F482398
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 824 | 409 | 798 | 284 |
Family's Representative Sequence
| Representative Sequence | 3300042015|Ga0439462_0007287|Ga0439462_0007287_1797_2642 |
| Length | 281 |
| Sequence | MFRKTYHATHPDMMVGASNDQLRERYLIDGLFVPGQVVLNYSHNERFVIGGAAPTTAPVSLPQQTEPASAAGKPFLERRELGIVNVGAGTGTVTVDGASFTLAPKDGLYVPMGSSDVQFASNDAATPAKFYLASTPAHARFEAKHISIAQAVPLERGALETSNERTIYQYIVPATCKSCQLLLGLTVLKTGSVWNTMPPHLHDRRSEVYFYFDLGDQSVMHFMGEPADMRHLVIRNDEAVVSPPWSIHMGSGTRNYCFIWAMGGENLDYTDMHQLDLCQLK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2582581280 | Caulobacter henricii CF287 | Isolate | Rhizosphere |
| 3 | 2582581293 | Caulobacter henricii YR570 | Isolate | Rhizosphere |
| 4 | 2643221552 | Caulobacter sp. Root1472 | Isolate | Unclassified |
| 5 | 2643221559 | Lysobacter sp. Root559 | Isolate | Unclassified |
| 6 | 2643221573 | Lysobacter sp. Root604 | Isolate | Unclassified |
| 7 | 2643221583 | Caulobacter sp. Root655 | Isolate | Unclassified |
| 8 | 2643221584 | Caulobacter sp. Root656 | Isolate | Unclassified |
| 9 | 2643221586 | Lysobacter sp. Root667 | Isolate | Unclassified |
| 10 | 2643221612 | Lysobacter sp. Root76 | Isolate | Unclassified |
| 11 | 2643221691 | Caulobacter sp. Root487D2Y | Isolate | Unclassified |
| 12 | 2643221720 | Lysobacter sp. Root916 | Isolate | Unclassified |
| 13 | 2643221727 | Lysobacter sp. Root96 | Isolate | Unclassified |
| 14 | 2643221728 | Lysobacter sp. Root983 | Isolate | Unclassified |
| 15 | 2739367756 | Asticcacaulis sp. CF398 | Isolate | Unclassified |
| 16 | 2747842501 | Xanthomonas sp. WCS2014-23 | Isolate | Unclassified |
| 17 | 2818991435 | Caulobacter henricii 536 | Isolate | Unclassified |
| 18 | 2818991454 | Caulobacter rhizosphaerae 3260 | Isolate | Rhizosphere |
| 19 | 2818991457 | Xanthomonas translucens 569 | Isolate | Unclassified |
| 20 | 2852684882 | Xanthomonas sp. JAI131 | Isolate | Rhizosphere |
| 21 | 2919130084 | Xanthomonas sp. 1678 | Isolate | Rhizosphere |
| 22 | 2928972540 | Brevundimonas sp. 1080 | Isolate | Rhizosphere |
| 23 | 2929195423 | Xanthomonas sp. R-73098 Hybrid assembly | Isolate | Unclassified |
| 24 | 2977240413 | Brevundimonas vesicularis SORGH_AS 431 | Isolate | Unclassified |
| 25 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 26 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 27 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 28 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 29 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 30 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 31 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 32 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 33 | 3300003575 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 34 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 35 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 36 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 37 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 38 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 39 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 40 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 41 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 42 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 43 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 44 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 45 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 46 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 47 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 48 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 52 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 54 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 55 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 57 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 64 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 67 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 68 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 69 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 72 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 73 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 74 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 75 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 77 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 78 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 81 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 82 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 84 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 85 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 86 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 87 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 88 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 89 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 90 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 91 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 92 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 93 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 94 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 95 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 97 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 98 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 99 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 100 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 101 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 102 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 103 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 105 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 106 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 130 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 131 | 3300015684 | Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.2_F02 | Metagenome | Unclassified |
| 132 | 3300015689 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 | Metagenome | Rhizosphere |
| 133 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 134 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 135 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 138 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 139 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 140 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 141 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 142 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 143 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 144 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 145 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 146 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 147 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 148 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 149 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 150 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 151 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 152 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 153 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 154 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 155 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 193 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 195 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 199 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 200 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 201 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 202 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 203 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 204 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 205 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 206 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 207 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 208 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 209 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 210 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 211 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 212 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 213 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 214 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 215 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 216 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 217 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 218 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 219 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 220 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 221 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 222 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 223 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 224 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 225 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 226 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 227 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 228 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 229 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 230 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 231 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 232 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 233 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 234 | 3300039145 | Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 | Metagenome | Unclassified |
| 235 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 236 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 237 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 238 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 239 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 240 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 241 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 242 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 243 | 3300041462 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG | Metagenome | Rhizoplane |
| 244 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 245 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 246 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 247 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 248 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 249 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 250 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 251 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 252 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 253 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 254 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 255 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 256 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 257 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 258 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 259 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 260 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 261 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 262 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 263 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 264 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 265 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 266 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 267 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 268 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 269 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 270 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 271 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 272 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 273 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 274 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 275 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 334 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 335 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 336 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 337 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 338 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 339 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 340 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 341 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 342 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 343 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 344 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 345 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 346 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 347 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 348 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 349 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 350 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 351 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 352 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 353 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 356 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 357 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 358 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 359 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 360 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 361 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 362 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 363 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 364 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 365 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 366 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 367 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 368 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 369 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 370 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 371 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 372 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 373 | 3300049762 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control | Metagenome | Rhizosphere |
| 374 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 375 | 3300049772 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control | Metagenome | Rhizosphere |
| 376 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 377 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 378 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 379 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 380 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 381 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 382 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 383 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 384 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 385 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 386 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 387 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 389 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 390 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 391 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 392 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 393 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 394 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 395 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 396 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 397 | 3300053124 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere | Metagenome | Endosphere |
| 398 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 399 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 400 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 401 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 402 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 403 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 404 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 405 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 406 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 407 | 8002869464 | Pseudoxanthomonas helianthi 110414 | Isolate | Unclassified |
| 408 | 8021622325 | Xanthomonas sp. LMG12462 | Isolate | Rhizosphere |
| 409 | 8021648035 | Xanthomonas sp. LMG 12461 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.72 |
| Metatranscriptomes | 0.12 |
| Isolates | 3.16 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 17.6 |
| Nodule | 0.24 |
| Rhizoplane | 2.79 |
| Rhizosphere | 71.72 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.65 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_2926702 | 2162886007 | Bacteria | 9446 |
| 2 | JGI25158J39367_1003149 | 3300002739 | Bacteria | 2584 |
| 3 | JGI25152J39213_1000004 | 3300002773 | Bacteria | 191383 |
| 4 | JGI25152J39213_1000188 | 3300002773 | Bacteria | 41653 |
| 5 | JGI25150J39212_1000338 | 3300002774 | Bacteria | 23091 |
| 6 | JGI25150J39212_1001502 | 3300002774 | Bacteria | 6443 |
| 7 | JGI25150J39212_1014869 | 3300002774 | Bacteria | 1310 |
| 8 | JGI25159J45721_1004310 | 3300002987 | Bacteria | 4756 |
| 9 | JGI25159J45721_1012739 | 3300002987 | Bacteria | 1985 |
| 10 | JGI25151J46595_10000010 | 3300003187 | Bacteria | 277507 |
| 11 | JGI25153J46596_10000013 | 3300003215 | Bacteria | 303690 |
| 12 | rootL2_10027242 | 3300003322 | Bacteria | 30675 |
| 13 | rootL2_10188467 | 3300003322 | Bacteria | 1471 |
| 14 | JGI25160J50197_1019420 | 3300003354 | Bacteria | 2083 |
| 15 | Ga0007409J51694_1027346 | 3300003575 | Bacteria | 996 |
| 16 | Ga0055525_1000008 | 3300003759 | Bacteria | 604287 |
| 17 | Ga0055529_1000421 | 3300003763 | Bacteria | 43457 |
| 18 | Ga0055526_1000025 | 3300003771 | Bacteria | 154279 |
| 19 | Ga0055526_1001631 | 3300003771 | Bacteria | 15752 |
| 20 | Ga0055526_1001917 | 3300003771 | Bacteria | 14393 |
| 21 | Ga0055526_1002815 | 3300003771 | Bacteria | 11518 |
| 22 | Ga0055526_1004482 | 3300003771 | Bacteria | 8370 |
| 23 | Ga0055526_1029113 | 3300003771 | Bacteria | 1650 |
| 24 | Ga0055537_1000004 | 3300003773 | Bacteria | 167383 |
| 25 | Ga0055537_1000340 | 3300003773 | Bacteria | 31969 |
| 26 | Ga0055524_1001695 | 3300003775 | Bacteria | 12278 |
| 27 | Ga0055524_1004092 | 3300003775 | Bacteria | 6845 |
| 28 | Ga0055524_1027176 | 3300003775 | Bacteria | 1744 |
| 29 | Ga0055534_1000069 | 3300003784 | Bacteria | 80193 |
| 30 | Ga0055534_1000216 | 3300003784 | Bacteria | 42623 |
| 31 | Ga0055528_1000141 | 3300003790 | Bacteria | 58279 |
| 32 | Ga0055528_1000203 | 3300003790 | Bacteria | 50129 |
| 33 | Ga0055530_10000166 | 3300003791 | Bacteria | 59932 |
| 34 | Ga0055530_10001740 | 3300003791 | Bacteria | 15262 |
| 35 | Ga0055530_10021404 | 3300003791 | Bacteria | 1907 |
| 36 | Ga0055530_10021642 | 3300003791 | Bacteria | 1889 |
| 37 | Ga0055530_10032757 | 3300003791 | Bacteria | 1348 |
| 38 | Ga0055531_10000053 | 3300003794 | Bacteria | 124623 |
| 39 | Ga0055531_10005918 | 3300003794 | Bacteria | 7038 |
| 40 | Ga0055531_10009486 | 3300003794 | Bacteria | 4968 |
| 41 | Ga0055531_10009495 | 3300003794 | Bacteria | 4965 |
| 42 | Ga0055531_10014313 | 3300003794 | Bacteria | 3579 |
| 43 | Ga0055531_10044908 | 3300003794 | Bacteria | 1232 |
| 44 | Ga0058692_1000118 | 3300003856 | Bacteria | 51072 |
| 45 | Ga0055543_1001580 | 3300004625 | Bacteria | 8792 |
| 46 | Ga0055543_1026194 | 3300004625 | Bacteria | 1037 |
| 47 | Ga0055543_1026202 | 3300004625 | Bacteria | 1037 |
| 48 | Ga0065165_1000003 | 3300005262 | Bacteria | 390701 |
| 49 | Ga0065165_1001826 | 3300005262 | Bacteria | 20836 |
| 50 | Ga0065165_1060666 | 3300005262 | Bacteria | 1037 |
| 51 | Ga0065165_1060668 | 3300005262 | Bacteria | 1037 |
| 52 | Ga0065704_10070417 | 3300005289 | Bacteria | 25844 |
| 53 | Ga0065704_10070983 | 3300005289 | Bacteria | 14054 |
| 54 | Ga0065715_10032639 | 3300005293 | Bacteria | 1557 |
| 55 | Ga0070658_10197790 | 3300005327 | Bacteria | 1695 |
| 56 | Ga0070676_10101877 | 3300005328 | Bacteria | 1775 |
| 57 | Ga0070683_100168049 | 3300005329 | Bacteria | 2081 |
| 58 | Ga0070690_100010591 | 3300005330 | Bacteria | 5370 |
| 59 | Ga0070670_100000769 | 3300005331 | Bacteria | 24932 |
| 60 | Ga0070670_100055571 | 3300005331 | Bacteria | 3398 |
| 61 | Ga0068869_100279216 | 3300005334 | Bacteria | 1343 |
| 62 | Ga0070680_100037517 | 3300005336 | Bacteria | 3916 |
| 63 | Ga0070660_100015374 | 3300005339 | Bacteria | 5523 |
| 64 | Ga0070660_100028787 | 3300005339 | Bacteria | 4159 |
| 65 | Ga0070689_100008730 | 3300005340 | Bacteria | 7153 |
| 66 | Ga0070689_100257008 | 3300005340 | Bacteria | 1443 |
| 67 | Ga0070661_100007078 | 3300005344 | Bacteria | 7738 |
| 68 | Ga0070661_100012297 | 3300005344 | Bacteria | 5985 |
| 69 | Ga0070668_100604702 | 3300005347 | Bacteria | 959 |
| 70 | Ga0070669_100166503 | 3300005353 | Bacteria | 1716 |
| 71 | Ga0070671_100086877 | 3300005355 | Bacteria | 2617 |
| 72 | Ga0070671_100132780 | 3300005355 | Bacteria | 2097 |
| 73 | Ga0070674_100090274 | 3300005356 | Bacteria | 2210 |
| 74 | Ga0070673_100284811 | 3300005364 | Bacteria | 1450 |
| 75 | Ga0070673_100302315 | 3300005364 | Unclassified | 1409 |
| 76 | Ga0070688_100442259 | 3300005365 | Bacteria | 970 |
| 77 | Ga0070659_100010441 | 3300005366 | Bacteria | 6830 |
| 78 | Ga0070667_100118327 | 3300005367 | Bacteria | 2303 |
| 79 | Ga0070667_100125929 | 3300005367 | Bacteria | 2232 |
| 80 | Ga0070701_10002132 | 3300005438 | Bacteria | 7527 |
| 81 | Ga0070700_100045227 | 3300005441 | Bacteria | 2715 |
| 82 | Ga0070694_100036163 | 3300005444 | Bacteria | 3270 |
| 83 | Ga0070678_100191696 | 3300005456 | Bacteria | 1681 |
| 84 | Ga0070662_100009401 | 3300005457 | Bacteria | 6389 |
| 85 | Ga0070681_10015337 | 3300005458 | Bacteria | 7624 |
| 86 | Ga0070681_10230494 | 3300005458 | Bacteria | 1766 |
| 87 | Ga0068867_100009154 | 3300005459 | Bacteria | 6988 |
| 88 | Ga0068867_100210020 | 3300005459 | Bacteria | 1563 |
| 89 | Ga0070685_10122820 | 3300005466 | Bacteria | 1614 |
| 90 | Ga0068853_100013970 | 3300005539 | Bacteria | 6568 |
| 91 | Ga0068853_100290588 | 3300005539 | Bacteria | 1509 |
| 92 | Ga0070672_100002346 | 3300005543 | Bacteria | 11965 |
| 93 | Ga0070686_100048146 | 3300005544 | Bacteria | 2700 |
| 94 | Ga0070695_100040608 | 3300005545 | Bacteria | 2946 |
| 95 | Ga0070693_100032117 | 3300005547 | Bacteria | 2884 |
| 96 | Ga0070665_100003266 | 3300005548 | Bacteria | 17393 |
| 97 | Ga0070704_100002860 | 3300005549 | Bacteria | 9785 |
| 98 | Ga0068855_100113810 | 3300005563 | Bacteria | 3103 |
| 99 | Ga0068855_100131602 | 3300005563 | Bacteria | 2857 |
| 100 | Ga0070664_100055995 | 3300005564 | Bacteria | 3350 |
| 101 | Ga0070664_100092967 | 3300005564 | Bacteria | 2612 |
| 102 | Ga0070664_100239646 | 3300005564 | Unclassified | 1628 |
| 103 | Ga0070664_100461462 | 3300005564 | Bacteria | 1167 |
| 104 | Ga0068857_100462902 | 3300005577 | Bacteria | 1187 |
| 105 | Ga0068852_100093242 | 3300005616 | Bacteria | 2699 |
| 106 | Ga0068852_100162637 | 3300005616 | Bacteria | 2085 |
| 107 | Ga0068852_100749505 | 3300005616 | Bacteria | 989 |
| 108 | Ga0068859_100137172 | 3300005617 | Bacteria | 2520 |
| 109 | Ga0068859_100153093 | 3300005617 | Bacteria | 2382 |
| 110 | Ga0068864_100020869 | 3300005618 | Bacteria | 5483 |
| 111 | Ga0068864_100143407 | 3300005618 | Bacteria | 2157 |
| 112 | Ga0068864_100282600 | 3300005618 | Bacteria | 1549 |
| 113 | Ga0068866_10322072 | 3300005718 | Bacteria | 973 |
| 114 | Ga0068861_100095476 | 3300005719 | Bacteria | 2355 |
| 115 | Ga0068863_100028480 | 3300005841 | Bacteria | 5334 |
| 116 | Ga0068863_100082400 | 3300005841 | Bacteria | 3049 |
| 117 | Ga0068863_100128359 | 3300005841 | Bacteria | 2420 |
| 118 | Ga0068863_100312509 | 3300005841 | Unclassified | 1525 |
| 119 | Ga0068858_100054049 | 3300005842 | Bacteria | 3714 |
| 120 | Ga0068858_100059362 | 3300005842 | Bacteria | 3535 |
| 121 | Ga0068858_100295151 | 3300005842 | Bacteria | 1545 |
| 122 | Ga0068860_100007275 | 3300005843 | Bacteria | 11073 |
| 123 | Ga0068860_100035180 | 3300005843 | Unclassified | 4805 |
| 124 | Ga0068860_100603133 | 3300005843 | Unclassified | 1103 |
| 125 | Ga0068862_100005471 | 3300005844 | Bacteria | 10615 |
| 126 | Ga0068862_100026878 | 3300005844 | Bacteria | 4841 |
| 127 | Ga0068862_100464386 | 3300005844 | Bacteria | 1195 |
| 128 | Ga0075363_100131301 | 3300006048 | Bacteria | 1405 |
| 129 | Ga0075366_10001034 | 3300006195 | Bacteria | 13655 |
| 130 | Ga0075366_10225749 | 3300006195 | Bacteria | 1141 |
| 131 | Ga0097621_100093228 | 3300006237 | Bacteria | 2523 |
| 132 | Ga0097621_100126129 | 3300006237 | Bacteria | 2174 |
| 133 | Ga0075370_10029360 | 3300006353 | Bacteria | 3063 |
| 134 | Ga0068871_100326300 | 3300006358 | Bacteria | 1353 |
| 135 | Ga0068871_100344332 | 3300006358 | Bacteria | 1317 |
| 136 | Ga0075428_100023051 | 3300006844 | Bacteria | 6889 |
| 137 | Ga0075428_100026890 | 3300006844 | Bacteria | 6371 |
| 138 | Ga0075428_100027193 | 3300006844 | Bacteria | 6333 |
| 139 | Ga0075428_100064300 | 3300006844 | Bacteria | 4017 |
| 140 | Ga0075430_100000781 | 3300006846 | Bacteria | 24618 |
| 141 | Ga0075430_100011325 | 3300006846 | Bacteria | 7564 |
| 142 | Ga0075431_100008277 | 3300006847 | Bacteria | 10399 |
| 143 | Ga0075431_100024236 | 3300006847 | Bacteria | 6215 |
| 144 | Ga0075429_100015188 | 3300006880 | Bacteria | 6674 |
| 145 | Ga0075429_100026571 | 3300006880 | Bacteria | 5027 |
| 146 | Ga0075429_100134837 | 3300006880 | Bacteria | 2161 |
| 147 | Ga0068865_100008656 | 3300006881 | Bacteria | 6296 |
| 148 | Ga0097620_100137164 | 3300006931 | Bacteria | 2520 |
| 149 | Ga0097620_100153090 | 3300006931 | Bacteria | 2382 |
| 150 | Ga0099826_10000001 | 3300006948 | Bacteria | 1155201 |
| 151 | Ga0075435_100113822 | 3300007076 | Bacteria | 2252 |
| 152 | Ga0105251_10000412 | 3300009011 | Bacteria | 41518 |
| 153 | Ga0105240_10030317 | 3300009093 | Bacteria | 7030 |
| 154 | Ga0105240_10186742 | 3300009093 | Bacteria | 2441 |
| 155 | Ga0111539_10015945 | 3300009094 | Bacteria | 9336 |
| 156 | Ga0111539_10061984 | 3300009094 | Bacteria | 4428 |
| 157 | Ga0111539_10173374 | 3300009094 | Bacteria | 2520 |
| 158 | Ga0105245_10318188 | 3300009098 | Bacteria | 1532 |
| 159 | Ga0114129_10003559 | 3300009147 | Bacteria | 21928 |
| 160 | Ga0105243_10000196 | 3300009148 | Bacteria | 71069 |
| 161 | Ga0105241_10040937 | 3300009174 | Bacteria | 3499 |
| 162 | Ga0105241_10150068 | 3300009174 | Bacteria | 1906 |
| 163 | Ga0105241_10182348 | 3300009174 | Bacteria | 1742 |
| 164 | Ga0105242_10083793 | 3300009176 | Bacteria | 2670 |
| 165 | Ga0105242_10230971 | 3300009176 | Bacteria | 1658 |
| 166 | Ga0105248_10254465 | 3300009177 | Bacteria | 1977 |
| 167 | Ga0105248_10509512 | 3300009177 | Bacteria | 1357 |
| 168 | Ga0105237_10080817 | 3300009545 | Bacteria | 3241 |
| 169 | Ga0105237_10106776 | 3300009545 | Bacteria | 2792 |
| 170 | Ga0105237_10461892 | 3300009545 | Bacteria | 1276 |
| 171 | Ga0105238_10449427 | 3300009551 | Bacteria | 1286 |
| 172 | Ga0105249_10061830 | 3300009553 | Bacteria | 3437 |
| 173 | Ga0105249_10386510 | 3300009553 | Bacteria | 1427 |
| 174 | Ga0105249_10726625 | 3300009553 | Unclassified | 1054 |
| 175 | Ga0105249_10765058 | 3300009553 | Bacteria | 1028 |
| 176 | Ga0105239_10058037 | 3300010375 | Bacteria | 4246 |
| 177 | Ga0105239_10076657 | 3300010375 | Bacteria | 3677 |
| 178 | Ga0105239_10147561 | 3300010375 | Bacteria | 2624 |
| 179 | Ga0157370_10003641 | 3300013104 | Bacteria | 18012 |
| 180 | Ga0157370_10037845 | 3300013104 | Bacteria | 4671 |
| 181 | Ga0157370_10142068 | 3300013104 | Bacteria | 2237 |
| 182 | Ga0157369_10025010 | 3300013105 | Bacteria | 6632 |
| 183 | Ga0157369_10131297 | 3300013105 | Bacteria | 2654 |
| 184 | Ga0157374_10202494 | 3300013296 | Bacteria | 1944 |
| 185 | Ga0157378_10085334 | 3300013297 | Bacteria | 2860 |
| 186 | Ga0157378_10368827 | 3300013297 | Bacteria | 1407 |
| 187 | Ga0157378_10502211 | 3300013297 | Bacteria | 1212 |
| 188 | Ga0163162_10000016 | 3300013306 | Bacteria | 250836 |
| 189 | Ga0163162_10023966 | 3300013306 | Bacteria | 6022 |
| 190 | Ga0163162_10205197 | 3300013306 | Bacteria | 2100 |
| 191 | Ga0163162_10268198 | 3300013306 | Bacteria | 1839 |
| 192 | Ga0157372_10044386 | 3300013307 | Bacteria | 4925 |
| 193 | Ga0157372_10317329 | 3300013307 | Bacteria | 1814 |
| 194 | Ga0157375_10020927 | 3300013308 | Bacteria | 5987 |
| 195 | Ga0157375_10094077 | 3300013308 | Bacteria | 3064 |
| 196 | Ga0157375_10139277 | 3300013308 | Bacteria | 2552 |
| 197 | Ga0157375_10175623 | 3300013308 | Bacteria | 2291 |
| 198 | Ga0157375_10188956 | 3300013308 | Bacteria | 2214 |
| 199 | Ga0163163_10246282 | 3300014325 | Bacteria | 1837 |
| 200 | Ga0157379_10110043 | 3300014968 | Bacteria | 2474 |
| 201 | Ga0157376_10223042 | 3300014969 | Bacteria | 1747 |
| 202 | Ga0182007_10000117 | 3300015262 | Bacteria | 54576 |
| 203 | Ga0182005_1000220 | 3300015265 | Bacteria | 37719 |
| 204 | Ga0183365_10001 | 3300015684 | Bacteria | 2090444 |
| 205 | Ga0183360_10001 | 3300015689 | Bacteria | 3943671 |
| 206 | Ga0213872_10001690 | 3300021361 | Bacteria | 13881 |
| 207 | Ga0213872_10003254 | 3300021361 | Bacteria | 9065 |
| 208 | Ga0213872_10023069 | 3300021361 | Bacteria | 2863 |
| 209 | Ga0213876_10000119 | 3300021384 | Bacteria | 85523 |
| 210 | Ga0213876_10000246 | 3300021384 | Bacteria | 51765 |
| 211 | Ga0209436_100176 | 3300025208 | Bacteria | 30384 |
| 212 | Ga0209436_107040 | 3300025208 | Bacteria | 2400 |
| 213 | Ga0209563_100003 | 3300025230 | Bacteria | 1932942 |
| 214 | Ga0207425_1000015 | 3300025245 | Bacteria | 466368 |
| 215 | Ga0207425_1000125 | 3300025245 | Bacteria | 72177 |
| 216 | Ga0207425_1000357 | 3300025245 | Bacteria | 31681 |
| 217 | Ga0209677_105361 | 3300025253 | Bacteria | 3368 |
| 218 | Ga0209148_1000933 | 3300025254 | Bacteria | 19249 |
| 219 | Ga0209129_1000074 | 3300025258 | Bacteria | 205648 |
| 220 | Ga0209129_1004558 | 3300025258 | Bacteria | 5343 |
| 221 | Ga0209565_1000018 | 3300025263 | Bacteria | 460940 |
| 222 | Ga0209565_1000033 | 3300025263 | Bacteria | 313960 |
| 223 | Ga0209565_1001039 | 3300025263 | Bacteria | 14093 |
| 224 | Ga0209565_1005044 | 3300025263 | Bacteria | 3903 |
| 225 | Ga0209455_1000026 | 3300025272 | Bacteria | 653778 |
| 226 | Ga0209673_1000062 | 3300025273 | Bacteria | 260727 |
| 227 | Ga0209673_1000090 | 3300025273 | Bacteria | 202223 |
| 228 | Ga0209673_1025985 | 3300025273 | Bacteria | 1934 |
| 229 | Ga0209673_1058763 | 3300025273 | Bacteria | 971 |
| 230 | Ga0209130_1000036 | 3300025284 | Bacteria | 284111 |
| 231 | Ga0209130_1002048 | 3300025284 | Bacteria | 10961 |
| 232 | Ga0209130_1005135 | 3300025284 | Bacteria | 4651 |
| 233 | Ga0209130_1015427 | 3300025284 | Bacteria | 1883 |
| 234 | Ga0209675_1000005 | 3300025291 | Bacteria | 849192 |
| 235 | Ga0209675_1000018 | 3300025291 | Bacteria | 377481 |
| 236 | Ga0209675_1003025 | 3300025291 | Bacteria | 8251 |
| 237 | Ga0209676_1000031 | 3300025292 | Bacteria | 478976 |
| 238 | Ga0209676_1000052 | 3300025292 | Bacteria | 371539 |
| 239 | Ga0209676_1000095 | 3300025292 | Bacteria | 245393 |
| 240 | Ga0209676_1001677 | 3300025292 | Bacteria | 19224 |
| 241 | Ga0209676_1001964 | 3300025292 | Bacteria | 16439 |
| 242 | Ga0209025_1000002 | 3300025294 | Bacteria | 1393142 |
| 243 | Ga0209025_1001683 | 3300025294 | Bacteria | 27024 |
| 244 | Ga0209025_1010456 | 3300025294 | Bacteria | 6283 |
| 245 | Ga0209564_1000027 | 3300025295 | Bacteria | 518458 |
| 246 | Ga0209564_1000078 | 3300025295 | Bacteria | 275766 |
| 247 | Ga0209564_1000637 | 3300025295 | Bacteria | 53200 |
| 248 | Ga0209564_1001694 | 3300025295 | Bacteria | 20890 |
| 249 | Ga0209564_1004422 | 3300025295 | Bacteria | 8609 |
| 250 | Ga0209564_1004530 | 3300025295 | Bacteria | 8445 |
| 251 | Ga0209758_1000003 | 3300025297 | Bacteria | 1398533 |
| 252 | Ga0209758_1001071 | 3300025297 | Bacteria | 35617 |
| 253 | Ga0209758_1001141 | 3300025297 | Bacteria | 34057 |
| 254 | Ga0209758_1058238 | 3300025297 | Bacteria | 1293 |
| 255 | Ga0209050_1000087 | 3300025298 | Bacteria | 261460 |
| 256 | Ga0209050_1000320 | 3300025298 | Bacteria | 96836 |
| 257 | Ga0209050_1009864 | 3300025298 | Bacteria | 4805 |
| 258 | Ga0209050_1009917 | 3300025298 | Bacteria | 4782 |
| 259 | Ga0209050_1012124 | 3300025298 | Bacteria | 3994 |
| 260 | Ga0209256_1000601 | 3300025299 | Bacteria | 49925 |
| 261 | Ga0209256_1001003 | 3300025299 | Bacteria | 33521 |
| 262 | Ga0207426_1001256 | 3300025302 | Bacteria | 22166 |
| 263 | Ga0207426_1066773 | 3300025302 | Bacteria | 1015 |
| 264 | Ga0209051_1001827 | 3300025303 | Bacteria | 16837 |
| 265 | Ga0209051_1010153 | 3300025303 | Bacteria | 4787 |
| 266 | Ga0209051_1019763 | 3300025303 | Bacteria | 2927 |
| 267 | Ga0209257_1000010 | 3300025304 | Bacteria | 1158682 |
| 268 | Ga0209257_1000046 | 3300025304 | Bacteria | 477765 |
| 269 | Ga0209257_1000050 | 3300025304 | Bacteria | 439325 |
| 270 | Ga0209257_1000136 | 3300025304 | Bacteria | 204863 |
| 271 | Ga0209257_1000153 | 3300025304 | Bacteria | 189177 |
| 272 | Ga0209257_1000261 | 3300025304 | Bacteria | 121357 |
| 273 | Ga0209257_1000548 | 3300025304 | Bacteria | 64548 |
| 274 | Ga0209257_1001489 | 3300025304 | Bacteria | 27496 |
| 275 | Ga0209257_1002549 | 3300025304 | Bacteria | 17822 |
| 276 | Ga0209257_1008476 | 3300025304 | Bacteria | 5831 |
| 277 | Ga0209257_1010260 | 3300025304 | Bacteria | 4785 |
| 278 | Ga0207655_1013138 | 3300025728 | Bacteria | 4774 |
| 279 | Ga0207655_1015127 | 3300025728 | Bacteria | 4311 |
| 280 | Ga0207713_1000385 | 3300025735 | Bacteria | 47906 |
| 281 | Ga0207713_1004235 | 3300025735 | Bacteria | 9378 |
| 282 | Ga0207710_10068171 | 3300025900 | Unclassified | 1627 |
| 283 | Ga0207688_10015900 | 3300025901 | Bacteria | 4081 |
| 284 | Ga0207643_10065422 | 3300025908 | Bacteria | 2083 |
| 285 | Ga0207654_10032083 | 3300025911 | Bacteria | 2898 |
| 286 | Ga0207707_10012317 | 3300025912 | Bacteria | 7432 |
| 287 | Ga0207707_10189362 | 3300025912 | Bacteria | 1795 |
| 288 | Ga0207695_10013070 | 3300025913 | Bacteria | 9910 |
| 289 | Ga0207695_10188865 | 3300025913 | Bacteria | 1978 |
| 290 | Ga0207671_10216961 | 3300025914 | Bacteria | 1498 |
| 291 | Ga0207657_10002453 | 3300025919 | Bacteria | 20036 |
| 292 | Ga0207650_10008931 | 3300025925 | Bacteria | 6848 |
| 293 | Ga0207650_10055501 | 3300025925 | Bacteria | 2941 |
| 294 | Ga0207659_10126747 | 3300025926 | Bacteria | 1964 |
| 295 | Ga0207690_10039847 | 3300025932 | Bacteria | 3067 |
| 296 | Ga0207706_10004937 | 3300025933 | Bacteria | 12457 |
| 297 | Ga0207706_10262663 | 3300025933 | Bacteria | 1507 |
| 298 | Ga0207706_10391533 | 3300025933 | Bacteria | 1205 |
| 299 | Ga0207686_10062107 | 3300025934 | Bacteria | 2371 |
| 300 | Ga0207709_10000504 | 3300025935 | Bacteria | 34671 |
| 301 | Ga0207670_10014543 | 3300025936 | Bacteria | 4675 |
| 302 | Ga0207670_10072490 | 3300025936 | Bacteria | 2385 |
| 303 | Ga0207669_10098411 | 3300025937 | Bacteria | 1926 |
| 304 | Ga0207669_10286246 | 3300025937 | Bacteria | 1246 |
| 305 | Ga0207704_10025489 | 3300025938 | Bacteria | 3227 |
| 306 | Ga0207691_10014770 | 3300025940 | Bacteria | 7442 |
| 307 | Ga0207691_10372510 | 3300025940 | Bacteria | 1220 |
| 308 | Ga0207711_10087686 | 3300025941 | Bacteria | 2731 |
| 309 | Ga0207689_10107680 | 3300025942 | Bacteria | 2290 |
| 310 | Ga0207689_10315296 | 3300025942 | Bacteria | 1297 |
| 311 | Ga0207679_10313986 | 3300025945 | Bacteria | 1355 |
| 312 | Ga0207679_10630670 | 3300025945 | Bacteria | 968 |
| 313 | Ga0207667_10046098 | 3300025949 | Bacteria | 4616 |
| 314 | Ga0207712_10039699 | 3300025961 | Bacteria | 3226 |
| 315 | Ga0207677_10102195 | 3300026023 | Unclassified | 2113 |
| 316 | Ga0207677_10213404 | 3300026023 | Bacteria | 1543 |
| 317 | Ga0207703_10155527 | 3300026035 | Bacteria | 1998 |
| 318 | Ga0207703_10180792 | 3300026035 | Bacteria | 1861 |
| 319 | Ga0207639_10086407 | 3300026041 | Bacteria | 2497 |
| 320 | Ga0207639_10302238 | 3300026041 | Bacteria | 1415 |
| 321 | Ga0207708_10023681 | 3300026075 | Bacteria | 4642 |
| 322 | Ga0207702_10104122 | 3300026078 | Bacteria | 2511 |
| 323 | Ga0207641_10086807 | 3300026088 | Bacteria | 2729 |
| 324 | Ga0207641_10117884 | 3300026088 | Bacteria | 2364 |
| 325 | Ga0207641_10142337 | 3300026088 | Bacteria | 2165 |
| 326 | Ga0207648_10010182 | 3300026089 | Bacteria | 8941 |
| 327 | Ga0207676_10468578 | 3300026095 | Bacteria | 1191 |
| 328 | Ga0207674_10524150 | 3300026116 | Bacteria | 1145 |
| 329 | Ga0207675_100003322 | 3300026118 | Bacteria | 15751 |
| 330 | Ga0207675_100003896 | 3300026118 | Bacteria | 14508 |
| 331 | Ga0207683_10010779 | 3300026121 | Bacteria | 7794 |
| 332 | Ga0207683_10053241 | 3300026121 | Bacteria | 3548 |
| 333 | Ga0209371_1000332 | 3300027312 | Bacteria | 51427 |
| 334 | Ga0209282_1000001 | 3300027666 | Bacteria | 2450367 |
| 335 | Ga0209966_1003002 | 3300027695 | Bacteria | 2830 |
| 336 | Ga0207428_10096658 | 3300027907 | Bacteria | 2287 |
| 337 | Ga0268266_10001411 | 3300028379 | Bacteria | 28670 |
| 338 | Ga0268265_10002277 | 3300028380 | Bacteria | 14624 |
| 339 | Ga0268265_10022305 | 3300028380 | Bacteria | 4446 |
| 340 | Ga0268265_10204253 | 3300028380 | Bacteria | 1716 |
| 341 | Ga0268264_10008154 | 3300028381 | Bacteria | 8706 |
| 342 | Ga0268264_10015656 | 3300028381 | Bacteria | 6210 |
| 343 | Ga0268264_10104266 | 3300028381 | Unclassified | 2471 |
| 344 | Ga0268264_10130613 | 3300028381 | Bacteria | 2226 |
| 345 | Ga0268264_10256730 | 3300028381 | Bacteria | 1626 |
| 346 | Ga0307515_10046926 | 3300028794 | Bacteria | 6587 |
| 347 | Ga0265338_10004919 | 3300028800 | Bacteria | 17766 |
| 348 | Ga0265338_10022222 | 3300028800 | Bacteria | 6576 |
| 349 | Ga0265338_10049015 | 3300028800 | Bacteria | 3834 |
| 350 | Ga0268256_1000285 | 3300030500 | Bacteria | 52251 |
| 351 | Ga0316177_1189032 | 3300030731 | Bacteria | 4597 |
| 352 | Ga0316183_1141288 | 3300030742 | Bacteria | 3037 |
| 353 | Ga0316182_1235230 | 3300030745 | Bacteria | 2409 |
| 354 | Ga0265330_10038918 | 3300031235 | Bacteria | 2113 |
| 355 | Ga0265332_10056130 | 3300031238 | Bacteria | 1687 |
| 356 | Ga0265340_10000072 | 3300031247 | Bacteria | 48524 |
| 357 | Ga0265340_10018477 | 3300031247 | Bacteria | 3595 |
| 358 | Ga0265339_10125700 | 3300031249 | Bacteria | 1315 |
| 359 | Ga0265327_10000039 | 3300031251 | Bacteria | 292334 |
| 360 | Ga0265327_10098827 | 3300031251 | Bacteria | 1411 |
| 361 | Ga0265316_10043250 | 3300031344 | Bacteria | 3592 |
| 362 | Ga0265316_10057899 | 3300031344 | Bacteria | 3020 |
| 363 | Ga0265316_10125186 | 3300031344 | Bacteria | 1938 |
| 364 | Ga0307513_10012392 | 3300031456 | Bacteria | 10530 |
| 365 | Ga0307513_10097214 | 3300031456 | Bacteria | 2980 |
| 366 | Ga0307408_100000618 | 3300031548 | Bacteria | 30213 |
| 367 | Ga0307408_100001729 | 3300031548 | Bacteria | 15977 |
| 368 | Ga0307408_100002147 | 3300031548 | Bacteria | 14113 |
| 369 | Ga0307408_100007999 | 3300031548 | Bacteria | 6991 |
| 370 | Ga0307408_100016004 | 3300031548 | Bacteria | 5001 |
| 371 | Ga0307408_100303217 | 3300031548 | Bacteria | 1339 |
| 372 | Ga0307408_100493011 | 3300031548 | Bacteria | 1071 |
| 373 | Ga0265314_10011526 | 3300031711 | Bacteria | 7284 |
| 374 | Ga0265314_10076430 | 3300031711 | Bacteria | 2225 |
| 375 | Ga0265342_10027636 | 3300031712 | Bacteria | 3541 |
| 376 | Ga0265342_10071229 | 3300031712 | Bacteria | 2026 |
| 377 | Ga0307516_10029535 | 3300031730 | Bacteria | 5542 |
| 378 | Ga0307516_10041993 | 3300031730 | Bacteria | 4540 |
| 379 | Ga0307405_10003199 | 3300031731 | Bacteria | 7460 |
| 380 | Ga0307413_10000617 | 3300031824 | Bacteria | 11980 |
| 381 | Ga0307410_10232651 | 3300031852 | Bacteria | 1424 |
| 382 | Ga0307406_10004595 | 3300031901 | Bacteria | 7513 |
| 383 | Ga0307406_10067913 | 3300031901 | Bacteria | 2326 |
| 384 | Ga0307407_10003220 | 3300031903 | Bacteria | 6632 |
| 385 | Ga0307412_10095811 | 3300031911 | Bacteria | 2087 |
| 386 | Ga0307409_100006208 | 3300031995 | Bacteria | 6993 |
| 387 | Ga0307409_100012834 | 3300031995 | Bacteria | 5359 |
| 388 | Ga0307409_100529500 | 3300031995 | Bacteria | 1153 |
| 389 | Ga0307416_100718177 | 3300032002 | Bacteria | 1090 |
| 390 | Ga0307414_10073765 | 3300032004 | Bacteria | 2470 |
| 391 | Ga0307414_10244180 | 3300032004 | Bacteria | 1488 |
| 392 | Ga0307414_10317538 | 3300032004 | Bacteria | 1324 |
| 393 | Ga0307411_10001591 | 3300032005 | Bacteria | 9425 |
| 394 | Ga0307411_10136718 | 3300032005 | Bacteria | 1801 |
| 395 | Ga0307415_100067617 | 3300032126 | Bacteria | 2498 |
| 396 | Ga0307415_100624907 | 3300032126 | Bacteria | 962 |
| 397 | Ga0307507_10182699 | 3300033179 | Bacteria | 1494 |
| 398 | Ga0307507_10184722 | 3300033179 | Bacteria | 1481 |
| 399 | Ga0307510_10071530 | 3300033180 | Bacteria | 3453 |
| 400 | Ga0395899_0000003 | 3300037312 | Bacteria | 1232684 |
| 401 | Ga0395899_0000012 | 3300037312 | Bacteria | 517561 |
| 402 | Ga0395899_0073557 | 3300037312 | Bacteria | 2498 |
| 403 | Ga0395900_0000028 | 3300037418 | Bacteria | 285042 |
| 404 | Ga0395900_0002683 | 3300037418 | Bacteria | 19454 |
| 405 | Ga0395900_0012863 | 3300037418 | Bacteria | 8549 |
| 406 | Ga0395900_0014052 | 3300037418 | Bacteria | 8175 |
| 407 | Ga0395900_0054335 | 3300037418 | Bacteria | 4124 |
| 408 | Ga0395900_0064343 | 3300037418 | Bacteria | 3769 |
| 409 | Ga0395898_0019762 | 3300037466 | Bacteria | 6850 |
| 410 | Ga0395905_0000022 | 3300037471 | Bacteria | 321527 |
| 411 | Ga0395905_0044068 | 3300037471 | Bacteria | 4186 |
| 412 | Ga0395901_0000076 | 3300038443 | Bacteria | 138169 |
| 413 | Ga0395901_0151064 | 3300038443 | Bacteria | 2440 |
| 414 | Ga0395901_0260964 | 3300038443 | Bacteria | 1803 |
| 415 | Ga0395901_0398871 | 3300038443 | Bacteria | 1413 |
| 416 | Ga0395901_0538581 | 3300038443 | Bacteria | 1184 |
| 417 | Ga0237819_00007 | 3300038705 | Bacteria | 74520 |
| 418 | Ga0237816_00241 | 3300039145 | Bacteria | 4567 |
| 419 | Ga0436365_0213934 | 3300039437 | Bacteria | 51788 |
| 420 | Ga0436365_1476328 | 3300039437 | Bacteria | 212791 |
| 421 | Ga0436361_0142459 | 3300039447 | Bacteria | 45175 |
| 422 | Ga0436361_0166535 | 3300039447 | Bacteria | 1094 |
| 423 | Ga0436361_0243746 | 3300039447 | Bacteria | 16129 |
| 424 | Ga0436361_0663918 | 3300039447 | Bacteria | 2238 |
| 425 | Ga0436361_0909588 | 3300039447 | Bacteria | 2279 |
| 426 | Ga0436361_1221194 | 3300039447 | Bacteria | 3910 |
| 427 | Ga0439465_0056709 | 3300041413 | Bacteria | 1291 |
| 428 | Ga0451791_0321965 | 3300041451 | Bacteria | 1944 |
| 429 | Ga0451791_0753430 | 3300041451 | Bacteria | 1315 |
| 430 | Ga0451797_1321202 | 3300041453 | Bacteria | 2178 |
| 431 | Ga0451798_1100220 | 3300041458 | Bacteria | 1197 |
| 432 | Ga0451800_0742652 | 3300041459 | Bacteria | 12172 |
| 433 | Ga0451802_0228891 | 3300041460 | Bacteria | 10583 |
| 434 | Ga0451806_158657 | 3300041462 | Bacteria | 6549 |
| 435 | Ga0451804_0269081 | 3300041463 | Bacteria | 4201 |
| 436 | Ga0451807_0617128 | 3300041486 | Bacteria | 1586 |
| 437 | Ga0451807_2291444 | 3300041486 | Bacteria | 9755 |
| 438 | Ga0451841_1039072 | 3300041498 | Bacteria | 1755 |
| 439 | Ga0451849_0981658 | 3300041505 | Bacteria | 2425 |
| 440 | Ga0451851_0837399 | 3300041507 | Bacteria | 1039 |
| 441 | Ga0451843_0711483 | 3300041509 | Bacteria | 2102 |
| 442 | Ga0439431_0076158 | 3300041997 | Bacteria | 900 |
| 443 | Ga0439441_006718 | 3300042001 | Bacteria | 1834 |
| 444 | Ga0439448_0001122 | 3300042005 | Bacteria | 6753 |
| 445 | Ga0439448_0024166 | 3300042005 | Bacteria | 1899 |
| 446 | Ga0439449_0000020 | 3300042007 | Bacteria | 46206 |
| 447 | Ga0439449_0005395 | 3300042007 | Bacteria | 4899 |
| 448 | Ga0439450_021695 | 3300042008 | Bacteria | 1381 |
| 449 | Ga0439455_0015456 | 3300042012 | Bacteria | 1755 |
| 450 | Ga0439462_0007287 | 3300042015 | Bacteria | 2765 |
| 451 | Ga0450905_003641 | 3300042142 | Bacteria | 2027 |
| 452 | Ga0439446_0014462 | 3300042156 | Bacteria | 2179 |
| 453 | Ga0451577_0002991 | 3300042876 | Bacteria | 19272 |
| 454 | Ga0466969_0038583 | 3300044656 | Bacteria | 2402 |
| 455 | Ga0466969_0073091 | 3300044656 | Bacteria | 1646 |
| 456 | Ga0466969_0137000 | 3300044656 | Bacteria | 1133 |
| 457 | Ga0466969_0145177 | 3300044656 | Bacteria | 1095 |
| 458 | Ga0466972_0042178 | 3300044658 | Bacteria | 2220 |
| 459 | Ga0466965_0022517 | 3300044683 | Bacteria | 3037 |
| 460 | Ga0466965_0063752 | 3300044683 | Bacteria | 1844 |
| 461 | Ga0466965_0089841 | 3300044683 | Bacteria | 1562 |
| 462 | Ga0466965_0213851 | 3300044683 | Bacteria | 1026 |
| 463 | Ga0466966_0000485 | 3300044684 | Bacteria | 25510 |
| 464 | Ga0466966_0001407 | 3300044684 | Bacteria | 15484 |
| 465 | Ga0466966_0001440 | 3300044684 | Bacteria | 15301 |
| 466 | Ga0466966_0008459 | 3300044684 | Bacteria | 6813 |
| 467 | Ga0466966_0024383 | 3300044684 | Bacteria | 3957 |
| 468 | Ga0466966_0088665 | 3300044684 | Bacteria | 1922 |
| 469 | Ga0466966_0164455 | 3300044684 | Bacteria | 1350 |
| 470 | Ga0466961_0041956 | 3300044693 | Bacteria | 2933 |
| 471 | Ga0466961_0053821 | 3300044693 | Bacteria | 2567 |
| 472 | Ga0466961_0309010 | 3300044693 | Bacteria | 965 |
| 473 | Ga0466963_0063269 | 3300044694 | Bacteria | 2476 |
| 474 | Ga0466963_0105135 | 3300044694 | Bacteria | 1935 |
| 475 | Ga0466964_0000150 | 3300044706 | Bacteria | 18826 |
| 476 | Ga0466964_0000506 | 3300044706 | Bacteria | 12145 |
| 477 | Ga0466964_0039462 | 3300044706 | Bacteria | 1902 |
| 478 | Ga0453684_0184554 | 3300044712 | Bacteria | 2446 |
| 479 | Ga0466971_0181499 | 3300044719 | Bacteria | 989 |
| 480 | Ga0466968_0003732 | 3300044735 | Bacteria | 5647 |
| 481 | Ga0466968_0153620 | 3300044735 | Bacteria | 1059 |
| 482 | Ga0466957_0000034 | 3300044842 | Bacteria | 48746 |
| 483 | Ga0466957_0011693 | 3300044842 | Bacteria | 5073 |
| 484 | Ga0466957_0089264 | 3300044842 | Bacteria | 1929 |
| 485 | Ga0466960_0037123 | 3300044901 | Bacteria | 2285 |
| 486 | Ga0466959_0000096 | 3300045049 | Bacteria | 55797 |
| 487 | Ga0466959_0004407 | 3300045049 | Bacteria | 9423 |
| 488 | Ga0466959_0017396 | 3300045049 | Bacteria | 5269 |
| 489 | Ga0466959_0131816 | 3300045049 | Bacteria | 1771 |
| 490 | Ga0466958_0003281 | 3300045836 | Bacteria | 8372 |
| 491 | Ga0466958_0027005 | 3300045836 | Bacteria | 3395 |
| 492 | Ga0466958_0244519 | 3300045836 | Bacteria | 1147 |
| 493 | Ga0466967_0027232 | 3300045976 | Bacteria | 4752 |
| 494 | Ga0466967_0064392 | 3300045976 | Bacteria | 3260 |
| 495 | Ga0466967_0360582 | 3300045976 | Bacteria | 1408 |
| 496 | Ga0495627_000015 | 3300046453 | Bacteria | 320787 |
| 497 | Ga0495627_000464 | 3300046453 | Bacteria | 35052 |
| 498 | Ga0495638_0000198 | 3300046460 | Bacteria | 86199 |
| 499 | Ga0495638_0000528 | 3300046460 | Bacteria | 44566 |
| 500 | Ga0495638_0002732 | 3300046460 | Bacteria | 14178 |
| 501 | Ga0495638_0003082 | 3300046460 | Bacteria | 13218 |
| 502 | Ga0495638_0005851 | 3300046460 | Bacteria | 9042 |
| 503 | Ga0495638_0007341 | 3300046460 | Bacteria | 7912 |
| 504 | Ga0495650_0000577 | 3300046471 | Bacteria | 51317 |
| 505 | Ga0495582_0036642 | 3300046473 | Bacteria | 2698 |
| 506 | Ga0495605_0000112 | 3300046474 | Bacteria | 104223 |
| 507 | Ga0495605_0001495 | 3300046474 | Bacteria | 15232 |
| 508 | Ga0495605_0002051 | 3300046474 | Bacteria | 12706 |
| 509 | Ga0495584_0008989 | 3300046491 | Bacteria | 5162 |
| 510 | Ga0495584_0030374 | 3300046491 | Bacteria | 2737 |
| 511 | Ga0495585_0019583 | 3300046492 | Bacteria | 3901 |
| 512 | Ga0495596_0000088 | 3300046500 | Bacteria | 64229 |
| 513 | Ga0495596_0003086 | 3300046500 | Bacteria | 8602 |
| 514 | Ga0495607_0001299 | 3300046501 | Bacteria | 22284 |
| 515 | Ga0495607_0001443 | 3300046501 | Bacteria | 21163 |
| 516 | Ga0495607_0035808 | 3300046501 | Bacteria | 2998 |
| 517 | Ga0495607_0118720 | 3300046501 | Bacteria | 1391 |
| 518 | Ga0495583_0000029 | 3300046506 | Bacteria | 255536 |
| 519 | Ga0495583_0000253 | 3300046506 | Bacteria | 88398 |
| 520 | Ga0495583_0000265 | 3300046506 | Bacteria | 86085 |
| 521 | Ga0495583_0005424 | 3300046506 | Bacteria | 8664 |
| 522 | Ga0495583_0014108 | 3300046506 | Bacteria | 4421 |
| 523 | Ga0495606_0005061 | 3300046507 | Bacteria | 12825 |
| 524 | Ga0495606_0025238 | 3300046507 | Bacteria | 4260 |
| 525 | Ga0495610_0000040 | 3300046512 | Bacteria | 165165 |
| 526 | Ga0495610_0000176 | 3300046512 | Bacteria | 71110 |
| 527 | Ga0495610_0001501 | 3300046512 | Bacteria | 20517 |
| 528 | Ga0495610_0004463 | 3300046512 | Bacteria | 10334 |
| 529 | Ga0495610_0011821 | 3300046512 | Bacteria | 5304 |
| 530 | Ga0495616_0000016 | 3300046513 | Bacteria | 182686 |
| 531 | Ga0495616_0000283 | 3300046513 | Bacteria | 41076 |
| 532 | Ga0495616_0000572 | 3300046513 | Bacteria | 27802 |
| 533 | Ga0495616_0001503 | 3300046513 | Bacteria | 16105 |
| 534 | Ga0495616_0005078 | 3300046513 | Bacteria | 8184 |
| 535 | Ga0495616_0025050 | 3300046513 | Bacteria | 3192 |
| 536 | Ga0495616_0025258 | 3300046513 | Bacteria | 3176 |
| 537 | Ga0495616_0029452 | 3300046513 | Bacteria | 2898 |
| 538 | Ga0495616_0095276 | 3300046513 | Bacteria | 1403 |
| 539 | Ga0495631_0003199 | 3300046518 | Bacteria | 9017 |
| 540 | Ga0495631_0010788 | 3300046518 | Bacteria | 4515 |
| 541 | Ga0495632_0000597 | 3300046519 | Bacteria | 33515 |
| 542 | Ga0495632_0009670 | 3300046519 | Bacteria | 5790 |
| 543 | Ga0495632_0016087 | 3300046519 | Bacteria | 4171 |
| 544 | Ga0495637_0015323 | 3300046520 | Bacteria | 3596 |
| 545 | Ga0495643_0000106 | 3300046522 | Bacteria | 138657 |
| 546 | Ga0495643_0000621 | 3300046522 | Bacteria | 42290 |
| 547 | Ga0495643_0001053 | 3300046522 | Bacteria | 27815 |
| 548 | Ga0495643_0006828 | 3300046522 | Bacteria | 7455 |
| 549 | Ga0495643_0012735 | 3300046522 | Bacteria | 5061 |
| 550 | Ga0495643_0050938 | 3300046522 | Bacteria | 2229 |
| 551 | Ga0495644_0006644 | 3300046523 | Bacteria | 4481 |
| 552 | Ga0495644_0017977 | 3300046523 | Bacteria | 2700 |
| 553 | Ga0495648_0000087 | 3300046524 | Bacteria | 116394 |
| 554 | Ga0495648_0000238 | 3300046524 | Bacteria | 63006 |
| 555 | Ga0495648_0005883 | 3300046524 | Bacteria | 10084 |
| 556 | Ga0495663_0000769 | 3300046525 | Bacteria | 10989 |
| 557 | Ga0495663_0024921 | 3300046525 | Bacteria | 1741 |
| 558 | Ga0495663_0062151 | 3300046525 | Bacteria | 1176 |
| 559 | Ga0495666_0040795 | 3300046526 | Bacteria | 2250 |
| 560 | Ga0495642_0000126 | 3300046528 | Bacteria | 43613 |
| 561 | Ga0495642_0002587 | 3300046528 | Bacteria | 7305 |
| 562 | Ga0495642_0005083 | 3300046528 | Bacteria | 5065 |
| 563 | Ga0495642_0005528 | 3300046528 | Bacteria | 4857 |
| 564 | Ga0495654_0016427 | 3300046530 | Bacteria | 3915 |
| 565 | Ga0495654_0026485 | 3300046530 | Bacteria | 2980 |
| 566 | Ga0495586_0010495 | 3300046535 | Bacteria | 4926 |
| 567 | Ga0495609_0000001 | 3300046538 | Bacteria | 1060094 |
| 568 | Ga0495609_0000241 | 3300046538 | Bacteria | 52185 |
| 569 | Ga0495609_0000420 | 3300046538 | Bacteria | 35497 |
| 570 | Ga0495609_0003048 | 3300046538 | Bacteria | 9853 |
| 571 | Ga0495609_0024711 | 3300046538 | Bacteria | 2754 |
| 572 | Ga0495609_0026119 | 3300046538 | Bacteria | 2674 |
| 573 | Ga0495609_0049273 | 3300046538 | Bacteria | 1880 |
| 574 | Ga0495609_0118781 | 3300046538 | Bacteria | 1138 |
| 575 | Ga0495597_0000119 | 3300046542 | Bacteria | 71150 |
| 576 | Ga0495645_0126180 | 3300046543 | Bacteria | 1798 |
| 577 | Ga0495622_0000084 | 3300046557 | Bacteria | 83759 |
| 578 | Ga0495633_0000187 | 3300046558 | Bacteria | 80958 |
| 579 | Ga0495633_0005872 | 3300046558 | Bacteria | 7383 |
| 580 | Ga0495633_0012294 | 3300046558 | Bacteria | 4563 |
| 581 | Ga0495633_0037894 | 3300046558 | Bacteria | 2305 |
| 582 | Ga0495633_0041303 | 3300046558 | Bacteria | 2194 |
| 583 | Ga0495656_0005629 | 3300046615 | Bacteria | 4335 |
| 584 | Ga0495656_0025112 | 3300046615 | Bacteria | 2359 |
| 585 | Ga0495656_0047249 | 3300046615 | Bacteria | 1825 |
| 586 | Ga0495668_0000239 | 3300046616 | Bacteria | 78426 |
| 587 | Ga0495668_0000715 | 3300046616 | Bacteria | 39968 |
| 588 | Ga0495668_0002001 | 3300046616 | Bacteria | 17817 |
| 589 | Ga0495668_0008395 | 3300046616 | Bacteria | 6455 |
| 590 | Ga0495668_0009316 | 3300046616 | Bacteria | 6035 |
| 591 | Ga0495668_0021485 | 3300046616 | Bacteria | 3700 |
| 592 | Ga0495668_0038810 | 3300046616 | Bacteria | 2660 |
| 593 | Ga0495668_0176551 | 3300046616 | Bacteria | 1170 |
| 594 | Ga0495611_0000226 | 3300046648 | Bacteria | 39543 |
| 595 | Ga0495625_0000038 | 3300046660 | Bacteria | 211808 |
| 596 | Ga0495625_0000099 | 3300046660 | Bacteria | 140467 |
| 597 | Ga0495625_0000800 | 3300046660 | Bacteria | 43543 |
| 598 | Ga0495625_0001311 | 3300046660 | Bacteria | 31043 |
| 599 | Ga0495625_0001665 | 3300046660 | Bacteria | 26013 |
| 600 | Ga0495625_0010857 | 3300046660 | Bacteria | 7486 |
| 601 | Ga0495625_0018893 | 3300046660 | Bacteria | 5365 |
| 602 | Ga0495625_0075315 | 3300046660 | Bacteria | 2361 |
| 603 | Ga0495625_0255681 | 3300046660 | Bacteria | 1135 |
| 604 | Ga0495625_0275782 | 3300046660 | Bacteria | 1083 |
| 605 | Ga0495659_0000550 | 3300046664 | Bacteria | 13871 |
| 606 | Ga0495659_0001060 | 3300046664 | Bacteria | 9607 |
| 607 | Ga0495661_0000069 | 3300046665 | Bacteria | 125790 |
| 608 | Ga0495661_0000181 | 3300046665 | Bacteria | 72564 |
| 609 | Ga0495661_0002091 | 3300046665 | Bacteria | 15672 |
| 610 | Ga0495661_0007418 | 3300046665 | Bacteria | 7645 |
| 611 | Ga0495661_0010282 | 3300046665 | Bacteria | 6391 |
| 612 | Ga0495661_0068928 | 3300046665 | Bacteria | 2074 |
| 613 | Ga0495588_0000041 | 3300046674 | Bacteria | 377896 |
| 614 | Ga0495657_0165041 | 3300046675 | Bacteria | 1368 |
| 615 | Ga0495658_0078222 | 3300046683 | Bacteria | 1935 |
| 616 | Ga0495669_0000341 | 3300046684 | Bacteria | 24536 |
| 617 | Ga0495669_0003613 | 3300046684 | Bacteria | 6366 |
| 618 | Ga0495670_0000114 | 3300046691 | Bacteria | 35822 |
| 619 | Ga0495670_0047159 | 3300046691 | Bacteria | 2153 |
| 620 | Ga0495671_0008482 | 3300046692 | Bacteria | 5778 |
| 621 | Ga0495671_0020050 | 3300046692 | Bacteria | 3527 |
| 622 | Ga0495649_0000263 | 3300046694 | Bacteria | 46744 |
| 623 | Ga0495649_0006606 | 3300046694 | Bacteria | 7212 |
| 624 | Ga0495649_0037609 | 3300046694 | Bacteria | 2656 |
| 625 | Ga0495589_0000061 | 3300046794 | Bacteria | 104649 |
| 626 | Ga0495589_0000165 | 3300046794 | Bacteria | 60337 |
| 627 | Ga0495589_0007854 | 3300046794 | Bacteria | 5585 |
| 628 | Ga0495589_0011973 | 3300046794 | Bacteria | 4497 |
| 629 | Ga0495660_0000104 | 3300046810 | Bacteria | 90778 |
| 630 | Ga0495660_0000450 | 3300046810 | Bacteria | 34288 |
| 631 | Ga0495660_0002266 | 3300046810 | Bacteria | 12378 |
| 632 | Ga0495660_0002391 | 3300046810 | Bacteria | 11979 |
| 633 | Ga0495660_0002719 | 3300046810 | Bacteria | 11167 |
| 634 | Ga0495660_0011168 | 3300046810 | Bacteria | 5214 |
| 635 | Ga0495660_0063322 | 3300046810 | Bacteria | 1981 |
| 636 | Ga0495660_0098847 | 3300046810 | Bacteria | 1505 |
| 637 | Ga0495581_0107833 | 3300047315 | Bacteria | 1619 |
| 638 | Ga0495636_0000720 | 3300047318 | Bacteria | 12107 |
| 639 | Ga0495636_0016558 | 3300047318 | Bacteria | 2946 |
| 640 | Ga0495674_0257315 | 3300047319 | Bacteria | 1435 |
| 641 | Ga0495672_0000141 | 3300047320 | Bacteria | 106630 |
| 642 | Ga0495672_0000214 | 3300047320 | Bacteria | 82882 |
| 643 | Ga0495672_0000264 | 3300047320 | Bacteria | 72738 |
| 644 | Ga0495672_0002375 | 3300047320 | Bacteria | 17376 |
| 645 | Ga0495672_0018604 | 3300047320 | Bacteria | 4605 |
| 646 | Ga0495683_0003920 | 3300047323 | Bacteria | 8558 |
| 647 | Ga0495683_0021841 | 3300047323 | Bacteria | 3297 |
| 648 | Ga0495683_0029748 | 3300047323 | Bacteria | 2790 |
| 649 | Ga0495687_000027 | 3300047443 | Bacteria | 299689 |
| 650 | Ga0495687_000062 | 3300047443 | Bacteria | 176135 |
| 651 | Ga0495687_000254 | 3300047443 | Bacteria | 71880 |
| 652 | Ga0495687_000477 | 3300047443 | Bacteria | 48508 |
| 653 | Ga0495687_003359 | 3300047443 | Bacteria | 11679 |
| 654 | Ga0495687_005981 | 3300047443 | Bacteria | 7583 |
| 655 | Ga0495687_008705 | 3300047443 | Bacteria | 5767 |
| 656 | Ga0495677_0000001 | 3300047445 | Bacteria | 715000 |
| 657 | Ga0495677_0032369 | 3300047445 | Bacteria | 1904 |
| 658 | Ga0495677_0040336 | 3300047445 | Bacteria | 1707 |
| 659 | Ga0495677_0083918 | 3300047445 | Bacteria | 1196 |
| 660 | Ga0495679_008042 | 3300047446 | Bacteria | 4328 |
| 661 | Ga0495679_030531 | 3300047446 | Bacteria | 1748 |
| 662 | Ga0495685_000658 | 3300047447 | Bacteria | 10556 |
| 663 | Ga0495685_037386 | 3300047447 | Bacteria | 1664 |
| 664 | Ga0495673_0000056 | 3300047469 | Bacteria | 245918 |
| 665 | Ga0495673_0000785 | 3300047469 | Bacteria | 29990 |
| 666 | Ga0495681_0005660 | 3300047470 | Bacteria | 8322 |
| 667 | Ga0495686_0087287 | 3300047472 | Bacteria | 1897 |
| 668 | Ga0495686_0253113 | 3300047472 | Bacteria | 989 |
| 669 | Ga0495615_0060260 | 3300048090 | Bacteria | 1000 |
| 670 | Ga0495626_0000101 | 3300048091 | Bacteria | 110322 |
| 671 | Ga0495626_0000135 | 3300048091 | Bacteria | 93280 |
| 672 | Ga0495626_0000745 | 3300048091 | Bacteria | 30039 |
| 673 | Ga0496100_0190941 | 3300048903 | Bacteria | 1487 |
| 674 | Ga0496100_0254821 | 3300048903 | Bacteria | 1299 |
| 675 | Ga0496102_0046604 | 3300048905 | Bacteria | 3937 |
| 676 | Ga0496103_0229792 | 3300048906 | Bacteria | 1193 |
| 677 | Ga0496104_0262415 | 3300048907 | Unclassified | 1640 |
| 678 | Ga0496105_0035928 | 3300048908 | Bacteria | 4081 |
| 679 | Ga0496106_0006892 | 3300048909 | Bacteria | 8407 |
| 680 | Ga0496107_0000095 | 3300048910 | Bacteria | 42594 |
| 681 | Ga0496107_0014761 | 3300048910 | Bacteria | 5470 |
| 682 | Ga0496107_0136204 | 3300048910 | Bacteria | 1814 |
| 683 | Ga0496107_0343847 | 3300048910 | Bacteria | 1110 |
| 684 | Ga0496110_0463667 | 3300048913 | Bacteria | 1154 |
| 685 | Ga0496114_0000254 | 3300048917 | Bacteria | 38642 |
| 686 | Ga0496116_0001111 | 3300048919 | Bacteria | 32190 |
| 687 | Ga0496116_0086580 | 3300048919 | Bacteria | 1921 |
| 688 | Ga0496117_0001300 | 3300048920 | Bacteria | 36745 |
| 689 | Ga0496118_0000703 | 3300048921 | Bacteria | 54182 |
| 690 | Ga0496118_0028073 | 3300048921 | Bacteria | 4748 |
| 691 | Ga0496119_0000301 | 3300048922 | Bacteria | 69339 |
| 692 | Ga0496120_0000402 | 3300048923 | Bacteria | 69322 |
| 693 | Ga0496121_0001883 | 3300048924 | Bacteria | 33669 |
| 694 | Ga0496121_0129712 | 3300048924 | Bacteria | 1889 |
| 695 | Ga0496122_0001165 | 3300048925 | Bacteria | 44919 |
| 696 | Ga0496122_0029671 | 3300048925 | Bacteria | 4605 |
| 697 | Ga0496123_0000933 | 3300048926 | Bacteria | 45679 |
| 698 | Ga0496123_0046819 | 3300048926 | Bacteria | 2929 |
| 699 | Ga0496124_0000009 | 3300048927 | Bacteria | 734820 |
| 700 | Ga0496124_0001841 | 3300048927 | Bacteria | 29280 |
| 701 | Ga0496124_0010055 | 3300048927 | Bacteria | 9650 |
| 702 | Ga0496124_0015900 | 3300048927 | Bacteria | 7185 |
| 703 | Ga0496124_0030252 | 3300048927 | Bacteria | 4809 |
| 704 | Ga0496124_0224003 | 3300048927 | Bacteria | 1412 |
| 705 | Ga0496125_0003869 | 3300048928 | Bacteria | 17713 |
| 706 | Ga0496125_0036606 | 3300048928 | Bacteria | 4281 |
| 707 | Ga0496125_0049747 | 3300048928 | Bacteria | 3478 |
| 708 | Ga0496125_0072611 | 3300048928 | Bacteria | 2680 |
| 709 | Ga0496126_0001069 | 3300048929 | Bacteria | 46093 |
| 710 | Ga0495678_000101 | 3300049459 | Bacteria | 104596 |
| 711 | Ga0495678_000663 | 3300049459 | Bacteria | 31565 |
| 712 | Ga0495678_002168 | 3300049459 | Bacteria | 13848 |
| 713 | Ga0495678_005468 | 3300049459 | Bacteria | 7002 |
| 714 | Ga0495678_016807 | 3300049459 | Bacteria | 3333 |
| 715 | Ga0495682_0000208 | 3300049460 | Bacteria | 47163 |
| 716 | Ga0495682_0004343 | 3300049460 | Bacteria | 6090 |
| 717 | Ga0501290_006438 | 3300049513 | Bacteria | 1471 |
| 718 | Ga0501300_006036 | 3300049523 | Bacteria | 1785 |
| 719 | Ga0501031_0074753 | 3300049568 | Bacteria | 2207 |
| 720 | Ga0501033_0002089 | 3300049570 | Bacteria | 17310 |
| 721 | Ga0501033_0215834 | 3300049570 | Bacteria | 1367 |
| 722 | Ga0501033_0247093 | 3300049570 | Bacteria | 1265 |
| 723 | Ga0501034_0000941 | 3300049571 | Bacteria | 42237 |
| 724 | Ga0501034_0022534 | 3300049571 | Bacteria | 6418 |
| 725 | Ga0501034_0037613 | 3300049571 | Bacteria | 4901 |
| 726 | Ga0501034_0041427 | 3300049571 | Bacteria | 4659 |
| 727 | Ga0501034_0506354 | 3300049571 | Bacteria | 1121 |
| 728 | Ga0501036_0170755 | 3300049572 | Bacteria | 1832 |
| 729 | Ga0501037_0008198 | 3300049573 | Bacteria | 7659 |
| 730 | Ga0501037_0119238 | 3300049573 | Bacteria | 1898 |
| 731 | Ga0501038_0383623 | 3300049574 | Bacteria | 1090 |
| 732 | Ga0501043_0003380 | 3300049579 | Bacteria | 13138 |
| 733 | Ga0501043_0288261 | 3300049579 | Bacteria | 1257 |
| 734 | Ga0501046_0037641 | 3300049580 | Bacteria | 3887 |
| 735 | Ga0501047_0188715 | 3300049581 | Bacteria | 1926 |
| 736 | Ga0501047_0195530 | 3300049581 | Bacteria | 1885 |
| 737 | Ga0501067_0000227 | 3300049583 | Bacteria | 31300 |
| 738 | Ga0501068_0000343 | 3300049584 | Bacteria | 23405 |
| 739 | Ga0501073_0000004 | 3300049589 | Bacteria | 261794 |
| 740 | Ga0501077_0000008 | 3300049593 | Bacteria | 106496 |
| 741 | Ga0501227_011098 | 3300049665 | Bacteria | 1959 |
| 742 | Ga0501225_0000492 | 3300049705 | Bacteria | 12311 |
| 743 | Ga0501080_0009522 | 3300049742 | Bacteria | 8865 |
| 744 | Ga0501265_000739 | 3300049762 | Bacteria | 3576 |
| 745 | Ga0501269_000056 | 3300049766 | Bacteria | 34896 |
| 746 | Ga0501269_005452 | 3300049766 | Bacteria | 1530 |
| 747 | Ga0501275_000047 | 3300049772 | Bacteria | 12242 |
| 748 | Ga0501279_000629 | 3300049775 | Bacteria | 4654 |
| 749 | Ga0501035_0002949 | 3300049822 | Bacteria | 16363 |
| 750 | Ga0501035_0111486 | 3300049822 | Bacteria | 2397 |
| 751 | Ga0501035_0115049 | 3300049822 | Bacteria | 2355 |
| 752 | Ga0501044_0000588 | 3300049823 | Bacteria | 44117 |
| 753 | Ga0501044_0000868 | 3300049823 | Bacteria | 36400 |
| 754 | Ga0501044_0092393 | 3300049823 | Bacteria | 3052 |
| 755 | nmdc:mga0k408_361_c1 | 3300050493 | Bacteria | 24992 |
| 756 | nmdc:mga0k408_41107_c1 | 3300050493 | Bacteria | 2661 |
| 757 | nmdc:mga07m45_24650_c1 | 3300050496 | Bacteria | 3297 |
| 758 | nmdc:mga05p37_956_c1 | 3300050507 | Bacteria | 32691 |
| 759 | nmdc:mga09592_25900_c1 | 3300050508 | Bacteria | 4858 |
| 760 | nmdc:mga09592_34828_c1 | 3300050508 | Bacteria | 4211 |
| 761 | nmdc:mga0qj67_552_c1 | 3300050509 | Bacteria | 25468 |
| 762 | nmdc:mga0qj67_9622_c1 | 3300050509 | Bacteria | 7203 |
| 763 | nmdc:mga06r32_32159_c1 | 3300050510 | Bacteria | 4933 |
| 764 | nmdc:mga06r32_481666_c1 | 3300050510 | Bacteria | 1219 |
| 765 | nmdc:mga06r32_6360_c1 | 3300050510 | Bacteria | 10614 |
| 766 | nmdc:mga08y16_109087_c1 | 3300050511 | Bacteria | 2882 |
| 767 | nmdc:mga08y16_143378_c1 | 3300050511 | Bacteria | 2483 |
| 768 | nmdc:mga08y16_63626_c1 | 3300050511 | Bacteria | 3853 |
| 769 | nmdc:mga0rr50_104404_c1 | 3300050513 | Bacteria | 2232 |
| 770 | Ga0495619_0193001 | 3300053085 | Bacteria | 1410 |
| 771 | Ga0500578_0000030 | 3300053086 | Bacteria | 140063 |
| 772 | Ga0500578_0000041 | 3300053086 | Bacteria | 129580 |
| 773 | Ga0500583_0082371 | 3300053092 | Bacteria | 1556 |
| 774 | Ga0500651_0000205 | 3300053093 | Bacteria | 37424 |
| 775 | Ga0500566_0056165 | 3300053094 | Bacteria | 2240 |
| 776 | Ga0500556_0002628 | 3300053104 | Bacteria | 5620 |
| 777 | Ga0500562_015346 | 3300053108 | Bacteria | 1964 |
| 778 | Ga0500562_049318 | 3300053108 | Bacteria | 1125 |
| 779 | Ga0500594_0000037 | 3300053118 | Bacteria | 43146 |
| 780 | Ga0500594_0000935 | 3300053118 | Bacteria | 6271 |
| 781 | Ga0500595_003278 | 3300053119 | Bacteria | 7647 |
| 782 | Ga0500608_000116 | 3300053122 | Bacteria | 32984 |
| 783 | Ga0500608_000211 | 3300053122 | Bacteria | 23249 |
| 784 | Ga0500608_000732 | 3300053122 | Bacteria | 11993 |
| 785 | Ga0500617_068862 | 3300053124 | Bacteria | 1554 |
| 786 | Ga0500618_000280 | 3300053125 | Bacteria | 39002 |
| 787 | Ga0500559_0000145 | 3300053136 | Bacteria | 55410 |
| 788 | Ga0500586_000313 | 3300053145 | Bacteria | 9663 |
| 789 | Ga0500588_0012319 | 3300053146 | Bacteria | 2117 |
| 790 | Ga0500604_0021066 | 3300053151 | Bacteria | 1840 |
| 791 | Ga0500622_0002338 | 3300053156 | Bacteria | 13811 |
| 792 | Ga0500622_0003917 | 3300053156 | Bacteria | 9634 |
| 793 | Ga0500622_0022714 | 3300053156 | Bacteria | 3322 |
| 794 | Ga0500622_0039882 | 3300053156 | Bacteria | 2447 |
| 795 | Ga0500637_0101531 | 3300053178 | Bacteria | 1668 |
| 796 | Ga0590071_022348 | 3300059421 | Bacteria | 1493 |
| 797 | Ga0466962_0015795 | 3300061719 | Bacteria | 3642 |
| 798 | Ga0466962_0198985 | 3300061719 | Bacteria | 979 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | iso_pu_bacteria | 2643221559 | 2643815988 | 277 |
| 2 | iso_pu_bacteria | 2643221573 | 2643881399 | 277 |
| 3 | iso_pu_bacteria | 2643221586 | 2643939537 | 277 |
| 4 | iso_pu_bacteria | 2643221612 | 2644078212 | 277 |
| 5 | iso_pu_bacteria | 2643221720 | 2644662172 | 277 |
| 6 | iso_pu_bacteria | 2643221727 | 2644696515 | 277 |
| 7 | iso_pu_bacteria | 2643221728 | 2644700314 | 277 |
| 8 | 3300005548 | Ga0070665_100003266 | Ga0070665_10000326615 | 279 |
| 9 | 3300009545 | Ga0105237_10106776 | Ga0105237_101067761 | 279 |
| 10 | 3300010375 | Ga0105239_10058037 | Ga0105239_100580374 | 279 |
| 11 | 3300025914 | Ga0207671_10216961 | Ga0207671_102169612 | 279 |
| 12 | 3300028379 | Ga0268266_10001411 | Ga0268266_1000141122 | 279 |
| 13 | 3300045049 | Ga0466959_0004407 | Ga0466959_0004407_8188_9027 | 279 |
| 14 | 3300053178 | Ga0500637_0101531 | Ga0500637_0101531_57_896 | 279 |
| 15 | iso_pu_bacteria | 2582581280 | 2585153395 | 279 |
| 16 | iso_pu_bacteria | 2582581293 | 2585196768 | 279 |
| 17 | iso_pu_bacteria | 2643221552 | 2643782997 | 279 |
| 18 | iso_pu_bacteria | 2643221584 | 2643930393 | 279 |
| 19 | iso_pu_bacteria | 2818991435 | 2819537787 | 279 |
| 20 | iso_pu_bacteria | 2818991454 | 2819647564 | 279 |
| 21 | 3300005340 | Ga0070689_100257008 | Ga0070689_1002570082 | 280 |
| 22 | 3300005438 | Ga0070701_10002132 | Ga0070701_100021323 | 280 |
| 23 | 3300005441 | Ga0070700_100045227 | Ga0070700_1000452273 | 280 |
| 24 | 3300005444 | Ga0070694_100036163 | Ga0070694_1000361632 | 280 |
| 25 | 3300005549 | Ga0070704_100002860 | Ga0070704_1000028608 | 280 |
| 26 | 3300005719 | Ga0068861_100095476 | Ga0068861_1000954762 | 280 |
| 27 | 3300005844 | Ga0068862_100026878 | Ga0068862_1000268783 | 280 |
| 28 | 3300006844 | Ga0075428_100027193 | Ga0075428_1000271933 | 280 |
| 29 | 3300006880 | Ga0075429_100026571 | Ga0075429_1000265714 | 280 |
| 30 | 3300007076 | Ga0075435_100113822 | Ga0075435_1001138222 | 280 |
| 31 | 3300009094 | Ga0111539_10173374 | Ga0111539_101733742 | 280 |
| 32 | 3300009553 | Ga0105249_10765058 | Ga0105249_107650582 | 280 |
| 33 | 3300021361 | Ga0213872_10001690 | Ga0213872_1000169014 | 280 |
| 34 | 3300021361 | Ga0213872_10003254 | Ga0213872_100032545 | 280 |
| 35 | 3300025936 | Ga0207670_10072490 | Ga0207670_100724902 | 280 |
| 36 | 3300026075 | Ga0207708_10023681 | Ga0207708_100236814 | 280 |
| 37 | 3300026118 | Ga0207675_100003896 | Ga0207675_1000038966 | 280 |
| 38 | 3300027695 | Ga0209966_1003002 | Ga0209966_10030022 | 280 |
| 39 | 3300027907 | Ga0207428_10096658 | Ga0207428_100966583 | 280 |
| 40 | 3300028380 | Ga0268265_10022305 | Ga0268265_100223053 | 280 |
| 41 | 3300037312 | Ga0395899_0000003 | Ga0395899_0000003_532606_533448 | 280 |
| 42 | 3300039447 | Ga0436361_0142459 | Ga0436361_0142459_27938_28780 | 280 |
| 43 | 3300039447 | Ga0436361_0243746 | Ga0436361_0243746_2619_3461 | 280 |
| 44 | 3300039447 | Ga0436361_0663918 | Ga0436361_0663918_1032_1874 | 280 |
| 45 | 3300039447 | Ga0436361_0909588 | Ga0436361_0909588_166_1008 | 280 |
| 46 | 3300041997 | Ga0439431_0076158 | Ga0439431_0076158_21_863 | 280 |
| 47 | 3300044656 | Ga0466969_0073091 | Ga0466969_0073091_778_1620 | 280 |
| 48 | 3300044683 | Ga0466965_0213851 | Ga0466965_0213851_80_922 | 280 |
| 49 | 3300045049 | Ga0466959_0131816 | Ga0466959_0131816_224_1066 | 280 |
| 50 | 3300050508 | nmdc:mga09592_34828_c1 | nmdc:mga09592_34828_c1_2232_3074 | 280 |
| 51 | 3300050511 | nmdc:mga08y16_63626_c1 | nmdc:mga08y16_63626_c1_2835_3677 | 280 |
| 52 | 3300050513 | nmdc:mga0rr50_104404_c1 | nmdc:mga0rr50_104404_c1_792_1655 | 280 |
| 53 | 3300059421 | Ga0590071_022348 | Ga0590071_022348_316_1164 | 280 |
| 54 | iso_pu_bacteria | 2747842501 | 2748017005 | 280 |
| 55 | iso_pu_bacteria | 2818991457 | 2819662052 | 280 |
| 56 | iso_pu_bacteria | 2852684882 | 2852688723 | 280 |
| 57 | iso_pu_bacteria | 2919130084 | 2919133395 | 280 |
| 58 | iso_pu_bacteria | 2929195423 | 2929195527 | 280 |
| 59 | iso_pu_bacteria | 8002869464 | 8002872498 | 280 |
| 60 | iso_pu_bacteria | 8021622325 | 8021622689 | 280 |
| 61 | iso_pu_bacteria | 8021648035 | 8021650932 | 280 |
| 62 | 3300003771 | Ga0055526_1029113 | Ga0055526_10291132 | 281 |
| 63 | 3300003794 | Ga0055531_10005918 | Ga0055531_100059182 | 281 |
| 64 | 3300003794 | Ga0055531_10009486 | Ga0055531_100094862 | 281 |
| 65 | 3300015689 | Ga0183360_10001 | Ga0183360_100012951 | 281 |
| 66 | 3300025273 | Ga0209673_1058763 | Ga0209673_10587631 | 281 |
| 67 | 3300025284 | Ga0209130_1002048 | Ga0209130_10020487 | 281 |
| 68 | 3300025292 | Ga0209676_1001677 | Ga0209676_100167711 | 281 |
| 69 | 3300025292 | Ga0209676_1001964 | Ga0209676_10019642 | 281 |
| 70 | 3300025294 | Ga0209025_1001683 | Ga0209025_10016837 | 281 |
| 71 | 3300025297 | Ga0209758_1058238 | Ga0209758_10582382 | 281 |
| 72 | 3300025298 | Ga0209050_1009864 | Ga0209050_10098642 | 281 |
| 73 | 3300025298 | Ga0209050_1012124 | Ga0209050_10121243 | 281 |
| 74 | 3300025299 | Ga0209256_1001003 | Ga0209256_100100311 | 281 |
| 75 | 3300025303 | Ga0209051_1010153 | Ga0209051_10101532 | 281 |
| 76 | 3300025304 | Ga0209257_1000261 | Ga0209257_100026114 | 281 |
| 77 | 3300025304 | Ga0209257_1000548 | Ga0209257_10005483 | 281 |
| 78 | 3300025304 | Ga0209257_1001489 | Ga0209257_100148915 | 281 |
| 79 | 3300025304 | Ga0209257_1008476 | Ga0209257_10084763 | 281 |
| 80 | 3300028794 | Ga0307515_10046926 | Ga0307515_100469267 | 281 |
| 81 | 3300031995 | Ga0307409_100529500 | Ga0307409_1005295002 | 281 |
| 82 | 3300033180 | Ga0307510_10071530 | Ga0307510_100715303 | 281 |
| 83 | 3300042015 | Ga0439462_0007287 | Ga0439462_0007287_1797_2642 | 281 |
| 84 | 3300046616 | Ga0495668_0002001 | Ga0495668_0002001_16566_17411 | 281 |
| 85 | 3300049579 | Ga0501043_0003380 | Ga0501043_0003380_10454_11299 | 281 |
| 86 | 3300049581 | Ga0501047_0188715 | Ga0501047_0188715_472_1323 | 281 |
| 87 | 3300050510 | nmdc:mga06r32_481666_c1 | nmdc:mga06r32_481666_c1_340_1194 | 281 |
| 88 | 3300053124 | Ga0500617_068862 | Ga0500617_068862_685_1536 | 281 |
| 89 | 3300053146 | Ga0500588_0012319 | Ga0500588_0012319_371_1222 | 281 |
| 90 | 3300053151 | Ga0500604_0021066 | Ga0500604_0021066_782_1633 | 281 |
| 91 | 3300053156 | Ga0500622_0003917 | Ga0500622_0003917_1685_2536 | 281 |
| 92 | 3300053156 | Ga0500622_0039882 | Ga0500622_0039882_1588_2433 | 281 |
| 93 | iso_pu_bacteria | 2928972540 | 2928975285 | 281 |
| 94 | iso_pu_bacteria | 2977240413 | 2977241727 | 281 |
| 95 | 3300002739 | JGI25158J39367_1003149 | JGI25158J39367_10031492 | 282 |
| 96 | 3300002773 | JGI25152J39213_1000004 | JGI25152J39213_100000413 | 282 |
| 97 | 3300002773 | JGI25152J39213_1000188 | JGI25152J39213_100018816 | 282 |
| 98 | 3300002774 | JGI25150J39212_1000338 | JGI25150J39212_10003384 | 282 |
| 99 | 3300002774 | JGI25150J39212_1001502 | JGI25150J39212_10015026 | 282 |
| 100 | 3300002774 | JGI25150J39212_1014869 | JGI25150J39212_10148691 | 282 |
| 101 | 3300002987 | JGI25159J45721_1004310 | JGI25159J45721_10043103 | 282 |
| 102 | 3300002987 | JGI25159J45721_1012739 | JGI25159J45721_10127392 | 282 |
| 103 | 3300003187 | JGI25151J46595_10000010 | JGI25151J46595_1000001013 | 282 |
| 104 | 3300003215 | JGI25153J46596_10000013 | JGI25153J46596_1000001313 | 282 |
| 105 | 3300003322 | rootL2_10027242 | rootL2_1002724218 | 282 |
| 106 | 3300003322 | rootL2_10188467 | rootL2_101884671 | 282 |
| 107 | 3300003354 | JGI25160J50197_1019420 | JGI25160J50197_10194202 | 282 |
| 108 | 3300003575 | Ga0007409J51694_1027346 | Ga0007409J51694_10273461 | 282 |
| 109 | 3300003759 | Ga0055525_1000008 | Ga0055525_100000888 | 282 |
| 110 | 3300003763 | Ga0055529_1000421 | Ga0055529_100042132 | 282 |
| 111 | 3300003771 | Ga0055526_1000025 | Ga0055526_100002572 | 282 |
| 112 | 3300003771 | Ga0055526_1001631 | Ga0055526_100163112 | 282 |
| 113 | 3300003771 | Ga0055526_1001917 | Ga0055526_100191713 | 282 |
| 114 | 3300003771 | Ga0055526_1002815 | Ga0055526_10028152 | 282 |
| 115 | 3300003771 | Ga0055526_1004482 | Ga0055526_10044822 | 282 |
| 116 | 3300003773 | Ga0055537_1000004 | Ga0055537_100000430 | 282 |
| 117 | 3300003773 | Ga0055537_1000340 | Ga0055537_100034012 | 282 |
| 118 | 3300003775 | Ga0055524_1001695 | Ga0055524_10016953 | 282 |
| 119 | 3300003775 | Ga0055524_1004092 | Ga0055524_10040923 | 282 |
| 120 | 3300003775 | Ga0055524_1027176 | Ga0055524_10271762 | 282 |
| 121 | 3300003784 | Ga0055534_1000069 | Ga0055534_10000699 | 282 |
| 122 | 3300003784 | Ga0055534_1000216 | Ga0055534_100021610 | 282 |
| 123 | 3300003790 | Ga0055528_1000141 | Ga0055528_10001419 | 282 |
| 124 | 3300003790 | Ga0055528_1000203 | Ga0055528_100020339 | 282 |
| 125 | 3300003791 | Ga0055530_10000166 | Ga0055530_1000016622 | 282 |
| 126 | 3300003791 | Ga0055530_10001740 | Ga0055530_100017406 | 282 |
| 127 | 3300003791 | Ga0055530_10021404 | Ga0055530_100214042 | 282 |
| 128 | 3300003791 | Ga0055530_10021642 | Ga0055530_100216421 | 282 |
| 129 | 3300003791 | Ga0055530_10032757 | Ga0055530_100327572 | 282 |
| 130 | 3300003794 | Ga0055531_10000053 | Ga0055531_1000005353 | 282 |
| 131 | 3300003794 | Ga0055531_10009495 | Ga0055531_100094955 | 282 |
| 132 | 3300003794 | Ga0055531_10014313 | Ga0055531_100143133 | 282 |
| 133 | 3300003794 | Ga0055531_10044908 | Ga0055531_100449081 | 282 |
| 134 | 3300004625 | Ga0055543_1001580 | Ga0055543_10015805 | 282 |
| 135 | 3300004625 | Ga0055543_1026194 | Ga0055543_10261941 | 282 |
| 136 | 3300004625 | Ga0055543_1026202 | Ga0055543_10262021 | 282 |
| 137 | 3300005262 | Ga0065165_1000003 | Ga0065165_1000003326 | 282 |
| 138 | 3300005262 | Ga0065165_1001826 | Ga0065165_100182612 | 282 |
| 139 | 3300005262 | Ga0065165_1060666 | Ga0065165_10606661 | 282 |
| 140 | 3300005262 | Ga0065165_1060668 | Ga0065165_10606681 | 282 |
| 141 | 3300005289 | Ga0065704_10070417 | Ga0065704_1007041711 | 282 |
| 142 | 3300005293 | Ga0065715_10032639 | Ga0065715_100326391 | 282 |
| 143 | 3300005327 | Ga0070658_10197790 | Ga0070658_101977902 | 282 |
| 144 | 3300005328 | Ga0070676_10101877 | Ga0070676_101018772 | 282 |
| 145 | 3300005329 | Ga0070683_100168049 | Ga0070683_1001680492 | 282 |
| 146 | 3300005330 | Ga0070690_100010591 | Ga0070690_1000105913 | 282 |
| 147 | 3300005331 | Ga0070670_100055571 | Ga0070670_1000555714 | 282 |
| 148 | 3300005334 | Ga0068869_100279216 | Ga0068869_1002792162 | 282 |
| 149 | 3300005336 | Ga0070680_100037517 | Ga0070680_1000375172 | 282 |
| 150 | 3300005339 | Ga0070660_100015374 | Ga0070660_1000153742 | 282 |
| 151 | 3300005339 | Ga0070660_100028787 | Ga0070660_1000287872 | 282 |
| 152 | 3300005340 | Ga0070689_100008730 | Ga0070689_1000087305 | 282 |
| 153 | 3300005344 | Ga0070661_100007078 | Ga0070661_1000070786 | 282 |
| 154 | 3300005344 | Ga0070661_100012297 | Ga0070661_1000122974 | 282 |
| 155 | 3300005347 | Ga0070668_100604702 | Ga0070668_1006047021 | 282 |
| 156 | 3300005353 | Ga0070669_100166503 | Ga0070669_1001665032 | 282 |
| 157 | 3300005355 | Ga0070671_100086877 | Ga0070671_1000868773 | 282 |
| 158 | 3300005355 | Ga0070671_100132780 | Ga0070671_1001327802 | 282 |
| 159 | 3300005356 | Ga0070674_100090274 | Ga0070674_1000902742 | 282 |
| 160 | 3300005364 | Ga0070673_100284811 | Ga0070673_1002848111 | 282 |
| 161 | 3300005364 | Ga0070673_100302315 | Ga0070673_1003023152 | 282 |
| 162 | 3300005365 | Ga0070688_100442259 | Ga0070688_1004422591 | 282 |
| 163 | 3300005366 | Ga0070659_100010441 | Ga0070659_1000104418 | 282 |
| 164 | 3300005367 | Ga0070667_100118327 | Ga0070667_1001183272 | 282 |
| 165 | 3300005367 | Ga0070667_100125929 | Ga0070667_1001259292 | 282 |
| 166 | 3300005456 | Ga0070678_100191696 | Ga0070678_1001916962 | 282 |
| 167 | 3300005457 | Ga0070662_100009401 | Ga0070662_1000094014 | 282 |
| 168 | 3300005458 | Ga0070681_10015337 | Ga0070681_100153375 | 282 |
| 169 | 3300005458 | Ga0070681_10230494 | Ga0070681_102304942 | 282 |
| 170 | 3300005459 | Ga0068867_100009154 | Ga0068867_1000091542 | 282 |
| 171 | 3300005459 | Ga0068867_100210020 | Ga0068867_1002100202 | 282 |
| 172 | 3300005466 | Ga0070685_10122820 | Ga0070685_101228202 | 282 |
| 173 | 3300005539 | Ga0068853_100013970 | Ga0068853_1000139704 | 282 |
| 174 | 3300005539 | Ga0068853_100290588 | Ga0068853_1002905882 | 282 |
| 175 | 3300005543 | Ga0070672_100002346 | Ga0070672_1000023466 | 282 |
| 176 | 3300005544 | Ga0070686_100048146 | Ga0070686_1000481462 | 282 |
| 177 | 3300005545 | Ga0070695_100040608 | Ga0070695_1000406083 | 282 |
| 178 | 3300005547 | Ga0070693_100032117 | Ga0070693_1000321172 | 282 |
| 179 | 3300005563 | Ga0068855_100113810 | Ga0068855_1001138102 | 282 |
| 180 | 3300005563 | Ga0068855_100131602 | Ga0068855_1001316022 | 282 |
| 181 | 3300005564 | Ga0070664_100055995 | Ga0070664_1000559952 | 282 |
| 182 | 3300005564 | Ga0070664_100092967 | Ga0070664_1000929673 | 282 |
| 183 | 3300005564 | Ga0070664_100239646 | Ga0070664_1002396462 | 282 |
| 184 | 3300005564 | Ga0070664_100461462 | Ga0070664_1004614621 | 282 |
| 185 | 3300005616 | Ga0068852_100093242 | Ga0068852_1000932423 | 282 |
| 186 | 3300005616 | Ga0068852_100162637 | Ga0068852_1001626372 | 282 |
| 187 | 3300005616 | Ga0068852_100749505 | Ga0068852_1007495051 | 282 |
| 188 | 3300005617 | Ga0068859_100137172 | Ga0068859_1001371722 | 282 |
| 189 | 3300005617 | Ga0068859_100153093 | Ga0068859_1001530933 | 282 |
| 190 | 3300005618 | Ga0068864_100020869 | Ga0068864_1000208693 | 282 |
| 191 | 3300005618 | Ga0068864_100143407 | Ga0068864_1001434072 | 282 |
| 192 | 3300005618 | Ga0068864_100282600 | Ga0068864_1002826002 | 282 |
| 193 | 3300005718 | Ga0068866_10322072 | Ga0068866_103220721 | 282 |
| 194 | 3300005841 | Ga0068863_100028480 | Ga0068863_1000284802 | 282 |
| 195 | 3300005841 | Ga0068863_100082400 | Ga0068863_1000824003 | 282 |
| 196 | 3300005841 | Ga0068863_100128359 | Ga0068863_1001283592 | 282 |
| 197 | 3300005841 | Ga0068863_100312509 | Ga0068863_1003125092 | 282 |
| 198 | 3300005842 | Ga0068858_100054049 | Ga0068858_1000540493 | 282 |
| 199 | 3300005842 | Ga0068858_100059362 | Ga0068858_1000593622 | 282 |
| 200 | 3300005842 | Ga0068858_100295151 | Ga0068858_1002951512 | 282 |
| 201 | 3300005843 | Ga0068860_100007275 | Ga0068860_10000727512 | 282 |
| 202 | 3300005843 | Ga0068860_100035180 | Ga0068860_1000351804 | 282 |
| 203 | 3300005843 | Ga0068860_100603133 | Ga0068860_1006031332 | 282 |
| 204 | 3300005844 | Ga0068862_100005471 | Ga0068862_1000054718 | 282 |
| 205 | 3300005844 | Ga0068862_100464386 | Ga0068862_1004643861 | 282 |
| 206 | 3300006048 | Ga0075363_100131301 | Ga0075363_1001313012 | 282 |
| 207 | 3300006195 | Ga0075366_10225749 | Ga0075366_102257491 | 282 |
| 208 | 3300006237 | Ga0097621_100093228 | Ga0097621_1000932282 | 282 |
| 209 | 3300006237 | Ga0097621_100126129 | Ga0097621_1001261292 | 282 |
| 210 | 3300006353 | Ga0075370_10029360 | Ga0075370_100293603 | 282 |
| 211 | 3300006358 | Ga0068871_100326300 | Ga0068871_1003263002 | 282 |
| 212 | 3300006358 | Ga0068871_100344332 | Ga0068871_1003443322 | 282 |
| 213 | 3300006844 | Ga0075428_100023051 | Ga0075428_1000230512 | 282 |
| 214 | 3300006844 | Ga0075428_100026890 | Ga0075428_1000268905 | 282 |
| 215 | 3300006844 | Ga0075428_100064300 | Ga0075428_1000643004 | 282 |
| 216 | 3300006846 | Ga0075430_100000781 | Ga0075430_1000007817 | 282 |
| 217 | 3300006846 | Ga0075430_100011325 | Ga0075430_1000113255 | 282 |
| 218 | 3300006847 | Ga0075431_100008277 | Ga0075431_1000082778 | 282 |
| 219 | 3300006847 | Ga0075431_100024236 | Ga0075431_1000242362 | 282 |
| 220 | 3300006880 | Ga0075429_100015188 | Ga0075429_1000151886 | 282 |
| 221 | 3300006880 | Ga0075429_100134837 | Ga0075429_1001348372 | 282 |
| 222 | 3300006881 | Ga0068865_100008656 | Ga0068865_1000086563 | 282 |
| 223 | 3300006931 | Ga0097620_100137164 | Ga0097620_1001371642 | 282 |
| 224 | 3300006931 | Ga0097620_100153090 | Ga0097620_1001530903 | 282 |
| 225 | 3300006948 | Ga0099826_10000001 | Ga0099826_10000001478 | 282 |
| 226 | 3300009093 | Ga0105240_10030317 | Ga0105240_100303175 | 282 |
| 227 | 3300009093 | Ga0105240_10186742 | Ga0105240_101867422 | 282 |
| 228 | 3300009094 | Ga0111539_10015945 | Ga0111539_100159453 | 282 |
| 229 | 3300009094 | Ga0111539_10061984 | Ga0111539_100619842 | 282 |
| 230 | 3300009098 | Ga0105245_10318188 | Ga0105245_103181881 | 282 |
| 231 | 3300009147 | Ga0114129_10003559 | Ga0114129_100035599 | 282 |
| 232 | 3300009174 | Ga0105241_10040937 | Ga0105241_100409373 | 282 |
| 233 | 3300009174 | Ga0105241_10150068 | Ga0105241_101500682 | 282 |
| 234 | 3300009174 | Ga0105241_10182348 | Ga0105241_101823482 | 282 |
| 235 | 3300009176 | Ga0105242_10083793 | Ga0105242_100837932 | 282 |
| 236 | 3300009176 | Ga0105242_10230971 | Ga0105242_102309712 | 282 |
| 237 | 3300009177 | Ga0105248_10254465 | Ga0105248_102544651 | 282 |
| 238 | 3300009177 | Ga0105248_10509512 | Ga0105248_105095122 | 282 |
| 239 | 3300009545 | Ga0105237_10080817 | Ga0105237_100808173 | 282 |
| 240 | 3300009551 | Ga0105238_10449427 | Ga0105238_104494271 | 282 |
| 241 | 3300009553 | Ga0105249_10061830 | Ga0105249_100618301 | 282 |
| 242 | 3300009553 | Ga0105249_10386510 | Ga0105249_103865101 | 282 |
| 243 | 3300009553 | Ga0105249_10726625 | Ga0105249_107266252 | 282 |
| 244 | 3300010375 | Ga0105239_10076657 | Ga0105239_100766575 | 282 |
| 245 | 3300013104 | Ga0157370_10142068 | Ga0157370_101420682 | 282 |
| 246 | 3300013105 | Ga0157369_10025010 | Ga0157369_100250105 | 282 |
| 247 | 3300013296 | Ga0157374_10202494 | Ga0157374_102024942 | 282 |
| 248 | 3300013297 | Ga0157378_10085334 | Ga0157378_100853341 | 282 |
| 249 | 3300013297 | Ga0157378_10368827 | Ga0157378_103688272 | 282 |
| 250 | 3300013297 | Ga0157378_10502211 | Ga0157378_105022112 | 282 |
| 251 | 3300013306 | Ga0163162_10000016 | Ga0163162_1000001614 | 282 |
| 252 | 3300013306 | Ga0163162_10023966 | Ga0163162_100239667 | 282 |
| 253 | 3300013306 | Ga0163162_10205197 | Ga0163162_102051972 | 282 |
| 254 | 3300013306 | Ga0163162_10268198 | Ga0163162_102681982 | 282 |
| 255 | 3300013307 | Ga0157372_10044386 | Ga0157372_100443862 | 282 |
| 256 | 3300013307 | Ga0157372_10317329 | Ga0157372_103173292 | 282 |
| 257 | 3300013308 | Ga0157375_10020927 | Ga0157375_100209273 | 282 |
| 258 | 3300013308 | Ga0157375_10094077 | Ga0157375_100940773 | 282 |
| 259 | 3300013308 | Ga0157375_10139277 | Ga0157375_101392772 | 282 |
| 260 | 3300013308 | Ga0157375_10175623 | Ga0157375_101756232 | 282 |
| 261 | 3300013308 | Ga0157375_10188956 | Ga0157375_101889562 | 282 |
| 262 | 3300014325 | Ga0163163_10246282 | Ga0163163_102462822 | 282 |
| 263 | 3300014968 | Ga0157379_10110043 | Ga0157379_101100432 | 282 |
| 264 | 3300014969 | Ga0157376_10223042 | Ga0157376_102230421 | 282 |
| 265 | 3300015262 | Ga0182007_10000117 | Ga0182007_1000011739 | 282 |
| 266 | 3300015265 | Ga0182005_1000220 | Ga0182005_10002206 | 282 |
| 267 | 3300021361 | Ga0213872_10023069 | Ga0213872_100230693 | 282 |
| 268 | 3300021384 | Ga0213876_10000119 | Ga0213876_100001193 | 282 |
| 269 | 3300021384 | Ga0213876_10000246 | Ga0213876_1000024615 | 282 |
| 270 | 3300025208 | Ga0209436_100176 | Ga0209436_10017627 | 282 |
| 271 | 3300025208 | Ga0209436_107040 | Ga0209436_1070402 | 282 |
| 272 | 3300025230 | Ga0209563_100003 | Ga0209563_1000031172 | 282 |
| 273 | 3300025245 | Ga0207425_1000015 | Ga0207425_1000015277 | 282 |
| 274 | 3300025245 | Ga0207425_1000125 | Ga0207425_10001257 | 282 |
| 275 | 3300025245 | Ga0207425_1000357 | Ga0207425_100035712 | 282 |
| 276 | 3300025253 | Ga0209677_105361 | Ga0209677_1053613 | 282 |
| 277 | 3300025254 | Ga0209148_1000933 | Ga0209148_10009335 | 282 |
| 278 | 3300025258 | Ga0209129_1000074 | Ga0209129_1000074158 | 282 |
| 279 | 3300025258 | Ga0209129_1004558 | Ga0209129_10045583 | 282 |
| 280 | 3300025263 | Ga0209565_1000018 | Ga0209565_100001845 | 282 |
| 281 | 3300025263 | Ga0209565_1000033 | Ga0209565_1000033167 | 282 |
| 282 | 3300025263 | Ga0209565_1001039 | Ga0209565_100103910 | 282 |
| 283 | 3300025263 | Ga0209565_1005044 | Ga0209565_10050443 | 282 |
| 284 | 3300025272 | Ga0209455_1000026 | Ga0209455_1000026248 | 282 |
| 285 | 3300025273 | Ga0209673_1000062 | Ga0209673_100006299 | 282 |
| 286 | 3300025273 | Ga0209673_1000090 | Ga0209673_1000090132 | 282 |
| 287 | 3300025273 | Ga0209673_1025985 | Ga0209673_10259852 | 282 |
| 288 | 3300025284 | Ga0209130_1000036 | Ga0209130_10000367 | 282 |
| 289 | 3300025284 | Ga0209130_1005135 | Ga0209130_10051353 | 282 |
| 290 | 3300025284 | Ga0209130_1015427 | Ga0209130_10154271 | 282 |
| 291 | 3300025291 | Ga0209675_1000005 | Ga0209675_100000545 | 282 |
| 292 | 3300025291 | Ga0209675_1000018 | Ga0209675_100001812 | 282 |
| 293 | 3300025291 | Ga0209675_1003025 | Ga0209675_10030253 | 282 |
| 294 | 3300025292 | Ga0209676_1000031 | Ga0209676_1000031162 | 282 |
| 295 | 3300025292 | Ga0209676_1000052 | Ga0209676_1000052172 | 282 |
| 296 | 3300025292 | Ga0209676_1000095 | Ga0209676_100009593 | 282 |
| 297 | 3300025294 | Ga0209025_1000002 | Ga0209025_10000021175 | 282 |
| 298 | 3300025294 | Ga0209025_1010456 | Ga0209025_10104564 | 282 |
| 299 | 3300025295 | Ga0209564_1000027 | Ga0209564_1000027106 | 282 |
| 300 | 3300025295 | Ga0209564_1000078 | Ga0209564_1000078219 | 282 |
| 301 | 3300025295 | Ga0209564_1000637 | Ga0209564_100063720 | 282 |
| 302 | 3300025295 | Ga0209564_1001694 | Ga0209564_10016943 | 282 |
| 303 | 3300025295 | Ga0209564_1004422 | Ga0209564_10044223 | 282 |
| 304 | 3300025295 | Ga0209564_1004530 | Ga0209564_10045306 | 282 |
| 305 | 3300025297 | Ga0209758_1000003 | Ga0209758_10000031182 | 282 |
| 306 | 3300025297 | Ga0209758_1001071 | Ga0209758_100107116 | 282 |
| 307 | 3300025297 | Ga0209758_1001141 | Ga0209758_10011414 | 282 |
| 308 | 3300025298 | Ga0209050_1000087 | Ga0209050_1000087110 | 282 |
| 309 | 3300025298 | Ga0209050_1000320 | Ga0209050_100032056 | 282 |
| 310 | 3300025298 | Ga0209050_1009917 | Ga0209050_10099172 | 282 |
| 311 | 3300025299 | Ga0209256_1000601 | Ga0209256_100060138 | 282 |
| 312 | 3300025302 | Ga0207426_1001256 | Ga0207426_100125615 | 282 |
| 313 | 3300025302 | Ga0207426_1066773 | Ga0207426_10667731 | 282 |
| 314 | 3300025303 | Ga0209051_1001827 | Ga0209051_100182714 | 282 |
| 315 | 3300025303 | Ga0209051_1019763 | Ga0209051_10197633 | 282 |
| 316 | 3300025304 | Ga0209257_1000010 | Ga0209257_1000010246 | 282 |
| 317 | 3300025304 | Ga0209257_1000046 | Ga0209257_1000046239 | 282 |
| 318 | 3300025304 | Ga0209257_1000050 | Ga0209257_1000050268 | 282 |
| 319 | 3300025304 | Ga0209257_1000136 | Ga0209257_1000136132 | 282 |
| 320 | 3300025304 | Ga0209257_1000153 | Ga0209257_100015370 | 282 |
| 321 | 3300025304 | Ga0209257_1002549 | Ga0209257_10025496 | 282 |
| 322 | 3300025304 | Ga0209257_1010260 | Ga0209257_10102605 | 282 |
| 323 | 3300025728 | Ga0207655_1013138 | Ga0207655_10131384 | 282 |
| 324 | 3300025728 | Ga0207655_1015127 | Ga0207655_10151273 | 282 |
| 325 | 3300025735 | Ga0207713_1004235 | Ga0207713_10042356 | 282 |
| 326 | 3300025900 | Ga0207710_10068171 | Ga0207710_100681712 | 282 |
| 327 | 3300025901 | Ga0207688_10015900 | Ga0207688_100159004 | 282 |
| 328 | 3300025908 | Ga0207643_10065422 | Ga0207643_100654222 | 282 |
| 329 | 3300025911 | Ga0207654_10032083 | Ga0207654_100320832 | 282 |
| 330 | 3300025912 | Ga0207707_10012317 | Ga0207707_100123174 | 282 |
| 331 | 3300025912 | Ga0207707_10189362 | Ga0207707_101893622 | 282 |
| 332 | 3300025913 | Ga0207695_10013070 | Ga0207695_100130708 | 282 |
| 333 | 3300025913 | Ga0207695_10188865 | Ga0207695_101888652 | 282 |
| 334 | 3300025919 | Ga0207657_10002453 | Ga0207657_1000245311 | 282 |
| 335 | 3300025925 | Ga0207650_10055501 | Ga0207650_100555013 | 282 |
| 336 | 3300025926 | Ga0207659_10126747 | Ga0207659_101267472 | 282 |
| 337 | 3300025932 | Ga0207690_10039847 | Ga0207690_100398473 | 282 |
| 338 | 3300025933 | Ga0207706_10004937 | Ga0207706_100049374 | 282 |
| 339 | 3300025933 | Ga0207706_10262663 | Ga0207706_102626631 | 282 |
| 340 | 3300025933 | Ga0207706_10391533 | Ga0207706_103915331 | 282 |
| 341 | 3300025934 | Ga0207686_10062107 | Ga0207686_100621072 | 282 |
| 342 | 3300025936 | Ga0207670_10014543 | Ga0207670_100145433 | 282 |
| 343 | 3300025937 | Ga0207669_10098411 | Ga0207669_100984112 | 282 |
| 344 | 3300025937 | Ga0207669_10286246 | Ga0207669_102862461 | 282 |
| 345 | 3300025938 | Ga0207704_10025489 | Ga0207704_100254892 | 282 |
| 346 | 3300025940 | Ga0207691_10014770 | Ga0207691_100147704 | 282 |
| 347 | 3300025940 | Ga0207691_10372510 | Ga0207691_103725101 | 282 |
| 348 | 3300025941 | Ga0207711_10087686 | Ga0207711_100876862 | 282 |
| 349 | 3300025942 | Ga0207689_10107680 | Ga0207689_101076802 | 282 |
| 350 | 3300025942 | Ga0207689_10315296 | Ga0207689_103152962 | 282 |
| 351 | 3300025945 | Ga0207679_10313986 | Ga0207679_103139862 | 282 |
| 352 | 3300025945 | Ga0207679_10630670 | Ga0207679_106306701 | 282 |
| 353 | 3300025949 | Ga0207667_10046098 | Ga0207667_100460983 | 282 |
| 354 | 3300025961 | Ga0207712_10039699 | Ga0207712_100396991 | 282 |
| 355 | 3300026023 | Ga0207677_10102195 | Ga0207677_101021953 | 282 |
| 356 | 3300026023 | Ga0207677_10213404 | Ga0207677_102134042 | 282 |
| 357 | 3300026035 | Ga0207703_10155527 | Ga0207703_101555272 | 282 |
| 358 | 3300026035 | Ga0207703_10180792 | Ga0207703_101807922 | 282 |
| 359 | 3300026041 | Ga0207639_10086407 | Ga0207639_100864072 | 282 |
| 360 | 3300026041 | Ga0207639_10302238 | Ga0207639_103022382 | 282 |
| 361 | 3300026078 | Ga0207702_10104122 | Ga0207702_101041222 | 282 |
| 362 | 3300026088 | Ga0207641_10086807 | Ga0207641_100868072 | 282 |
| 363 | 3300026088 | Ga0207641_10117884 | Ga0207641_101178841 | 282 |
| 364 | 3300026088 | Ga0207641_10142337 | Ga0207641_101423372 | 282 |
| 365 | 3300026089 | Ga0207648_10010182 | Ga0207648_100101824 | 282 |
| 366 | 3300026095 | Ga0207676_10468578 | Ga0207676_104685782 | 282 |
| 367 | 3300026116 | Ga0207674_10524150 | Ga0207674_105241501 | 282 |
| 368 | 3300026118 | Ga0207675_100003322 | Ga0207675_1000033227 | 282 |
| 369 | 3300026121 | Ga0207683_10010779 | Ga0207683_100107796 | 282 |
| 370 | 3300026121 | Ga0207683_10053241 | Ga0207683_100532412 | 282 |
| 371 | 3300027666 | Ga0209282_1000001 | Ga0209282_10000011616 | 282 |
| 372 | 3300028380 | Ga0268265_10002277 | Ga0268265_100022776 | 282 |
| 373 | 3300028380 | Ga0268265_10204253 | Ga0268265_102042532 | 282 |
| 374 | 3300028381 | Ga0268264_10008154 | Ga0268264_100081543 | 282 |
| 375 | 3300028381 | Ga0268264_10015656 | Ga0268264_100156565 | 282 |
| 376 | 3300028381 | Ga0268264_10104266 | Ga0268264_101042661 | 282 |
| 377 | 3300028381 | Ga0268264_10130613 | Ga0268264_101306132 | 282 |
| 378 | 3300028381 | Ga0268264_10256730 | Ga0268264_102567302 | 282 |
| 379 | 3300028800 | Ga0265338_10004919 | Ga0265338_100049192 | 282 |
| 380 | 3300028800 | Ga0265338_10022222 | Ga0265338_100222224 | 282 |
| 381 | 3300030731 | Ga0316177_1189032 | Ga0316177_11890326 | 282 |
| 382 | 3300030742 | Ga0316183_1141288 | Ga0316183_11412882 | 282 |
| 383 | 3300030745 | Ga0316182_1235230 | Ga0316182_12352302 | 282 |
| 384 | 3300031235 | Ga0265330_10038918 | Ga0265330_100389182 | 282 |
| 385 | 3300031238 | Ga0265332_10056130 | Ga0265332_100561302 | 282 |
| 386 | 3300031247 | Ga0265340_10000072 | Ga0265340_1000007211 | 282 |
| 387 | 3300031247 | Ga0265340_10018477 | Ga0265340_100184773 | 282 |
| 388 | 3300031249 | Ga0265339_10125700 | Ga0265339_101257002 | 282 |
| 389 | 3300031251 | Ga0265327_10000039 | Ga0265327_10000039139 | 282 |
| 390 | 3300031251 | Ga0265327_10098827 | Ga0265327_100988272 | 282 |
| 391 | 3300031344 | Ga0265316_10043250 | Ga0265316_100432502 | 282 |
| 392 | 3300031344 | Ga0265316_10057899 | Ga0265316_100578993 | 282 |
| 393 | 3300031344 | Ga0265316_10125186 | Ga0265316_101251862 | 282 |
| 394 | 3300031456 | Ga0307513_10012392 | Ga0307513_100123929 | 282 |
| 395 | 3300031456 | Ga0307513_10097214 | Ga0307513_100972142 | 282 |
| 396 | 3300031548 | Ga0307408_100000618 | Ga0307408_1000006189 | 282 |
| 397 | 3300031548 | Ga0307408_100001729 | Ga0307408_1000017292 | 282 |
| 398 | 3300031548 | Ga0307408_100002147 | Ga0307408_1000021475 | 282 |
| 399 | 3300031548 | Ga0307408_100007999 | Ga0307408_1000079992 | 282 |
| 400 | 3300031548 | Ga0307408_100016004 | Ga0307408_1000160043 | 282 |
| 401 | 3300031548 | Ga0307408_100303217 | Ga0307408_1003032172 | 282 |
| 402 | 3300031548 | Ga0307408_100493011 | Ga0307408_1004930112 | 282 |
| 403 | 3300031711 | Ga0265314_10011526 | Ga0265314_100115264 | 282 |
| 404 | 3300031711 | Ga0265314_10076430 | Ga0265314_100764302 | 282 |
| 405 | 3300031712 | Ga0265342_10027636 | Ga0265342_100276362 | 282 |
| 406 | 3300031712 | Ga0265342_10071229 | Ga0265342_100712292 | 282 |
| 407 | 3300031730 | Ga0307516_10029535 | Ga0307516_100295352 | 282 |
| 408 | 3300031730 | Ga0307516_10041993 | Ga0307516_100419934 | 282 |
| 409 | 3300031731 | Ga0307405_10003199 | Ga0307405_100031996 | 282 |
| 410 | 3300031824 | Ga0307413_10000617 | Ga0307413_100006177 | 282 |
| 411 | 3300031852 | Ga0307410_10232651 | Ga0307410_102326512 | 282 |
| 412 | 3300031901 | Ga0307406_10004595 | Ga0307406_100045956 | 282 |
| 413 | 3300031901 | Ga0307406_10067913 | Ga0307406_100679132 | 282 |
| 414 | 3300031903 | Ga0307407_10003220 | Ga0307407_100032202 | 282 |
| 415 | 3300031911 | Ga0307412_10095811 | Ga0307412_100958112 | 282 |
| 416 | 3300031995 | Ga0307409_100006208 | Ga0307409_1000062082 | 282 |
| 417 | 3300031995 | Ga0307409_100012834 | Ga0307409_1000128342 | 282 |
| 418 | 3300032002 | Ga0307416_100718177 | Ga0307416_1007181771 | 282 |
| 419 | 3300032004 | Ga0307414_10073765 | Ga0307414_100737652 | 282 |
| 420 | 3300032004 | Ga0307414_10317538 | Ga0307414_103175381 | 282 |
| 421 | 3300032005 | Ga0307411_10001591 | Ga0307411_100015918 | 282 |
| 422 | 3300032005 | Ga0307411_10136718 | Ga0307411_101367182 | 282 |
| 423 | 3300032126 | Ga0307415_100067617 | Ga0307415_1000676172 | 282 |
| 424 | 3300032126 | Ga0307415_100624907 | Ga0307415_1006249071 | 282 |
| 425 | 3300033179 | Ga0307507_10182699 | Ga0307507_101826991 | 282 |
| 426 | 3300033179 | Ga0307507_10184722 | Ga0307507_101847223 | 282 |
| 427 | 3300037312 | Ga0395899_0000012 | Ga0395899_0000012_54291_55139 | 282 |
| 428 | 3300037312 | Ga0395899_0073557 | Ga0395899_0073557_1424_2272 | 282 |
| 429 | 3300037418 | Ga0395900_0000028 | Ga0395900_0000028_135083_135931 | 282 |
| 430 | 3300037418 | Ga0395900_0002683 | Ga0395900_0002683_12777_13625 | 282 |
| 431 | 3300037418 | Ga0395900_0012863 | Ga0395900_0012863_369_1217 | 282 |
| 432 | 3300037418 | Ga0395900_0014052 | Ga0395900_0014052_5367_6215 | 282 |
| 433 | 3300037418 | Ga0395900_0054335 | Ga0395900_0054335_468_1316 | 282 |
| 434 | 3300037418 | Ga0395900_0064343 | Ga0395900_0064343_810_1703 | 282 |
| 435 | 3300037466 | Ga0395898_0019762 | Ga0395898_0019762_1082_1930 | 282 |
| 436 | 3300037471 | Ga0395905_0044068 | Ga0395905_0044068_1326_2174 | 282 |
| 437 | 3300038443 | Ga0395901_0000076 | Ga0395901_0000076_45712_46560 | 282 |
| 438 | 3300038443 | Ga0395901_0151064 | Ga0395901_0151064_1085_1933 | 282 |
| 439 | 3300038443 | Ga0395901_0260964 | Ga0395901_0260964_36_929 | 282 |
| 440 | 3300038443 | Ga0395901_0398871 | Ga0395901_0398871_86_934 | 282 |
| 441 | 3300038443 | Ga0395901_0538581 | Ga0395901_0538581_319_1167 | 282 |
| 442 | 3300038705 | Ga0237819_00007 | Ga0237819_00007_59186_60034 | 282 |
| 443 | 3300039145 | Ga0237816_00241 | Ga0237816_00241_3215_4063 | 282 |
| 444 | 3300039437 | Ga0436365_0213934 | Ga0436365_0213934_19708_20556 | 282 |
| 445 | 3300039437 | Ga0436365_1476328 | Ga0436365_1476328_41641_42489 | 282 |
| 446 | 3300039447 | Ga0436361_0166535 | Ga0436361_0166535_153_1001 | 282 |
| 447 | 3300039447 | Ga0436361_1221194 | Ga0436361_1221194_1667_2515 | 282 |
| 448 | 3300041413 | Ga0439465_0056709 | Ga0439465_0056709_168_1016 | 282 |
| 449 | 3300041451 | Ga0451791_0321965 | Ga0451791_0321965_821_1669 | 282 |
| 450 | 3300041451 | Ga0451791_0753430 | Ga0451791_0753430_113_961 | 282 |
| 451 | 3300041458 | Ga0451798_1100220 | Ga0451798_1100220_121_969 | 282 |
| 452 | 3300041460 | Ga0451802_0228891 | Ga0451802_0228891_2984_3832 | 282 |
| 453 | 3300041486 | Ga0451807_0617128 | Ga0451807_0617128_264_1112 | 282 |
| 454 | 3300041498 | Ga0451841_1039072 | Ga0451841_1039072_799_1647 | 282 |
| 455 | 3300041505 | Ga0451849_0981658 | Ga0451849_0981658_691_1539 | 282 |
| 456 | 3300041507 | Ga0451851_0837399 | Ga0451851_0837399_12_860 | 282 |
| 457 | 3300041509 | Ga0451843_0711483 | Ga0451843_0711483_1240_2088 | 282 |
| 458 | 3300042001 | Ga0439441_006718 | Ga0439441_006718_560_1408 | 282 |
| 459 | 3300042005 | Ga0439448_0001122 | Ga0439448_0001122_3549_4397 | 282 |
| 460 | 3300042007 | Ga0439449_0000020 | Ga0439449_0000020_11146_11994 | 282 |
| 461 | 3300042007 | Ga0439449_0005395 | Ga0439449_0005395_3465_4313 | 282 |
| 462 | 3300042008 | Ga0439450_021695 | Ga0439450_021695_209_1057 | 282 |
| 463 | 3300042012 | Ga0439455_0015456 | Ga0439455_0015456_349_1197 | 282 |
| 464 | 3300042142 | Ga0450905_003641 | Ga0450905_003641_834_1682 | 282 |
| 465 | 3300042156 | Ga0439446_0014462 | Ga0439446_0014462_262_1110 | 282 |
| 466 | 3300042876 | Ga0451577_0002991 | Ga0451577_0002991_5822_6670 | 282 |
| 467 | 3300044656 | Ga0466969_0137000 | Ga0466969_0137000_236_1084 | 282 |
| 468 | 3300044656 | Ga0466969_0145177 | Ga0466969_0145177_211_1059 | 282 |
| 469 | 3300044658 | Ga0466972_0042178 | Ga0466972_0042178_1185_2033 | 282 |
| 470 | 3300044683 | Ga0466965_0022517 | Ga0466965_0022517_513_1379 | 282 |
| 471 | 3300044683 | Ga0466965_0063752 | Ga0466965_0063752_787_1635 | 282 |
| 472 | 3300044683 | Ga0466965_0089841 | Ga0466965_0089841_650_1498 | 282 |
| 473 | 3300044684 | Ga0466966_0000485 | Ga0466966_0000485_11496_12344 | 282 |
| 474 | 3300044684 | Ga0466966_0001407 | Ga0466966_0001407_12654_13502 | 282 |
| 475 | 3300044684 | Ga0466966_0008459 | Ga0466966_0008459_3189_4055 | 282 |
| 476 | 3300044684 | Ga0466966_0024383 | Ga0466966_0024383_3075_3923 | 282 |
| 477 | 3300044684 | Ga0466966_0088665 | Ga0466966_0088665_620_1468 | 282 |
| 478 | 3300044684 | Ga0466966_0164455 | Ga0466966_0164455_477_1325 | 282 |
| 479 | 3300044693 | Ga0466961_0053821 | Ga0466961_0053821_736_1584 | 282 |
| 480 | 3300044693 | Ga0466961_0309010 | Ga0466961_0309010_32_880 | 282 |
| 481 | 3300044694 | Ga0466963_0063269 | Ga0466963_0063269_1127_1975 | 282 |
| 482 | 3300044706 | Ga0466964_0000150 | Ga0466964_0000150_5787_6635 | 282 |
| 483 | 3300044706 | Ga0466964_0039462 | Ga0466964_0039462_564_1412 | 282 |
| 484 | 3300044712 | Ga0453684_0184554 | Ga0453684_0184554_197_1045 | 282 |
| 485 | 3300044719 | Ga0466971_0181499 | Ga0466971_0181499_74_922 | 282 |
| 486 | 3300044735 | Ga0466968_0003732 | Ga0466968_0003732_3532_4380 | 282 |
| 487 | 3300044735 | Ga0466968_0153620 | Ga0466968_0153620_135_983 | 282 |
| 488 | 3300044842 | Ga0466957_0000034 | Ga0466957_0000034_26802_27650 | 282 |
| 489 | 3300044842 | Ga0466957_0089264 | Ga0466957_0089264_47_895 | 282 |
| 490 | 3300044901 | Ga0466960_0037123 | Ga0466960_0037123_233_1081 | 282 |
| 491 | 3300045049 | Ga0466959_0017396 | Ga0466959_0017396_3644_4492 | 282 |
| 492 | 3300045836 | Ga0466958_0027005 | Ga0466958_0027005_821_1687 | 282 |
| 493 | 3300045836 | Ga0466958_0244519 | Ga0466958_0244519_113_961 | 282 |
| 494 | 3300045976 | Ga0466967_0027232 | Ga0466967_0027232_701_1549 | 282 |
| 495 | 3300045976 | Ga0466967_0064392 | Ga0466967_0064392_1060_1932 | 282 |
| 496 | 3300045976 | Ga0466967_0360582 | Ga0466967_0360582_133_981 | 282 |
| 497 | 3300046453 | Ga0495627_000015 | Ga0495627_000015_147908_148756 | 282 |
| 498 | 3300046460 | Ga0495638_0000198 | Ga0495638_0000198_23578_24426 | 282 |
| 499 | 3300046460 | Ga0495638_0000528 | Ga0495638_0000528_5804_6673 | 282 |
| 500 | 3300046460 | Ga0495638_0002732 | Ga0495638_0002732_10340_11200 | 282 |
| 501 | 3300046460 | Ga0495638_0003082 | Ga0495638_0003082_7204_8052 | 282 |
| 502 | 3300046460 | Ga0495638_0005851 | Ga0495638_0005851_2997_3845 | 282 |
| 503 | 3300046460 | Ga0495638_0007341 | Ga0495638_0007341_4302_5225 | 282 |
| 504 | 3300046471 | Ga0495650_0000577 | Ga0495650_0000577_26983_27831 | 282 |
| 505 | 3300046473 | Ga0495582_0036642 | Ga0495582_0036642_1139_1987 | 282 |
| 506 | 3300046474 | Ga0495605_0000112 | Ga0495605_0000112_67345_68193 | 282 |
| 507 | 3300046474 | Ga0495605_0001495 | Ga0495605_0001495_13276_14136 | 282 |
| 508 | 3300046474 | Ga0495605_0002051 | Ga0495605_0002051_4864_5712 | 282 |
| 509 | 3300046491 | Ga0495584_0008989 | Ga0495584_0008989_207_1067 | 282 |
| 510 | 3300046491 | Ga0495584_0030374 | Ga0495584_0030374_607_1455 | 282 |
| 511 | 3300046492 | Ga0495585_0019583 | Ga0495585_0019583_1643_2503 | 282 |
| 512 | 3300046500 | Ga0495596_0000088 | Ga0495596_0000088_27495_28343 | 282 |
| 513 | 3300046501 | Ga0495607_0001299 | Ga0495607_0001299_18654_19517 | 282 |
| 514 | 3300046501 | Ga0495607_0001443 | Ga0495607_0001443_3339_4187 | 282 |
| 515 | 3300046501 | Ga0495607_0035808 | Ga0495607_0035808_1416_2276 | 282 |
| 516 | 3300046501 | Ga0495607_0118720 | Ga0495607_0118720_530_1378 | 282 |
| 517 | 3300046506 | Ga0495583_0000029 | Ga0495583_0000029_64795_65643 | 282 |
| 518 | 3300046506 | Ga0495583_0000253 | Ga0495583_0000253_38200_39060 | 282 |
| 519 | 3300046506 | Ga0495583_0000265 | Ga0495583_0000265_61741_62589 | 282 |
| 520 | 3300046506 | Ga0495583_0014108 | Ga0495583_0014108_1590_2453 | 282 |
| 521 | 3300046507 | Ga0495606_0005061 | Ga0495606_0005061_1153_2001 | 282 |
| 522 | 3300046507 | Ga0495606_0025238 | Ga0495606_0025238_3227_4075 | 282 |
| 523 | 3300046512 | Ga0495610_0000040 | Ga0495610_0000040_76644_77567 | 282 |
| 524 | 3300046512 | Ga0495610_0000176 | Ga0495610_0000176_172_1020 | 282 |
| 525 | 3300046512 | Ga0495610_0001501 | Ga0495610_0001501_18107_18955 | 282 |
| 526 | 3300046512 | Ga0495610_0004463 | Ga0495610_0004463_29_877 | 282 |
| 527 | 3300046512 | Ga0495610_0011821 | Ga0495610_0011821_3105_3953 | 282 |
| 528 | 3300046513 | Ga0495616_0000016 | Ga0495616_0000016_70732_71583 | 282 |
| 529 | 3300046513 | Ga0495616_0000283 | Ga0495616_0000283_17888_18748 | 282 |
| 530 | 3300046513 | Ga0495616_0000572 | Ga0495616_0000572_16294_17142 | 282 |
| 531 | 3300046513 | Ga0495616_0001503 | Ga0495616_0001503_11402_12250 | 282 |
| 532 | 3300046513 | Ga0495616_0025050 | Ga0495616_0025050_2273_3121 | 282 |
| 533 | 3300046513 | Ga0495616_0025258 | Ga0495616_0025258_1236_2099 | 282 |
| 534 | 3300046513 | Ga0495616_0029452 | Ga0495616_0029452_1731_2579 | 282 |
| 535 | 3300046513 | Ga0495616_0095276 | Ga0495616_0095276_268_1191 | 282 |
| 536 | 3300046518 | Ga0495631_0010788 | Ga0495631_0010788_740_1588 | 282 |
| 537 | 3300046519 | Ga0495632_0000597 | Ga0495632_0000597_5977_6828 | 282 |
| 538 | 3300046519 | Ga0495632_0009670 | Ga0495632_0009670_4007_4855 | 282 |
| 539 | 3300046519 | Ga0495632_0016087 | Ga0495632_0016087_1668_2516 | 282 |
| 540 | 3300046520 | Ga0495637_0015323 | Ga0495637_0015323_1837_2685 | 282 |
| 541 | 3300046522 | Ga0495643_0000106 | Ga0495643_0000106_106344_107192 | 282 |
| 542 | 3300046522 | Ga0495643_0000621 | Ga0495643_0000621_20813_21661 | 282 |
| 543 | 3300046522 | Ga0495643_0001053 | Ga0495643_0001053_14058_14906 | 282 |
| 544 | 3300046522 | Ga0495643_0012735 | Ga0495643_0012735_1482_2330 | 282 |
| 545 | 3300046522 | Ga0495643_0050938 | Ga0495643_0050938_1236_2084 | 282 |
| 546 | 3300046523 | Ga0495644_0006644 | Ga0495644_0006644_341_1189 | 282 |
| 547 | 3300046523 | Ga0495644_0017977 | Ga0495644_0017977_766_1626 | 282 |
| 548 | 3300046524 | Ga0495648_0000087 | Ga0495648_0000087_58693_59541 | 282 |
| 549 | 3300046524 | Ga0495648_0000238 | Ga0495648_0000238_12775_13635 | 282 |
| 550 | 3300046525 | Ga0495663_0000769 | Ga0495663_0000769_7773_8621 | 282 |
| 551 | 3300046525 | Ga0495663_0024921 | Ga0495663_0024921_572_1420 | 282 |
| 552 | 3300046525 | Ga0495663_0062151 | Ga0495663_0062151_246_1094 | 282 |
| 553 | 3300046526 | Ga0495666_0040795 | Ga0495666_0040795_1147_2013 | 282 |
| 554 | 3300046528 | Ga0495642_0005083 | Ga0495642_0005083_627_1475 | 282 |
| 555 | 3300046528 | Ga0495642_0005528 | Ga0495642_0005528_3513_4376 | 282 |
| 556 | 3300046530 | Ga0495654_0016427 | Ga0495654_0016427_3014_3865 | 282 |
| 557 | 3300046530 | Ga0495654_0026485 | Ga0495654_0026485_292_1152 | 282 |
| 558 | 3300046535 | Ga0495586_0010495 | Ga0495586_0010495_1008_1874 | 282 |
| 559 | 3300046538 | Ga0495609_0000001 | Ga0495609_0000001_581751_582599 | 282 |
| 560 | 3300046538 | Ga0495609_0000241 | Ga0495609_0000241_18018_18878 | 282 |
| 561 | 3300046538 | Ga0495609_0000420 | Ga0495609_0000420_15385_16248 | 282 |
| 562 | 3300046538 | Ga0495609_0024711 | Ga0495609_0024711_1518_2366 | 282 |
| 563 | 3300046538 | Ga0495609_0026119 | Ga0495609_0026119_1797_2645 | 282 |
| 564 | 3300046538 | Ga0495609_0049273 | Ga0495609_0049273_578_1429 | 282 |
| 565 | 3300046538 | Ga0495609_0118781 | Ga0495609_0118781_261_1109 | 282 |
| 566 | 3300046542 | Ga0495597_0000119 | Ga0495597_0000119_20638_21486 | 282 |
| 567 | 3300046543 | Ga0495645_0126180 | Ga0495645_0126180_249_1097 | 282 |
| 568 | 3300046557 | Ga0495622_0000084 | Ga0495622_0000084_48465_49313 | 282 |
| 569 | 3300046558 | Ga0495633_0000187 | Ga0495633_0000187_43890_44738 | 282 |
| 570 | 3300046558 | Ga0495633_0005872 | Ga0495633_0005872_282_1130 | 282 |
| 571 | 3300046558 | Ga0495633_0012294 | Ga0495633_0012294_1221_2069 | 282 |
| 572 | 3300046558 | Ga0495633_0037894 | Ga0495633_0037894_1238_2086 | 282 |
| 573 | 3300046615 | Ga0495656_0005629 | Ga0495656_0005629_1550_2410 | 282 |
| 574 | 3300046615 | Ga0495656_0025112 | Ga0495656_0025112_210_1058 | 282 |
| 575 | 3300046615 | Ga0495656_0047249 | Ga0495656_0047249_492_1340 | 282 |
| 576 | 3300046616 | Ga0495668_0000239 | Ga0495668_0000239_43076_43924 | 282 |
| 577 | 3300046616 | Ga0495668_0008395 | Ga0495668_0008395_1872_2720 | 282 |
| 578 | 3300046616 | Ga0495668_0009316 | Ga0495668_0009316_3310_4158 | 282 |
| 579 | 3300046616 | Ga0495668_0021485 | Ga0495668_0021485_1103_1966 | 282 |
| 580 | 3300046616 | Ga0495668_0038810 | Ga0495668_0038810_94_942 | 282 |
| 581 | 3300046616 | Ga0495668_0176551 | Ga0495668_0176551_103_954 | 282 |
| 582 | 3300046660 | Ga0495625_0000038 | Ga0495625_0000038_162728_163576 | 282 |
| 583 | 3300046660 | Ga0495625_0000800 | Ga0495625_0000800_37437_38360 | 282 |
| 584 | 3300046660 | Ga0495625_0001311 | Ga0495625_0001311_14272_15120 | 282 |
| 585 | 3300046660 | Ga0495625_0001665 | Ga0495625_0001665_9868_10728 | 282 |
| 586 | 3300046660 | Ga0495625_0010857 | Ga0495625_0010857_3101_3964 | 282 |
| 587 | 3300046660 | Ga0495625_0018893 | Ga0495625_0018893_4493_5341 | 282 |
| 588 | 3300046660 | Ga0495625_0075315 | Ga0495625_0075315_687_1535 | 282 |
| 589 | 3300046660 | Ga0495625_0255681 | Ga0495625_0255681_274_1122 | 282 |
| 590 | 3300046660 | Ga0495625_0275782 | Ga0495625_0275782_135_983 | 282 |
| 591 | 3300046664 | Ga0495659_0000550 | Ga0495659_0000550_8013_8876 | 282 |
| 592 | 3300046664 | Ga0495659_0001060 | Ga0495659_0001060_5564_6424 | 282 |
| 593 | 3300046665 | Ga0495661_0000069 | Ga0495661_0000069_37803_38651 | 282 |
| 594 | 3300046665 | Ga0495661_0002091 | Ga0495661_0002091_7083_7931 | 282 |
| 595 | 3300046665 | Ga0495661_0010282 | Ga0495661_0010282_3612_4472 | 282 |
| 596 | 3300046665 | Ga0495661_0068928 | Ga0495661_0068928_1154_2041 | 282 |
| 597 | 3300046674 | Ga0495588_0000041 | Ga0495588_0000041_76758_77606 | 282 |
| 598 | 3300046675 | Ga0495657_0165041 | Ga0495657_0165041_270_1118 | 282 |
| 599 | 3300046683 | Ga0495658_0078222 | Ga0495658_0078222_846_1694 | 282 |
| 600 | 3300046684 | Ga0495669_0000341 | Ga0495669_0000341_10672_11535 | 282 |
| 601 | 3300046684 | Ga0495669_0003613 | Ga0495669_0003613_1077_1925 | 282 |
| 602 | 3300046691 | Ga0495670_0000114 | Ga0495670_0000114_18941_19801 | 282 |
| 603 | 3300046691 | Ga0495670_0047159 | Ga0495670_0047159_1207_2055 | 282 |
| 604 | 3300046692 | Ga0495671_0008482 | Ga0495671_0008482_3981_4841 | 282 |
| 605 | 3300046692 | Ga0495671_0020050 | Ga0495671_0020050_938_1798 | 282 |
| 606 | 3300046694 | Ga0495649_0000263 | Ga0495649_0000263_19784_20632 | 282 |
| 607 | 3300046694 | Ga0495649_0006606 | Ga0495649_0006606_2969_3817 | 282 |
| 608 | 3300046694 | Ga0495649_0037609 | Ga0495649_0037609_978_1841 | 282 |
| 609 | 3300046794 | Ga0495589_0000061 | Ga0495589_0000061_97738_98586 | 282 |
| 610 | 3300046794 | Ga0495589_0000165 | Ga0495589_0000165_17383_18231 | 282 |
| 611 | 3300046794 | Ga0495589_0007854 | Ga0495589_0007854_510_1358 | 282 |
| 612 | 3300046810 | Ga0495660_0000104 | Ga0495660_0000104_29161_30009 | 282 |
| 613 | 3300046810 | Ga0495660_0000450 | Ga0495660_0000450_4671_5519 | 282 |
| 614 | 3300046810 | Ga0495660_0002266 | Ga0495660_0002266_7556_8407 | 282 |
| 615 | 3300046810 | Ga0495660_0002391 | Ga0495660_0002391_10537_11385 | 282 |
| 616 | 3300046810 | Ga0495660_0002719 | Ga0495660_0002719_3938_4786 | 282 |
| 617 | 3300046810 | Ga0495660_0011168 | Ga0495660_0011168_1630_2478 | 282 |
| 618 | 3300046810 | Ga0495660_0063322 | Ga0495660_0063322_544_1395 | 282 |
| 619 | 3300046810 | Ga0495660_0098847 | Ga0495660_0098847_561_1409 | 282 |
| 620 | 3300047315 | Ga0495581_0107833 | Ga0495581_0107833_30_878 | 282 |
| 621 | 3300047318 | Ga0495636_0000720 | Ga0495636_0000720_8947_9807 | 282 |
| 622 | 3300047318 | Ga0495636_0016558 | Ga0495636_0016558_978_1841 | 282 |
| 623 | 3300047319 | Ga0495674_0257315 | Ga0495674_0257315_437_1285 | 282 |
| 624 | 3300047320 | Ga0495672_0000141 | Ga0495672_0000141_37462_38310 | 282 |
| 625 | 3300047320 | Ga0495672_0000214 | Ga0495672_0000214_58326_59174 | 282 |
| 626 | 3300047320 | Ga0495672_0000264 | Ga0495672_0000264_25045_25905 | 282 |
| 627 | 3300047320 | Ga0495672_0002375 | Ga0495672_0002375_6395_7282 | 282 |
| 628 | 3300047320 | Ga0495672_0018604 | Ga0495672_0018604_149_1009 | 282 |
| 629 | 3300047323 | Ga0495683_0003920 | Ga0495683_0003920_1576_2436 | 282 |
| 630 | 3300047323 | Ga0495683_0029748 | Ga0495683_0029748_33_881 | 282 |
| 631 | 3300047443 | Ga0495687_000027 | Ga0495687_000027_240023_240871 | 282 |
| 632 | 3300047443 | Ga0495687_000062 | Ga0495687_000062_140713_141573 | 282 |
| 633 | 3300047443 | Ga0495687_000477 | Ga0495687_000477_27508_28356 | 282 |
| 634 | 3300047443 | Ga0495687_003359 | Ga0495687_003359_6260_7108 | 282 |
| 635 | 3300047443 | Ga0495687_005981 | Ga0495687_005981_5546_6394 | 282 |
| 636 | 3300047443 | Ga0495687_008705 | Ga0495687_008705_3927_4790 | 282 |
| 637 | 3300047445 | Ga0495677_0000001 | Ga0495677_0000001_240104_240952 | 282 |
| 638 | 3300047445 | Ga0495677_0032369 | Ga0495677_0032369_383_1231 | 282 |
| 639 | 3300047445 | Ga0495677_0040336 | Ga0495677_0040336_153_1013 | 282 |
| 640 | 3300047445 | Ga0495677_0083918 | Ga0495677_0083918_289_1137 | 282 |
| 641 | 3300047446 | Ga0495679_008042 | Ga0495679_008042_2811_3659 | 282 |
| 642 | 3300047446 | Ga0495679_030531 | Ga0495679_030531_164_1027 | 282 |
| 643 | 3300047447 | Ga0495685_000658 | Ga0495685_000658_4935_5795 | 282 |
| 644 | 3300047447 | Ga0495685_037386 | Ga0495685_037386_109_972 | 282 |
| 645 | 3300047469 | Ga0495673_0000056 | Ga0495673_0000056_229028_229876 | 282 |
| 646 | 3300047469 | Ga0495673_0000785 | Ga0495673_0000785_24029_24889 | 282 |
| 647 | 3300047470 | Ga0495681_0005660 | Ga0495681_0005660_2748_3611 | 282 |
| 648 | 3300047472 | Ga0495686_0087287 | Ga0495686_0087287_50_898 | 282 |
| 649 | 3300047472 | Ga0495686_0253113 | Ga0495686_0253113_108_956 | 282 |
| 650 | 3300048090 | Ga0495615_0060260 | Ga0495615_0060260_126_974 | 282 |
| 651 | 3300048091 | Ga0495626_0000101 | Ga0495626_0000101_73444_74292 | 282 |
| 652 | 3300048091 | Ga0495626_0000135 | Ga0495626_0000135_32470_33318 | 282 |
| 653 | 3300048903 | Ga0496100_0190941 | Ga0496100_0190941_616_1464 | 282 |
| 654 | 3300048905 | Ga0496102_0046604 | Ga0496102_0046604_1902_2774 | 282 |
| 655 | 3300048906 | Ga0496103_0229792 | Ga0496103_0229792_214_1086 | 282 |
| 656 | 3300048907 | Ga0496104_0262415 | Ga0496104_0262415_541_1389 | 282 |
| 657 | 3300048909 | Ga0496106_0006892 | Ga0496106_0006892_3245_4093 | 282 |
| 658 | 3300048910 | Ga0496107_0000095 | Ga0496107_0000095_16135_16983 | 282 |
| 659 | 3300048910 | Ga0496107_0014761 | Ga0496107_0014761_1665_2513 | 282 |
| 660 | 3300048910 | Ga0496107_0136204 | Ga0496107_0136204_568_1440 | 282 |
| 661 | 3300048910 | Ga0496107_0343847 | Ga0496107_0343847_57_905 | 282 |
| 662 | 3300048917 | Ga0496114_0000254 | Ga0496114_0000254_4951_5799 | 282 |
| 663 | 3300048919 | Ga0496116_0001111 | Ga0496116_0001111_29131_29979 | 282 |
| 664 | 3300048919 | Ga0496116_0086580 | Ga0496116_0086580_659_1507 | 282 |
| 665 | 3300048920 | Ga0496117_0001300 | Ga0496117_0001300_18685_19533 | 282 |
| 666 | 3300048921 | Ga0496118_0000703 | Ga0496118_0000703_25805_26653 | 282 |
| 667 | 3300048921 | Ga0496118_0028073 | Ga0496118_0028073_119_967 | 282 |
| 668 | 3300048922 | Ga0496119_0000301 | Ga0496119_0000301_1982_2830 | 282 |
| 669 | 3300048923 | Ga0496120_0000402 | Ga0496120_0000402_1982_2830 | 282 |
| 670 | 3300048924 | Ga0496121_0001883 | Ga0496121_0001883_21927_22775 | 282 |
| 671 | 3300048924 | Ga0496121_0129712 | Ga0496121_0129712_771_1619 | 282 |
| 672 | 3300048925 | Ga0496122_0001165 | Ga0496122_0001165_12626_13519 | 282 |
| 673 | 3300048925 | Ga0496122_0029671 | Ga0496122_0029671_682_1530 | 282 |
| 674 | 3300048926 | Ga0496123_0000933 | Ga0496123_0000933_37446_38294 | 282 |
| 675 | 3300048926 | Ga0496123_0046819 | Ga0496123_0046819_1445_2338 | 282 |
| 676 | 3300048927 | Ga0496124_0000009 | Ga0496124_0000009_662435_663283 | 282 |
| 677 | 3300048927 | Ga0496124_0010055 | Ga0496124_0010055_5146_6030 | 282 |
| 678 | 3300048927 | Ga0496124_0015900 | Ga0496124_0015900_6207_7055 | 282 |
| 679 | 3300048927 | Ga0496124_0030252 | Ga0496124_0030252_423_1271 | 282 |
| 680 | 3300048927 | Ga0496124_0224003 | Ga0496124_0224003_43_891 | 282 |
| 681 | 3300048928 | Ga0496125_0036606 | Ga0496125_0036606_383_1231 | 282 |
| 682 | 3300048928 | Ga0496125_0049747 | Ga0496125_0049747_517_1365 | 282 |
| 683 | 3300048928 | Ga0496125_0072611 | Ga0496125_0072611_1575_2468 | 282 |
| 684 | 3300048929 | Ga0496126_0001069 | Ga0496126_0001069_38510_39358 | 282 |
| 685 | 3300049459 | Ga0495678_000101 | Ga0495678_000101_66286_67134 | 282 |
| 686 | 3300049459 | Ga0495678_000663 | Ga0495678_000663_11577_12437 | 282 |
| 687 | 3300049459 | Ga0495678_002168 | Ga0495678_002168_3812_4681 | 282 |
| 688 | 3300049459 | Ga0495678_005468 | Ga0495678_005468_4487_5335 | 282 |
| 689 | 3300049459 | Ga0495678_016807 | Ga0495678_016807_2304_3152 | 282 |
| 690 | 3300049460 | Ga0495682_0000208 | Ga0495682_0000208_19029_19889 | 282 |
| 691 | 3300049513 | Ga0501290_006438 | Ga0501290_006438_592_1440 | 282 |
| 692 | 3300049523 | Ga0501300_006036 | Ga0501300_006036_160_1008 | 282 |
| 693 | 3300049568 | Ga0501031_0074753 | Ga0501031_0074753_1259_2125 | 282 |
| 694 | 3300049570 | Ga0501033_0002089 | Ga0501033_0002089_15373_16224 | 282 |
| 695 | 3300049571 | Ga0501034_0000941 | Ga0501034_0000941_22996_23844 | 282 |
| 696 | 3300049571 | Ga0501034_0022534 | Ga0501034_0022534_4982_5830 | 282 |
| 697 | 3300049571 | Ga0501034_0041427 | Ga0501034_0041427_2985_3836 | 282 |
| 698 | 3300049571 | Ga0501034_0506354 | Ga0501034_0506354_202_1050 | 282 |
| 699 | 3300049572 | Ga0501036_0170755 | Ga0501036_0170755_669_1529 | 282 |
| 700 | 3300049573 | Ga0501037_0008198 | Ga0501037_0008198_1713_2573 | 282 |
| 701 | 3300049573 | Ga0501037_0119238 | Ga0501037_0119238_528_1376 | 282 |
| 702 | 3300049574 | Ga0501038_0383623 | Ga0501038_0383623_180_1028 | 282 |
| 703 | 3300049579 | Ga0501043_0288261 | Ga0501043_0288261_388_1236 | 282 |
| 704 | 3300049580 | Ga0501046_0037641 | Ga0501046_0037641_2743_3591 | 282 |
| 705 | 3300049581 | Ga0501047_0195530 | Ga0501047_0195530_879_1727 | 282 |
| 706 | 3300049583 | Ga0501067_0000227 | Ga0501067_0000227_24578_25438 | 282 |
| 707 | 3300049584 | Ga0501068_0000343 | Ga0501068_0000343_3905_4765 | 282 |
| 708 | 3300049589 | Ga0501073_0000004 | Ga0501073_0000004_121058_121918 | 282 |
| 709 | 3300049593 | Ga0501077_0000008 | Ga0501077_0000008_102243_103103 | 282 |
| 710 | 3300049665 | Ga0501227_011098 | Ga0501227_011098_896_1744 | 282 |
| 711 | 3300049705 | Ga0501225_0000492 | Ga0501225_0000492_1007_1855 | 282 |
| 712 | 3300049742 | Ga0501080_0009522 | Ga0501080_0009522_346_1206 | 282 |
| 713 | 3300049762 | Ga0501265_000739 | Ga0501265_000739_1037_1885 | 282 |
| 714 | 3300049766 | Ga0501269_000056 | Ga0501269_000056_1211_2059 | 282 |
| 715 | 3300049766 | Ga0501269_005452 | Ga0501269_005452_110_958 | 282 |
| 716 | 3300049772 | Ga0501275_000047 | Ga0501275_000047_4795_5643 | 282 |
| 717 | 3300049775 | Ga0501279_000629 | Ga0501279_000629_1371_2219 | 282 |
| 718 | 3300049822 | Ga0501035_0002949 | Ga0501035_0002949_14784_15632 | 282 |
| 719 | 3300049822 | Ga0501035_0115049 | Ga0501035_0115049_1011_1859 | 282 |
| 720 | 3300049823 | Ga0501044_0000588 | Ga0501044_0000588_5911_6762 | 282 |
| 721 | 3300049823 | Ga0501044_0000868 | Ga0501044_0000868_14812_15672 | 282 |
| 722 | 3300049823 | Ga0501044_0092393 | Ga0501044_0092393_851_1699 | 282 |
| 723 | 3300050493 | nmdc:mga0k408_41107_c1 | nmdc:mga0k408_41107_c1_1452_2300 | 282 |
| 724 | 3300050496 | nmdc:mga07m45_24650_c1 | nmdc:mga07m45_24650_c1_113_961 | 282 |
| 725 | 3300050507 | nmdc:mga05p37_956_c1 | nmdc:mga05p37_956_c1_31036_31905 | 282 |
| 726 | 3300050508 | nmdc:mga09592_25900_c1 | nmdc:mga09592_25900_c1_818_1687 | 282 |
| 727 | 3300050509 | nmdc:mga0qj67_552_c1 | nmdc:mga0qj67_552_c1_9894_10763 | 282 |
| 728 | 3300050509 | nmdc:mga0qj67_9622_c1 | nmdc:mga0qj67_9622_c1_391_1260 | 282 |
| 729 | 3300050510 | nmdc:mga06r32_32159_c1 | nmdc:mga06r32_32159_c1_346_1215 | 282 |
| 730 | 3300050510 | nmdc:mga06r32_6360_c1 | nmdc:mga06r32_6360_c1_4898_5767 | 282 |
| 731 | 3300050511 | nmdc:mga08y16_109087_c1 | nmdc:mga08y16_109087_c1_560_1438 | 282 |
| 732 | 3300050511 | nmdc:mga08y16_143378_c1 | nmdc:mga08y16_143378_c1_1330_2199 | 282 |
| 733 | 3300053085 | Ga0495619_0193001 | Ga0495619_0193001_79_927 | 282 |
| 734 | 3300053086 | Ga0500578_0000030 | Ga0500578_0000030_129247_130095 | 282 |
| 735 | 3300053092 | Ga0500583_0082371 | Ga0500583_0082371_117_965 | 282 |
| 736 | 3300053094 | Ga0500566_0056165 | Ga0500566_0056165_224_1072 | 282 |
| 737 | 3300053104 | Ga0500556_0002628 | Ga0500556_0002628_144_992 | 282 |
| 738 | 3300053108 | Ga0500562_015346 | Ga0500562_015346_240_1088 | 282 |
| 739 | 3300053108 | Ga0500562_049318 | Ga0500562_049318_124_972 | 282 |
| 740 | 3300053118 | Ga0500594_0000037 | Ga0500594_0000037_26807_27655 | 282 |
| 741 | 3300053118 | Ga0500594_0000935 | Ga0500594_0000935_1544_2413 | 282 |
| 742 | 3300053119 | Ga0500595_003278 | Ga0500595_003278_4934_5782 | 282 |
| 743 | 3300053122 | Ga0500608_000116 | Ga0500608_000116_18388_19236 | 282 |
| 744 | 3300053125 | Ga0500618_000280 | Ga0500618_000280_38086_38934 | 282 |
| 745 | 3300053136 | Ga0500559_0000145 | Ga0500559_0000145_43423_44271 | 282 |
| 746 | 3300053145 | Ga0500586_000313 | Ga0500586_000313_492_1340 | 282 |
| 747 | 3300053156 | Ga0500622_0002338 | Ga0500622_0002338_10022_10870 | 282 |
| 748 | 3300053156 | Ga0500622_0022714 | Ga0500622_0022714_904_1755 | 282 |
| 749 | 3300061719 | Ga0466962_0198985 | Ga0466962_0198985_85_933 | 282 |
| 750 | iso_pu_bacteria | 2739367756 | 2739790957 | 282 |
| 751 | 3300005577 | Ga0068857_100462902 | Ga0068857_1004629022 | 283 |
| 752 | 3300009545 | Ga0105237_10461892 | Ga0105237_104618921 | 283 |
| 753 | 3300010375 | Ga0105239_10147561 | Ga0105239_101475612 | 283 |
| 754 | 3300013104 | Ga0157370_10003641 | Ga0157370_100036412 | 283 |
| 755 | 3300013105 | Ga0157369_10131297 | Ga0157369_101312972 | 283 |
| 756 | 3300032004 | Ga0307414_10244180 | Ga0307414_102441801 | 283 |
| 757 | 3300042005 | Ga0439448_0024166 | Ga0439448_0024166_892_1788 | 283 |
| 758 | 3300044706 | Ga0466964_0000506 | Ga0466964_0000506_6575_7468 | 283 |
| 759 | 3300044842 | Ga0466957_0011693 | Ga0466957_0011693_1471_2364 | 283 |
| 760 | 3300046524 | Ga0495648_0005883 | Ga0495648_0005883_8988_9896 | 283 |
| 761 | 3300046665 | Ga0495661_0000181 | Ga0495661_0000181_13110_14018 | 283 |
| 762 | 3300047443 | Ga0495687_000254 | Ga0495687_000254_37547_38452 | 283 |
| 763 | 3300048903 | Ga0496100_0254821 | Ga0496100_0254821_248_1144 | 283 |
| 764 | 3300048908 | Ga0496105_0035928 | Ga0496105_0035928_2616_3512 | 283 |
| 765 | 3300048913 | Ga0496110_0463667 | Ga0496110_0463667_146_1042 | 283 |
| 766 | 3300048928 | Ga0496125_0003869 | Ga0496125_0003869_164_1024 | 283 |
| 767 | 2162886007 | SwRhRL2b_contig_2926702 | SwRhRL2b_0178.00004840 | 284 |
| 768 | 3300003856 | Ga0058692_1000118 | Ga0058692_100011849 | 284 |
| 769 | 3300005289 | Ga0065704_10070983 | Ga0065704_100709832 | 284 |
| 770 | 3300005331 | Ga0070670_100000769 | Ga0070670_10000076913 | 284 |
| 771 | 3300006195 | Ga0075366_10001034 | Ga0075366_100010344 | 284 |
| 772 | 3300009011 | Ga0105251_10000412 | Ga0105251_100004126 | 284 |
| 773 | 3300009148 | Ga0105243_10000196 | Ga0105243_1000019663 | 284 |
| 774 | 3300013104 | Ga0157370_10037845 | Ga0157370_100378454 | 284 |
| 775 | 3300015684 | Ga0183365_10001 | Ga0183365_100011035 | 284 |
| 776 | 3300025735 | Ga0207713_1000385 | Ga0207713_100038543 | 284 |
| 777 | 3300025925 | Ga0207650_10008931 | Ga0207650_100089311 | 284 |
| 778 | 3300025935 | Ga0207709_10000504 | Ga0207709_1000050439 | 284 |
| 779 | 3300027312 | Ga0209371_1000332 | Ga0209371_100033247 | 284 |
| 780 | 3300028800 | Ga0265338_10049015 | Ga0265338_100490152 | 284 |
| 781 | 3300030500 | Ga0268256_1000285 | Ga0268256_100028547 | 284 |
| 782 | 3300037471 | Ga0395905_0000022 | Ga0395905_0000022_201019_201882 | 284 |
| 783 | 3300041453 | Ga0451797_1321202 | Ga0451797_1321202_122_976 | 284 |
| 784 | 3300041459 | Ga0451800_0742652 | Ga0451800_0742652_8737_9591 | 284 |
| 785 | 3300041462 | Ga0451806_158657 | Ga0451806_158657_3200_4054 | 284 |
| 786 | 3300041463 | Ga0451804_0269081 | Ga0451804_0269081_1565_2419 | 284 |
| 787 | 3300041486 | Ga0451807_2291444 | Ga0451807_2291444_1836_2690 | 284 |
| 788 | 3300044656 | Ga0466969_0038583 | Ga0466969_0038583_1232_2095 | 284 |
| 789 | 3300044684 | Ga0466966_0001440 | Ga0466966_0001440_2353_3216 | 284 |
| 790 | 3300044693 | Ga0466961_0041956 | Ga0466961_0041956_1115_1978 | 284 |
| 791 | 3300044694 | Ga0466963_0105135 | Ga0466963_0105135_686_1549 | 284 |
| 792 | 3300045049 | Ga0466959_0000096 | Ga0466959_0000096_44505_45368 | 284 |
| 793 | 3300045836 | Ga0466958_0003281 | Ga0466958_0003281_6274_7137 | 284 |
| 794 | 3300046453 | Ga0495627_000464 | Ga0495627_000464_25760_26716 | 284 |
| 795 | 3300046500 | Ga0495596_0003086 | Ga0495596_0003086_3440_4348 | 284 |
| 796 | 3300046506 | Ga0495583_0005424 | Ga0495583_0005424_4317_5225 | 284 |
| 797 | 3300046513 | Ga0495616_0005078 | Ga0495616_0005078_1879_2787 | 284 |
| 798 | 3300046518 | Ga0495631_0003199 | Ga0495631_0003199_3158_4066 | 284 |
| 799 | 3300046522 | Ga0495643_0006828 | Ga0495643_0006828_4409_5317 | 284 |
| 800 | 3300046528 | Ga0495642_0000126 | Ga0495642_0000126_29654_30556 | 284 |
| 801 | 3300046528 | Ga0495642_0002587 | Ga0495642_0002587_3292_4200 | 284 |
| 802 | 3300046538 | Ga0495609_0003048 | Ga0495609_0003048_1607_2515 | 284 |
| 803 | 3300046558 | Ga0495633_0041303 | Ga0495633_0041303_89_1045 | 284 |
| 804 | 3300046616 | Ga0495668_0000715 | Ga0495668_0000715_14887_15795 | 284 |
| 805 | 3300046648 | Ga0495611_0000226 | Ga0495611_0000226_14606_15514 | 284 |
| 806 | 3300046660 | Ga0495625_0000099 | Ga0495625_0000099_130845_131801 | 284 |
| 807 | 3300046665 | Ga0495661_0007418 | Ga0495661_0007418_528_1436 | 284 |
| 808 | 3300046794 | Ga0495589_0011973 | Ga0495589_0011973_942_1850 | 284 |
| 809 | 3300047323 | Ga0495683_0021841 | Ga0495683_0021841_1183_2091 | 284 |
| 810 | 3300048091 | Ga0495626_0000745 | Ga0495626_0000745_10242_11120 | 284 |
| 811 | 3300048927 | Ga0496124_0001841 | Ga0496124_0001841_25195_26241 | 284 |
| 812 | 3300049460 | Ga0495682_0004343 | Ga0495682_0004343_203_1111 | 284 |
| 813 | 3300049570 | Ga0501033_0215834 | Ga0501033_0215834_228_1091 | 284 |
| 814 | 3300049570 | Ga0501033_0247093 | Ga0501033_0247093_373_1236 | 284 |
| 815 | 3300049571 | Ga0501034_0037613 | Ga0501034_0037613_1205_2065 | 284 |
| 816 | 3300049822 | Ga0501035_0111486 | Ga0501035_0111486_1222_2085 | 284 |
| 817 | 3300050493 | nmdc:mga0k408_361_c1 | nmdc:mga0k408_361_c1_11309_12163 | 284 |
| 818 | 3300053086 | Ga0500578_0000041 | Ga0500578_0000041_66881_67837 | 284 |
| 819 | 3300053093 | Ga0500651_0000205 | Ga0500651_0000205_16387_17277 | 284 |
| 820 | 3300053122 | Ga0500608_000211 | Ga0500608_000211_6850_7740 | 284 |
| 821 | 3300053122 | Ga0500608_000732 | Ga0500608_000732_9184_10044 | 284 |
| 822 | 3300061719 | Ga0466962_0015795 | Ga0466962_0015795_2563_3426 | 284 |
| 823 | iso_pu_bacteria | 2643221583 | 2643925506 | 284 |
| 824 | iso_pu_bacteria | 2643221691 | 2644510424 | 284 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1xru-assembly1.cif.gz_A | crystal structure of 5-keto-4-deoxyuronate isomerase from eschericia coli | 0.9697 | 11 | 284 |
| 1x8m-assembly1.cif.gz_A | x-ray structure of pectin degrading enzyme 5-keto 4-deoxyuronate isomerase from escherichia coli | 0.9665 | 11 | 272 |
| 7yrs-assembly4.cif.gz_D | crystal structure of lactobacillus rhamnosus 4-deoxy-l-threo-5-hexosulose-uronate ketol-isomerase kdui complexed with mops | 0.9619 | 9 | 269 |
| 1ywk-assembly6.cif.gz_F | crystal structure of 4-deoxy-1-threo-5-hexosulose-uronate ketol-isomerase from enterococcus faecalis | 0.9608 | 9 | 268 |
| 1ywk-assembly3.cif.gz_C | crystal structure of 4-deoxy-1-threo-5-hexosulose-uronate ketol-isomerase from enterococcus faecalis | 0.9608 | 9 | 267 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1x8mA02 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9742 | 151 | 272 | 2.60.120.10 |
| af_Q46938_25_265_2.60.120.10 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9699 | 30 | 271 | 2.60.120.10 |
| af_Q46938_25_265_2.60.120.10 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.962 | 30 | 271 | 2.60.120.10 |
| 1ywkB00 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9607 | 9 | 268 | 2.60.120.10 |
| 1xruB01 | Mainly Beta;Sandwich;Jelly Rolls;pectin degrading enzyme 5-keto 4- deoxyuronate isomerase, domain 1 | 0.9343 | 43 | 149 | 2.60.120.520 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A484YH81-F1-model_v4 | 5-keto-4-deoxyuronate isomerase (EC 5.3.1.17) | 0.9961 | 75 | 147 |
GO:0008697
GO:0019698 GO:0042840 GO:0045490 GO:0046872 |
| AF-A0A0M1KQH6-F1-model_v4 | deleted | 0.9953 | 51 | 284 |
|
| AF-A0A0Q8FH16-F1-model_v4 | 5-dehydro-4-deoxy-D-glucuronate isomerase (EC 5.3.1.17) | 0.9924 | 16 | 284 |
GO:0008697
GO:0019698 GO:0042840 GO:0045490 GO:0046872 |
| AF-A0A4Q3RVT9-F1-model_v4 | 5-dehydro-4-deoxy-D-glucuronate isomerase (EC 5.3.1.17) | 0.9922 | 86 | 284 |
GO:0008697
GO:0019698 GO:0042840 GO:0045490 GO:0046872 |
| AF-A0A4Q3VTK0-F1-model_v4 | 5-dehydro-4-deoxy-D-glucuronate isomerase (EC 5.3.1.17) | 0.9908 | 76 | 284 |
GO:0008697
GO:0019698 GO:0042840 GO:0045490 GO:0046872 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar