3300049766 Bacteria 34896
746 Ga0501269_005452 3300049766 Bacteria 1530
747 Ga0501275_000047 3300049772 Bacteria 12242
748 Ga0501279_000629 3300049775 Bacteria 4654
749 Ga0501035_0002949 3300049822 Bacteria 16363
750 Ga0501035_0111486 3300049822 Bacteria 2397
751 Ga0501035_0115049 3300049822 Bacteria 2355
752 Ga0501044_0000588 3300049823 Bacteria 44117
753 Ga0501044_0000868 3300049823 Bacteria 36400
754 Ga0501044_0092393 3300049823 Bacteria 3052
755 nmdc:mga0k408_361_c1 3300050493 Bacteria 24992
756 nmdc:mga0k408_41107_c1 3300050493 Bacteria 2661
757 nmdc:mga07m45_24650_c1 3300050496 Bacteria 3297
758 nmdc:mga05p37_956_c1 3300050507 Bacteria 32691
759 nmdc:mga09592_25900_c1 3300050508 Bacteria 4858
760 nmdc:mga09592_34828_c1 3300050508 Bacteria 4211
761 nmdc:mga0qj67_552_c1 3300050509 Bacteria 25468
762 nmdc:mga0qj67_9622_c1 3300050509 Bacteria 7203
763 nmdc:mga06r32_32159_c1 3300050510 Bacteria 4933
764 nmdc:mga06r32_481666_c1 3300050510 Bacteria 1219
765 nmdc:mga06r32_6360_c1 3300050510 Bacteria 10614
766 nmdc:mga08y16_109087_c1 3300050511 Bacteria 2882
767 nmdc:mga08y16_143378_c1 3300050511 Bacteria 2483
768 nmdc:mga08y16_63626_c1 3300050511 Bacteria 3853
769 nmdc:mga0rr50_104404_c1 3300050513 Bacteria 2232
770 Ga0495619_0193001 3300053085 Bacteria 1410
771 Ga0500578_0000030 3300053086 Bacteria 140063
772 Ga0500578_0000041 3300053086 Bacteria 129580
773 Ga0500583_0082371 3300053092 Bacteria 1556
774 Ga0500651_0000205 3300053093 Bacteria 37424
775 Ga0500566_0056165 3300053094 Bacteria 2240
776 Ga0500556_0002628 3300053104 Bacteria 5620
777 Ga0500562_015346 3300053108 Bacteria 1964
778 Ga0500562_049318 3300053108 Bacteria 1125
779 Ga0500594_0000037 3300053118 Bacteria 43146
780 Ga0500594_0000935 3300053118 Bacteria 6271
781 Ga0500595_003278 3300053119 Bacteria 7647
782 Ga0500608_000116 3300053122 Bacteria 32984
783 Ga0500608_000211 3300053122 Bacteria 23249
784 Ga0500608_000732 3300053122 Bacteria 11993
785 Ga0500617_068862 3300053124 Bacteria 1554
786 Ga0500618_000280 3300053125 Bacteria 39002
787 Ga0500559_0000145 3300053136 Bacteria 55410
788 Ga0500586_000313 3300053145 Bacteria 9663
789 Ga0500588_0012319 3300053146 Bacteria 2117
790 Ga0500604_0021066 3300053151 Bacteria 1840
791 Ga0500622_0002338 3300053156 Bacteria 13811
792 Ga0500622_0003917 3300053156 Bacteria 9634
793 Ga0500622_0022714 3300053156 Bacteria 3322
794 Ga0500622_0039882 3300053156 Bacteria 2447
795 Ga0500637_0101531 3300053178 Bacteria 1668
796 Ga0590071_022348 3300059421 Bacteria 1493
797 Ga0466962_0015795 3300061719 Bacteria 3642
798 Ga0466962_0198985 3300061719 Bacteria 979

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2643221559 2643815988 277
2 iso_pu_bacteria 2643221573 2643881399 277
3 iso_pu_bacteria 2643221586 2643939537 277
4 iso_pu_bacteria 2643221612 2644078212 277
5 iso_pu_bacteria 2643221720 2644662172 277
6 iso_pu_bacteria 2643221727 2644696515 277
7 iso_pu_bacteria 2643221728 2644700314 277
8 3300005548 Ga0070665_100003266 Ga0070665_10000326615 279
9 3300009545 Ga0105237_10106776 Ga0105237_101067761 279
10 3300010375 Ga0105239_10058037 Ga0105239_100580374 279
11 3300025914 Ga0207671_10216961 Ga0207671_102169612 279
12 3300028379 Ga0268266_10001411 Ga0268266_1000141122 279
13 3300045049 Ga0466959_0004407 Ga0466959_0004407_8188_9027 279
14 3300053178 Ga0500637_0101531 Ga0500637_0101531_57_896 279
15 iso_pu_bacteria 2582581280 2585153395 279
16 iso_pu_bacteria 2582581293 2585196768 279
17 iso_pu_bacteria 2643221552 2643782997 279
18 iso_pu_bacteria 2643221584 2643930393 279
19 iso_pu_bacteria 2818991435 2819537787 279
20 iso_pu_bacteria 2818991454 2819647564 279
21 3300005340 Ga0070689_100257008 Ga0070689_1002570082 280
22 3300005438 Ga0070701_10002132 Ga0070701_100021323 280
23 3300005441 Ga0070700_100045227 Ga0070700_1000452273 280
24 3300005444 Ga0070694_100036163 Ga0070694_1000361632 280
25 3300005549 Ga0070704_100002860 Ga0070704_1000028608 280
26 3300005719 Ga0068861_100095476 Ga0068861_1000954762 280
27 3300005844 Ga0068862_100026878 Ga0068862_1000268783 280
28 3300006844 Ga0075428_100027193 Ga0075428_1000271933 280
29 3300006880 Ga0075429_100026571 Ga0075429_1000265714 280
30 3300007076 Ga0075435_100113822 Ga0075435_1001138222 280
31 3300009094 Ga0111539_10173374 Ga0111539_101733742 280
32 3300009553 Ga0105249_10765058 Ga0105249_107650582 280
33 3300021361 Ga0213872_10001690 Ga0213872_1000169014 280
34 3300021361 Ga0213872_10003254 Ga0213872_100032545 280
35 3300025936 Ga0207670_10072490 Ga0207670_100724902 280
36 3300026075 Ga0207708_10023681 Ga0207708_100236814 280
37 3300026118 Ga0207675_100003896 Ga0207675_1000038966 280
38 3300027695 Ga0209966_1003002 Ga0209966_10030022 280
39 3300027907 Ga0207428_10096658 Ga0207428_100966583 280
40 3300028380 Ga0268265_10022305 Ga0268265_100223053 280
41 3300037312 Ga0395899_0000003 Ga0395899_0000003_532606_533448 280
42 3300039447 Ga0436361_0142459 Ga0436361_0142459_27938_28780 280
43 3300039447 Ga0436361_0243746 Ga0436361_0243746_2619_3461 280
44 3300039447 Ga0436361_0663918 Ga0436361_0663918_1032_1874 280
45 3300039447 Ga0436361_0909588 Ga0436361_0909588_166_1008 280
46 3300041997 Ga0439431_0076158 Ga0439431_0076158_21_863 280
47 3300044656 Ga0466969_0073091 Ga0466969_0073091_778_1620 280
48 3300044683 Ga0466965_0213851 Ga0466965_0213851_80_922 280
49 3300045049 Ga0466959_0131816 Ga0466959_0131816_224_1066 280
50 3300050508 nmdc:mga09592_34828_c1 nmdc:mga09592_34828_c1_2232_3074 280
51 3300050511 nmdc:mga08y16_63626_c1 nmdc:mga08y16_63626_c1_2835_3677 280
52 3300050513 nmdc:mga0rr50_104404_c1 nmdc:mga0rr50_104404_c1_792_1655 280
53 3300059421 Ga0590071_022348 Ga0590071_022348_316_1164 280
54 iso_pu_bacteria 2747842501 2748017005 280
55 iso_pu_bacteria 2818991457 2819662052 280
56 iso_pu_bacteria 2852684882 2852688723 280
57 iso_pu_bacteria 2919130084 2919133395 280
58 iso_pu_bacteria 2929195423 2929195527 280
59 iso_pu_bacteria 8002869464 8002872498 280
60 iso_pu_bacteria 8021622325 8021622689 280
61 iso_pu_bacteria 8021648035 8021650932 280
62 3300003771 Ga0055526_1029113 Ga0055526_10291132 281
63 3300003794 Ga0055531_10005918 Ga0055531_100059182 281
64 3300003794 Ga0055531_10009486 Ga0055531_100094862 281
65 3300015689 Ga0183360_10001 Ga0183360_100012951 281
66 3300025273 Ga0209673_1058763 Ga0209673_10587631 281
67 3300025284 Ga0209130_1002048 Ga0209130_10020487 281
68 3300025292 Ga0209676_1001677 Ga0209676_100167711 281
69 3300025292 Ga0209676_1001964 Ga0209676_10019642 281
70 3300025294 Ga0209025_1001683 Ga0209025_10016837 281
71 3300025297 Ga0209758_1058238 Ga0209758_10582382 281
72 3300025298 Ga0209050_1009864 Ga0209050_10098642 281
73 3300025298 Ga0209050_1012124 Ga0209050_10121243 281
74 3300025299 Ga0209256_1001003 Ga0209256_100100311 281
75 3300025303 Ga0209051_1010153 Ga0209051_10101532 281
76 3300025304 Ga0209257_1000261 Ga0209257_100026114 281
77 3300025304 Ga0209257_1000548 Ga0209257_10005483 281
78 3300025304 Ga0209257_1001489 Ga0209257_100148915 281
79 3300025304 Ga0209257_1008476 Ga0209257_10084763 281
80 3300028794 Ga0307515_10046926 Ga0307515_100469267 281
81 3300031995 Ga0307409_100529500 Ga0307409_1005295002 281
82 3300033180 Ga0307510_10071530 Ga0307510_100715303 281
83 3300042015 Ga0439462_0007287 Ga0439462_0007287_1797_2642 281
84 3300046616 Ga0495668_0002001 Ga0495668_0002001_16566_17411 281
85 3300049579 Ga0501043_0003380 Ga0501043_0003380_10454_11299 281
86 3300049581 Ga0501047_0188715 Ga0501047_0188715_472_1323 281
87 3300050510 nmdc:mga06r32_481666_c1 nmdc:mga06r32_481666_c1_340_1194 281
88 3300053124 Ga0500617_068862 Ga0500617_068862_685_1536 281
89 3300053146 Ga0500588_0012319 Ga0500588_0012319_371_1222 281
90 3300053151 Ga0500604_0021066 Ga0500604_0021066_782_1633 281
91 3300053156 Ga0500622_0003917 Ga0500622_0003917_1685_2536 281
92 3300053156 Ga0500622_0039882 Ga0500622_0039882_1588_2433 281
93 iso_pu_bacteria 2928972540 2928975285 281
94 iso_pu_bacteria 2977240413 2977241727 281
95 3300002739 JGI25158J39367_1003149 JGI25158J39367_10031492 282
96 3300002773 JGI25152J39213_1000004 JGI25152J39213_100000413 282
97 3300002773 JGI25152J39213_1000188 JGI25152J39213_100018816 282
98 3300002774 JGI25150J39212_1000338 JGI25150J39212_10003384 282
99 3300002774 JGI25150J39212_1001502 JGI25150J39212_10015026 282
100 3300002774 JGI25150J39212_1014869 JGI25150J39212_10148691 282
101 3300002987 JGI25159J45721_1004310 JGI25159J45721_10043103 282
102 3300002987 JGI25159J45721_1012739 JGI25159J45721_10127392 282
103 3300003187 JGI25151J46595_10000010 JGI25151J46595_1000001013 282
104 3300003215 JGI25153J46596_10000013 JGI25153J46596_1000001313 282
105 3300003322 rootL2_10027242 rootL2_1002724218 282
106 3300003322 rootL2_10188467 rootL2_101884671 282
107 3300003354 JGI25160J50197_1019420 JGI25160J50197_10194202 282
108 3300003575 Ga0007409J51694_1027346 Ga0007409J51694_10273461 282
109 3300003759 Ga0055525_1000008 Ga0055525_100000888 282
110 3300003763 Ga0055529_1000421 Ga0055529_100042132 282
111 3300003771 Ga0055526_1000025 Ga0055526_100002572 282
112 3300003771 Ga0055526_1001631 Ga0055526_100163112 282
113 3300003771 Ga0055526_1001917 Ga0055526_100191713 282
114 3300003771 Ga0055526_1002815 Ga0055526_10028152 282
115 3300003771 Ga0055526_1004482 Ga0055526_10044822 282
116 3300003773 Ga0055537_1000004 Ga0055537_100000430 282
117 3300003773 Ga0055537_1000340 Ga0055537_100034012 282
118 3300003775 Ga0055524_1001695 Ga0055524_10016953 282
119 3300003775 Ga0055524_1004092 Ga0055524_10040923 282
120 3300003775 Ga0055524_1027176 Ga0055524_10271762 282
121 3300003784 Ga0055534_1000069 Ga0055534_10000699 282
122 3300003784 Ga0055534_1000216 Ga0055534_100021610 282
123 3300003790 Ga0055528_1000141 Ga0055528_10001419 282
124 3300003790 Ga0055528_1000203 Ga0055528_100020339 282
125 3300003791 Ga0055530_10000166 Ga0055530_1000016622 282
126 3300003791 Ga0055530_10001740 Ga0055530_100017406 282
127 3300003791 Ga0055530_10021404 Ga0055530_100214042 282
128 3300003791 Ga0055530_10021642 Ga0055530_100216421 282
129 3300003791 Ga0055530_10032757 Ga0055530_100327572 282
130 3300003794 Ga0055531_10000053 Ga0055531_1000005353 282
131 3300003794 Ga0055531_10009495 Ga0055531_100094955 282
132 3300003794 Ga0055531_10014313 Ga0055531_100143133 282
133 3300003794 Ga0055531_10044908 Ga0055531_100449081 282
134 3300004625 Ga0055543_1001580 Ga0055543_10015805 282
135 3300004625 Ga0055543_1026194 Ga0055543_10261941 282
136 3300004625 Ga0055543_1026202 Ga0055543_10262021 282
137 3300005262 Ga0065165_1000003 Ga0065165_1000003326 282
138 3300005262 Ga0065165_1001826 Ga0065165_100182612 282
139 3300005262 Ga0065165_1060666 Ga0065165_10606661 282
140 3300005262 Ga0065165_1060668 Ga0065165_10606681 282
141 3300005289 Ga0065704_10070417 Ga0065704_1007041711 282
142 3300005293 Ga0065715_10032639 Ga0065715_100326391 282
143 3300005327 Ga0070658_10197790 Ga0070658_101977902 282
144 3300005328 Ga0070676_10101877 Ga0070676_101018772 282
145 3300005329 Ga0070683_100168049 Ga0070683_1001680492 282
146 3300005330 Ga0070690_100010591 Ga0070690_1000105913 282
147 3300005331 Ga0070670_100055571 Ga0070670_1000555714 282
148 3300005334 Ga0068869_100279216 Ga0068869_1002792162 282
149 3300005336 Ga0070680_100037517 Ga0070680_1000375172 282
150 3300005339 Ga0070660_100015374 Ga0070660_1000153742 282
151 3300005339 Ga0070660_100028787 Ga0070660_1000287872 282
152 3300005340 Ga0070689_100008730 Ga0070689_1000087305 282
153 3300005344 Ga0070661_100007078 Ga0070661_1000070786 282
154 3300005344 Ga0070661_100012297 Ga0070661_1000122974 282
155 3300005347 Ga0070668_100604702 Ga0070668_1006047021 282
156 3300005353 Ga0070669_100166503 Ga0070669_1001665032 282
157 3300005355 Ga0070671_100086877 Ga0070671_1000868773 282
158 3300005355 Ga0070671_100132780 Ga0070671_1001327802 282
159 3300005356 Ga0070674_100090274 Ga0070674_1000902742 282
160 3300005364 Ga0070673_100284811 Ga0070673_1002848111 282
161 3300005364 Ga0070673_100302315 Ga0070673_1003023152 282
162 3300005365 Ga0070688_100442259 Ga0070688_1004422591 282
163 3300005366 Ga0070659_100010441 Ga0070659_1000104418 282
164 3300005367 Ga0070667_100118327 Ga0070667_1001183272 282
165 3300005367 Ga0070667_100125929 Ga0070667_1001259292 282
166 3300005456 Ga0070678_100191696 Ga0070678_1001916962 282
167 3300005457 Ga0070662_100009401 Ga0070662_1000094014 282
168 3300005458 Ga0070681_10015337 Ga0070681_100153375 282
169 3300005458 Ga0070681_10230494 Ga0070681_102304942 282
170 3300005459 Ga0068867_100009154 Ga0068867_1000091542 282
171 3300005459 Ga0068867_100210020 Ga0068867_1002100202 282
172 3300005466 Ga0070685_10122820 Ga0070685_101228202 282
173 3300005539 Ga0068853_100013970 Ga0068853_1000139704 282
174 3300005539 Ga0068853_100290588 Ga0068853_1002905882 282
175 3300005543 Ga0070672_100002346 Ga0070672_1000023466 282
176 3300005544 Ga0070686_100048146 Ga0070686_1000481462 282
177 3300005545 Ga0070695_100040608 Ga0070695_1000406083 282
178 3300005547 Ga0070693_100032117 Ga0070693_1000321172 282
179 3300005563 Ga0068855_100113810 Ga0068855_1001138102 282
180 3300005563 Ga0068855_100131602 Ga0068855_1001316022 282
181 3300005564 Ga0070664_100055995 Ga0070664_1000559952 282
182 3300005564 Ga0070664_100092967 Ga0070664_1000929673 282
183 3300005564 Ga0070664_100239646 Ga0070664_1002396462 282
184 3300005564 Ga0070664_100461462 Ga0070664_1004614621 282
185 3300005616 Ga0068852_100093242 Ga0068852_1000932423 282
186 3300005616 Ga0068852_100162637 Ga0068852_1001626372 282
187 3300005616 Ga0068852_100749505 Ga0068852_1007495051 282
188 3300005617 Ga0068859_100137172 Ga0068859_1001371722 282
189 3300005617 Ga0068859_100153093 Ga0068859_1001530933 282
190 3300005618 Ga0068864_100020869 Ga0068864_1000208693 282
191 3300005618 Ga0068864_100143407 Ga0068864_1001434072 282
192 3300005618 Ga0068864_100282600 Ga0068864_1002826002 282
193 3300005718 Ga0068866_10322072 Ga0068866_103220721 282
194 3300005841 Ga0068863_100028480 Ga0068863_1000284802 282
195 3300005841 Ga0068863_100082400 Ga0068863_1000824003 282
196 3300005841 Ga0068863_100128359 Ga0068863_1001283592 282
197 3300005841 Ga0068863_100312509 Ga0068863_1003125092 282
198 3300005842 Ga0068858_100054049 Ga0068858_1000540493 282
199 3300005842 Ga0068858_100059362 Ga0068858_1000593622 282
200 3300005842 Ga0068858_100295151 Ga0068858_1002951512 282
201 3300005843 Ga0068860_100007275 Ga0068860_10000727512 282
202 3300005843 Ga0068860_100035180 Ga0068860_1000351804 282
203 3300005843 Ga0068860_100603133 Ga0068860_1006031332 282
204 3300005844 Ga0068862_100005471 Ga0068862_1000054718 282
205 3300005844 Ga0068862_100464386 Ga0068862_1004643861 282
206 3300006048 Ga0075363_100131301 Ga0075363_1001313012 282
207 3300006195 Ga0075366_10225749 Ga0075366_102257491 282
208 3300006237 Ga0097621_100093228 Ga0097621_1000932282 282
209 3300006237 Ga0097621_100126129 Ga0097621_1001261292 282
210 3300006353 Ga0075370_10029360 Ga0075370_100293603 282
211 3300006358 Ga0068871_100326300 Ga0068871_1003263002 282
212 3300006358 Ga0068871_100344332 Ga0068871_1003443322 282
213 3300006844 Ga0075428_100023051 Ga0075428_1000230512 282
214 3300006844 Ga0075428_100026890 Ga0075428_1000268905 282
215 3300006844 Ga0075428_100064300 Ga0075428_1000643004 282
216 3300006846 Ga0075430_100000781 Ga0075430_1000007817 282
217 3300006846 Ga0075430_100011325 Ga0075430_1000113255 282
218 3300006847 Ga0075431_100008277 Ga0075431_1000082778 282
219 3300006847 Ga0075431_100024236 Ga0075431_1000242362 282
220 3300006880 Ga0075429_100015188 Ga0075429_1000151886 282
221 3300006880 Ga0075429_100134837 Ga0075429_1001348372 282
222 3300006881 Ga0068865_100008656 Ga0068865_1000086563 282
223 3300006931 Ga0097620_100137164 Ga0097620_1001371642 282
224 3300006931 Ga0097620_100153090 Ga0097620_1001530903 282
225 3300006948 Ga0099826_10000001 Ga0099826_10000001478 282
226 3300009093 Ga0105240_10030317 Ga0105240_100303175 282
227 3300009093 Ga0105240_10186742 Ga0105240_101867422 282
228 3300009094 Ga0111539_10015945 Ga0111539_100159453 282
229 3300009094 Ga0111539_10061984 Ga0111539_100619842 282
230 3300009098 Ga0105245_10318188 Ga0105245_103181881 282
231 3300009147 Ga0114129_10003559 Ga0114129_100035599 282
232 3300009174 Ga0105241_10040937 Ga0105241_100409373 282
233 3300009174 Ga0105241_10150068 Ga0105241_101500682 282
234 3300009174 Ga0105241_10182348 Ga0105241_101823482 282
235 3300009176 Ga0105242_10083793 Ga0105242_100837932 282
236 3300009176 Ga0105242_10230971 Ga0105242_102309712 282
237 3300009177 Ga0105248_10254465 Ga0105248_102544651 282
238 3300009177 Ga0105248_10509512 Ga0105248_105095122 282
239 3300009545 Ga0105237_10080817 Ga0105237_100808173 282
240 3300009551 Ga0105238_10449427 Ga0105238_104494271 282
241 3300009553 Ga0105249_10061830 Ga0105249_100618301 282
242 3300009553 Ga0105249_10386510 Ga0105249_103865101 282
243 3300009553 Ga0105249_10726625 Ga0105249_107266252 282
244 3300010375 Ga0105239_10076657 Ga0105239_100766575 282
245 3300013104 Ga0157370_10142068 Ga0157370_101420682 282
246 3300013105 Ga0157369_10025010 Ga0157369_100250105 282
247 3300013296 Ga0157374_10202494 Ga0157374_102024942 282
248 3300013297 Ga0157378_10085334 Ga0157378_100853341 282
249 3300013297 Ga0157378_10368827 Ga0157378_103688272 282
250 3300013297 Ga0157378_10502211 Ga0157378_105022112 282
251 3300013306 Ga0163162_10000016 Ga0163162_1000001614 282
252 3300013306 Ga0163162_10023966 Ga0163162_100239667 282
253 3300013306 Ga0163162_10205197 Ga0163162_102051972 282
254 3300013306 Ga0163162_10268198 Ga0163162_102681982 282
255 3300013307 Ga0157372_10044386 Ga0157372_100443862 282
256 3300013307 Ga0157372_10317329 Ga0157372_103173292 282
257 3300013308 Ga0157375_10020927 Ga0157375_100209273 282
258 3300013308 Ga0157375_10094077 Ga0157375_100940773 282
259 3300013308 Ga0157375_10139277 Ga0157375_101392772 282
260 3300013308 Ga0157375_10175623 Ga0157375_101756232 282
261 3300013308 Ga0157375_10188956 Ga0157375_101889562 282
262 3300014325 Ga0163163_10246282 Ga0163163_102462822 282
263 3300014968 Ga0157379_10110043 Ga0157379_101100432 282
264 3300014969 Ga0157376_10223042 Ga0157376_102230421 282
265 3300015262 Ga0182007_10000117 Ga0182007_1000011739 282
266 3300015265 Ga0182005_1000220 Ga0182005_10002206 282
267 3300021361 Ga0213872_10023069 Ga0213872_100230693 282
268 3300021384 Ga0213876_10000119 Ga0213876_100001193 282
269 3300021384 Ga0213876_10000246 Ga0213876_1000024615 282
270 3300025208 Ga0209436_100176 Ga0209436_10017627 282
271 3300025208 Ga0209436_107040 Ga0209436_1070402 282
272 3300025230 Ga0209563_100003 Ga0209563_1000031172 282
273 3300025245 Ga0207425_1000015 Ga0207425_1000015277 282
274 3300025245 Ga0207425_1000125 Ga0207425_10001257 282
275 3300025245 Ga0207425_1000357 Ga0207425_100035712 282
276 3300025253 Ga0209677_105361 Ga0209677_1053613 282
277 3300025254 Ga0209148_1000933 Ga0209148_10009335 282
278 3300025258 Ga0209129_1000074 Ga0209129_1000074158 282
279 3300025258 Ga0209129_1004558 Ga0209129_10045583 282
280 3300025263 Ga0209565_1000018 Ga0209565_100001845 282
281 3300025263 Ga0209565_1000033 Ga0209565_1000033167 282
282 3300025263 Ga0209565_1001039 Ga0209565_100103910 282
283 3300025263 Ga0209565_1005044 Ga0209565_10050443 282
284 3300025272 Ga0209455_1000026 Ga0209455_1000026248 282
285 3300025273 Ga0209673_1000062 Ga0209673_100006299 282
286 3300025273 Ga0209673_1000090 Ga0209673_1000090132 282
287 3300025273 Ga0209673_1025985 Ga0209673_10259852 282
288 3300025284 Ga0209130_1000036 Ga0209130_10000367 282
289 3300025284 Ga0209130_1005135 Ga0209130_10051353 282
290 3300025284 Ga0209130_1015427 Ga0209130_10154271 282
291 3300025291 Ga0209675_1000005 Ga0209675_100000545 282
292 3300025291 Ga0209675_1000018 Ga0209675_100001812 282
293 3300025291 Ga0209675_1003025 Ga0209675_10030253 282
294 3300025292 Ga0209676_1000031 Ga0209676_1000031162 282
295 3300025292 Ga0209676_1000052 Ga0209676_1000052172 282
296 3300025292 Ga0209676_1000095 Ga0209676_100009593 282
297 3300025294 Ga0209025_1000002 Ga0209025_10000021175 282
298 3300025294 Ga0209025_1010456 Ga0209025_10104564 282
299 3300025295 Ga0209564_1000027 Ga0209564_1000027106 282
300 3300025295 Ga0209564_1000078 Ga0209564_1000078219 282
301 3300025295 Ga0209564_1000637 Ga0209564_100063720 282
302 3300025295 Ga0209564_1001694 Ga0209564_10016943 282
303 3300025295 Ga0209564_1004422 Ga0209564_10044223 282
304 3300025295 Ga0209564_1004530 Ga0209564_10045306 282
305 3300025297 Ga0209758_1000003 Ga0209758_10000031182 282
306 3300025297 Ga0209758_1001071 Ga0209758_100107116 282
307 3300025297 Ga0209758_1001141 Ga0209758_10011414 282
308 3300025298 Ga0209050_1000087 Ga0209050_1000087110 282
309 3300025298 Ga0209050_1000320 Ga0209050_100032056 282
310 3300025298 Ga0209050_1009917 Ga0209050_10099172 282
311 3300025299 Ga0209256_1000601 Ga0209256_100060138 282
312 3300025302 Ga0207426_1001256 Ga0207426_100125615 282
313 3300025302 Ga0207426_1066773 Ga0207426_10667731 282
314 3300025303 Ga0209051_1001827 Ga0209051_100182714 282
315 3300025303 Ga0209051_1019763 Ga0209051_10197633 282
316 3300025304 Ga0209257_1000010 Ga0209257_1000010246 282
317 3300025304 Ga0209257_1000046 Ga0209257_1000046239 282
318 3300025304 Ga0209257_1000050 Ga0209257_1000050268 282
319 3300025304 Ga0209257_1000136 Ga0209257_1000136132 282
320 3300025304 Ga0209257_1000153 Ga0209257_100015370 282
321 3300025304 Ga0209257_1002549 Ga0209257_10025496 282
322 3300025304 Ga0209257_1010260 Ga0209257_10102605 282
323 3300025728 Ga0207655_1013138 Ga0207655_10131384 282
324 3300025728 Ga0207655_1015127 Ga0207655_10151273 282
325 3300025735 Ga0207713_1004235 Ga0207713_10042356 282
326 3300025900 Ga0207710_10068171 Ga0207710_100681712 282
327 3300025901 Ga0207688_10015900 Ga0207688_100159004 282
328 3300025908 Ga0207643_10065422 Ga0207643_100654222 282
329 3300025911 Ga0207654_10032083 Ga0207654_100320832 282
330 3300025912 Ga0207707_10012317 Ga0207707_100123174 282
331 3300025912 Ga0207707_10189362 Ga0207707_101893622 282
332 3300025913 Ga0207695_10013070 Ga0207695_100130708 282
333 3300025913 Ga0207695_10188865 Ga0207695_101888652 282
334 3300025919 Ga0207657_10002453 Ga0207657_1000245311 282
335 3300025925 Ga0207650_10055501 Ga0207650_100555013 282
336 3300025926 Ga0207659_10126747 Ga0207659_101267472 282
337 3300025932 Ga0207690_10039847 Ga0207690_100398473 282
338 3300025933 Ga0207706_10004937 Ga0207706_100049374 282
339 3300025933 Ga0207706_10262663 Ga0207706_102626631 282
340 3300025933 Ga0207706_10391533 Ga0207706_103915331 282
341 3300025934 Ga0207686_10062107 Ga0207686_100621072 282
342 3300025936 Ga0207670_10014543 Ga0207670_100145433 282
343 3300025937 Ga0207669_10098411 Ga0207669_100984112 282
344 3300025937 Ga0207669_10286246 Ga0207669_102862461 282
345 3300025938 Ga0207704_10025489 Ga0207704_100254892 282
346 3300025940 Ga0207691_10014770 Ga0207691_100147704 282
347 3300025940 Ga0207691_10372510 Ga0207691_103725101 282
348 3300025941 Ga0207711_10087686 Ga0207711_100876862 282
349 3300025942 Ga0207689_10107680 Ga0207689_101076802 282
350 3300025942 Ga0207689_10315296 Ga0207689_103152962 282
351 3300025945 Ga0207679_10313986 Ga0207679_103139862 282
352 3300025945 Ga0207679_10630670 Ga0207679_106306701 282
353 3300025949 Ga0207667_10046098 Ga0207667_100460983 282
354 3300025961 Ga0207712_10039699 Ga0207712_100396991 282
355 3300026023 Ga0207677_10102195 Ga0207677_101021953 282
356 3300026023 Ga0207677_10213404 Ga0207677_102134042 282
357 3300026035 Ga0207703_10155527 Ga0207703_101555272 282
358 3300026035 Ga0207703_10180792 Ga0207703_101807922 282
359 3300026041 Ga0207639_10086407 Ga0207639_100864072 282
360 3300026041 Ga0207639_10302238 Ga0207639_103022382 282
361 3300026078 Ga0207702_10104122 Ga0207702_101041222 282
362 3300026088 Ga0207641_10086807 Ga0207641_100868072 282
363 3300026088 Ga0207641_10117884 Ga0207641_101178841 282
364 3300026088 Ga0207641_10142337 Ga0207641_101423372 282
365 3300026089 Ga0207648_10010182 Ga0207648_100101824 282
366 3300026095 Ga0207676_10468578 Ga0207676_104685782 282
367 3300026116 Ga0207674_10524150 Ga0207674_105241501 282
368 3300026118 Ga0207675_100003322 Ga0207675_1000033227 282
369 3300026121 Ga0207683_10010779 Ga0207683_100107796 282
370 3300026121 Ga0207683_10053241 Ga0207683_100532412 282
371 3300027666 Ga0209282_1000001 Ga0209282_10000011616 282
372 3300028380 Ga0268265_10002277 Ga0268265_100022776 282
373 3300028380 Ga0268265_10204253 Ga0268265_102042532 282
374 3300028381 Ga0268264_10008154 Ga0268264_100081543 282
375 3300028381 Ga0268264_10015656 Ga0268264_100156565 282
376 3300028381 Ga0268264_10104266 Ga0268264_101042661 282
377 3300028381 Ga0268264_10130613 Ga0268264_101306132 282
378 3300028381 Ga0268264_10256730 Ga0268264_102567302 282
379 3300028800 Ga0265338_10004919 Ga0265338_100049192 282
380 3300028800 Ga0265338_10022222 Ga0265338_100222224 282
381 3300030731 Ga0316177_1189032 Ga0316177_11890326 282
382 3300030742 Ga0316183_1141288 Ga0316183_11412882 282
383 3300030745 Ga0316182_1235230 Ga0316182_12352302 282
384 3300031235 Ga0265330_10038918 Ga0265330_100389182 282
385 3300031238 Ga0265332_10056130 Ga0265332_100561302 282
386 3300031247 Ga0265340_10000072 Ga0265340_1000007211 282
387 3300031247 Ga0265340_10018477 Ga0265340_100184773 282
388 3300031249 Ga0265339_10125700 Ga0265339_101257002 282
389 3300031251 Ga0265327_10000039 Ga0265327_10000039139 282
390 3300031251 Ga0265327_10098827 Ga0265327_100988272 282
391 3300031344 Ga0265316_10043250 Ga0265316_100432502 282
392 3300031344 Ga0265316_10057899 Ga0265316_100578993 282
393 3300031344 Ga0265316_10125186 Ga0265316_101251862 282
394 3300031456 Ga0307513_10012392 Ga0307513_100123929 282
395 3300031456 Ga0307513_10097214 Ga0307513_100972142 282
396 3300031548 Ga0307408_100000618 Ga0307408_1000006189 282
397 3300031548 Ga0307408_100001729 Ga0307408_1000017292 282
398 3300031548 Ga0307408_100002147 Ga0307408_1000021475 282
399 3300031548 Ga0307408_100007999 Ga0307408_1000079992 282
400 3300031548 Ga0307408_100016004 Ga0307408_1000160043 282
401 3300031548 Ga0307408_100303217 Ga0307408_1003032172 282
402 3300031548 Ga0307408_100493011 Ga0307408_1004930112 282
403 3300031711 Ga0265314_10011526 Ga0265314_100115264 282
404 3300031711 Ga0265314_10076430 Ga0265314_100764302 282
405 3300031712 Ga0265342_10027636 Ga0265342_100276362 282
406 3300031712 Ga0265342_10071229 Ga0265342_100712292 282
407 3300031730 Ga0307516_10029535 Ga0307516_100295352 282
408 3300031730 Ga0307516_10041993 Ga0307516_100419934 282
409 3300031731 Ga0307405_10003199 Ga0307405_100031996 282
410 3300031824 Ga0307413_10000617 Ga0307413_100006177 282
411 3300031852 Ga0307410_10232651 Ga0307410_102326512 282
412 3300031901 Ga0307406_10004595 Ga0307406_100045956 282
413 3300031901 Ga0307406_10067913 Ga0307406_100679132 282
414 3300031903 Ga0307407_10003220 Ga0307407_100032202 282
415 3300031911 Ga0307412_10095811 Ga0307412_100958112 282
416 3300031995 Ga0307409_100006208 Ga0307409_1000062082 282
417 3300031995 Ga0307409_100012834 Ga0307409_1000128342 282
418 3300032002 Ga0307416_100718177 Ga0307416_1007181771 282
419 3300032004 Ga0307414_10073765 Ga0307414_100737652 282
420 3300032004 Ga0307414_10317538 Ga0307414_103175381 282
421 3300032005 Ga0307411_10001591 Ga0307411_100015918 282
422 3300032005 Ga0307411_10136718 Ga0307411_101367182 282
423 3300032126 Ga0307415_100067617 Ga0307415_1000676172 282
424 3300032126 Ga0307415_100624907 Ga0307415_1006249071 282
425 3300033179 Ga0307507_10182699 Ga0307507_101826991 282
426 3300033179 Ga0307507_10184722 Ga0307507_101847223 282
427 3300037312 Ga0395899_0000012 Ga0395899_0000012_54291_55139 282
428 3300037312 Ga0395899_0073557 Ga0395899_0073557_1424_2272 282
429 3300037418 Ga0395900_0000028 Ga0395900_0000028_135083_135931 282
430 3300037418 Ga0395900_0002683 Ga0395900_0002683_12777_13625 282
431 3300037418 Ga0395900_0012863 Ga0395900_0012863_369_1217 282
432 3300037418 Ga0395900_0014052 Ga0395900_0014052_5367_6215 282
433 3300037418 Ga0395900_0054335 Ga0395900_0054335_468_1316 282
434 3300037418 Ga0395900_0064343 Ga0395900_0064343_810_1703 282
435 3300037466 Ga0395898_0019762 Ga0395898_0019762_1082_1930 282
436 3300037471 Ga0395905_0044068 Ga0395905_0044068_1326_2174 282
437 3300038443 Ga0395901_0000076 Ga0395901_0000076_45712_46560 282
438 3300038443 Ga0395901_0151064 Ga0395901_0151064_1085_1933 282
439 3300038443 Ga0395901_0260964 Ga0395901_0260964_36_929 282
440 3300038443 Ga0395901_0398871 Ga0395901_0398871_86_934 282
441 3300038443 Ga0395901_0538581 Ga0395901_0538581_319_1167 282
442 3300038705 Ga0237819_00007 Ga0237819_00007_59186_60034 282
443 3300039145 Ga0237816_00241 Ga0237816_00241_3215_4063 282
444 3300039437 Ga0436365_0213934 Ga0436365_0213934_19708_20556 282
445 3300039437 Ga0436365_1476328 Ga0436365_1476328_41641_42489 282
446 3300039447 Ga0436361_0166535 Ga0436361_0166535_153_1001 282
447 3300039447 Ga0436361_1221194 Ga0436361_1221194_1667_2515 282
448 3300041413 Ga0439465_0056709 Ga0439465_0056709_168_1016 282
449 3300041451 Ga0451791_0321965 Ga0451791_0321965_821_1669 282
450 3300041451 Ga0451791_0753430 Ga0451791_0753430_113_961 282
451 3300041458 Ga0451798_1100220 Ga0451798_1100220_121_969 282
452 3300041460 Ga0451802_0228891 Ga0451802_0228891_2984_3832 282
453 3300041486 Ga0451807_0617128 Ga0451807_0617128_264_1112 282
454 3300041498 Ga0451841_1039072 Ga0451841_1039072_799_1647 282
455 3300041505 Ga0451849_0981658 Ga0451849_0981658_691_1539 282
456 3300041507 Ga0451851_0837399 Ga0451851_0837399_12_860 282
457 3300041509 Ga0451843_0711483 Ga0451843_0711483_1240_2088 282
458 3300042001 Ga0439441_006718 Ga0439441_006718_560_1408 282
459 3300042005 Ga0439448_0001122 Ga0439448_0001122_3549_4397 282
460 3300042007 Ga0439449_0000020 Ga0439449_0000020_11146_11994 282
461 3300042007 Ga0439449_0005395 Ga0439449_0005395_3465_4313 282
462 3300042008 Ga0439450_021695 Ga0439450_021695_209_1057 282
463 3300042012 Ga0439455_0015456 Ga0439455_0015456_349_1197 282
464 3300042142 Ga0450905_003641 Ga0450905_003641_834_1682 282
465 3300042156 Ga0439446_0014462 Ga0439446_0014462_262_1110 282
466 3300042876 Ga0451577_0002991 Ga0451577_0002991_5822_6670 282
467 3300044656 Ga0466969_0137000 Ga0466969_0137000_236_1084 282
468 3300044656 Ga0466969_0145177 Ga0466969_0145177_211_1059 282
469 3300044658 Ga0466972_0042178 Ga0466972_0042178_1185_2033 282
470 3300044683 Ga0466965_0022517 Ga0466965_0022517_513_1379 282
471 3300044683 Ga0466965_0063752 Ga0466965_0063752_787_1635 282
472 3300044683 Ga0466965_0089841 Ga0466965_0089841_650_1498 282
473 3300044684 Ga0466966_0000485 Ga0466966_0000485_11496_12344 282
474 3300044684 Ga0466966_0001407 Ga0466966_0001407_12654_13502 282
475 3300044684 Ga0466966_0008459 Ga0466966_0008459_3189_4055 282
476 3300044684 Ga0466966_0024383 Ga0466966_0024383_3075_3923 282
477 3300044684 Ga0466966_0088665 Ga0466966_0088665_620_1468 282
478 3300044684 Ga0466966_0164455 Ga0466966_0164455_477_1325 282
479 3300044693 Ga0466961_0053821 Ga0466961_0053821_736_1584 282
480 3300044693 Ga0466961_0309010 Ga0466961_0309010_32_880 282
481 3300044694 Ga0466963_0063269 Ga0466963_0063269_1127_1975 282
482 3300044706 Ga0466964_0000150 Ga0466964_0000150_5787_6635 282
483 3300044706 Ga0466964_0039462 Ga0466964_0039462_564_1412 282
484 3300044712 Ga0453684_0184554 Ga0453684_0184554_197_1045 282
485 3300044719 Ga0466971_0181499 Ga0466971_0181499_74_922 282
486 3300044735 Ga0466968_0003732 Ga0466968_0003732_3532_4380 282
487 3300044735 Ga0466968_0153620 Ga0466968_0153620_135_983 282
488 3300044842 Ga0466957_0000034 Ga0466957_0000034_26802_27650 282
489 3300044842 Ga0466957_0089264 Ga0466957_0089264_47_895 282
490 3300044901 Ga0466960_0037123 Ga0466960_0037123_233_1081 282
491 3300045049 Ga0466959_0017396 Ga0466959_0017396_3644_4492 282
492 3300045836 Ga0466958_0027005 Ga0466958_0027005_821_1687 282
493 3300045836 Ga0466958_0244519 Ga0466958_0244519_113_961 282
494 3300045976 Ga0466967_0027232 Ga0466967_0027232_701_1549 282
495 3300045976 Ga0466967_0064392 Ga0466967_0064392_1060_1932 282
496 3300045976 Ga0466967_0360582 Ga0466967_0360582_133_981 282
497 3300046453 Ga0495627_000015 Ga0495627_000015_147908_148756 282
498 3300046460 Ga0495638_0000198 Ga0495638_0000198_23578_24426 282
499 3300046460 Ga0495638_0000528 Ga0495638_0000528_5804_6673 282
500 3300046460 Ga0495638_0002732 Ga0495638_0002732_10340_11200 282
501 3300046460 Ga0495638_0003082 Ga0495638_0003082_7204_8052 282
502 3300046460 Ga0495638_0005851 Ga0495638_0005851_2997_3845 282
503 3300046460 Ga0495638_0007341 Ga0495638_0007341_4302_5225 282
504 3300046471 Ga0495650_0000577 Ga0495650_0000577_26983_27831 282
505 3300046473 Ga0495582_0036642 Ga0495582_0036642_1139_1987 282
506 3300046474 Ga0495605_0000112 Ga0495605_0000112_67345_68193 282
507 3300046474 Ga0495605_0001495 Ga0495605_0001495_13276_14136 282
508 3300046474 Ga0495605_0002051 Ga0495605_0002051_4864_5712 282
509 3300046491 Ga0495584_0008989 Ga0495584_0008989_207_1067 282
510 3300046491 Ga0495584_0030374 Ga0495584_0030374_607_1455 282
511 3300046492 Ga0495585_0019583 Ga0495585_0019583_1643_2503 282
512 3300046500 Ga0495596_0000088 Ga0495596_0000088_27495_28343 282
513 3300046501 Ga0495607_0001299 Ga0495607_0001299_18654_19517 282
514 3300046501 Ga0495607_0001443 Ga0495607_0001443_3339_4187 282
515 3300046501 Ga0495607_0035808 Ga0495607_0035808_1416_2276 282
516 3300046501 Ga0495607_0118720 Ga0495607_0118720_530_1378 282
517 3300046506 Ga0495583_0000029 Ga0495583_0000029_64795_65643 282
518 3300046506 Ga0495583_0000253 Ga0495583_0000253_38200_39060 282
519 3300046506 Ga0495583_0000265 Ga0495583_0000265_61741_62589 282
520 3300046506 Ga0495583_0014108 Ga0495583_0014108_1590_2453 282
521 3300046507 Ga0495606_0005061 Ga0495606_0005061_1153_2001 282
522 3300046507 Ga0495606_0025238 Ga0495606_0025238_3227_4075 282
523 3300046512 Ga0495610_0000040 Ga0495610_0000040_76644_77567 282
524 3300046512 Ga0495610_0000176 Ga0495610_0000176_172_1020 282
525 3300046512 Ga0495610_0001501 Ga0495610_0001501_18107_18955 282
526 3300046512 Ga0495610_0004463 Ga0495610_0004463_29_877 282
527 3300046512 Ga0495610_0011821 Ga0495610_0011821_3105_3953 282
528 3300046513 Ga0495616_0000016 Ga0495616_0000016_70732_71583 282
529 3300046513 Ga0495616_0000283 Ga0495616_0000283_17888_18748 282
530 3300046513 Ga0495616_0000572 Ga0495616_0000572_16294_17142 282
531 3300046513 Ga0495616_0001503 Ga0495616_0001503_11402_12250 282
532 3300046513 Ga0495616_0025050 Ga0495616_0025050_2273_3121 282
533 3300046513 Ga0495616_0025258 Ga0495616_0025258_1236_2099 282
534 3300046513 Ga0495616_0029452 Ga0495616_0029452_1731_2579 282
535 3300046513 Ga0495616_0095276 Ga0495616_0095276_268_1191 282
536 3300046518 Ga0495631_0010788 Ga0495631_0010788_740_1588 282
537 3300046519 Ga0495632_0000597 Ga0495632_0000597_5977_6828 282
538 3300046519 Ga0495632_0009670 Ga0495632_0009670_4007_4855 282
539 3300046519 Ga0495632_0016087 Ga0495632_0016087_1668_2516 282
540 3300046520 Ga0495637_0015323 Ga0495637_0015323_1837_2685 282
541 3300046522 Ga0495643_0000106 Ga0495643_0000106_106344_107192 282
542 3300046522 Ga0495643_0000621 Ga0495643_0000621_20813_21661 282
543 3300046522 Ga0495643_0001053 Ga0495643_0001053_14058_14906 282
544 3300046522 Ga0495643_0012735 Ga0495643_0012735_1482_2330 282
545 3300046522 Ga0495643_0050938 Ga0495643_0050938_1236_2084 282
546 3300046523 Ga0495644_0006644 Ga0495644_0006644_341_1189 282
547 3300046523 Ga0495644_0017977 Ga0495644_0017977_766_1626 282
548 3300046524 Ga0495648_0000087 Ga0495648_0000087_58693_59541 282
549 3300046524 Ga0495648_0000238 Ga0495648_0000238_12775_13635 282
550 3300046525 Ga0495663_0000769 Ga0495663_0000769_7773_8621 282
551 3300046525 Ga0495663_0024921 Ga0495663_0024921_572_1420 282
552 3300046525 Ga0495663_0062151 Ga0495663_0062151_246_1094 282
553 3300046526 Ga0495666_0040795 Ga0495666_0040795_1147_2013 282
554 3300046528 Ga0495642_0005083 Ga0495642_0005083_627_1475 282
555 3300046528 Ga0495642_0005528 Ga0495642_0005528_3513_4376 282
556 3300046530 Ga0495654_0016427 Ga0495654_0016427_3014_3865 282
557 3300046530 Ga0495654_0026485 Ga0495654_0026485_292_1152 282
558 3300046535 Ga0495586_0010495 Ga0495586_0010495_1008_1874 282
559 3300046538 Ga0495609_0000001 Ga0495609_0000001_581751_582599 282
560 3300046538 Ga0495609_0000241 Ga0495609_0000241_18018_18878 282
561 3300046538 Ga0495609_0000420 Ga0495609_0000420_15385_16248 282
562 3300046538 Ga0495609_0024711 Ga0495609_0024711_1518_2366 282
563 3300046538 Ga0495609_0026119 Ga0495609_0026119_1797_2645 282
564 3300046538 Ga0495609_0049273 Ga0495609_0049273_578_1429 282
565 3300046538 Ga0495609_0118781 Ga0495609_0118781_261_1109 282
566 3300046542 Ga0495597_0000119 Ga0495597_0000119_20638_21486 282
567 3300046543 Ga0495645_0126180 Ga0495645_0126180_249_1097 282
568 3300046557 Ga0495622_0000084 Ga0495622_0000084_48465_49313 282
569 3300046558 Ga0495633_0000187 Ga0495633_0000187_43890_44738 282
570 3300046558 Ga0495633_0005872 Ga0495633_0005872_282_1130 282
571 3300046558 Ga0495633_0012294 Ga0495633_0012294_1221_2069 282
572 3300046558 Ga0495633_0037894 Ga0495633_0037894_1238_2086 282
573 3300046615 Ga0495656_0005629 Ga0495656_0005629_1550_2410 282
574 3300046615 Ga0495656_0025112 Ga0495656_0025112_210_1058 282
575 3300046615 Ga0495656_0047249 Ga0495656_0047249_492_1340 282
576 3300046616 Ga0495668_0000239 Ga0495668_0000239_43076_43924 282
577 3300046616 Ga0495668_0008395 Ga0495668_0008395_1872_2720 282
578 3300046616 Ga0495668_0009316 Ga0495668_0009316_3310_4158 282
579 3300046616 Ga0495668_0021485 Ga0495668_0021485_1103_1966 282
580 3300046616 Ga0495668_0038810 Ga0495668_0038810_94_942 282
581 3300046616 Ga0495668_0176551 Ga0495668_0176551_103_954 282
582 3300046660 Ga0495625_0000038 Ga0495625_0000038_162728_163576 282
583 3300046660 Ga0495625_0000800 Ga0495625_0000800_37437_38360 282
584 3300046660 Ga0495625_0001311 Ga0495625_0001311_14272_15120 282
585 3300046660 Ga0495625_0001665 Ga0495625_0001665_9868_10728 282
586 3300046660 Ga0495625_0010857 Ga0495625_0010857_3101_3964 282
587 3300046660 Ga0495625_0018893 Ga0495625_0018893_4493_5341 282
588 3300046660 Ga0495625_0075315 Ga0495625_0075315_687_1535 282
589 3300046660 Ga0495625_0255681 Ga0495625_0255681_274_1122 282
590 3300046660 Ga0495625_0275782 Ga0495625_0275782_135_983 282
591 3300046664 Ga0495659_0000550 Ga0495659_0000550_8013_8876 282
592 3300046664 Ga0495659_0001060 Ga0495659_0001060_5564_6424 282
593 3300046665 Ga0495661_0000069 Ga0495661_0000069_37803_38651 282
594 3300046665 Ga0495661_0002091 Ga0495661_0002091_7083_7931 282
595 3300046665 Ga0495661_0010282 Ga0495661_0010282_3612_4472 282
596 3300046665 Ga0495661_0068928 Ga0495661_0068928_1154_2041 282
597 3300046674 Ga0495588_0000041 Ga0495588_0000041_76758_77606 282
598 3300046675 Ga0495657_0165041 Ga0495657_0165041_270_1118 282
599 3300046683 Ga0495658_0078222 Ga0495658_0078222_846_1694 282
600 3300046684 Ga0495669_0000341 Ga0495669_0000341_10672_11535 282
601 3300046684 Ga0495669_0003613 Ga0495669_0003613_1077_1925 282
602 3300046691 Ga0495670_0000114 Ga0495670_0000114_18941_19801 282
603 3300046691 Ga0495670_0047159 Ga0495670_0047159_1207_2055 282
604 3300046692 Ga0495671_0008482 Ga0495671_0008482_3981_4841 282
605 3300046692 Ga0495671_0020050 Ga0495671_0020050_938_1798 282
606 3300046694 Ga0495649_0000263 Ga0495649_0000263_19784_20632 282
607 3300046694 Ga0495649_0006606 Ga0495649_0006606_2969_3817 282
608 3300046694 Ga0495649_0037609 Ga0495649_0037609_978_1841 282
609 3300046794 Ga0495589_0000061 Ga0495589_0000061_97738_98586 282
610 3300046794 Ga0495589_0000165 Ga0495589_0000165_17383_18231 282
611 3300046794 Ga0495589_0007854 Ga0495589_0007854_510_1358 282
612 3300046810 Ga0495660_0000104 Ga0495660_0000104_29161_30009 282
613 3300046810 Ga0495660_0000450 Ga0495660_0000450_4671_5519 282
614 3300046810 Ga0495660_0002266 Ga0495660_0002266_7556_8407 282
615 3300046810 Ga0495660_0002391 Ga0495660_0002391_10537_11385 282
616 3300046810 Ga0495660_0002719 Ga0495660_0002719_3938_4786 282
617 3300046810 Ga0495660_0011168 Ga0495660_0011168_1630_2478 282
618 3300046810 Ga0495660_0063322 Ga0495660_0063322_544_1395 282
619 3300046810 Ga0495660_0098847 Ga0495660_0098847_561_1409 282
620 3300047315 Ga0495581_0107833 Ga0495581_0107833_30_878 282
621 3300047318 Ga0495636_0000720 Ga0495636_0000720_8947_9807 282
622 3300047318 Ga0495636_0016558 Ga0495636_0016558_978_1841 282
623 3300047319 Ga0495674_0257315 Ga0495674_0257315_437_1285 282
624 3300047320 Ga0495672_0000141 Ga0495672_0000141_37462_38310 282
625 3300047320 Ga0495672_0000214 Ga0495672_0000214_58326_59174 282
626 3300047320 Ga0495672_0000264 Ga0495672_0000264_25045_25905 282
627 3300047320 Ga0495672_0002375 Ga0495672_0002375_6395_7282 282
628 3300047320 Ga0495672_0018604 Ga0495672_0018604_149_1009 282
629 3300047323 Ga0495683_0003920 Ga0495683_0003920_1576_2436 282
630 3300047323 Ga0495683_0029748 Ga0495683_0029748_33_881 282
631 3300047443 Ga0495687_000027 Ga0495687_000027_240023_240871 282
632 3300047443 Ga0495687_000062 Ga0495687_000062_140713_141573 282
633 3300047443 Ga0495687_000477 Ga0495687_000477_27508_28356 282
634 3300047443 Ga0495687_003359 Ga0495687_003359_6260_7108 282
635 3300047443 Ga0495687_005981 Ga0495687_005981_5546_6394 282
636 3300047443 Ga0495687_008705 Ga0495687_008705_3927_4790 282
637 3300047445 Ga0495677_0000001 Ga0495677_0000001_240104_240952 282
638 3300047445 Ga0495677_0032369 Ga0495677_0032369_383_1231 282
639 3300047445 Ga0495677_0040336 Ga0495677_0040336_153_1013 282
640 3300047445 Ga0495677_0083918 Ga0495677_0083918_289_1137 282
641 3300047446 Ga0495679_008042 Ga0495679_008042_2811_3659 282
642 3300047446 Ga0495679_030531 Ga0495679_030531_164_1027 282
643 3300047447 Ga0495685_000658 Ga0495685_000658_4935_5795 282
644 3300047447 Ga0495685_037386 Ga0495685_037386_109_972 282
645 3300047469 Ga0495673_0000056 Ga0495673_0000056_229028_229876 282
646 3300047469 Ga0495673_0000785 Ga0495673_0000785_24029_24889 282
647 3300047470 Ga0495681_0005660 Ga0495681_0005660_2748_3611 282
648 3300047472 Ga0495686_0087287 Ga0495686_0087287_50_898 282
649 3300047472 Ga0495686_0253113 Ga0495686_0253113_108_956 282
650 3300048090 Ga0495615_0060260 Ga0495615_0060260_126_974 282
651 3300048091 Ga0495626_0000101 Ga0495626_0000101_73444_74292 282
652 3300048091 Ga0495626_0000135 Ga0495626_0000135_32470_33318 282
653 3300048903 Ga0496100_0190941 Ga0496100_0190941_616_1464 282
654 3300048905 Ga0496102_0046604 Ga0496102_0046604_1902_2774 282
655 3300048906 Ga0496103_0229792 Ga0496103_0229792_214_1086 282
656 3300048907 Ga0496104_0262415 Ga0496104_0262415_541_1389 282
657 3300048909 Ga0496106_0006892 Ga0496106_0006892_3245_4093 282
658 3300048910 Ga0496107_0000095 Ga0496107_0000095_16135_16983 282
659 3300048910 Ga0496107_0014761 Ga0496107_0014761_1665_2513 282
660 3300048910 Ga0496107_0136204 Ga0496107_0136204_568_1440 282
661 3300048910 Ga0496107_0343847 Ga0496107_0343847_57_905 282
662 3300048917 Ga0496114_0000254 Ga0496114_0000254_4951_5799 282
663 3300048919 Ga0496116_0001111 Ga0496116_0001111_29131_29979 282
664 3300048919 Ga0496116_0086580 Ga0496116_0086580_659_1507 282
665 3300048920 Ga0496117_0001300 Ga0496117_0001300_18685_19533 282
666 3300048921 Ga0496118_0000703 Ga0496118_0000703_25805_26653 282
667 3300048921 Ga0496118_0028073 Ga0496118_0028073_119_967 282
668 3300048922 Ga0496119_0000301 Ga0496119_0000301_1982_2830 282
669 3300048923 Ga0496120_0000402 Ga0496120_0000402_1982_2830 282
670 3300048924 Ga0496121_0001883 Ga0496121_0001883_21927_22775 282
671 3300048924 Ga0496121_0129712 Ga0496121_0129712_771_1619 282
672 3300048925 Ga0496122_0001165 Ga0496122_0001165_12626_13519 282
673 3300048925 Ga0496122_0029671 Ga0496122_0029671_682_1530 282
674 3300048926 Ga0496123_0000933 Ga0496123_0000933_37446_38294 282
675 3300048926 Ga0496123_0046819 Ga0496123_0046819_1445_2338 282
676 3300048927 Ga0496124_0000009 Ga0496124_0000009_662435_663283 282
677 3300048927 Ga0496124_0010055 Ga0496124_0010055_5146_6030 282
678 3300048927 Ga0496124_0015900 Ga0496124_0015900_6207_7055 282
679 3300048927 Ga0496124_0030252 Ga0496124_0030252_423_1271 282
680 3300048927 Ga0496124_0224003 Ga0496124_0224003_43_891 282
681 3300048928 Ga0496125_0036606 Ga0496125_0036606_383_1231 282
682 3300048928 Ga0496125_0049747 Ga0496125_0049747_517_1365 282
683 3300048928 Ga0496125_0072611 Ga0496125_0072611_1575_2468 282
684 3300048929 Ga0496126_0001069 Ga0496126_0001069_38510_39358 282
685 3300049459 Ga0495678_000101 Ga0495678_000101_66286_67134 282
686 3300049459 Ga0495678_000663 Ga0495678_000663_11577_12437 282
687 3300049459 Ga0495678_002168 Ga0495678_002168_3812_4681 282
688 3300049459 Ga0495678_005468 Ga0495678_005468_4487_5335 282
689 3300049459 Ga0495678_016807 Ga0495678_016807_2304_3152 282
690 3300049460 Ga0495682_0000208 Ga0495682_0000208_19029_19889 282
691 3300049513 Ga0501290_006438 Ga0501290_006438_592_1440 282
692 3300049523 Ga0501300_006036 Ga0501300_006036_160_1008 282
693 3300049568 Ga0501031_0074753 Ga0501031_0074753_1259_2125 282
694 3300049570 Ga0501033_0002089 Ga0501033_0002089_15373_16224 282
695 3300049571 Ga0501034_0000941 Ga0501034_0000941_22996_23844 282
696 3300049571 Ga0501034_0022534 Ga0501034_0022534_4982_5830 282
697 3300049571 Ga0501034_0041427 Ga0501034_0041427_2985_3836 282
698 3300049571 Ga0501034_0506354 Ga0501034_0506354_202_1050 282
699 3300049572 Ga0501036_0170755 Ga0501036_0170755_669_1529 282
700 3300049573 Ga0501037_0008198 Ga0501037_0008198_1713_2573 282
701 3300049573 Ga0501037_0119238 Ga0501037_0119238_528_1376 282
702 3300049574 Ga0501038_0383623 Ga0501038_0383623_180_1028 282
703 3300049579 Ga0501043_0288261 Ga0501043_0288261_388_1236 282
704 3300049580 Ga0501046_0037641 Ga0501046_0037641_2743_3591 282
705 3300049581 Ga0501047_0195530 Ga0501047_0195530_879_1727 282
706 3300049583 Ga0501067_0000227 Ga0501067_0000227_24578_25438 282
707 3300049584 Ga0501068_0000343 Ga0501068_0000343_3905_4765 282
708 3300049589 Ga0501073_0000004 Ga0501073_0000004_121058_121918 282
709 3300049593 Ga0501077_0000008 Ga0501077_0000008_102243_103103 282
710 3300049665 Ga0501227_011098 Ga0501227_011098_896_1744 282
711 3300049705 Ga0501225_0000492 Ga0501225_0000492_1007_1855 282
712 3300049742 Ga0501080_0009522 Ga0501080_0009522_346_1206 282
713 3300049762 Ga0501265_000739 Ga0501265_000739_1037_1885 282
714 3300049766 Ga0501269_000056 Ga0501269_000056_1211_2059 282
715 3300049766 Ga0501269_005452 Ga0501269_005452_110_958 282
716 3300049772 Ga0501275_000047 Ga0501275_000047_4795_5643 282
717 3300049775 Ga0501279_000629 Ga0501279_000629_1371_2219 282
718 3300049822 Ga0501035_0002949 Ga0501035_0002949_14784_15632 282
719 3300049822 Ga0501035_0115049 Ga0501035_0115049_1011_1859 282
720 3300049823 Ga0501044_0000588 Ga0501044_0000588_5911_6762 282
721 3300049823 Ga0501044_0000868 Ga0501044_0000868_14812_15672 282
722 3300049823 Ga0501044_0092393 Ga0501044_0092393_851_1699 282
723 3300050493 nmdc:mga0k408_41107_c1 nmdc:mga0k408_41107_c1_1452_2300 282
724 3300050496 nmdc:mga07m45_24650_c1 nmdc:mga07m45_24650_c1_113_961 282
725 3300050507 nmdc:mga05p37_956_c1 nmdc:mga05p37_956_c1_31036_31905 282
726 3300050508 nmdc:mga09592_25900_c1 nmdc:mga09592_25900_c1_818_1687 282
727 3300050509 nmdc:mga0qj67_552_c1 nmdc:mga0qj67_552_c1_9894_10763 282
728 3300050509 nmdc:mga0qj67_9622_c1 nmdc:mga0qj67_9622_c1_391_1260 282
729 3300050510 nmdc:mga06r32_32159_c1 nmdc:mga06r32_32159_c1_346_1215 282
730 3300050510 nmdc:mga06r32_6360_c1 nmdc:mga06r32_6360_c1_4898_5767 282
731 3300050511 nmdc:mga08y16_109087_c1 nmdc:mga08y16_109087_c1_560_1438 282
732 3300050511 nmdc:mga08y16_143378_c1 nmdc:mga08y16_143378_c1_1330_2199 282
733 3300053085 Ga0495619_0193001 Ga0495619_0193001_79_927 282
734 3300053086 Ga0500578_0000030 Ga0500578_0000030_129247_130095 282
735 3300053092 Ga0500583_0082371 Ga0500583_0082371_117_965 282
736 3300053094 Ga0500566_0056165 Ga0500566_0056165_224_1072 282
737 3300053104 Ga0500556_0002628 Ga0500556_0002628_144_992 282
738 3300053108 Ga0500562_015346 Ga0500562_015346_240_1088 282
739 3300053108 Ga0500562_049318 Ga0500562_049318_124_972 282
740 3300053118 Ga0500594_0000037 Ga0500594_0000037_26807_27655 282
741 3300053118 Ga0500594_0000935 Ga0500594_0000935_1544_2413 282
742 3300053119 Ga0500595_003278 Ga0500595_003278_4934_5782 282
743 3300053122 Ga0500608_000116 Ga0500608_000116_18388_19236 282
744 3300053125 Ga0500618_000280 Ga0500618_000280_38086_38934 282
745 3300053136 Ga0500559_0000145 Ga0500559_0000145_43423_44271 282
746 3300053145 Ga0500586_000313 Ga0500586_000313_492_1340 282
747 3300053156 Ga0500622_0002338 Ga0500622_0002338_10022_10870 282
748 3300053156 Ga0500622_0022714 Ga0500622_0022714_904_1755 282
749 3300061719 Ga0466962_0198985 Ga0466962_0198985_85_933 282
750 iso_pu_bacteria 2739367756 2739790957 282
751 3300005577 Ga0068857_100462902 Ga0068857_1004629022 283
752 3300009545 Ga0105237_10461892 Ga0105237_104618921 283
753 3300010375 Ga0105239_10147561 Ga0105239_101475612 283
754 3300013104 Ga0157370_10003641 Ga0157370_100036412 283
755 3300013105 Ga0157369_10131297 Ga0157369_101312972 283
756 3300032004 Ga0307414_10244180 Ga0307414_102441801 283
757 3300042005 Ga0439448_0024166 Ga0439448_0024166_892_1788 283
758 3300044706 Ga0466964_0000506 Ga0466964_0000506_6575_7468 283
759 3300044842 Ga0466957_0011693 Ga0466957_0011693_1471_2364 283
760 3300046524 Ga0495648_0005883 Ga0495648_0005883_8988_9896 283
761 3300046665 Ga0495661_0000181 Ga0495661_0000181_13110_14018 283
762 3300047443 Ga0495687_000254 Ga0495687_000254_37547_38452 283
763 3300048903 Ga0496100_0254821 Ga0496100_0254821_248_1144 283
764 3300048908 Ga0496105_0035928 Ga0496105_0035928_2616_3512 283
765 3300048913 Ga0496110_0463667 Ga0496110_0463667_146_1042 283
766 3300048928 Ga0496125_0003869 Ga0496125_0003869_164_1024 283
767 2162886007 SwRhRL2b_contig_2926702 SwRhRL2b_0178.00004840 284
768 3300003856 Ga0058692_1000118 Ga0058692_100011849 284
769 3300005289 Ga0065704_10070983 Ga0065704_100709832 284
770 3300005331 Ga0070670_100000769 Ga0070670_10000076913 284
771 3300006195 Ga0075366_10001034 Ga0075366_100010344 284
772 3300009011 Ga0105251_10000412 Ga0105251_100004126 284
773 3300009148 Ga0105243_10000196 Ga0105243_1000019663 284
774 3300013104 Ga0157370_10037845 Ga0157370_100378454 284
775 3300015684 Ga0183365_10001 Ga0183365_100011035 284
776 3300025735 Ga0207713_1000385 Ga0207713_100038543 284
777 3300025925 Ga0207650_10008931 Ga0207650_100089311 284
778 3300025935 Ga0207709_10000504 Ga0207709_1000050439 284
779 3300027312 Ga0209371_1000332 Ga0209371_100033247 284
780 3300028800 Ga0265338_10049015 Ga0265338_100490152 284
781 3300030500 Ga0268256_1000285 Ga0268256_100028547 284
782 3300037471 Ga0395905_0000022 Ga0395905_0000022_201019_201882 284
783 3300041453 Ga0451797_1321202 Ga0451797_1321202_122_976 284
784 3300041459 Ga0451800_0742652 Ga0451800_0742652_8737_9591 284
785 3300041462 Ga0451806_158657 Ga0451806_158657_3200_4054 284
786 3300041463 Ga0451804_0269081 Ga0451804_0269081_1565_2419 284
787 3300041486 Ga0451807_2291444 Ga0451807_2291444_1836_2690 284
788 3300044656 Ga0466969_0038583 Ga0466969_0038583_1232_2095 284
789 3300044684 Ga0466966_0001440 Ga0466966_0001440_2353_3216 284
790 3300044693 Ga0466961_0041956 Ga0466961_0041956_1115_1978 284
791 3300044694 Ga0466963_0105135 Ga0466963_0105135_686_1549 284
792 3300045049 Ga0466959_0000096 Ga0466959_0000096_44505_45368 284
793 3300045836 Ga0466958_0003281 Ga0466958_0003281_6274_7137 284
794 3300046453 Ga0495627_000464 Ga0495627_000464_25760_26716 284
795 3300046500 Ga0495596_0003086 Ga0495596_0003086_3440_4348 284
796 3300046506 Ga0495583_0005424 Ga0495583_0005424_4317_5225 284
797 3300046513 Ga0495616_0005078 Ga0495616_0005078_1879_2787 284
798 3300046518 Ga0495631_0003199 Ga0495631_0003199_3158_4066 284
799 3300046522 Ga0495643_0006828 Ga0495643_0006828_4409_5317 284
800 3300046528 Ga0495642_0000126 Ga0495642_0000126_29654_30556 284
801 3300046528 Ga0495642_0002587 Ga0495642_0002587_3292_4200 284
802 3300046538 Ga0495609_0003048 Ga0495609_0003048_1607_2515 284
803 3300046558 Ga0495633_0041303 Ga0495633_0041303_89_1045 284
804 3300046616 Ga0495668_0000715 Ga0495668_0000715_14887_15795 284
805 3300046648 Ga0495611_0000226 Ga0495611_0000226_14606_15514 284
806 3300046660 Ga0495625_0000099 Ga0495625_0000099_130845_131801 284
807 3300046665 Ga0495661_0007418 Ga0495661_0007418_528_1436 284
808 3300046794 Ga0495589_0011973 Ga0495589_0011973_942_1850 284
809 3300047323 Ga0495683_0021841 Ga0495683_0021841_1183_2091 284
810 3300048091 Ga0495626_0000745 Ga0495626_0000745_10242_11120 284
811 3300048927 Ga0496124_0001841 Ga0496124_0001841_25195_26241 284
812 3300049460 Ga0495682_0004343 Ga0495682_0004343_203_1111 284
813 3300049570 Ga0501033_0215834 Ga0501033_0215834_228_1091 284
814 3300049570 Ga0501033_0247093 Ga0501033_0247093_373_1236 284
815 3300049571 Ga0501034_0037613 Ga0501034_0037613_1205_2065 284
816 3300049822 Ga0501035_0111486 Ga0501035_0111486_1222_2085 284
817 3300050493 nmdc:mga0k408_361_c1 nmdc:mga0k408_361_c1_11309_12163 284
818 3300053086 Ga0500578_0000041 Ga0500578_0000041_66881_67837 284
819 3300053093 Ga0500651_0000205 Ga0500651_0000205_16387_17277 284
820 3300053122 Ga0500608_000211 Ga0500608_000211_6850_7740 284
821 3300053122 Ga0500608_000732 Ga0500608_000732_9184_10044 284
822 3300061719 Ga0466962_0015795 Ga0466962_0015795_2563_3426 284
823 iso_pu_bacteria 2643221583 2643925506 284
824 iso_pu_bacteria 2643221691 2644510424 284

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04962

KduI

KduI/IolB family

31

276

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
1xru-assembly1.cif.gz_A crystal structure of 5-keto-4-deoxyuronate isomerase from eschericia coli 0.9697 11 284
1x8m-assembly1.cif.gz_A x-ray structure of pectin degrading enzyme 5-keto 4-deoxyuronate isomerase from escherichia coli 0.9665 11 272
7yrs-assembly4.cif.gz_D crystal structure of lactobacillus rhamnosus 4-deoxy-l-threo-5-hexosulose-uronate ketol-isomerase kdui complexed with mops 0.9619 9 269
1ywk-assembly6.cif.gz_F crystal structure of 4-deoxy-1-threo-5-hexosulose-uronate ketol-isomerase from enterococcus faecalis 0.9608 9 268
1ywk-assembly3.cif.gz_C crystal structure of 4-deoxy-1-threo-5-hexosulose-uronate ketol-isomerase from enterococcus faecalis 0.9608 9 267
ID Description Score Start End Superfamily
1x8mA02 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9742 151 272 2.60.120.10
af_Q46938_25_265_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9699 30 271 2.60.120.10
af_Q46938_25_265_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.962 30 271 2.60.120.10
1ywkB00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9607 9 268 2.60.120.10
1xruB01 Mainly Beta;Sandwich;Jelly Rolls;pectin degrading enzyme 5-keto 4- deoxyuronate isomerase, domain 1 0.9343 43 149 2.60.120.520
ID Description Score Start End GO Terms
AF-A0A484YH81-F1-model_v4 5-keto-4-deoxyuronate isomerase (EC 5.3.1.17) 0.9961 75 147 GO:0008697
GO:0019698
GO:0042840
GO:0045490
GO:0046872
AF-A0A0M1KQH6-F1-model_v4 deleted 0.9953 51 284
AF-A0A0Q8FH16-F1-model_v4 5-dehydro-4-deoxy-D-glucuronate isomerase (EC 5.3.1.17) 0.9924 16 284 GO:0008697
GO:0019698
GO:0042840
GO:0045490
GO:0046872
AF-A0A4Q3RVT9-F1-model_v4 5-dehydro-4-deoxy-D-glucuronate isomerase (EC 5.3.1.17) 0.9922 86 284 GO:0008697
GO:0019698
GO:0042840
GO:0045490
GO:0046872
AF-A0A4Q3VTK0-F1-model_v4 5-dehydro-4-deoxy-D-glucuronate isomerase (EC 5.3.1.17) 0.9908 76 284 GO:0008697
GO:0019698
GO:0042840
GO:0045490
GO:0046872

Feature Viewer

pLDDT pTM Quality
93.48 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map