F482162
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 819 | 431 | 810 | 60 |
Family's Representative Sequence
| Representative Sequence | 3300005578|Ga0068854_101666333|Ga0068854_1016663332 |
| Length | 69 |
| Sequence | MTQKQIKVTLVRSPIGTKQSHRDTVRGLGLRRINRSRVLQDTPEVRGMIRKVDYLVTATEVTPADAPQV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221660 | Methylibium sp. Root1272 | Isolate | Unclassified |
| 2 | 2855730933 | Achromobacter sp. HZ28 | Isolate | Nodule |
| 3 | 2855767633 | Achromobacter sp. HZ34 | Isolate | Nodule |
| 4 | 2857542790 | Achromobacter sp. R-72367 | Isolate | Unclassified |
| 5 | 2881412998 | Achromobacter aloeverae AVA-1 | Isolate | Unclassified |
| 6 | 2904434214 | Robbsia andropogonis 1567 | Isolate | Rhizosphere |
| 7 | 2919704043 | Hydrogenophaga palleronii 4249 | Isolate | Unclassified |
| 8 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 9 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 10 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 11 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 12 | 3300003300 | Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_1 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 13 | 3300003347 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM | Metagenome | Rhizosphere |
| 14 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 15 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 16 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 17 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 18 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 25 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 27 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 29 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 30 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 40 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 51 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 52 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 55 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 57 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 59 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 64 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 65 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 66 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 68 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 69 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 70 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 71 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 72 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 73 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 74 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 75 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 76 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 77 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 78 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 79 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 80 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 81 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 82 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 83 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 84 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 85 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 86 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 87 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 88 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 89 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 90 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 92 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 93 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 94 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 95 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 96 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 97 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 98 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 99 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 100 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 101 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 103 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 104 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Metagenome | Rhizosphere |
| 116 | 3300012503 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R | Metagenome | Rhizosphere |
| 117 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 129 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 130 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 131 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 193 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 196 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 197 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 198 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 199 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 200 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 201 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 202 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 203 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 204 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 205 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 206 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 207 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 208 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 209 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 210 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 211 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 212 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 213 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 214 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 215 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 216 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 217 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 218 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 219 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 220 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 221 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 222 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 223 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 224 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 225 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 226 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 227 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 228 | 3300033527 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 229 | 3300033529 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 230 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 231 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 232 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 233 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 234 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 235 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 236 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 237 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 238 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 239 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 240 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 241 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 242 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 243 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 244 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 245 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 246 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 247 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 248 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 249 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 250 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 251 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 252 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 253 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 254 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 255 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 256 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 257 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 258 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 259 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 260 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 261 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 262 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 263 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 264 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 265 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 266 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 267 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 268 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 269 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 270 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 271 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 272 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 273 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 274 | 3300041461 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT | Metatranscriptome | Rhizoplane |
| 275 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 276 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 277 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 278 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 279 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 280 | 3300042000 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 | Metagenome | Rhizosphere |
| 281 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 282 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 283 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 284 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 285 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 286 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 287 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 288 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 289 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 290 | 3300042116 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 | Metagenome | Rhizosphere |
| 291 | 3300042126 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 | Metagenome | Rhizosphere |
| 292 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 293 | 3300042129 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 | Metagenome | Rhizosphere |
| 294 | 3300042130 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 | Metagenome | Rhizosphere |
| 295 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 296 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 297 | 3300042135 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 | Metagenome | Rhizosphere |
| 298 | 3300042144 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 | Metagenome | Rhizosphere |
| 299 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 300 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 301 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 302 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 303 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 304 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 305 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 306 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 307 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 308 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 309 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 310 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 311 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 312 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 313 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 314 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 315 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 316 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 317 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 318 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 319 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 320 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 321 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 322 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 347 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 348 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 349 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 350 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 351 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 352 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 353 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 354 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 355 | 3300049160 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 356 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 357 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 358 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 359 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 360 | 3300049529 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 361 | 3300049530 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 362 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 363 | 3300049532 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 364 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 365 | 3300049534 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 366 | 3300049535 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 367 | 3300049536 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 368 | 3300049537 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 369 | 3300049538 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 370 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 371 | 3300049540 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 372 | 3300049551 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 373 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 374 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 375 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 376 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 377 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 378 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 379 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 380 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 381 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 382 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 383 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 384 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 385 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 386 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 387 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 388 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 389 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 390 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 391 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 392 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 393 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 394 | 3300049656 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought | Metagenome | Rhizosphere |
| 395 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 396 | 3300049670 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought | Metagenome | Rhizosphere |
| 397 | 3300049678 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought | Metagenome | Rhizosphere |
| 398 | 3300049684 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control | Metagenome | Rhizosphere |
| 399 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 400 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 401 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 402 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 403 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 404 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 405 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 406 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 407 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 408 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 409 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 410 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 411 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 412 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 413 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 414 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 415 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 416 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 417 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 418 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 419 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 421 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 422 | 3300053149 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere | Metagenome | Endosphere |
| 423 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 424 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 425 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 426 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 427 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 428 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 429 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 430 | 8048746797 | Alcaligenes endophyticus DSM 100498 | Isolate | Unclassified |
| 431 | 8055225921 | Achromobacter panacis KCTC 42751 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 90.96 |
| Metatranscriptomes | 7.94 |
| Isolates | 1.1 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.37 |
| Nodule | 0.24 |
| Rhizoplane | 0.73 |
| Rhizosphere | 89.99 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.66 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | ARSoilOldRDRAFT_c011456 | 3300000044 | Bacteria | 743 |
| 2 | JGI24750J21931_1058011 | 3300002070 | Unclassified | 615 |
| 3 | JGI24034J26672_10110490 | 3300002239 | Bacteria | 525 |
| 4 | JGI25151J46595_10000457 | 3300003187 | Bacteria | 39373 |
| 5 | Ga0006758J48902_1026783 | 3300003300 | Bacteria | 1395 |
| 6 | JGI26128J50194_1000120 | 3300003347 | Bacteria | 3224 |
| 7 | Ga0058859_11182523 | 3300004798 | Bacteria | 771 |
| 8 | Ga0058860_12156074 | 3300004801 | Bacteria | 1492 |
| 9 | Ga0058862_12655437 | 3300004803 | Bacteria | 1020 |
| 10 | Ga0065707_10014633 | 3300005295 | Bacteria | 2787 |
| 11 | Ga0065707_10037915 | 3300005295 | Bacteria | 1017 |
| 12 | Ga0065707_11006424 | 3300005295 | Bacteria | 537 |
| 13 | Ga0070658_10069230 | 3300005327 | Bacteria | 2886 |
| 14 | Ga0070676_10060920 | 3300005328 | Bacteria | 2242 |
| 15 | Ga0070676_10241894 | 3300005328 | Bacteria | 1201 |
| 16 | Ga0070683_100105419 | 3300005329 | Bacteria | 2658 |
| 17 | Ga0070690_100001051 | 3300005330 | Bacteria | 14153 |
| 18 | Ga0070690_100006945 | 3300005330 | Bacteria | 6443 |
| 19 | Ga0070690_100211418 | 3300005330 | Bacteria | 1355 |
| 20 | Ga0070690_100444857 | 3300005330 | Bacteria | 960 |
| 21 | Ga0070670_100551381 | 3300005331 | Bacteria | 1028 |
| 22 | Ga0070677_10852002 | 3300005333 | Bacteria | 524 |
| 23 | Ga0068869_100006377 | 3300005334 | Bacteria | 7477 |
| 24 | Ga0070666_10279744 | 3300005335 | Bacteria | 1186 |
| 25 | Ga0070666_10808556 | 3300005335 | Bacteria | 691 |
| 26 | Ga0070666_11388189 | 3300005335 | Bacteria | 525 |
| 27 | Ga0070680_100024534 | 3300005336 | Bacteria | 4818 |
| 28 | Ga0070682_100010140 | 3300005337 | Bacteria | 5341 |
| 29 | Ga0068868_100001937 | 3300005338 | Bacteria | 14202 |
| 30 | Ga0068868_100459194 | 3300005338 | Bacteria | 1109 |
| 31 | Ga0070689_100001590 | 3300005340 | Bacteria | 14486 |
| 32 | Ga0070689_101621954 | 3300005340 | Bacteria | 588 |
| 33 | Ga0070691_10001529 | 3300005341 | Bacteria | 9951 |
| 34 | Ga0070691_10960764 | 3300005341 | Bacteria | 531 |
| 35 | Ga0070687_100000486 | 3300005343 | Bacteria | 13224 |
| 36 | Ga0070687_100030365 | 3300005343 | Bacteria | 2641 |
| 37 | Ga0070692_10002474 | 3300005345 | Bacteria | 7182 |
| 38 | Ga0070692_10171877 | 3300005345 | Bacteria | 1250 |
| 39 | Ga0070692_10642910 | 3300005345 | Bacteria | 707 |
| 40 | Ga0070692_10813886 | 3300005345 | Bacteria | 639 |
| 41 | Ga0070668_100410448 | 3300005347 | Bacteria | 1158 |
| 42 | Ga0070668_100563465 | 3300005347 | Bacteria | 993 |
| 43 | Ga0070669_100077546 | 3300005353 | Bacteria | 2469 |
| 44 | Ga0070669_100208195 | 3300005353 | Bacteria | 1542 |
| 45 | Ga0070669_100267967 | 3300005353 | Bacteria | 1365 |
| 46 | Ga0070675_100415889 | 3300005354 | Bacteria | 1202 |
| 47 | Ga0070675_100554307 | 3300005354 | Bacteria | 1040 |
| 48 | Ga0070675_100614389 | 3300005354 | Bacteria | 986 |
| 49 | Ga0070671_100071598 | 3300005355 | Bacteria | 2894 |
| 50 | Ga0070671_100529069 | 3300005355 | Bacteria | 1015 |
| 51 | Ga0070674_100039880 | 3300005356 | Bacteria | 3174 |
| 52 | Ga0070674_100899720 | 3300005356 | Bacteria | 771 |
| 53 | Ga0070673_100055764 | 3300005364 | Bacteria | 3115 |
| 54 | Ga0070673_100450317 | 3300005364 | Bacteria | 1158 |
| 55 | Ga0070673_101981655 | 3300005364 | Bacteria | 553 |
| 56 | Ga0070688_101241677 | 3300005365 | Bacteria | 600 |
| 57 | Ga0070688_101305742 | 3300005365 | Bacteria | 586 |
| 58 | Ga0070667_100308597 | 3300005367 | Bacteria | 1426 |
| 59 | Ga0070667_100337290 | 3300005367 | Bacteria | 1363 |
| 60 | Ga0070703_10008050 | 3300005406 | Bacteria | 2963 |
| 61 | Ga0070701_10002480 | 3300005438 | Bacteria | 7125 |
| 62 | Ga0070701_10022859 | 3300005438 | Bacteria | 3003 |
| 63 | Ga0070711_100158878 | 3300005439 | Bacteria | 1712 |
| 64 | Ga0070705_100004302 | 3300005440 | Bacteria | 6941 |
| 65 | Ga0070705_100403726 | 3300005440 | Bacteria | 1013 |
| 66 | Ga0070700_100006166 | 3300005441 | Bacteria | 6387 |
| 67 | Ga0070700_101126730 | 3300005441 | Bacteria | 652 |
| 68 | Ga0070694_100001615 | 3300005444 | Bacteria | 13236 |
| 69 | Ga0070694_100212985 | 3300005444 | Bacteria | 1446 |
| 70 | Ga0070694_100881568 | 3300005444 | Bacteria | 738 |
| 71 | Ga0070694_101713698 | 3300005444 | Bacteria | 535 |
| 72 | Ga0070663_100121854 | 3300005455 | Bacteria | 1971 |
| 73 | Ga0070678_100199417 | 3300005456 | Bacteria | 1651 |
| 74 | Ga0070678_101220504 | 3300005456 | Bacteria | 698 |
| 75 | Ga0070662_100060375 | 3300005457 | Bacteria | 2765 |
| 76 | Ga0070681_10379200 | 3300005458 | Bacteria | 1325 |
| 77 | Ga0070681_10687359 | 3300005458 | Bacteria | 939 |
| 78 | Ga0068867_100002002 | 3300005459 | Bacteria | 14223 |
| 79 | Ga0068867_100002598 | 3300005459 | Bacteria | 12737 |
| 80 | Ga0070706_101952369 | 3300005467 | Bacteria | 532 |
| 81 | Ga0070707_101411866 | 3300005468 | Bacteria | 663 |
| 82 | Ga0070679_100073605 | 3300005530 | Bacteria | 3407 |
| 83 | Ga0070679_100951429 | 3300005530 | Bacteria | 803 |
| 84 | Ga0070684_100788461 | 3300005535 | Bacteria | 888 |
| 85 | Ga0068853_100646245 | 3300005539 | Bacteria | 1007 |
| 86 | Ga0068853_102139023 | 3300005539 | Bacteria | 542 |
| 87 | Ga0070672_100070334 | 3300005543 | Bacteria | 2781 |
| 88 | Ga0070672_100237690 | 3300005543 | Bacteria | 1532 |
| 89 | Ga0070686_100008053 | 3300005544 | Bacteria | 5887 |
| 90 | Ga0070686_100008478 | 3300005544 | Bacteria | 5757 |
| 91 | Ga0070686_100975126 | 3300005544 | Bacteria | 694 |
| 92 | Ga0070695_100002452 | 3300005545 | Bacteria | 10674 |
| 93 | Ga0070696_100002331 | 3300005546 | Bacteria | 12524 |
| 94 | Ga0070696_100006223 | 3300005546 | Bacteria | 7986 |
| 95 | Ga0070693_100000371 | 3300005547 | Bacteria | 20420 |
| 96 | Ga0070693_100156801 | 3300005547 | Bacteria | 1446 |
| 97 | Ga0070704_100003415 | 3300005549 | Bacteria | 9103 |
| 98 | Ga0070704_100029374 | 3300005549 | Bacteria | 3670 |
| 99 | Ga0070704_100141749 | 3300005549 | Bacteria | 1878 |
| 100 | Ga0070704_100538282 | 3300005549 | Bacteria | 1019 |
| 101 | Ga0068855_100025005 | 3300005563 | Bacteria | 7148 |
| 102 | Ga0068854_100044185 | 3300005578 | Bacteria | 3161 |
| 103 | Ga0068854_100658960 | 3300005578 | Bacteria | 899 |
| 104 | Ga0068854_101666333 | 3300005578 | Bacteria | 582 |
| 105 | Ga0068854_102011181 | 3300005578 | Bacteria | 533 |
| 106 | Ga0068856_100020864 | 3300005614 | Bacteria | 6368 |
| 107 | Ga0068856_100246767 | 3300005614 | Bacteria | 1801 |
| 108 | Ga0068856_102605820 | 3300005614 | Bacteria | 512 |
| 109 | Ga0070702_100021043 | 3300005615 | Bacteria | 3426 |
| 110 | Ga0070702_100906033 | 3300005615 | Bacteria | 691 |
| 111 | Ga0068852_101153037 | 3300005616 | Bacteria | 796 |
| 112 | Ga0068852_101159039 | 3300005616 | Bacteria | 794 |
| 113 | Ga0068852_101714626 | 3300005616 | Bacteria | 651 |
| 114 | Ga0068859_100011503 | 3300005617 | Bacteria | 8897 |
| 115 | Ga0068859_100021700 | 3300005617 | Bacteria | 6443 |
| 116 | Ga0068859_100158427 | 3300005617 | Bacteria | 2342 |
| 117 | Ga0068859_100177088 | 3300005617 | Bacteria | 2214 |
| 118 | Ga0068859_101947328 | 3300005617 | Bacteria | 649 |
| 119 | Ga0068864_100127994 | 3300005618 | Bacteria | 2278 |
| 120 | Ga0068866_10000800 | 3300005718 | Bacteria | 14106 |
| 121 | Ga0068866_10377022 | 3300005718 | Bacteria | 909 |
| 122 | Ga0068861_100001378 | 3300005719 | Bacteria | 15253 |
| 123 | Ga0068861_100016735 | 3300005719 | Bacteria | 5194 |
| 124 | Ga0068861_100107394 | 3300005719 | Bacteria | 2231 |
| 125 | Ga0068861_101270836 | 3300005719 | Bacteria | 714 |
| 126 | Ga0068851_10971253 | 3300005834 | Bacteria | 535 |
| 127 | Ga0068870_10087184 | 3300005840 | Bacteria | 1738 |
| 128 | Ga0068870_10170429 | 3300005840 | Bacteria | 1299 |
| 129 | Ga0068870_11453171 | 3300005840 | Bacteria | 504 |
| 130 | Ga0068863_100117575 | 3300005841 | Bacteria | 2533 |
| 131 | Ga0068863_101629612 | 3300005841 | Bacteria | 655 |
| 132 | Ga0068863_101849770 | 3300005841 | Bacteria | 614 |
| 133 | Ga0068858_100003490 | 3300005842 | Bacteria | 15590 |
| 134 | Ga0068858_100081023 | 3300005842 | Bacteria | 3017 |
| 135 | Ga0068858_100155623 | 3300005842 | Bacteria | 2150 |
| 136 | Ga0068860_100008442 | 3300005843 | Bacteria | 10260 |
| 137 | Ga0068860_100017732 | 3300005843 | Bacteria | 6935 |
| 138 | Ga0068860_100351103 | 3300005843 | Bacteria | 1451 |
| 139 | Ga0068862_100006216 | 3300005844 | Bacteria | 9947 |
| 140 | Ga0068862_100103203 | 3300005844 | Bacteria | 2497 |
| 141 | Ga0068862_100304329 | 3300005844 | Bacteria | 1467 |
| 142 | Ga0068862_101822540 | 3300005844 | Bacteria | 618 |
| 143 | Ga0081455_10719063 | 3300005937 | Bacteria | 634 |
| 144 | Ga0081539_10000233 | 3300005985 | Bacteria | 130647 |
| 145 | Ga0075368_10404726 | 3300006042 | Bacteria | 600 |
| 146 | Ga0075363_100070219 | 3300006048 | Bacteria | 1902 |
| 147 | Ga0075364_10011108 | 3300006051 | Bacteria | 5468 |
| 148 | Ga0075364_10344321 | 3300006051 | Bacteria | 1016 |
| 149 | Ga0075432_10074382 | 3300006058 | Bacteria | 1224 |
| 150 | Ga0070715_10801206 | 3300006163 | Bacteria | 572 |
| 151 | Ga0070716_100158008 | 3300006173 | Bacteria | 1466 |
| 152 | Ga0075362_10023034 | 3300006177 | Bacteria | 2630 |
| 153 | Ga0075362_10075198 | 3300006177 | Bacteria | 1549 |
| 154 | Ga0075362_10096208 | 3300006177 | Bacteria | 1380 |
| 155 | Ga0075362_10134088 | 3300006177 | Bacteria | 1180 |
| 156 | Ga0075362_10276050 | 3300006177 | Bacteria | 830 |
| 157 | Ga0075362_10406739 | 3300006177 | Bacteria | 687 |
| 158 | Ga0075367_10233591 | 3300006178 | Bacteria | 1152 |
| 159 | Ga0075369_10564350 | 3300006186 | Bacteria | 544 |
| 160 | Ga0075366_10005640 | 3300006195 | Bacteria | 6787 |
| 161 | Ga0075366_10085328 | 3300006195 | Bacteria | 1888 |
| 162 | Ga0075366_10123139 | 3300006195 | Bacteria | 1563 |
| 163 | Ga0075366_10193121 | 3300006195 | Bacteria | 1237 |
| 164 | Ga0075366_10295620 | 3300006195 | Bacteria | 990 |
| 165 | Ga0075366_10437397 | 3300006195 | Bacteria | 806 |
| 166 | Ga0075366_10638525 | 3300006195 | Bacteria | 660 |
| 167 | Ga0075366_10661102 | 3300006195 | Bacteria | 648 |
| 168 | Ga0097621_100001348 | 3300006237 | Bacteria | 16895 |
| 169 | Ga0097621_100037976 | 3300006237 | Bacteria | 3862 |
| 170 | Ga0075370_10279859 | 3300006353 | Bacteria | 991 |
| 171 | Ga0075370_10739432 | 3300006353 | Bacteria | 599 |
| 172 | Ga0075370_10749158 | 3300006353 | Bacteria | 595 |
| 173 | Ga0068871_100000763 | 3300006358 | Bacteria | 21687 |
| 174 | Ga0068871_100001793 | 3300006358 | Bacteria | 14486 |
| 175 | Ga0068871_100586171 | 3300006358 | Bacteria | 1013 |
| 176 | Ga0075428_100000047 | 3300006844 | Bacteria | 96882 |
| 177 | Ga0075428_101335042 | 3300006844 | Bacteria | 754 |
| 178 | Ga0075428_102264332 | 3300006844 | Bacteria | 560 |
| 179 | Ga0075430_100211888 | 3300006846 | Bacteria | 1607 |
| 180 | Ga0075430_101486354 | 3300006846 | Bacteria | 557 |
| 181 | Ga0075431_100355207 | 3300006847 | Bacteria | 1473 |
| 182 | Ga0075433_10020651 | 3300006852 | Bacteria | 5511 |
| 183 | Ga0075433_10216266 | 3300006852 | Bacteria | 1703 |
| 184 | Ga0075433_10949551 | 3300006852 | Bacteria | 749 |
| 185 | Ga0075434_100012054 | 3300006871 | Bacteria | 8182 |
| 186 | Ga0075434_100517439 | 3300006871 | Bacteria | 1214 |
| 187 | Ga0075429_100000047 | 3300006880 | Bacteria | 56773 |
| 188 | Ga0075429_100136853 | 3300006880 | Bacteria | 2144 |
| 189 | Ga0068865_100001223 | 3300006881 | Bacteria | 14933 |
| 190 | Ga0068865_100004060 | 3300006881 | Bacteria | 8794 |
| 191 | Ga0075436_100002331 | 3300006914 | Bacteria | 13096 |
| 192 | Ga0075436_100005646 | 3300006914 | Bacteria | 8587 |
| 193 | Ga0097620_100011503 | 3300006931 | Bacteria | 8897 |
| 194 | Ga0097620_100021700 | 3300006931 | Bacteria | 6443 |
| 195 | Ga0097620_100158439 | 3300006931 | Bacteria | 2342 |
| 196 | Ga0097620_100177092 | 3300006931 | Bacteria | 2214 |
| 197 | Ga0097620_101947557 | 3300006931 | Bacteria | 649 |
| 198 | Ga0075435_100005357 | 3300007076 | Bacteria | 8945 |
| 199 | Ga0075435_100221707 | 3300007076 | Bacteria | 1606 |
| 200 | Ga0075435_101309385 | 3300007076 | Bacteria | 635 |
| 201 | Ga0099794_10057533 | 3300007265 | Bacteria | 1884 |
| 202 | Ga0111539_10069166 | 3300009094 | Bacteria | 4169 |
| 203 | Ga0111539_10150015 | 3300009094 | Bacteria | 2729 |
| 204 | Ga0111539_10497859 | 3300009094 | Bacteria | 1419 |
| 205 | Ga0111539_10614098 | 3300009094 | Bacteria | 1266 |
| 206 | Ga0111539_11073136 | 3300009094 | Bacteria | 936 |
| 207 | Ga0111539_12395326 | 3300009094 | Bacteria | 612 |
| 208 | Ga0105245_10002556 | 3300009098 | Bacteria | 16384 |
| 209 | Ga0114129_10008888 | 3300009147 | Bacteria | 14322 |
| 210 | Ga0114129_10334228 | 3300009147 | Bacteria | 2011 |
| 211 | Ga0105243_10003107 | 3300009148 | Bacteria | 13657 |
| 212 | Ga0105243_10158093 | 3300009148 | Bacteria | 1951 |
| 213 | Ga0105242_10002800 | 3300009176 | Bacteria | 13659 |
| 214 | Ga0105242_10924217 | 3300009176 | Bacteria | 874 |
| 215 | Ga0105248_10893186 | 3300009177 | Bacteria | 1003 |
| 216 | Ga0105248_10910370 | 3300009177 | Bacteria | 993 |
| 217 | Ga0105248_11329146 | 3300009177 | Bacteria | 813 |
| 218 | Ga0105237_11829334 | 3300009545 | Bacteria | 615 |
| 219 | Ga0105238_12583875 | 3300009551 | Bacteria | 544 |
| 220 | Ga0105249_10022359 | 3300009553 | Bacteria | 5664 |
| 221 | Ga0105249_10284435 | 3300009553 | Bacteria | 1653 |
| 222 | Ga0105249_10432441 | 3300009553 | Bacteria | 1352 |
| 223 | Ga0105249_10728482 | 3300009553 | Bacteria | 1053 |
| 224 | Ga0105239_11177518 | 3300010375 | Bacteria | 883 |
| 225 | Ga0105246_10121917 | 3300011119 | Bacteria | 1933 |
| 226 | Ga0105246_10198792 | 3300011119 | Bacteria | 1557 |
| 227 | Ga0157345_1026061 | 3300012498 | Bacteria | 627 |
| 228 | Ga0157313_1018748 | 3300012503 | Bacteria | 684 |
| 229 | Ga0157371_10918516 | 3300013102 | Bacteria | 664 |
| 230 | Ga0157378_10007830 | 3300013297 | Bacteria | 9326 |
| 231 | Ga0157378_10008661 | 3300013297 | Bacteria | 8856 |
| 232 | Ga0163162_10004148 | 3300013306 | Bacteria | 13915 |
| 233 | Ga0163162_10617606 | 3300013306 | Bacteria | 1209 |
| 234 | Ga0157372_10486829 | 3300013307 | Bacteria | 1438 |
| 235 | Ga0157375_10041626 | 3300013308 | Bacteria | 4438 |
| 236 | Ga0157375_10889746 | 3300013308 | Bacteria | 1035 |
| 237 | Ga0163163_11000923 | 3300014325 | Bacteria | 899 |
| 238 | Ga0157380_10024376 | 3300014326 | Bacteria | 4579 |
| 239 | Ga0157380_10383528 | 3300014326 | Bacteria | 1327 |
| 240 | Ga0157380_12400474 | 3300014326 | Bacteria | 592 |
| 241 | Ga0157377_10044509 | 3300014745 | Bacteria | 2475 |
| 242 | Ga0157379_10069525 | 3300014968 | Bacteria | 3149 |
| 243 | Ga0157379_10163599 | 3300014968 | Bacteria | 2008 |
| 244 | Ga0157379_11618587 | 3300014968 | Bacteria | 633 |
| 245 | Ga0157376_10008899 | 3300014969 | Bacteria | 7268 |
| 246 | Ga0157376_10019067 | 3300014969 | Bacteria | 5277 |
| 247 | Ga0163161_10021239 | 3300017792 | Bacteria | 4564 |
| 248 | Ga0163161_10653042 | 3300017792 | Bacteria | 872 |
| 249 | Ga0163161_10689708 | 3300017792 | Bacteria | 849 |
| 250 | Ga0163161_11012719 | 3300017792 | Bacteria | 710 |
| 251 | Ga0213872_10039057 | 3300021361 | Bacteria | 2166 |
| 252 | Ga0209025_1000039 | 3300025294 | Bacteria | 377396 |
| 253 | Ga0209564_1058966 | 3300025295 | Bacteria | 874 |
| 254 | Ga0207697_10203172 | 3300025315 | Bacteria | 872 |
| 255 | Ga0207653_10008869 | 3300025885 | Bacteria | 3136 |
| 256 | Ga0207682_10570910 | 3300025893 | Bacteria | 534 |
| 257 | Ga0207692_10083260 | 3300025898 | Bacteria | 1716 |
| 258 | Ga0207642_10002949 | 3300025899 | Bacteria | 5327 |
| 259 | Ga0207642_10018748 | 3300025899 | Bacteria | 2663 |
| 260 | Ga0207688_10017544 | 3300025901 | Bacteria | 3891 |
| 261 | Ga0207688_10689152 | 3300025901 | Bacteria | 646 |
| 262 | Ga0207680_10281450 | 3300025903 | Bacteria | 1155 |
| 263 | Ga0207680_11292106 | 3300025903 | Bacteria | 519 |
| 264 | Ga0207645_10139908 | 3300025907 | Bacteria | 1577 |
| 265 | Ga0207645_10857355 | 3300025907 | Bacteria | 617 |
| 266 | Ga0207643_10005493 | 3300025908 | Bacteria | 6776 |
| 267 | Ga0207705_10374636 | 3300025909 | Bacteria | 1099 |
| 268 | Ga0207707_10300202 | 3300025912 | Bacteria | 1389 |
| 269 | Ga0207707_10387605 | 3300025912 | Bacteria | 1201 |
| 270 | Ga0207707_11232489 | 3300025912 | Bacteria | 604 |
| 271 | Ga0207663_10310873 | 3300025916 | Bacteria | 1181 |
| 272 | Ga0207660_10001979 | 3300025917 | Bacteria | 13656 |
| 273 | Ga0207660_10558601 | 3300025917 | Bacteria | 931 |
| 274 | Ga0207662_10000006 | 3300025918 | Bacteria | 105457 |
| 275 | Ga0207662_10009139 | 3300025918 | Bacteria | 5448 |
| 276 | Ga0207662_10547337 | 3300025918 | Bacteria | 801 |
| 277 | Ga0207652_10016184 | 3300025921 | Bacteria | 6084 |
| 278 | Ga0207681_10256446 | 3300025923 | Bacteria | 1367 |
| 279 | Ga0207681_10590164 | 3300025923 | Bacteria | 917 |
| 280 | Ga0207659_10339805 | 3300025926 | Bacteria | 1243 |
| 281 | Ga0207659_10357490 | 3300025926 | Bacteria | 1213 |
| 282 | Ga0207659_11385894 | 3300025926 | Bacteria | 603 |
| 283 | Ga0207687_10005454 | 3300025927 | Bacteria | 8413 |
| 284 | Ga0207700_10361588 | 3300025928 | Bacteria | 1266 |
| 285 | Ga0207644_10021011 | 3300025931 | Bacteria | 4445 |
| 286 | Ga0207644_10395553 | 3300025931 | Bacteria | 1129 |
| 287 | Ga0207644_11658297 | 3300025931 | Bacteria | 536 |
| 288 | Ga0207706_10254171 | 3300025933 | Bacteria | 1534 |
| 289 | Ga0207686_10001285 | 3300025934 | Bacteria | 14428 |
| 290 | Ga0207686_10725505 | 3300025934 | Bacteria | 792 |
| 291 | Ga0207709_10005880 | 3300025935 | Bacteria | 6927 |
| 292 | Ga0207709_10228947 | 3300025935 | Bacteria | 1345 |
| 293 | Ga0207709_11048595 | 3300025935 | Bacteria | 668 |
| 294 | Ga0207670_10005544 | 3300025936 | Bacteria | 6937 |
| 295 | Ga0207670_10183639 | 3300025936 | Bacteria | 1577 |
| 296 | Ga0207669_10027395 | 3300025937 | Bacteria | 3119 |
| 297 | Ga0207704_10000913 | 3300025938 | Bacteria | 13073 |
| 298 | Ga0207704_10006606 | 3300025938 | Bacteria | 5426 |
| 299 | Ga0207704_10252372 | 3300025938 | Bacteria | 1325 |
| 300 | Ga0207665_11464318 | 3300025939 | Bacteria | 543 |
| 301 | Ga0207691_10119614 | 3300025940 | Bacteria | 2336 |
| 302 | Ga0207691_10154910 | 3300025940 | Bacteria | 2013 |
| 303 | Ga0207691_10304462 | 3300025940 | Bacteria | 1369 |
| 304 | Ga0207711_10719917 | 3300025941 | Bacteria | 931 |
| 305 | Ga0207711_10828529 | 3300025941 | Bacteria | 861 |
| 306 | Ga0207711_11222325 | 3300025941 | Bacteria | 693 |
| 307 | Ga0207689_10019913 | 3300025942 | Bacteria | 5651 |
| 308 | Ga0207689_11751455 | 3300025942 | Bacteria | 514 |
| 309 | Ga0207661_10057404 | 3300025944 | Bacteria | 3130 |
| 310 | Ga0207667_10002489 | 3300025949 | Bacteria | 22959 |
| 311 | Ga0207651_10059456 | 3300025960 | Bacteria | 2648 |
| 312 | Ga0207712_10002872 | 3300025961 | Bacteria | 11017 |
| 313 | Ga0207712_10070429 | 3300025961 | Bacteria | 2512 |
| 314 | Ga0207712_10492500 | 3300025961 | Bacteria | 1047 |
| 315 | Ga0207712_12011474 | 3300025961 | Bacteria | 517 |
| 316 | Ga0207668_10181279 | 3300025972 | Bacteria | 1661 |
| 317 | Ga0207668_10451257 | 3300025972 | Bacteria | 1097 |
| 318 | Ga0207640_10005155 | 3300025981 | Bacteria | 7105 |
| 319 | Ga0207640_11701493 | 3300025981 | Bacteria | 569 |
| 320 | Ga0207658_10165595 | 3300025986 | Bacteria | 1816 |
| 321 | Ga0207658_11381413 | 3300025986 | Bacteria | 644 |
| 322 | Ga0207677_10002702 | 3300026023 | Bacteria | 9350 |
| 323 | Ga0207703_10004381 | 3300026035 | Bacteria | 11604 |
| 324 | Ga0207703_10027342 | 3300026035 | Bacteria | 4492 |
| 325 | Ga0207703_10060243 | 3300026035 | Bacteria | 3103 |
| 326 | Ga0207639_10092277 | 3300026041 | Bacteria | 2427 |
| 327 | Ga0207678_10097661 | 3300026067 | Bacteria | 2510 |
| 328 | Ga0207708_10010574 | 3300026075 | Bacteria | 6852 |
| 329 | Ga0207708_10049162 | 3300026075 | Bacteria | 3210 |
| 330 | Ga0207708_11019692 | 3300026075 | Bacteria | 720 |
| 331 | Ga0207702_10019596 | 3300026078 | Bacteria | 5598 |
| 332 | Ga0207702_10333621 | 3300026078 | Bacteria | 1447 |
| 333 | Ga0207641_10280061 | 3300026088 | Bacteria | 1568 |
| 334 | Ga0207641_10432785 | 3300026088 | Bacteria | 1269 |
| 335 | Ga0207641_11076003 | 3300026088 | Bacteria | 802 |
| 336 | Ga0207641_12325455 | 3300026088 | Bacteria | 535 |
| 337 | Ga0207641_12373667 | 3300026088 | Bacteria | 529 |
| 338 | Ga0207648_10004560 | 3300026089 | Bacteria | 14202 |
| 339 | Ga0207648_10005939 | 3300026089 | Bacteria | 12211 |
| 340 | Ga0207648_10186006 | 3300026089 | Bacteria | 1840 |
| 341 | Ga0207648_10551344 | 3300026089 | Bacteria | 1059 |
| 342 | Ga0207676_10014207 | 3300026095 | Bacteria | 5721 |
| 343 | Ga0207674_11680028 | 3300026116 | Bacteria | 603 |
| 344 | Ga0207675_100006663 | 3300026118 | Bacteria | 10927 |
| 345 | Ga0207675_100024184 | 3300026118 | Bacteria | 5648 |
| 346 | Ga0207675_100174415 | 3300026118 | Bacteria | 2057 |
| 347 | Ga0207683_11091757 | 3300026121 | Bacteria | 740 |
| 348 | Ga0207698_10183308 | 3300026142 | Bacteria | 1857 |
| 349 | Ga0207698_11561593 | 3300026142 | Bacteria | 675 |
| 350 | Ga0207698_11587902 | 3300026142 | Bacteria | 670 |
| 351 | Ga0209969_1001632 | 3300027360 | Bacteria | 3101 |
| 352 | Ga0209969_1047307 | 3300027360 | Bacteria | 673 |
| 353 | Ga0209967_1000358 | 3300027364 | Bacteria | 6044 |
| 354 | Ga0209981_1002763 | 3300027378 | Bacteria | 2251 |
| 355 | Ga0209981_1003413 | 3300027378 | Bacteria | 2063 |
| 356 | Ga0209996_1000729 | 3300027395 | Bacteria | 3938 |
| 357 | Ga0209996_1011883 | 3300027395 | Bacteria | 1167 |
| 358 | Ga0210000_1034579 | 3300027462 | Bacteria | 795 |
| 359 | Ga0209995_1000242 | 3300027471 | Bacteria | 8706 |
| 360 | Ga0209995_1001135 | 3300027471 | Bacteria | 4092 |
| 361 | Ga0209968_1000130 | 3300027526 | Bacteria | 13315 |
| 362 | Ga0209968_1001973 | 3300027526 | Bacteria | 3121 |
| 363 | Ga0209968_1025750 | 3300027526 | Bacteria | 970 |
| 364 | Ga0209999_1003266 | 3300027543 | Bacteria | 2893 |
| 365 | Ga0209999_1007636 | 3300027543 | Bacteria | 1945 |
| 366 | Ga0209588_1269912 | 3300027671 | Bacteria | 516 |
| 367 | Ga0209966_1000117 | 3300027695 | Bacteria | 35145 |
| 368 | Ga0209966_1001758 | 3300027695 | Bacteria | 3668 |
| 369 | Ga0209998_10003290 | 3300027717 | Bacteria | 3551 |
| 370 | Ga0207428_10009607 | 3300027907 | Bacteria | 8666 |
| 371 | Ga0207428_10081909 | 3300027907 | Bacteria | 2519 |
| 372 | Ga0268265_10004065 | 3300028380 | Bacteria | 10284 |
| 373 | Ga0268265_10029280 | 3300028380 | Bacteria | 3951 |
| 374 | Ga0268265_10158583 | 3300028380 | Bacteria | 1918 |
| 375 | Ga0268265_10159132 | 3300028380 | Bacteria | 1916 |
| 376 | Ga0268265_10349690 | 3300028380 | Bacteria | 1349 |
| 377 | Ga0268265_11354509 | 3300028380 | Bacteria | 713 |
| 378 | Ga0268264_10002318 | 3300028381 | Bacteria | 16843 |
| 379 | Ga0268264_10003087 | 3300028381 | Bacteria | 14417 |
| 380 | Ga0268264_10325919 | 3300028381 | Bacteria | 1454 |
| 381 | Ga0307517_10547982 | 3300028786 | Bacteria | 579 |
| 382 | Ga0307515_10000096 | 3300028794 | Bacteria | 206366 |
| 383 | Ga0307515_10006150 | 3300028794 | Bacteria | 24126 |
| 384 | Ga0307515_10012540 | 3300028794 | Bacteria | 15942 |
| 385 | Ga0307515_10119204 | 3300028794 | Bacteria | 3004 |
| 386 | Ga0307515_10124094 | 3300028794 | Bacteria | 2899 |
| 387 | Ga0307515_10276308 | 3300028794 | Bacteria | 1393 |
| 388 | Ga0265324_10017152 | 3300029957 | Bacteria | 2635 |
| 389 | Ga0307512_10080686 | 3300030522 | Bacteria | 2340 |
| 390 | Ga0265331_10149695 | 3300031250 | Bacteria | 1060 |
| 391 | Ga0265327_10028075 | 3300031251 | Bacteria | 3226 |
| 392 | Ga0265327_10299265 | 3300031251 | Bacteria | 708 |
| 393 | Ga0265316_10000201 | 3300031344 | Bacteria | 69415 |
| 394 | Ga0307513_10004080 | 3300031456 | Bacteria | 19563 |
| 395 | Ga0307513_10005218 | 3300031456 | Bacteria | 17209 |
| 396 | Ga0307513_10099285 | 3300031456 | Bacteria | 2940 |
| 397 | Ga0307408_100013705 | 3300031548 | Bacteria | 5383 |
| 398 | Ga0307408_100198260 | 3300031548 | Bacteria | 1623 |
| 399 | Ga0307408_100383599 | 3300031548 | Bacteria | 1202 |
| 400 | Ga0307408_100421256 | 3300031548 | Bacteria | 1151 |
| 401 | Ga0307408_100559458 | 3300031548 | Bacteria | 1010 |
| 402 | Ga0307408_100809011 | 3300031548 | Bacteria | 851 |
| 403 | Ga0307514_10000530 | 3300031649 | Bacteria | 74660 |
| 404 | Ga0316575_10000771 | 3300031665 | Bacteria | 9685 |
| 405 | Ga0316575_10028250 | 3300031665 | Bacteria | 2186 |
| 406 | Ga0316575_10339941 | 3300031665 | Bacteria | 638 |
| 407 | Ga0316579_10010128 | 3300031691 | Bacteria | 3978 |
| 408 | Ga0316579_10010387 | 3300031691 | Bacteria | 3935 |
| 409 | Ga0316576_10135201 | 3300031727 | Bacteria | 1855 |
| 410 | Ga0316578_10044753 | 3300031728 | Bacteria | 2575 |
| 411 | Ga0316578_10055271 | 3300031728 | Bacteria | 2329 |
| 412 | Ga0307516_10026535 | 3300031730 | Bacteria | 5881 |
| 413 | Ga0307405_10023807 | 3300031731 | Bacteria | 3487 |
| 414 | Ga0307405_10996488 | 3300031731 | Bacteria | 714 |
| 415 | Ga0307405_10999450 | 3300031731 | Bacteria | 714 |
| 416 | Ga0307405_11717345 | 3300031731 | Bacteria | 556 |
| 417 | Ga0316577_10033326 | 3300031733 | Bacteria | 2877 |
| 418 | Ga0316577_10183925 | 3300031733 | Bacteria | 1180 |
| 419 | Ga0307413_10869981 | 3300031824 | Bacteria | 763 |
| 420 | Ga0307413_11006224 | 3300031824 | Bacteria | 715 |
| 421 | Ga0307413_11944083 | 3300031824 | Bacteria | 529 |
| 422 | Ga0307410_11296513 | 3300031852 | Bacteria | 637 |
| 423 | Ga0307406_10186243 | 3300031901 | Bacteria | 1516 |
| 424 | Ga0307406_10819345 | 3300031901 | Bacteria | 787 |
| 425 | Ga0307406_11312373 | 3300031901 | Bacteria | 632 |
| 426 | Ga0307406_11867127 | 3300031901 | Bacteria | 535 |
| 427 | Ga0307407_10567806 | 3300031903 | Bacteria | 841 |
| 428 | Ga0307407_10839262 | 3300031903 | Bacteria | 701 |
| 429 | Ga0307407_10923156 | 3300031903 | Bacteria | 671 |
| 430 | Ga0307412_10555595 | 3300031911 | Bacteria | 965 |
| 431 | Ga0307412_11556169 | 3300031911 | Bacteria | 603 |
| 432 | Ga0307412_11614402 | 3300031911 | Bacteria | 592 |
| 433 | Ga0307412_11837666 | 3300031911 | Bacteria | 558 |
| 434 | Ga0307412_11962916 | 3300031911 | Bacteria | 541 |
| 435 | Ga0307412_12102148 | 3300031911 | Bacteria | 524 |
| 436 | Ga0307412_12309417 | 3300031911 | Bacteria | 502 |
| 437 | Ga0307409_101808537 | 3300031995 | Bacteria | 640 |
| 438 | Ga0307416_100164217 | 3300032002 | Bacteria | 2057 |
| 439 | Ga0307416_100303075 | 3300032002 | Bacteria | 1589 |
| 440 | Ga0307416_100402979 | 3300032002 | Bacteria | 1406 |
| 441 | Ga0307416_100688901 | 3300032002 | Bacteria | 1110 |
| 442 | Ga0307416_100773172 | 3300032002 | Bacteria | 1054 |
| 443 | Ga0307416_101406681 | 3300032002 | Bacteria | 803 |
| 444 | Ga0307416_102666251 | 3300032002 | Bacteria | 597 |
| 445 | Ga0307416_103483122 | 3300032002 | Bacteria | 527 |
| 446 | Ga0307414_10291090 | 3300032004 | Bacteria | 1377 |
| 447 | Ga0307414_10649692 | 3300032004 | Bacteria | 951 |
| 448 | Ga0307411_10211556 | 3300032005 | Bacteria | 1498 |
| 449 | Ga0307411_10924742 | 3300032005 | Bacteria | 776 |
| 450 | Ga0307411_10989813 | 3300032005 | Bacteria | 752 |
| 451 | Ga0307411_11079767 | 3300032005 | Bacteria | 722 |
| 452 | Ga0307415_101600920 | 3300032126 | Bacteria | 626 |
| 453 | Ga0307415_102481850 | 3300032126 | Bacteria | 510 |
| 454 | Ga0316583_10002317 | 3300032133 | Bacteria | 6567 |
| 455 | Ga0316583_10018653 | 3300032133 | Bacteria | 2491 |
| 456 | Ga0316583_10022934 | 3300032133 | Bacteria | 2232 |
| 457 | Ga0316585_10053551 | 3300032137 | Bacteria | 1297 |
| 458 | Ga0316580_10021418 | 3300032139 | Bacteria | 1992 |
| 459 | Ga0316580_10051025 | 3300032139 | Bacteria | 1275 |
| 460 | Ga0316593_10004609 | 3300032168 | Bacteria | 3555 |
| 461 | Ga0316593_10042198 | 3300032168 | Bacteria | 1521 |
| 462 | Ga0316593_10223821 | 3300032168 | Bacteria | 699 |
| 463 | Ga0307510_10259489 | 3300033180 | Bacteria | 1220 |
| 464 | Ga0316592_1007100 | 3300033524 | Bacteria | 2177 |
| 465 | Ga0316586_1000300 | 3300033527 | Bacteria | 4509 |
| 466 | Ga0316587_1041763 | 3300033529 | Bacteria | 829 |
| 467 | Ga0316596_1004696 | 3300033541 | Bacteria | 3082 |
| 468 | Ga0373930_0029026 | 3300034816 | Bacteria | 1128 |
| 469 | Ga0373948_0010756 | 3300034817 | Bacteria | 1603 |
| 470 | Ga0373950_0012134 | 3300034818 | Bacteria | 1419 |
| 471 | Ga0373958_0048463 | 3300034819 | Bacteria | 891 |
| 472 | Ga0373959_0109104 | 3300034820 | Bacteria | 666 |
| 473 | Ga0373938_0055891 | 3300034957 | Bacteria | 912 |
| 474 | Ga0373928_0009124 | 3300035084 | Bacteria | 1935 |
| 475 | Ga0373929_0089566 | 3300035085 | Bacteria | 761 |
| 476 | Ga0373940_0139052 | 3300035088 | Bacteria | 766 |
| 477 | Ga0373940_0203762 | 3300035088 | Bacteria | 651 |
| 478 | Ga0373940_0328001 | 3300035088 | Bacteria | 533 |
| 479 | Ga0373949_0022177 | 3300035090 | Bacteria | 1462 |
| 480 | Ga0373952_0046971 | 3300035092 | Bacteria | 1016 |
| 481 | Ga0373952_0078765 | 3300035092 | Bacteria | 837 |
| 482 | Ga0373923_0147248 | 3300035111 | Bacteria | 1067 |
| 483 | Ga0373936_0077460 | 3300035113 | Bacteria | 1379 |
| 484 | Ga0373939_0031815 | 3300035114 | Bacteria | 1528 |
| 485 | Ga0373939_0047314 | 3300035114 | Bacteria | 1320 |
| 486 | Ga0373939_0176349 | 3300035114 | Bacteria | 794 |
| 487 | Ga0373941_0007557 | 3300035115 | Bacteria | 2662 |
| 488 | Ga0373953_0022203 | 3300035117 | Bacteria | 2391 |
| 489 | Ga0373956_0053410 | 3300035119 | Bacteria | 1819 |
| 490 | Ga0373957_0200461 | 3300035120 | Bacteria | 831 |
| 491 | Ga0373960_0093774 | 3300035121 | Bacteria | 963 |
| 492 | Ga0373960_0102246 | 3300035121 | Bacteria | 930 |
| 493 | Ga0373960_0130507 | 3300035121 | Bacteria | 842 |
| 494 | Ga0373943_0283592 | 3300035170 | Bacteria | 937 |
| 495 | Ga0373955_0002904 | 3300035172 | Bacteria | 7521 |
| 496 | Ga0373955_0996417 | 3300035172 | Bacteria | 516 |
| 497 | Ga0373942_0002486 | 3300035207 | Bacteria | 4471 |
| 498 | Ga0373942_0257773 | 3300035207 | Bacteria | 594 |
| 499 | Ga0373961_0298020 | 3300035241 | Bacteria | 596 |
| 500 | Ga0373962_0024426 | 3300035242 | Bacteria | 1616 |
| 501 | Ga0373962_0144698 | 3300035242 | Bacteria | 774 |
| 502 | Ga0373924_0032565 | 3300035410 | Bacteria | 2100 |
| 503 | Ga0373931_0002669 | 3300035691 | Bacteria | 7930 |
| 504 | Ga0373931_0048665 | 3300035691 | Bacteria | 2248 |
| 505 | Ga0373931_0051539 | 3300035691 | Bacteria | 2192 |
| 506 | Ga0373931_0464538 | 3300035691 | Bacteria | 811 |
| 507 | Ga0373935_1184415 | 3300035692 | Bacteria | 569 |
| 508 | Ga0373927_0090861 | 3300035695 | Bacteria | 1983 |
| 509 | Ga0373933_0029527 | 3300035724 | Bacteria | 3171 |
| 510 | Ga0373947_0233084 | 3300035725 | Bacteria | 1213 |
| 511 | Ga0373937_0002498 | 3300036401 | Bacteria | 15273 |
| 512 | Ga0316582_0012337 | 3300036647 | Bacteria | 4764 |
| 513 | Ga0316582_0034187 | 3300036647 | Bacteria | 3128 |
| 514 | Ga0316582_0389217 | 3300036647 | Bacteria | 960 |
| 515 | Ga0316584_0077596 | 3300036712 | Bacteria | 2488 |
| 516 | Ga0316584_0240898 | 3300036712 | Bacteria | 1323 |
| 517 | Ga0373925_0087096 | 3300037068 | Bacteria | 2383 |
| 518 | Ga0373925_0472249 | 3300037068 | Bacteria | 1028 |
| 519 | Ga0373925_1538293 | 3300037068 | Bacteria | 544 |
| 520 | Ga0395905_0797396 | 3300037471 | Bacteria | 847 |
| 521 | Ga0316581_0098634 | 3300037588 | Bacteria | 900 |
| 522 | Ga0436364_0587970 | 3300037853 | Bacteria | 2503 |
| 523 | Ga0436361_0482102 | 3300039447 | Bacteria | 1639 |
| 524 | Ga0439436_0063088 | 3300041404 | Bacteria | 1036 |
| 525 | Ga0439439_0066211 | 3300041406 | Bacteria | 964 |
| 526 | Ga0439461_0002934 | 3300041410 | Bacteria | 2769 |
| 527 | Ga0439461_0007483 | 3300041410 | Bacteria | 1936 |
| 528 | Ga0439465_0093075 | 3300041413 | Bacteria | 1033 |
| 529 | Ga0439465_0255073 | 3300041413 | Bacteria | 649 |
| 530 | Ga0451797_1450145 | 3300041453 | Bacteria | 1063 |
| 531 | Ga0451805_038163 | 3300041461 | Bacteria | 728 |
| 532 | Ga0451807_1762141 | 3300041486 | Bacteria | 668 |
| 533 | Ga0451833_1307539 | 3300041491 | Bacteria | 519 |
| 534 | Ga0451837_1027358 | 3300041494 | Bacteria | 612 |
| 535 | Ga0451843_0842857 | 3300041509 | Bacteria | 542 |
| 536 | Ga0439431_0044792 | 3300041997 | Bacteria | 1135 |
| 537 | Ga0439431_0048855 | 3300041997 | Bacteria | 1093 |
| 538 | Ga0439431_0094685 | 3300041997 | Bacteria | 816 |
| 539 | Ga0439437_010893 | 3300042000 | Bacteria | 1038 |
| 540 | Ga0439437_026527 | 3300042000 | Bacteria | 717 |
| 541 | Ga0439441_031275 | 3300042001 | Bacteria | 1033 |
| 542 | Ga0439445_0055209 | 3300042004 | Bacteria | 1078 |
| 543 | Ga0439445_0117097 | 3300042004 | Bacteria | 763 |
| 544 | Ga0439432_052729 | 3300042006 | Bacteria | 1266 |
| 545 | Ga0439449_0079765 | 3300042007 | Bacteria | 1207 |
| 546 | Ga0439449_0197990 | 3300042007 | Bacteria | 752 |
| 547 | Ga0439452_105424 | 3300042010 | Bacteria | 604 |
| 548 | Ga0439455_0200498 | 3300042012 | Bacteria | 578 |
| 549 | Ga0439456_036841 | 3300042013 | Bacteria | 1056 |
| 550 | Ga0439457_178460 | 3300042014 | Bacteria | 518 |
| 551 | Ga0439462_0133044 | 3300042015 | Bacteria | 695 |
| 552 | Ga0439462_0174825 | 3300042015 | Bacteria | 608 |
| 553 | Ga0439462_0188671 | 3300042015 | Bacteria | 585 |
| 554 | Ga0450912_009544 | 3300042116 | Bacteria | 820 |
| 555 | Ga0450888_006168 | 3300042126 | Bacteria | 1298 |
| 556 | Ga0450890_015249 | 3300042127 | Bacteria | 1011 |
| 557 | Ga0450891_019880 | 3300042129 | Bacteria | 655 |
| 558 | Ga0450892_026137 | 3300042130 | Bacteria | 595 |
| 559 | Ga0450896_012830 | 3300042133 | Bacteria | 1188 |
| 560 | Ga0450898_025958 | 3300042134 | Bacteria | 1053 |
| 561 | Ga0450898_155158 | 3300042134 | Bacteria | 502 |
| 562 | Ga0450899_008179 | 3300042135 | Bacteria | 1144 |
| 563 | Ga0450889_034540 | 3300042144 | Bacteria | 599 |
| 564 | Ga0439446_0050577 | 3300042156 | Bacteria | 1240 |
| 565 | Ga0439446_0139347 | 3300042156 | Bacteria | 791 |
| 566 | Ga0439446_0332653 | 3300042156 | Bacteria | 538 |
| 567 | Ga0439434_0000888 | 3300042435 | Bacteria | 8613 |
| 568 | Ga0439434_0027368 | 3300042435 | Bacteria | 1723 |
| 569 | Ga0439435_0000151 | 3300042436 | Bacteria | 9438 |
| 570 | Ga0439460_0072489 | 3300042461 | Bacteria | 1069 |
| 571 | Ga0439460_0117851 | 3300042461 | Bacteria | 866 |
| 572 | Ga0450893_0032704 | 3300042532 | Bacteria | 931 |
| 573 | Ga0451577_0000013 | 3300042876 | Bacteria | 550689 |
| 574 | Ga0451577_0003495 | 3300042876 | Bacteria | 17459 |
| 575 | Ga0451577_0069675 | 3300042876 | Bacteria | 3136 |
| 576 | Ga0451577_0081193 | 3300042876 | Bacteria | 2891 |
| 577 | Ga0451577_0213403 | 3300042876 | Bacteria | 1744 |
| 578 | Ga0451577_0286581 | 3300042876 | Bacteria | 1492 |
| 579 | Ga0451577_0352048 | 3300042876 | Bacteria | 1336 |
| 580 | Ga0451577_0749480 | 3300042876 | Bacteria | 883 |
| 581 | Ga0451577_1055460 | 3300042876 | Bacteria | 728 |
| 582 | Ga0451577_1456937 | 3300042876 | Bacteria | 606 |
| 583 | Ga0466969_0000018 | 3300044656 | Bacteria | 102911 |
| 584 | Ga0466969_0001561 | 3300044656 | Bacteria | 12286 |
| 585 | Ga0466972_0008302 | 3300044658 | Bacteria | 5206 |
| 586 | Ga0466972_0040259 | 3300044658 | Bacteria | 2277 |
| 587 | Ga0453683_0000059 | 3300044673 | Bacteria | 187158 |
| 588 | Ga0453683_0211230 | 3300044673 | Bacteria | 1233 |
| 589 | Ga0453683_0228165 | 3300044673 | Bacteria | 1185 |
| 590 | Ga0453683_0848729 | 3300044673 | Bacteria | 602 |
| 591 | Ga0466965_0021276 | 3300044683 | Bacteria | 3120 |
| 592 | Ga0466965_0071050 | 3300044683 | Bacteria | 1750 |
| 593 | Ga0466966_0009766 | 3300044684 | Bacteria | 6359 |
| 594 | Ga0466966_0010593 | 3300044684 | Bacteria | 6129 |
| 595 | Ga0466961_0004306 | 3300044693 | Bacteria | 8909 |
| 596 | Ga0466961_0051858 | 3300044693 | Bacteria | 2619 |
| 597 | Ga0466964_0272744 | 3300044706 | Bacteria | 842 |
| 598 | Ga0466964_0550720 | 3300044706 | Bacteria | 626 |
| 599 | Ga0453684_0000585 | 3300044712 | Bacteria | 135647 |
| 600 | Ga0453684_0000989 | 3300044712 | Bacteria | 92793 |
| 601 | Ga0453684_0242050 | 3300044712 | Bacteria | 2076 |
| 602 | Ga0453684_0294967 | 3300044712 | Bacteria | 1845 |
| 603 | Ga0453684_0348092 | 3300044712 | Bacteria | 1672 |
| 604 | Ga0453684_0378031 | 3300044712 | Bacteria | 1591 |
| 605 | Ga0453684_0799892 | 3300044712 | Bacteria | 1017 |
| 606 | Ga0453684_0968886 | 3300044712 | Bacteria | 906 |
| 607 | Ga0453684_1490577 | 3300044712 | Bacteria | 698 |
| 608 | Ga0466971_0003261 | 3300044719 | Bacteria | 6925 |
| 609 | Ga0466968_0087772 | 3300044735 | Bacteria | 1374 |
| 610 | Ga0466968_0413688 | 3300044735 | Bacteria | 662 |
| 611 | Ga0466970_0086890 | 3300044765 | Bacteria | 1695 |
| 612 | Ga0466970_0744725 | 3300044765 | Bacteria | 572 |
| 613 | Ga0466970_0850985 | 3300044765 | Bacteria | 535 |
| 614 | Ga0466957_0112308 | 3300044842 | Bacteria | 1729 |
| 615 | Ga0466960_0432839 | 3300044901 | Bacteria | 762 |
| 616 | Ga0466959_0003145 | 3300045049 | Bacteria | 10707 |
| 617 | Ga0466959_0074705 | 3300045049 | Bacteria | 2450 |
| 618 | Ga0451576_0000013 | 3300045051 | Bacteria | 665120 |
| 619 | Ga0451576_0000018 | 3300045051 | Bacteria | 550689 |
| 620 | Ga0451576_0001791 | 3300045051 | Bacteria | 35197 |
| 621 | Ga0451576_0003595 | 3300045051 | Bacteria | 21077 |
| 622 | Ga0451576_0013761 | 3300045051 | Bacteria | 9038 |
| 623 | Ga0451576_0075129 | 3300045051 | Bacteria | 3516 |
| 624 | Ga0451576_0076007 | 3300045051 | Bacteria | 3495 |
| 625 | Ga0451576_0430530 | 3300045051 | Bacteria | 1384 |
| 626 | Ga0451576_0439305 | 3300045051 | Bacteria | 1369 |
| 627 | Ga0451576_0451212 | 3300045051 | Bacteria | 1350 |
| 628 | Ga0451576_0694652 | 3300045051 | Bacteria | 1069 |
| 629 | Ga0451576_1317612 | 3300045051 | Bacteria | 753 |
| 630 | Ga0451576_1904423 | 3300045051 | Bacteria | 613 |
| 631 | Ga0451576_2050312 | 3300045051 | Bacteria | 589 |
| 632 | Ga0451576_2672921 | 3300045051 | Bacteria | 508 |
| 633 | Ga0466958_0194302 | 3300045836 | Bacteria | 1290 |
| 634 | Ga0466958_0307647 | 3300045836 | Bacteria | 1018 |
| 635 | Ga0466958_0697788 | 3300045836 | Bacteria | 661 |
| 636 | Ga0466967_0016890 | 3300045976 | Bacteria | 5771 |
| 637 | Ga0495592_0845073 | 3300046454 | Bacteria | 541 |
| 638 | Ga0495650_0032266 | 3300046471 | Bacteria | 2344 |
| 639 | Ga0495608_0682645 | 3300046511 | Bacteria | 612 |
| 640 | Ga0495663_0015935 | 3300046525 | Bacteria | 2123 |
| 641 | Ga0495642_0004003 | 3300046528 | Bacteria | 5759 |
| 642 | Ga0495642_0475104 | 3300046528 | Bacteria | 553 |
| 643 | Ga0495654_0001400 | 3300046530 | Bacteria | 16709 |
| 644 | Ga0495586_0033259 | 3300046535 | Bacteria | 2767 |
| 645 | Ga0495598_0020927 | 3300046537 | Bacteria | 1733 |
| 646 | Ga0495598_0166025 | 3300046537 | Bacteria | 780 |
| 647 | Ga0495621_0050465 | 3300046539 | Bacteria | 1487 |
| 648 | Ga0495621_0183831 | 3300046539 | Bacteria | 835 |
| 649 | Ga0495621_0235612 | 3300046539 | Bacteria | 744 |
| 650 | Ga0495621_0529443 | 3300046539 | Bacteria | 510 |
| 651 | Ga0495633_0176329 | 3300046558 | Bacteria | 984 |
| 652 | Ga0495667_0225459 | 3300046559 | Bacteria | 1195 |
| 653 | Ga0495656_0004795 | 3300046615 | Bacteria | 4654 |
| 654 | Ga0495656_0036747 | 3300046615 | Bacteria | 2019 |
| 655 | Ga0495635_0132836 | 3300046663 | Bacteria | 1697 |
| 656 | Ga0495659_0332783 | 3300046664 | Bacteria | 646 |
| 657 | Ga0495588_0011885 | 3300046674 | Bacteria | 4099 |
| 658 | Ga0495588_0505682 | 3300046674 | Bacteria | 633 |
| 659 | Ga0495647_0104279 | 3300046681 | Bacteria | 1177 |
| 660 | Ga0495658_0406349 | 3300046683 | Bacteria | 868 |
| 661 | Ga0495669_0035839 | 3300046684 | Bacteria | 2191 |
| 662 | Ga0495670_0212705 | 3300046691 | Bacteria | 1026 |
| 663 | Ga0495636_0032780 | 3300047318 | Bacteria | 2132 |
| 664 | Ga0495636_0106143 | 3300047318 | Bacteria | 1232 |
| 665 | Ga0495680_0056613 | 3300047322 | Bacteria | 3035 |
| 666 | Ga0495685_020801 | 3300047447 | Bacteria | 2256 |
| 667 | Ga0495681_0196945 | 3300047470 | Bacteria | 819 |
| 668 | Ga0495615_0090636 | 3300048090 | Bacteria | 851 |
| 669 | Ga0495615_0161699 | 3300048090 | Bacteria | 673 |
| 670 | Ga0495615_0310777 | 3300048090 | Bacteria | 513 |
| 671 | Ga0496106_0147203 | 3300048909 | Bacteria | 1856 |
| 672 | Ga0496106_0166754 | 3300048909 | Bacteria | 1744 |
| 673 | Ga0496107_0962909 | 3300048910 | Bacteria | 620 |
| 674 | Ga0496121_0011225 | 3300048924 | Bacteria | 9983 |
| 675 | Ga0496121_0049229 | 3300048924 | Bacteria | 3576 |
| 676 | Ga0496122_0025868 | 3300048925 | Bacteria | 5081 |
| 677 | Ga0496124_0000007 | 3300048927 | Bacteria | 883534 |
| 678 | Ga0496124_0527405 | 3300048927 | Bacteria | 785 |
| 679 | Ga0501306_028698 | 3300049127 | Bacteria | 817 |
| 680 | Ga0501306_066993 | 3300049127 | Bacteria | 600 |
| 681 | Ga0501306_079011 | 3300049127 | Bacteria | 565 |
| 682 | Ga0501308_054895 | 3300049128 | Bacteria | 591 |
| 683 | Ga0501308_056902 | 3300049128 | Bacteria | 583 |
| 684 | Ga0501308_074204 | 3300049128 | Bacteria | 533 |
| 685 | Ga0501309_005668 | 3300049129 | Bacteria | 1497 |
| 686 | Ga0501309_044409 | 3300049129 | Bacteria | 686 |
| 687 | Ga0501310_012788 | 3300049130 | Bacteria | 966 |
| 688 | Ga0501310_013709 | 3300049130 | Bacteria | 944 |
| 689 | Ga0501310_014405 | 3300049130 | Bacteria | 928 |
| 690 | Ga0501310_072518 | 3300049130 | Bacteria | 529 |
| 691 | Ga0501304_000459 | 3300049160 | Bacteria | 2107 |
| 692 | Ga0501304_016247 | 3300049160 | Bacteria | 703 |
| 693 | Ga0501304_043934 | 3300049160 | Bacteria | 506 |
| 694 | Ga0501305_009452 | 3300049161 | Bacteria | 1282 |
| 695 | Ga0501305_060313 | 3300049161 | Bacteria | 652 |
| 696 | Ga0501305_070281 | 3300049161 | Bacteria | 615 |
| 697 | Ga0501305_071331 | 3300049161 | Bacteria | 611 |
| 698 | Ga0501305_083154 | 3300049161 | Bacteria | 578 |
| 699 | Ga0501307_001882 | 3300049162 | Bacteria | 1876 |
| 700 | Ga0501307_031865 | 3300049162 | Bacteria | 734 |
| 701 | Ga0501307_093647 | 3300049162 | Bacteria | 504 |
| 702 | Ga0501311_021806 | 3300049527 | Bacteria | 876 |
| 703 | Ga0501312_002194 | 3300049528 | Bacteria | 2077 |
| 704 | Ga0501312_011502 | 3300049528 | Bacteria | 1204 |
| 705 | Ga0501312_019245 | 3300049528 | Bacteria | 1001 |
| 706 | Ga0501312_048038 | 3300049528 | Bacteria | 714 |
| 707 | Ga0501313_020312 | 3300049529 | Bacteria | 817 |
| 708 | Ga0501313_070576 | 3300049529 | Bacteria | 506 |
| 709 | Ga0501314_001080 | 3300049530 | Bacteria | 1885 |
| 710 | Ga0501314_006685 | 3300049530 | Bacteria | 1010 |
| 711 | Ga0501314_012337 | 3300049530 | Bacteria | 819 |
| 712 | Ga0501314_024539 | 3300049530 | Bacteria | 644 |
| 713 | Ga0501315_002433 | 3300049531 | Bacteria | 1749 |
| 714 | Ga0501315_007565 | 3300049531 | Bacteria | 1241 |
| 715 | Ga0501316_002875 | 3300049532 | Bacteria | 1631 |
| 716 | Ga0501316_005899 | 3300049532 | Bacteria | 1286 |
| 717 | Ga0501316_034002 | 3300049532 | Bacteria | 692 |
| 718 | Ga0501316_056157 | 3300049532 | Bacteria | 575 |
| 719 | Ga0501317_017647 | 3300049533 | Bacteria | 938 |
| 720 | Ga0501318_027607 | 3300049534 | Bacteria | 756 |
| 721 | Ga0501318_070882 | 3300049534 | Bacteria | 550 |
| 722 | Ga0501319_014463 | 3300049535 | Bacteria | 663 |
| 723 | Ga0501320_013490 | 3300049536 | Bacteria | 873 |
| 724 | Ga0501320_036926 | 3300049536 | Bacteria | 628 |
| 725 | Ga0501321_024738 | 3300049537 | Bacteria | 770 |
| 726 | Ga0501322_016762 | 3300049538 | Bacteria | 616 |
| 727 | Ga0501323_029573 | 3300049539 | Bacteria | 764 |
| 728 | Ga0501324_004430 | 3300049540 | Bacteria | 1117 |
| 729 | Ga0501335_031092 | 3300049551 | Bacteria | 603 |
| 730 | Ga0501031_0100062 | 3300049568 | Bacteria | 1892 |
| 731 | Ga0501032_0244711 | 3300049569 | Bacteria | 1165 |
| 732 | Ga0501033_0032115 | 3300049570 | Bacteria | 3942 |
| 733 | Ga0501034_1465083 | 3300049571 | Bacteria | 557 |
| 734 | Ga0501036_0375199 | 3300049572 | Bacteria | 1187 |
| 735 | Ga0501037_0904395 | 3300049573 | Bacteria | 578 |
| 736 | Ga0501038_0681881 | 3300049574 | Bacteria | 771 |
| 737 | Ga0501039_0501708 | 3300049575 | Bacteria | 953 |
| 738 | Ga0501039_1136843 | 3300049575 | Bacteria | 605 |
| 739 | Ga0501041_0662843 | 3300049577 | Bacteria | 667 |
| 740 | Ga0501041_0686090 | 3300049577 | Bacteria | 655 |
| 741 | Ga0501042_1264981 | 3300049578 | Bacteria | 538 |
| 742 | Ga0501043_0694290 | 3300049579 | Bacteria | 744 |
| 743 | Ga0501047_0017972 | 3300049581 | Bacteria | 6777 |
| 744 | Ga0501048_0110710 | 3300049582 | Bacteria | 1939 |
| 745 | Ga0501067_0688056 | 3300049583 | Bacteria | 575 |
| 746 | Ga0501069_0080728 | 3300049585 | Bacteria | 1832 |
| 747 | Ga0501071_0974516 | 3300049587 | Bacteria | 655 |
| 748 | Ga0501072_0448210 | 3300049588 | Bacteria | 1022 |
| 749 | Ga0501072_0497388 | 3300049588 | Bacteria | 964 |
| 750 | Ga0501073_1047584 | 3300049589 | Bacteria | 561 |
| 751 | Ga0501076_1319131 | 3300049592 | Bacteria | 593 |
| 752 | Ga0501077_0272334 | 3300049593 | Bacteria | 1077 |
| 753 | Ga0501198_000043 | 3300049649 | Bacteria | 44170 |
| 754 | Ga0501209_159545 | 3300049656 | Bacteria | 682 |
| 755 | Ga0501222_000051 | 3300049662 | Bacteria | 43800 |
| 756 | Ga0501236_092588 | 3300049670 | Bacteria | 583 |
| 757 | Ga0501248_035790 | 3300049678 | Bacteria | 588 |
| 758 | Ga0501255_027380 | 3300049684 | Bacteria | 775 |
| 759 | Ga0501225_0066433 | 3300049705 | Bacteria | 1020 |
| 760 | Ga0501079_0274751 | 3300049741 | Bacteria | 1317 |
| 761 | Ga0501083_0498399 | 3300049744 | Bacteria | 793 |
| 762 | Ga0501035_0011202 | 3300049822 | Bacteria | 8305 |
| 763 | Ga0501044_0024898 | 3300049823 | Bacteria | 6347 |
| 764 | Ga0501045_0383086 | 3300049824 | Bacteria | 1047 |
| 765 | nmdc:mga03683_111107_c1 | 3300050489 | Bacteria | 1212 |
| 766 | nmdc:mga03683_72943_c1 | 3300050489 | Bacteria | 1471 |
| 767 | nmdc:mga03n38_47560_c1 | 3300050490 | Bacteria | 1899 |
| 768 | nmdc:mga00v17_12098_c1 | 3300050491 | Bacteria | 4754 |
| 769 | nmdc:mga0k408_124759_c1 | 3300050493 | Bacteria | 1527 |
| 770 | nmdc:mga0k408_1824_c2 | 3300050493 | Bacteria | 7032 |
| 771 | nmdc:mga0k408_190921_c1 | 3300050493 | Bacteria | 1222 |
| 772 | nmdc:mga0k408_23422_c1 | 3300050493 | Bacteria | 3483 |
| 773 | nmdc:mga0k408_248690_c1 | 3300050493 | Bacteria | 1062 |
| 774 | nmdc:mga0k408_409360_c1 | 3300050493 | Bacteria | 807 |
| 775 | nmdc:mga0k408_87248_c1 | 3300050493 | Bacteria | 1832 |
| 776 | nmdc:mga0k408_97182_c1 | 3300050493 | Bacteria | 1734 |
| 777 | nmdc:mga07m45_146138_c1 | 3300050496 | Bacteria | 1370 |
| 778 | nmdc:mga07m45_786486_c1 | 3300050496 | Bacteria | 546 |
| 779 | nmdc:mga05p37_275238_c1 | 3300050507 | Bacteria | 2010 |
| 780 | nmdc:mga05p37_2800_c1 | 3300050507 | Bacteria | 20274 |
| 781 | nmdc:mga09592_1477_c1 | 3300050508 | Bacteria | 18889 |
| 782 | nmdc:mga09592_280883_c1 | 3300050508 | Bacteria | 1444 |
| 783 | nmdc:mga0qj67_1020781_c1 | 3300050509 | Bacteria | 648 |
| 784 | nmdc:mga0qj67_263575_c1 | 3300050509 | Bacteria | 1398 |
| 785 | nmdc:mga06r32_1458863_c1 | 3300050510 | Bacteria | 625 |
| 786 | nmdc:mga08y16_20591_c1 | 3300050511 | Bacteria | 6962 |
| 787 | nmdc:mga08y16_4095_c1 | 3300050511 | Bacteria | 15220 |
| 788 | nmdc:mga08y16_72548_c1 | 3300050511 | Bacteria | 3587 |
| 789 | nmdc:mga08y16_997814_c1 | 3300050511 | Bacteria | 817 |
| 790 | nmdc:mga0n895_30950_c1 | 3300050512 | Bacteria | 5119 |
| 791 | nmdc:mga0n895_691979_c1 | 3300050512 | Bacteria | 1016 |
| 792 | nmdc:mga0rr50_1381268_c1 | 3300050513 | Bacteria | 596 |
| 793 | nmdc:mga0rr50_301_c1 | 3300050513 | Bacteria | 26775 |
| 794 | nmdc:mga08x19_2636_c1 | 3300050514 | Bacteria | 10849 |
| 795 | nmdc:mga08x19_64591_c1 | 3300050514 | Bacteria | 2376 |
| 796 | nmdc:mga0a205_1167027_c1 | 3300050515 | Bacteria | 618 |
| 797 | nmdc:mga0a205_217_c1 | 3300050515 | Bacteria | 40547 |
| 798 | nmdc:mga0a205_285553_c1 | 3300050515 | Bacteria | 1525 |
| 799 | Ga0495601_0588086 | 3300053077 | Bacteria | 715 |
| 800 | Ga0500644_0265983 | 3300053088 | Bacteria | 726 |
| 801 | Ga0500646_0297648 | 3300053090 | Bacteria | 578 |
| 802 | Ga0500600_0129045 | 3300053149 | Bacteria | 1290 |
| 803 | Ga0500600_0277307 | 3300053149 | Bacteria | 733 |
| 804 | Ga0501084_0197300 | 3300054114 | Bacteria | 1698 |
| 805 | Ga0590071_162906 | 3300059421 | Bacteria | 581 |
| 806 | Ga0587083_0000314 | 3300059505 | Bacteria | 3935 |
| 807 | Ga0587101_000304 | 3300059623 | Bacteria | 3203 |
| 808 | Ga0501082_1060306 | 3300060353 | Bacteria | 709 |
| 809 | Ga0466962_0186260 | 3300061719 | Bacteria | 1012 |
| 810 | Ga0530510_1093645 | 3300061734 | Bacteria | 611 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300003300 | Ga0006758J48902_1026783 | Ga0006758J48902_10267832 | 55 |
| 2 | 3300006177 | Ga0075362_10276050 | Ga0075362_102760502 | 55 |
| 3 | 3300031731 | Ga0307405_10999450 | Ga0307405_109994502 | 55 |
| 4 | 3300006042 | Ga0075368_10404726 | Ga0075368_104047261 | 56 |
| 5 | 3300032133 | Ga0316583_10002317 | Ga0316583_1000231712 | 56 |
| 6 | 3300042876 | Ga0451577_0352048 | Ga0451577_0352048_1003_1188 | 56 |
| 7 | 3300044673 | Ga0453683_0211230 | Ga0453683_0211230_418_603 | 56 |
| 8 | 3300045051 | Ga0451576_0000013 | Ga0451576_0000013_540318_540503 | 56 |
| 9 | iso_pu_bacteria | 2643221660 | 2644338015 | 56 |
| 10 | iso_pu_bacteria | 2855730933 | 2855735568 | 56 |
| 11 | iso_pu_bacteria | 2855767633 | 2855771351 | 56 |
| 12 | iso_pu_bacteria | 2857542790 | 2857543715 | 56 |
| 13 | iso_pu_bacteria | 2881412998 | 2881416787 | 56 |
| 14 | iso_pu_bacteria | 2904434214 | 2904438987 | 56 |
| 15 | iso_pu_bacteria | 2919704043 | 2919708816 | 56 |
| 16 | iso_pu_bacteria | 8048746797 | 8048749924 | 56 |
| 17 | iso_pu_bacteria | 8055225921 | 8055226492 | 56 |
| 18 | 3300003187 | JGI25151J46595_10000457 | JGI25151J46595_1000045730 | 57 |
| 19 | 3300003347 | JGI26128J50194_1000120 | JGI26128J50194_10001204 | 57 |
| 20 | 3300005327 | Ga0070658_10069230 | Ga0070658_100692304 | 57 |
| 21 | 3300005328 | Ga0070676_10060920 | Ga0070676_100609202 | 57 |
| 22 | 3300005328 | Ga0070676_10241894 | Ga0070676_102418942 | 57 |
| 23 | 3300005330 | Ga0070690_100444857 | Ga0070690_1004448572 | 57 |
| 24 | 3300005331 | Ga0070670_100551381 | Ga0070670_1005513811 | 57 |
| 25 | 3300005333 | Ga0070677_10852002 | Ga0070677_108520021 | 57 |
| 26 | 3300005335 | Ga0070666_10808556 | Ga0070666_108085562 | 57 |
| 27 | 3300005335 | Ga0070666_11388189 | Ga0070666_113881891 | 57 |
| 28 | 3300005341 | Ga0070691_10960764 | Ga0070691_109607642 | 57 |
| 29 | 3300005347 | Ga0070668_100410448 | Ga0070668_1004104482 | 57 |
| 30 | 3300005347 | Ga0070668_100563465 | Ga0070668_1005634652 | 57 |
| 31 | 3300005353 | Ga0070669_100077546 | Ga0070669_1000775465 | 57 |
| 32 | 3300005353 | Ga0070669_100208195 | Ga0070669_1002081951 | 57 |
| 33 | 3300005354 | Ga0070675_100554307 | Ga0070675_1005543073 | 57 |
| 34 | 3300005355 | Ga0070671_100529069 | Ga0070671_1005290691 | 57 |
| 35 | 3300005356 | Ga0070674_100039880 | Ga0070674_1000398802 | 57 |
| 36 | 3300005364 | Ga0070673_100055764 | Ga0070673_1000557642 | 57 |
| 37 | 3300005367 | Ga0070667_100308597 | Ga0070667_1003085972 | 57 |
| 38 | 3300005367 | Ga0070667_100337290 | Ga0070667_1003372901 | 57 |
| 39 | 3300005455 | Ga0070663_100121854 | Ga0070663_1001218542 | 57 |
| 40 | 3300005456 | Ga0070678_100199417 | Ga0070678_1001994172 | 57 |
| 41 | 3300005457 | Ga0070662_100060375 | Ga0070662_1000603755 | 57 |
| 42 | 3300005459 | Ga0068867_100002598 | Ga0068867_1000025987 | 57 |
| 43 | 3300005467 | Ga0070706_101952369 | Ga0070706_1019523692 | 57 |
| 44 | 3300005539 | Ga0068853_100646245 | Ga0068853_1006462452 | 57 |
| 45 | 3300005539 | Ga0068853_102139023 | Ga0068853_1021390231 | 57 |
| 46 | 3300005543 | Ga0070672_100070334 | Ga0070672_1000703343 | 57 |
| 47 | 3300005543 | Ga0070672_100237690 | Ga0070672_1002376903 | 57 |
| 48 | 3300005578 | Ga0068854_100658960 | Ga0068854_1006589603 | 57 |
| 49 | 3300005578 | Ga0068854_101666333 | Ga0068854_1016663332 | 57 |
| 50 | 3300005718 | Ga0068866_10377022 | Ga0068866_103770222 | 57 |
| 51 | 3300005719 | Ga0068861_100016735 | Ga0068861_1000167353 | 57 |
| 52 | 3300005840 | Ga0068870_11453171 | Ga0068870_114531712 | 57 |
| 53 | 3300005841 | Ga0068863_101849770 | Ga0068863_1018497701 | 57 |
| 54 | 3300005842 | Ga0068858_100155623 | Ga0068858_1001556233 | 57 |
| 55 | 3300005843 | Ga0068860_100008442 | Ga0068860_10000844213 | 57 |
| 56 | 3300005844 | Ga0068862_100103203 | Ga0068862_1001032035 | 57 |
| 57 | 3300005937 | Ga0081455_10719063 | Ga0081455_107190632 | 57 |
| 58 | 3300006048 | Ga0075363_100070219 | Ga0075363_1000702194 | 57 |
| 59 | 3300006051 | Ga0075364_10011108 | Ga0075364_100111082 | 57 |
| 60 | 3300006051 | Ga0075364_10344321 | Ga0075364_103443213 | 57 |
| 61 | 3300006177 | Ga0075362_10023034 | Ga0075362_100230342 | 57 |
| 62 | 3300006177 | Ga0075362_10075198 | Ga0075362_100751983 | 57 |
| 63 | 3300006177 | Ga0075362_10096208 | Ga0075362_100962082 | 57 |
| 64 | 3300006177 | Ga0075362_10406739 | Ga0075362_104067392 | 57 |
| 65 | 3300006178 | Ga0075367_10233591 | Ga0075367_102335913 | 57 |
| 66 | 3300006186 | Ga0075369_10564350 | Ga0075369_105643502 | 57 |
| 67 | 3300006195 | Ga0075366_10005640 | Ga0075366_1000564010 | 57 |
| 68 | 3300006195 | Ga0075366_10085328 | Ga0075366_100853284 | 57 |
| 69 | 3300006195 | Ga0075366_10123139 | Ga0075366_101231392 | 57 |
| 70 | 3300006195 | Ga0075366_10193121 | Ga0075366_101931212 | 57 |
| 71 | 3300006195 | Ga0075366_10295620 | Ga0075366_102956202 | 57 |
| 72 | 3300006195 | Ga0075366_10437397 | Ga0075366_104373972 | 57 |
| 73 | 3300006195 | Ga0075366_10638525 | Ga0075366_106385252 | 57 |
| 74 | 3300006195 | Ga0075366_10661102 | Ga0075366_106611022 | 57 |
| 75 | 3300006353 | Ga0075370_10279859 | Ga0075370_102798593 | 57 |
| 76 | 3300006353 | Ga0075370_10739432 | Ga0075370_107394322 | 57 |
| 77 | 3300006353 | Ga0075370_10749158 | Ga0075370_107491582 | 57 |
| 78 | 3300006844 | Ga0075428_101335042 | Ga0075428_1013350422 | 57 |
| 79 | 3300006846 | Ga0075430_100211888 | Ga0075430_1002118882 | 57 |
| 80 | 3300006880 | Ga0075429_100136853 | Ga0075429_1001368533 | 57 |
| 81 | 3300006881 | Ga0068865_100004060 | Ga0068865_1000040609 | 57 |
| 82 | 3300009094 | Ga0111539_12395326 | Ga0111539_123953262 | 57 |
| 83 | 3300009148 | Ga0105243_10158093 | Ga0105243_101580933 | 57 |
| 84 | 3300009176 | Ga0105242_10924217 | Ga0105242_109242172 | 57 |
| 85 | 3300009177 | Ga0105248_10893186 | Ga0105248_108931863 | 57 |
| 86 | 3300009545 | Ga0105237_11829334 | Ga0105237_118293341 | 57 |
| 87 | 3300009551 | Ga0105238_12583875 | Ga0105238_125838752 | 57 |
| 88 | 3300009553 | Ga0105249_10284435 | Ga0105249_102844353 | 57 |
| 89 | 3300011119 | Ga0105246_10198792 | Ga0105246_101987923 | 57 |
| 90 | 3300012503 | Ga0157313_1018748 | Ga0157313_10187482 | 57 |
| 91 | 3300013297 | Ga0157378_10008661 | Ga0157378_1000866110 | 57 |
| 92 | 3300013306 | Ga0163162_10004148 | Ga0163162_1000414812 | 57 |
| 93 | 3300013308 | Ga0157375_10041626 | Ga0157375_100416263 | 57 |
| 94 | 3300014325 | Ga0163163_11000923 | Ga0163163_110009232 | 57 |
| 95 | 3300014968 | Ga0157379_10069525 | Ga0157379_100695253 | 57 |
| 96 | 3300017792 | Ga0163161_10021239 | Ga0163161_1002123910 | 57 |
| 97 | 3300017792 | Ga0163161_10653042 | Ga0163161_106530422 | 57 |
| 98 | 3300017792 | Ga0163161_10689708 | Ga0163161_106897082 | 57 |
| 99 | 3300021361 | Ga0213872_10039057 | Ga0213872_100390573 | 57 |
| 100 | 3300025294 | Ga0209025_1000039 | Ga0209025_100003924 | 57 |
| 101 | 3300025295 | Ga0209564_1058966 | Ga0209564_10589662 | 57 |
| 102 | 3300025315 | Ga0207697_10203172 | Ga0207697_102031722 | 57 |
| 103 | 3300025893 | Ga0207682_10570910 | Ga0207682_105709102 | 57 |
| 104 | 3300025899 | Ga0207642_10018748 | Ga0207642_100187482 | 57 |
| 105 | 3300025901 | Ga0207688_10689152 | Ga0207688_106891522 | 57 |
| 106 | 3300025903 | Ga0207680_10281450 | Ga0207680_102814502 | 57 |
| 107 | 3300025907 | Ga0207645_10139908 | Ga0207645_101399082 | 57 |
| 108 | 3300025909 | Ga0207705_10374636 | Ga0207705_103746361 | 57 |
| 109 | 3300025923 | Ga0207681_10256446 | Ga0207681_102564462 | 57 |
| 110 | 3300025926 | Ga0207659_10339805 | Ga0207659_103398052 | 57 |
| 111 | 3300025931 | Ga0207644_10395553 | Ga0207644_103955533 | 57 |
| 112 | 3300025931 | Ga0207644_11658297 | Ga0207644_116582972 | 57 |
| 113 | 3300025933 | Ga0207706_10254171 | Ga0207706_102541714 | 57 |
| 114 | 3300025934 | Ga0207686_10725505 | Ga0207686_107255052 | 57 |
| 115 | 3300025935 | Ga0207709_10228947 | Ga0207709_102289473 | 57 |
| 116 | 3300025935 | Ga0207709_11048595 | Ga0207709_110485952 | 57 |
| 117 | 3300025937 | Ga0207669_10027395 | Ga0207669_100273957 | 57 |
| 118 | 3300025938 | Ga0207704_10006606 | Ga0207704_100066065 | 57 |
| 119 | 3300025938 | Ga0207704_10252372 | Ga0207704_102523723 | 57 |
| 120 | 3300025940 | Ga0207691_10119614 | Ga0207691_101196143 | 57 |
| 121 | 3300025940 | Ga0207691_10154910 | Ga0207691_101549102 | 57 |
| 122 | 3300025940 | Ga0207691_10304462 | Ga0207691_103044623 | 57 |
| 123 | 3300025941 | Ga0207711_10719917 | Ga0207711_107199173 | 57 |
| 124 | 3300025942 | Ga0207689_11751455 | Ga0207689_117514551 | 57 |
| 125 | 3300025960 | Ga0207651_10059456 | Ga0207651_100594562 | 57 |
| 126 | 3300025961 | Ga0207712_10070429 | Ga0207712_100704293 | 57 |
| 127 | 3300025961 | Ga0207712_10492500 | Ga0207712_104925002 | 57 |
| 128 | 3300025972 | Ga0207668_10181279 | Ga0207668_101812793 | 57 |
| 129 | 3300025972 | Ga0207668_10451257 | Ga0207668_104512572 | 57 |
| 130 | 3300025986 | Ga0207658_10165595 | Ga0207658_101655952 | 57 |
| 131 | 3300026035 | Ga0207703_10027342 | Ga0207703_100273423 | 57 |
| 132 | 3300026041 | Ga0207639_10092277 | Ga0207639_100922772 | 57 |
| 133 | 3300026067 | Ga0207678_10097661 | Ga0207678_100976613 | 57 |
| 134 | 3300026088 | Ga0207641_10432785 | Ga0207641_104327853 | 57 |
| 135 | 3300026089 | Ga0207648_10005939 | Ga0207648_1000593919 | 57 |
| 136 | 3300026089 | Ga0207648_10186006 | Ga0207648_101860064 | 57 |
| 137 | 3300026089 | Ga0207648_10551344 | Ga0207648_105513443 | 57 |
| 138 | 3300026118 | Ga0207675_100006663 | Ga0207675_1000066639 | 57 |
| 139 | 3300026142 | Ga0207698_11587902 | Ga0207698_115879022 | 57 |
| 140 | 3300027360 | Ga0209969_1047307 | Ga0209969_10473072 | 57 |
| 141 | 3300027378 | Ga0209981_1003413 | Ga0209981_10034135 | 57 |
| 142 | 3300027395 | Ga0209996_1000729 | Ga0209996_100072910 | 57 |
| 143 | 3300027471 | Ga0209995_1000242 | Ga0209995_10002427 | 57 |
| 144 | 3300027526 | Ga0209968_1000130 | Ga0209968_100013019 | 57 |
| 145 | 3300027526 | Ga0209968_1025750 | Ga0209968_10257503 | 57 |
| 146 | 3300027543 | Ga0209999_1007636 | Ga0209999_10076363 | 57 |
| 147 | 3300027695 | Ga0209966_1000117 | Ga0209966_100011731 | 57 |
| 148 | 3300027717 | Ga0209998_10003290 | Ga0209998_100032904 | 57 |
| 149 | 3300028380 | Ga0268265_10029280 | Ga0268265_100292804 | 57 |
| 150 | 3300028380 | Ga0268265_10158583 | Ga0268265_101585833 | 57 |
| 151 | 3300028380 | Ga0268265_11354509 | Ga0268265_113545092 | 57 |
| 152 | 3300028381 | Ga0268264_10002318 | Ga0268264_1000231814 | 57 |
| 153 | 3300028786 | Ga0307517_10547982 | Ga0307517_105479822 | 57 |
| 154 | 3300028794 | Ga0307515_10000096 | Ga0307515_10000096182 | 57 |
| 155 | 3300028794 | Ga0307515_10012540 | Ga0307515_100125409 | 57 |
| 156 | 3300028794 | Ga0307515_10119204 | Ga0307515_101192043 | 57 |
| 157 | 3300028794 | Ga0307515_10124094 | Ga0307515_101240946 | 57 |
| 158 | 3300028794 | Ga0307515_10276308 | Ga0307515_102763083 | 57 |
| 159 | 3300029957 | Ga0265324_10017152 | Ga0265324_100171522 | 57 |
| 160 | 3300031251 | Ga0265327_10028075 | Ga0265327_100280754 | 57 |
| 161 | 3300031251 | Ga0265327_10299265 | Ga0265327_102992651 | 57 |
| 162 | 3300031344 | Ga0265316_10000201 | Ga0265316_100002019 | 57 |
| 163 | 3300031456 | Ga0307513_10004080 | Ga0307513_1000408023 | 57 |
| 164 | 3300031456 | Ga0307513_10099285 | Ga0307513_100992853 | 57 |
| 165 | 3300031548 | Ga0307408_100013705 | Ga0307408_1000137053 | 57 |
| 166 | 3300031548 | Ga0307408_100198260 | Ga0307408_1001982604 | 57 |
| 167 | 3300031548 | Ga0307408_100559458 | Ga0307408_1005594583 | 57 |
| 168 | 3300031730 | Ga0307516_10026535 | Ga0307516_100265353 | 57 |
| 169 | 3300031731 | Ga0307405_10996488 | Ga0307405_109964882 | 57 |
| 170 | 3300031824 | Ga0307413_10869981 | Ga0307413_108699812 | 57 |
| 171 | 3300031901 | Ga0307406_10186243 | Ga0307406_101862432 | 57 |
| 172 | 3300031901 | Ga0307406_10819345 | Ga0307406_108193452 | 57 |
| 173 | 3300031901 | Ga0307406_11867127 | Ga0307406_118671272 | 57 |
| 174 | 3300031903 | Ga0307407_10923156 | Ga0307407_109231562 | 57 |
| 175 | 3300031911 | Ga0307412_10555595 | Ga0307412_105555953 | 57 |
| 176 | 3300031911 | Ga0307412_11556169 | Ga0307412_115561692 | 57 |
| 177 | 3300031911 | Ga0307412_11614402 | Ga0307412_116144022 | 57 |
| 178 | 3300031911 | Ga0307412_11837666 | Ga0307412_118376662 | 57 |
| 179 | 3300031911 | Ga0307412_11962916 | Ga0307412_119629162 | 57 |
| 180 | 3300031911 | Ga0307412_12102148 | Ga0307412_121021482 | 57 |
| 181 | 3300031995 | Ga0307409_101808537 | Ga0307409_1018085371 | 57 |
| 182 | 3300032002 | Ga0307416_100164217 | Ga0307416_1001642173 | 57 |
| 183 | 3300032002 | Ga0307416_100303075 | Ga0307416_1003030753 | 57 |
| 184 | 3300032002 | Ga0307416_101406681 | Ga0307416_1014066812 | 57 |
| 185 | 3300032002 | Ga0307416_102666251 | Ga0307416_1026662511 | 57 |
| 186 | 3300032002 | Ga0307416_103483122 | Ga0307416_1034831222 | 57 |
| 187 | 3300032004 | Ga0307414_10291090 | Ga0307414_102910902 | 57 |
| 188 | 3300032004 | Ga0307414_10649692 | Ga0307414_106496922 | 57 |
| 189 | 3300032005 | Ga0307411_10211556 | Ga0307411_102115563 | 57 |
| 190 | 3300032005 | Ga0307411_11079767 | Ga0307411_110797672 | 57 |
| 191 | 3300032126 | Ga0307415_101600920 | Ga0307415_1016009202 | 57 |
| 192 | 3300034957 | Ga0373938_0055891 | Ga0373938_0055891_660_842 | 57 |
| 193 | 3300035170 | Ga0373943_0283592 | Ga0373943_0283592_480_668 | 57 |
| 194 | 3300035172 | Ga0373955_0996417 | Ga0373955_0996417_191_373 | 57 |
| 195 | 3300035691 | Ga0373931_0002669 | Ga0373931_0002669_3771_3953 | 57 |
| 196 | 3300035695 | Ga0373927_0090861 | Ga0373927_0090861_1621_1809 | 57 |
| 197 | 3300035725 | Ga0373947_0233084 | Ga0373947_0233084_66_254 | 57 |
| 198 | 3300037068 | Ga0373925_0087096 | Ga0373925_0087096_380_568 | 57 |
| 199 | 3300037068 | Ga0373925_1538293 | Ga0373925_1538293_125_307 | 57 |
| 200 | 3300037471 | Ga0395905_0797396 | Ga0395905_0797396_490_672 | 57 |
| 201 | 3300039447 | Ga0436361_0482102 | Ga0436361_0482102_1136_1321 | 57 |
| 202 | 3300041410 | Ga0439461_0007483 | Ga0439461_0007483_811_993 | 57 |
| 203 | 3300041413 | Ga0439465_0093075 | Ga0439465_0093075_715_897 | 57 |
| 204 | 3300041413 | Ga0439465_0255073 | Ga0439465_0255073_455_637 | 57 |
| 205 | 3300041453 | Ga0451797_1450145 | Ga0451797_1450145_64_249 | 57 |
| 206 | 3300041491 | Ga0451833_1307539 | Ga0451833_1307539_309_491 | 57 |
| 207 | 3300041494 | Ga0451837_1027358 | Ga0451837_1027358_331_513 | 57 |
| 208 | 3300041509 | Ga0451843_0842857 | Ga0451843_0842857_299_487 | 57 |
| 209 | 3300041997 | Ga0439431_0048855 | Ga0439431_0048855_757_939 | 57 |
| 210 | 3300041997 | Ga0439431_0094685 | Ga0439431_0094685_10_192 | 57 |
| 211 | 3300042000 | Ga0439437_010893 | Ga0439437_010893_211_396 | 57 |
| 212 | 3300042000 | Ga0439437_026527 | Ga0439437_026527_78_263 | 57 |
| 213 | 3300042004 | Ga0439445_0055209 | Ga0439445_0055209_663_845 | 57 |
| 214 | 3300042004 | Ga0439445_0117097 | Ga0439445_0117097_278_460 | 57 |
| 215 | 3300042006 | Ga0439432_052729 | Ga0439432_052729_41_223 | 57 |
| 216 | 3300042007 | Ga0439449_0079765 | Ga0439449_0079765_673_855 | 57 |
| 217 | 3300042007 | Ga0439449_0197990 | Ga0439449_0197990_348_530 | 57 |
| 218 | 3300042010 | Ga0439452_105424 | Ga0439452_105424_323_505 | 57 |
| 219 | 3300042012 | Ga0439455_0200498 | Ga0439455_0200498_214_399 | 57 |
| 220 | 3300042014 | Ga0439457_178460 | Ga0439457_178460_206_388 | 57 |
| 221 | 3300042015 | Ga0439462_0133044 | Ga0439462_0133044_143_325 | 57 |
| 222 | 3300042015 | Ga0439462_0174825 | Ga0439462_0174825_216_398 | 57 |
| 223 | 3300042116 | Ga0450912_009544 | Ga0450912_009544_76_258 | 57 |
| 224 | 3300042126 | Ga0450888_006168 | Ga0450888_006168_492_674 | 57 |
| 225 | 3300042127 | Ga0450890_015249 | Ga0450890_015249_470_661 | 57 |
| 226 | 3300042129 | Ga0450891_019880 | Ga0450891_019880_263_448 | 57 |
| 227 | 3300042130 | Ga0450892_026137 | Ga0450892_026137_303_488 | 57 |
| 228 | 3300042133 | Ga0450896_012830 | Ga0450896_012830_240_422 | 57 |
| 229 | 3300042134 | Ga0450898_025958 | Ga0450898_025958_525_707 | 57 |
| 230 | 3300042134 | Ga0450898_155158 | Ga0450898_155158_217_399 | 57 |
| 231 | 3300042135 | Ga0450899_008179 | Ga0450899_008179_381_563 | 57 |
| 232 | 3300042144 | Ga0450889_034540 | Ga0450889_034540_166_348 | 57 |
| 233 | 3300042156 | Ga0439446_0050577 | Ga0439446_0050577_280_462 | 57 |
| 234 | 3300042156 | Ga0439446_0139347 | Ga0439446_0139347_213_395 | 57 |
| 235 | 3300042156 | Ga0439446_0332653 | Ga0439446_0332653_62_247 | 57 |
| 236 | 3300042435 | Ga0439434_0027368 | Ga0439434_0027368_1318_1500 | 57 |
| 237 | 3300042461 | Ga0439460_0117851 | Ga0439460_0117851_552_737 | 57 |
| 238 | 3300042532 | Ga0450893_0032704 | Ga0450893_0032704_612_794 | 57 |
| 239 | 3300042876 | Ga0451577_0003495 | Ga0451577_0003495_1248_1430 | 57 |
| 240 | 3300042876 | Ga0451577_0069675 | Ga0451577_0069675_57_239 | 57 |
| 241 | 3300042876 | Ga0451577_0213403 | Ga0451577_0213403_1459_1650 | 57 |
| 242 | 3300042876 | Ga0451577_0749480 | Ga0451577_0749480_275_469 | 57 |
| 243 | 3300044656 | Ga0466969_0000018 | Ga0466969_0000018_4430_4615 | 57 |
| 244 | 3300044656 | Ga0466969_0001561 | Ga0466969_0001561_10178_10360 | 57 |
| 245 | 3300044658 | Ga0466972_0008302 | Ga0466972_0008302_991_1176 | 57 |
| 246 | 3300044658 | Ga0466972_0040259 | Ga0466972_0040259_1412_1600 | 57 |
| 247 | 3300044673 | Ga0453683_0228165 | Ga0453683_0228165_588_770 | 57 |
| 248 | 3300044683 | Ga0466965_0021276 | Ga0466965_0021276_2075_2260 | 57 |
| 249 | 3300044683 | Ga0466965_0071050 | Ga0466965_0071050_1500_1682 | 57 |
| 250 | 3300044684 | Ga0466966_0009766 | Ga0466966_0009766_3637_3822 | 57 |
| 251 | 3300044684 | Ga0466966_0010593 | Ga0466966_0010593_385_567 | 57 |
| 252 | 3300044693 | Ga0466961_0004306 | Ga0466961_0004306_5236_5418 | 57 |
| 253 | 3300044693 | Ga0466961_0051858 | Ga0466961_0051858_2146_2331 | 57 |
| 254 | 3300044706 | Ga0466964_0272744 | Ga0466964_0272744_243_425 | 57 |
| 255 | 3300044712 | Ga0453684_0242050 | Ga0453684_0242050_251_433 | 57 |
| 256 | 3300044712 | Ga0453684_0294967 | Ga0453684_0294967_349_531 | 57 |
| 257 | 3300044712 | Ga0453684_0378031 | Ga0453684_0378031_1133_1315 | 57 |
| 258 | 3300044712 | Ga0453684_0968886 | Ga0453684_0968886_393_575 | 57 |
| 259 | 3300044712 | Ga0453684_1490577 | Ga0453684_1490577_230_421 | 57 |
| 260 | 3300044719 | Ga0466971_0003261 | Ga0466971_0003261_5837_6019 | 57 |
| 261 | 3300044735 | Ga0466968_0413688 | Ga0466968_0413688_286_468 | 57 |
| 262 | 3300044765 | Ga0466970_0086890 | Ga0466970_0086890_452_637 | 57 |
| 263 | 3300044765 | Ga0466970_0744725 | Ga0466970_0744725_119_301 | 57 |
| 264 | 3300044765 | Ga0466970_0850985 | Ga0466970_0850985_66_251 | 57 |
| 265 | 3300044842 | Ga0466957_0112308 | Ga0466957_0112308_214_396 | 57 |
| 266 | 3300045049 | Ga0466959_0003145 | Ga0466959_0003145_4242_4424 | 57 |
| 267 | 3300045049 | Ga0466959_0074705 | Ga0466959_0074705_402_587 | 57 |
| 268 | 3300045051 | Ga0451576_0003595 | Ga0451576_0003595_15619_15801 | 57 |
| 269 | 3300045051 | Ga0451576_0075129 | Ga0451576_0075129_409_591 | 57 |
| 270 | 3300045051 | Ga0451576_0076007 | Ga0451576_0076007_1223_1417 | 57 |
| 271 | 3300045836 | Ga0466958_0194302 | Ga0466958_0194302_940_1122 | 57 |
| 272 | 3300045836 | Ga0466958_0697788 | Ga0466958_0697788_412_600 | 57 |
| 273 | 3300046471 | Ga0495650_0032266 | Ga0495650_0032266_220_411 | 57 |
| 274 | 3300046511 | Ga0495608_0682645 | Ga0495608_0682645_226_408 | 57 |
| 275 | 3300046525 | Ga0495663_0015935 | Ga0495663_0015935_637_822 | 57 |
| 276 | 3300046528 | Ga0495642_0004003 | Ga0495642_0004003_1407_1592 | 57 |
| 277 | 3300046528 | Ga0495642_0475104 | Ga0495642_0475104_197_382 | 57 |
| 278 | 3300046535 | Ga0495586_0033259 | Ga0495586_0033259_1460_1642 | 57 |
| 279 | 3300046537 | Ga0495598_0020927 | Ga0495598_0020927_1037_1219 | 57 |
| 280 | 3300046537 | Ga0495598_0166025 | Ga0495598_0166025_293_478 | 57 |
| 281 | 3300046539 | Ga0495621_0050465 | Ga0495621_0050465_1093_1278 | 57 |
| 282 | 3300046539 | Ga0495621_0183831 | Ga0495621_0183831_168_350 | 57 |
| 283 | 3300046539 | Ga0495621_0235612 | Ga0495621_0235612_266_448 | 57 |
| 284 | 3300046539 | Ga0495621_0529443 | Ga0495621_0529443_18_200 | 57 |
| 285 | 3300046558 | Ga0495633_0176329 | Ga0495633_0176329_685_870 | 57 |
| 286 | 3300046615 | Ga0495656_0004795 | Ga0495656_0004795_3236_3421 | 57 |
| 287 | 3300046615 | Ga0495656_0036747 | Ga0495656_0036747_1794_1976 | 57 |
| 288 | 3300046664 | Ga0495659_0332783 | Ga0495659_0332783_208_393 | 57 |
| 289 | 3300046674 | Ga0495588_0011885 | Ga0495588_0011885_3514_3699 | 57 |
| 290 | 3300046674 | Ga0495588_0505682 | Ga0495588_0505682_100_288 | 57 |
| 291 | 3300046681 | Ga0495647_0104279 | Ga0495647_0104279_240_428 | 57 |
| 292 | 3300046683 | Ga0495658_0406349 | Ga0495658_0406349_361_549 | 57 |
| 293 | 3300046684 | Ga0495669_0035839 | Ga0495669_0035839_1191_1376 | 57 |
| 294 | 3300046691 | Ga0495670_0212705 | Ga0495670_0212705_728_913 | 57 |
| 295 | 3300047318 | Ga0495636_0032780 | Ga0495636_0032780_1522_1707 | 57 |
| 296 | 3300047318 | Ga0495636_0106143 | Ga0495636_0106143_279_464 | 57 |
| 297 | 3300047447 | Ga0495685_020801 | Ga0495685_020801_1100_1285 | 57 |
| 298 | 3300047470 | Ga0495681_0196945 | Ga0495681_0196945_453_638 | 57 |
| 299 | 3300048090 | Ga0495615_0090636 | Ga0495615_0090636_599_781 | 57 |
| 300 | 3300048090 | Ga0495615_0161699 | Ga0495615_0161699_128_313 | 57 |
| 301 | 3300048090 | Ga0495615_0310777 | Ga0495615_0310777_235_417 | 57 |
| 302 | 3300048909 | Ga0496106_0147203 | Ga0496106_0147203_16_201 | 57 |
| 303 | 3300048910 | Ga0496107_0962909 | Ga0496107_0962909_252_437 | 57 |
| 304 | 3300048924 | Ga0496121_0011225 | Ga0496121_0011225_6959_7144 | 57 |
| 305 | 3300048924 | Ga0496121_0049229 | Ga0496121_0049229_701_886 | 57 |
| 306 | 3300048925 | Ga0496122_0025868 | Ga0496122_0025868_4710_4895 | 57 |
| 307 | 3300048927 | Ga0496124_0000007 | Ga0496124_0000007_14593_14778 | 57 |
| 308 | 3300048927 | Ga0496124_0527405 | Ga0496124_0527405_289_471 | 57 |
| 309 | 3300049127 | Ga0501306_028698 | Ga0501306_028698_603_791 | 57 |
| 310 | 3300049127 | Ga0501306_066993 | Ga0501306_066993_301_489 | 57 |
| 311 | 3300049127 | Ga0501306_079011 | Ga0501306_079011_298_486 | 57 |
| 312 | 3300049128 | Ga0501308_054895 | Ga0501308_054895_22_204 | 57 |
| 313 | 3300049128 | Ga0501308_056902 | Ga0501308_056902_356_538 | 57 |
| 314 | 3300049128 | Ga0501308_074204 | Ga0501308_074204_135_317 | 57 |
| 315 | 3300049129 | Ga0501309_005668 | Ga0501309_005668_390_575 | 57 |
| 316 | 3300049129 | Ga0501309_044409 | Ga0501309_044409_152_334 | 57 |
| 317 | 3300049130 | Ga0501310_012788 | Ga0501310_012788_282_464 | 57 |
| 318 | 3300049130 | Ga0501310_013709 | Ga0501310_013709_735_917 | 57 |
| 319 | 3300049130 | Ga0501310_014405 | Ga0501310_014405_735_917 | 57 |
| 320 | 3300049130 | Ga0501310_072518 | Ga0501310_072518_271_459 | 57 |
| 321 | 3300049160 | Ga0501304_000459 | Ga0501304_000459_1027_1209 | 57 |
| 322 | 3300049160 | Ga0501304_016247 | Ga0501304_016247_468_656 | 57 |
| 323 | 3300049160 | Ga0501304_043934 | Ga0501304_043934_198_389 | 57 |
| 324 | 3300049161 | Ga0501305_009452 | Ga0501305_009452_849_1031 | 57 |
| 325 | 3300049161 | Ga0501305_060313 | Ga0501305_060313_132_317 | 57 |
| 326 | 3300049161 | Ga0501305_070281 | Ga0501305_070281_72_254 | 57 |
| 327 | 3300049161 | Ga0501305_071331 | Ga0501305_071331_104_292 | 57 |
| 328 | 3300049161 | Ga0501305_083154 | Ga0501305_083154_158_343 | 57 |
| 329 | 3300049162 | Ga0501307_001882 | Ga0501307_001882_533_715 | 57 |
| 330 | 3300049162 | Ga0501307_031865 | Ga0501307_031865_242_430 | 57 |
| 331 | 3300049162 | Ga0501307_093647 | Ga0501307_093647_107_292 | 57 |
| 332 | 3300049527 | Ga0501311_021806 | Ga0501311_021806_659_841 | 57 |
| 333 | 3300049528 | Ga0501312_002194 | Ga0501312_002194_646_831 | 57 |
| 334 | 3300049528 | Ga0501312_011502 | Ga0501312_011502_442_630 | 57 |
| 335 | 3300049528 | Ga0501312_019245 | Ga0501312_019245_477_659 | 57 |
| 336 | 3300049528 | Ga0501312_048038 | Ga0501312_048038_182_364 | 57 |
| 337 | 3300049529 | Ga0501313_020312 | Ga0501313_020312_497_679 | 57 |
| 338 | 3300049529 | Ga0501313_070576 | Ga0501313_070576_41_223 | 57 |
| 339 | 3300049530 | Ga0501314_001080 | Ga0501314_001080_1154_1336 | 57 |
| 340 | 3300049530 | Ga0501314_006685 | Ga0501314_006685_284_466 | 57 |
| 341 | 3300049530 | Ga0501314_012337 | Ga0501314_012337_535_726 | 57 |
| 342 | 3300049530 | Ga0501314_024539 | Ga0501314_024539_26_208 | 57 |
| 343 | 3300049531 | Ga0501315_002433 | Ga0501315_002433_1018_1200 | 57 |
| 344 | 3300049531 | Ga0501315_007565 | Ga0501315_007565_592_777 | 57 |
| 345 | 3300049532 | Ga0501316_002875 | Ga0501316_002875_1153_1338 | 57 |
| 346 | 3300049532 | Ga0501316_005899 | Ga0501316_005899_489_677 | 57 |
| 347 | 3300049532 | Ga0501316_034002 | Ga0501316_034002_362_550 | 57 |
| 348 | 3300049532 | Ga0501316_056157 | Ga0501316_056157_137_322 | 57 |
| 349 | 3300049533 | Ga0501317_017647 | Ga0501317_017647_388_570 | 57 |
| 350 | 3300049534 | Ga0501318_027607 | Ga0501318_027607_181_363 | 57 |
| 351 | 3300049534 | Ga0501318_070882 | Ga0501318_070882_58_240 | 57 |
| 352 | 3300049535 | Ga0501319_014463 | Ga0501319_014463_449_631 | 57 |
| 353 | 3300049536 | Ga0501320_013490 | Ga0501320_013490_107_295 | 57 |
| 354 | 3300049536 | Ga0501320_036926 | Ga0501320_036926_319_501 | 57 |
| 355 | 3300049537 | Ga0501321_024738 | Ga0501321_024738_127_312 | 57 |
| 356 | 3300049538 | Ga0501322_016762 | Ga0501322_016762_61_243 | 57 |
| 357 | 3300049539 | Ga0501323_029573 | Ga0501323_029573_537_722 | 57 |
| 358 | 3300049540 | Ga0501324_004430 | Ga0501324_004430_293_475 | 57 |
| 359 | 3300049551 | Ga0501335_031092 | Ga0501335_031092_351_536 | 57 |
| 360 | 3300049569 | Ga0501032_0244711 | Ga0501032_0244711_339_524 | 57 |
| 361 | 3300049570 | Ga0501033_0032115 | Ga0501033_0032115_2252_2437 | 57 |
| 362 | 3300049571 | Ga0501034_1465083 | Ga0501034_1465083_16_201 | 57 |
| 363 | 3300049572 | Ga0501036_0375199 | Ga0501036_0375199_54_239 | 57 |
| 364 | 3300049573 | Ga0501037_0904395 | Ga0501037_0904395_377_562 | 57 |
| 365 | 3300049574 | Ga0501038_0681881 | Ga0501038_0681881_32_217 | 57 |
| 366 | 3300049578 | Ga0501042_1264981 | Ga0501042_1264981_273_467 | 57 |
| 367 | 3300049579 | Ga0501043_0694290 | Ga0501043_0694290_296_481 | 57 |
| 368 | 3300049581 | Ga0501047_0017972 | Ga0501047_0017972_3691_3876 | 57 |
| 369 | 3300049582 | Ga0501048_0110710 | Ga0501048_0110710_548_733 | 57 |
| 370 | 3300049587 | Ga0501071_0974516 | Ga0501071_0974516_201_383 | 57 |
| 371 | 3300049589 | Ga0501073_1047584 | Ga0501073_1047584_168_350 | 57 |
| 372 | 3300049649 | Ga0501198_000043 | Ga0501198_000043_34526_34708 | 57 |
| 373 | 3300049662 | Ga0501222_000051 | Ga0501222_000051_9463_9645 | 57 |
| 374 | 3300049678 | Ga0501248_035790 | Ga0501248_035790_171_356 | 57 |
| 375 | 3300049684 | Ga0501255_027380 | Ga0501255_027380_478_666 | 57 |
| 376 | 3300049822 | Ga0501035_0011202 | Ga0501035_0011202_2033_2218 | 57 |
| 377 | 3300049823 | Ga0501044_0024898 | Ga0501044_0024898_2270_2455 | 57 |
| 378 | 3300050489 | nmdc:mga03683_111107_c1 | nmdc:mga03683_111107_c1_571_753 | 57 |
| 379 | 3300050489 | nmdc:mga03683_72943_c1 | nmdc:mga03683_72943_c1_943_1125 | 57 |
| 380 | 3300050490 | nmdc:mga03n38_47560_c1 | nmdc:mga03n38_47560_c1_1084_1266 | 57 |
| 381 | 3300050491 | nmdc:mga00v17_12098_c1 | nmdc:mga00v17_12098_c1_3555_3743 | 57 |
| 382 | 3300050493 | nmdc:mga0k408_124759_c1 | nmdc:mga0k408_124759_c1_1020_1202 | 57 |
| 383 | 3300050493 | nmdc:mga0k408_1824_c2 | nmdc:mga0k408_1824_c2_5998_6180 | 57 |
| 384 | 3300050493 | nmdc:mga0k408_190921_c1 | nmdc:mga0k408_190921_c1_269_451 | 57 |
| 385 | 3300050493 | nmdc:mga0k408_23422_c1 | nmdc:mga0k408_23422_c1_434_616 | 57 |
| 386 | 3300050493 | nmdc:mga0k408_248690_c1 | nmdc:mga0k408_248690_c1_96_278 | 57 |
| 387 | 3300050493 | nmdc:mga0k408_409360_c1 | nmdc:mga0k408_409360_c1_428_616 | 57 |
| 388 | 3300050493 | nmdc:mga0k408_87248_c1 | nmdc:mga0k408_87248_c1_1364_1552 | 57 |
| 389 | 3300050493 | nmdc:mga0k408_97182_c1 | nmdc:mga0k408_97182_c1_1417_1605 | 57 |
| 390 | 3300050496 | nmdc:mga07m45_146138_c1 | nmdc:mga07m45_146138_c1_253_435 | 57 |
| 391 | 3300050496 | nmdc:mga07m45_786486_c1 | nmdc:mga07m45_786486_c1_117_305 | 57 |
| 392 | 3300050508 | nmdc:mga09592_280883_c1 | nmdc:mga09592_280883_c1_1137_1322 | 57 |
| 393 | 3300050509 | nmdc:mga0qj67_263575_c1 | nmdc:mga0qj67_263575_c1_881_1066 | 57 |
| 394 | 3300053088 | Ga0500644_0265983 | Ga0500644_0265983_109_291 | 57 |
| 395 | 3300053149 | Ga0500600_0277307 | Ga0500600_0277307_125_331 | 57 |
| 396 | 3300059421 | Ga0590071_162906 | Ga0590071_162906_130_321 | 57 |
| 397 | 3300059505 | Ga0587083_0000314 | Ga0587083_0000314_3618_3803 | 57 |
| 398 | 3300059623 | Ga0587101_000304 | Ga0587101_000304_2882_3067 | 57 |
| 399 | 3300061719 | Ga0466962_0186260 | Ga0466962_0186260_249_434 | 57 |
| 400 | 3300061734 | Ga0530510_1093645 | Ga0530510_1093645_73_258 | 57 |
| 401 | 3300000044 | ARSoilOldRDRAFT_c011456 | ARSoilOldRDRAFT_0114562 | 58 |
| 402 | 3300002070 | JGI24750J21931_1058011 | JGI24750J21931_10580112 | 58 |
| 403 | 3300002239 | JGI24034J26672_10110490 | JGI24034J26672_101104901 | 58 |
| 404 | 3300004798 | Ga0058859_11182523 | Ga0058859_111825231 | 58 |
| 405 | 3300004801 | Ga0058860_12156074 | Ga0058860_121560744 | 58 |
| 406 | 3300004803 | Ga0058862_12655437 | Ga0058862_126554372 | 58 |
| 407 | 3300005295 | Ga0065707_10014633 | Ga0065707_100146331 | 58 |
| 408 | 3300005295 | Ga0065707_10037915 | Ga0065707_100379152 | 58 |
| 409 | 3300005295 | Ga0065707_11006424 | Ga0065707_110064242 | 58 |
| 410 | 3300005329 | Ga0070683_100105419 | Ga0070683_1001054193 | 58 |
| 411 | 3300005330 | Ga0070690_100001051 | Ga0070690_10000105120 | 58 |
| 412 | 3300005330 | Ga0070690_100006945 | Ga0070690_1000069458 | 58 |
| 413 | 3300005330 | Ga0070690_100211418 | Ga0070690_1002114183 | 58 |
| 414 | 3300005334 | Ga0068869_100006377 | Ga0068869_1000063779 | 58 |
| 415 | 3300005335 | Ga0070666_10279744 | Ga0070666_102797442 | 58 |
| 416 | 3300005336 | Ga0070680_100024534 | Ga0070680_1000245348 | 58 |
| 417 | 3300005337 | Ga0070682_100010140 | Ga0070682_1000101409 | 58 |
| 418 | 3300005338 | Ga0068868_100001937 | Ga0068868_10000193720 | 58 |
| 419 | 3300005338 | Ga0068868_100459194 | Ga0068868_1004591941 | 58 |
| 420 | 3300005340 | Ga0070689_100001590 | Ga0070689_1000015909 | 58 |
| 421 | 3300005340 | Ga0070689_101621954 | Ga0070689_1016219542 | 58 |
| 422 | 3300005341 | Ga0070691_10001529 | Ga0070691_100015298 | 58 |
| 423 | 3300005343 | Ga0070687_100000486 | Ga0070687_10000048616 | 58 |
| 424 | 3300005343 | Ga0070687_100030365 | Ga0070687_1000303654 | 58 |
| 425 | 3300005345 | Ga0070692_10002474 | Ga0070692_100024747 | 58 |
| 426 | 3300005345 | Ga0070692_10171877 | Ga0070692_101718772 | 58 |
| 427 | 3300005345 | Ga0070692_10642910 | Ga0070692_106429102 | 58 |
| 428 | 3300005345 | Ga0070692_10813886 | Ga0070692_108138861 | 58 |
| 429 | 3300005353 | Ga0070669_100267967 | Ga0070669_1002679673 | 58 |
| 430 | 3300005354 | Ga0070675_100415889 | Ga0070675_1004158893 | 58 |
| 431 | 3300005354 | Ga0070675_100614389 | Ga0070675_1006143893 | 58 |
| 432 | 3300005355 | Ga0070671_100071598 | Ga0070671_1000715985 | 58 |
| 433 | 3300005356 | Ga0070674_100899720 | Ga0070674_1008997202 | 58 |
| 434 | 3300005364 | Ga0070673_100450317 | Ga0070673_1004503173 | 58 |
| 435 | 3300005364 | Ga0070673_101981655 | Ga0070673_1019816552 | 58 |
| 436 | 3300005365 | Ga0070688_101241677 | Ga0070688_1012416772 | 58 |
| 437 | 3300005365 | Ga0070688_101305742 | Ga0070688_1013057422 | 58 |
| 438 | 3300005406 | Ga0070703_10008050 | Ga0070703_100080505 | 58 |
| 439 | 3300005438 | Ga0070701_10002480 | Ga0070701_100024808 | 58 |
| 440 | 3300005438 | Ga0070701_10022859 | Ga0070701_100228592 | 58 |
| 441 | 3300005439 | Ga0070711_100158878 | Ga0070711_1001588782 | 58 |
| 442 | 3300005440 | Ga0070705_100004302 | Ga0070705_1000043027 | 58 |
| 443 | 3300005440 | Ga0070705_100403726 | Ga0070705_1004037262 | 58 |
| 444 | 3300005441 | Ga0070700_100006166 | Ga0070700_10000616610 | 58 |
| 445 | 3300005441 | Ga0070700_101126730 | Ga0070700_1011267301 | 58 |
| 446 | 3300005444 | Ga0070694_100001615 | Ga0070694_10000161520 | 58 |
| 447 | 3300005444 | Ga0070694_100212985 | Ga0070694_1002129852 | 58 |
| 448 | 3300005444 | Ga0070694_100881568 | Ga0070694_1008815682 | 58 |
| 449 | 3300005444 | Ga0070694_101713698 | Ga0070694_1017136982 | 58 |
| 450 | 3300005456 | Ga0070678_101220504 | Ga0070678_1012205042 | 58 |
| 451 | 3300005458 | Ga0070681_10379200 | Ga0070681_103792001 | 58 |
| 452 | 3300005458 | Ga0070681_10687359 | Ga0070681_106873592 | 58 |
| 453 | 3300005459 | Ga0068867_100002002 | Ga0068867_10000200220 | 58 |
| 454 | 3300005468 | Ga0070707_101411866 | Ga0070707_1014118662 | 58 |
| 455 | 3300005530 | Ga0070679_100073605 | Ga0070679_1000736054 | 58 |
| 456 | 3300005530 | Ga0070679_100951429 | Ga0070679_1009514292 | 58 |
| 457 | 3300005535 | Ga0070684_100788461 | Ga0070684_1007884612 | 58 |
| 458 | 3300005544 | Ga0070686_100008053 | Ga0070686_10000805313 | 58 |
| 459 | 3300005544 | Ga0070686_100008478 | Ga0070686_1000084787 | 58 |
| 460 | 3300005544 | Ga0070686_100975126 | Ga0070686_1009751262 | 58 |
| 461 | 3300005545 | Ga0070695_100002452 | Ga0070695_1000024523 | 58 |
| 462 | 3300005546 | Ga0070696_100002331 | Ga0070696_10000233123 | 58 |
| 463 | 3300005546 | Ga0070696_100006223 | Ga0070696_1000062239 | 58 |
| 464 | 3300005547 | Ga0070693_100000371 | Ga0070693_1000003717 | 58 |
| 465 | 3300005547 | Ga0070693_100156801 | Ga0070693_1001568012 | 58 |
| 466 | 3300005549 | Ga0070704_100003415 | Ga0070704_10000341512 | 58 |
| 467 | 3300005549 | Ga0070704_100029374 | Ga0070704_1000293749 | 58 |
| 468 | 3300005549 | Ga0070704_100141749 | Ga0070704_1001417492 | 58 |
| 469 | 3300005549 | Ga0070704_100538282 | Ga0070704_1005382822 | 58 |
| 470 | 3300005563 | Ga0068855_100025005 | Ga0068855_1000250059 | 58 |
| 471 | 3300005578 | Ga0068854_100044185 | Ga0068854_1000441857 | 58 |
| 472 | 3300005578 | Ga0068854_102011181 | Ga0068854_1020111812 | 58 |
| 473 | 3300005614 | Ga0068856_100020864 | Ga0068856_1000208645 | 58 |
| 474 | 3300005614 | Ga0068856_100246767 | Ga0068856_1002467673 | 58 |
| 475 | 3300005614 | Ga0068856_102605820 | Ga0068856_1026058202 | 58 |
| 476 | 3300005615 | Ga0070702_100021043 | Ga0070702_1000210437 | 58 |
| 477 | 3300005615 | Ga0070702_100906033 | Ga0070702_1009060331 | 58 |
| 478 | 3300005616 | Ga0068852_101153037 | Ga0068852_1011530372 | 58 |
| 479 | 3300005616 | Ga0068852_101159039 | Ga0068852_1011590392 | 58 |
| 480 | 3300005616 | Ga0068852_101714626 | Ga0068852_1017146262 | 58 |
| 481 | 3300005617 | Ga0068859_100011503 | Ga0068859_1000115037 | 58 |
| 482 | 3300005617 | Ga0068859_100021700 | Ga0068859_10002170013 | 58 |
| 483 | 3300005617 | Ga0068859_100158427 | Ga0068859_1001584275 | 58 |
| 484 | 3300005617 | Ga0068859_100177088 | Ga0068859_1001770883 | 58 |
| 485 | 3300005617 | Ga0068859_101947328 | Ga0068859_1019473282 | 58 |
| 486 | 3300005618 | Ga0068864_100127994 | Ga0068864_1001279944 | 58 |
| 487 | 3300005718 | Ga0068866_10000800 | Ga0068866_1000080020 | 58 |
| 488 | 3300005719 | Ga0068861_100001378 | Ga0068861_10000137819 | 58 |
| 489 | 3300005719 | Ga0068861_100107394 | Ga0068861_1001073944 | 58 |
| 490 | 3300005719 | Ga0068861_101270836 | Ga0068861_1012708361 | 58 |
| 491 | 3300005834 | Ga0068851_10971253 | Ga0068851_109712532 | 58 |
| 492 | 3300005840 | Ga0068870_10087184 | Ga0068870_100871843 | 58 |
| 493 | 3300005840 | Ga0068870_10170429 | Ga0068870_101704292 | 58 |
| 494 | 3300005841 | Ga0068863_100117575 | Ga0068863_1001175755 | 58 |
| 495 | 3300005841 | Ga0068863_101629612 | Ga0068863_1016296122 | 58 |
| 496 | 3300005842 | Ga0068858_100003490 | Ga0068858_10000349018 | 58 |
| 497 | 3300005842 | Ga0068858_100081023 | Ga0068858_1000810232 | 58 |
| 498 | 3300005843 | Ga0068860_100017732 | Ga0068860_1000177325 | 58 |
| 499 | 3300005843 | Ga0068860_100351103 | Ga0068860_1003511032 | 58 |
| 500 | 3300005844 | Ga0068862_100006216 | Ga0068862_10000621613 | 58 |
| 501 | 3300005844 | Ga0068862_100304329 | Ga0068862_1003043292 | 58 |
| 502 | 3300005844 | Ga0068862_101822540 | Ga0068862_1018225401 | 58 |
| 503 | 3300005985 | Ga0081539_10000233 | Ga0081539_100002335 | 58 |
| 504 | 3300006058 | Ga0075432_10074382 | Ga0075432_100743822 | 58 |
| 505 | 3300006163 | Ga0070715_10801206 | Ga0070715_108012062 | 58 |
| 506 | 3300006173 | Ga0070716_100158008 | Ga0070716_1001580084 | 58 |
| 507 | 3300006177 | Ga0075362_10134088 | Ga0075362_101340883 | 58 |
| 508 | 3300006237 | Ga0097621_100001348 | Ga0097621_10000134813 | 58 |
| 509 | 3300006237 | Ga0097621_100037976 | Ga0097621_1000379767 | 58 |
| 510 | 3300006358 | Ga0068871_100000763 | Ga0068871_10000076319 | 58 |
| 511 | 3300006358 | Ga0068871_100001793 | Ga0068871_10000179321 | 58 |
| 512 | 3300006358 | Ga0068871_100586171 | Ga0068871_1005861712 | 58 |
| 513 | 3300006844 | Ga0075428_100000047 | Ga0075428_10000004795 | 58 |
| 514 | 3300006844 | Ga0075428_102264332 | Ga0075428_1022643322 | 58 |
| 515 | 3300006846 | Ga0075430_101486354 | Ga0075430_1014863542 | 58 |
| 516 | 3300006847 | Ga0075431_100355207 | Ga0075431_1003552072 | 58 |
| 517 | 3300006852 | Ga0075433_10020651 | Ga0075433_100206513 | 58 |
| 518 | 3300006852 | Ga0075433_10216266 | Ga0075433_102162663 | 58 |
| 519 | 3300006852 | Ga0075433_10949551 | Ga0075433_109495512 | 58 |
| 520 | 3300006871 | Ga0075434_100012054 | Ga0075434_1000120549 | 58 |
| 521 | 3300006871 | Ga0075434_100517439 | Ga0075434_1005174392 | 58 |
| 522 | 3300006880 | Ga0075429_100000047 | Ga0075429_10000004756 | 58 |
| 523 | 3300006881 | Ga0068865_100001223 | Ga0068865_10000122320 | 58 |
| 524 | 3300006914 | Ga0075436_100002331 | Ga0075436_10000233122 | 58 |
| 525 | 3300006914 | Ga0075436_100005646 | Ga0075436_10000564613 | 58 |
| 526 | 3300006931 | Ga0097620_100011503 | Ga0097620_1000115037 | 58 |
| 527 | 3300006931 | Ga0097620_100021700 | Ga0097620_1000217003 | 58 |
| 528 | 3300006931 | Ga0097620_100158439 | Ga0097620_1001584395 | 58 |
| 529 | 3300006931 | Ga0097620_100177092 | Ga0097620_1001770923 | 58 |
| 530 | 3300006931 | Ga0097620_101947557 | Ga0097620_1019475572 | 58 |
| 531 | 3300007076 | Ga0075435_100005357 | Ga0075435_1000053578 | 58 |
| 532 | 3300007076 | Ga0075435_100221707 | Ga0075435_1002217074 | 58 |
| 533 | 3300007076 | Ga0075435_101309385 | Ga0075435_1013093852 | 58 |
| 534 | 3300007265 | Ga0099794_10057533 | Ga0099794_100575333 | 58 |
| 535 | 3300009094 | Ga0111539_10069166 | Ga0111539_100691669 | 58 |
| 536 | 3300009094 | Ga0111539_10150015 | Ga0111539_101500153 | 58 |
| 537 | 3300009094 | Ga0111539_10497859 | Ga0111539_104978592 | 58 |
| 538 | 3300009094 | Ga0111539_10614098 | Ga0111539_106140983 | 58 |
| 539 | 3300009094 | Ga0111539_11073136 | Ga0111539_110731362 | 58 |
| 540 | 3300009098 | Ga0105245_10002556 | Ga0105245_1000255613 | 58 |
| 541 | 3300009147 | Ga0114129_10008888 | Ga0114129_1000888821 | 58 |
| 542 | 3300009147 | Ga0114129_10334228 | Ga0114129_103342282 | 58 |
| 543 | 3300009148 | Ga0105243_10003107 | Ga0105243_1000310720 | 58 |
| 544 | 3300009176 | Ga0105242_10002800 | Ga0105242_100028009 | 58 |
| 545 | 3300009177 | Ga0105248_10910370 | Ga0105248_109103702 | 58 |
| 546 | 3300009177 | Ga0105248_11329146 | Ga0105248_113291462 | 58 |
| 547 | 3300009553 | Ga0105249_10022359 | Ga0105249_100223598 | 58 |
| 548 | 3300009553 | Ga0105249_10432441 | Ga0105249_104324412 | 58 |
| 549 | 3300009553 | Ga0105249_10728482 | Ga0105249_107284821 | 58 |
| 550 | 3300010375 | Ga0105239_11177518 | Ga0105239_111775182 | 58 |
| 551 | 3300011119 | Ga0105246_10121917 | Ga0105246_101219174 | 58 |
| 552 | 3300012498 | Ga0157345_1026061 | Ga0157345_10260612 | 58 |
| 553 | 3300013102 | Ga0157371_10918516 | Ga0157371_109185162 | 58 |
| 554 | 3300013297 | Ga0157378_10007830 | Ga0157378_1000783010 | 58 |
| 555 | 3300013306 | Ga0163162_10617606 | Ga0163162_106176063 | 58 |
| 556 | 3300013307 | Ga0157372_10486829 | Ga0157372_104868293 | 58 |
| 557 | 3300013308 | Ga0157375_10889746 | Ga0157375_108897462 | 58 |
| 558 | 3300014326 | Ga0157380_10024376 | Ga0157380_100243769 | 58 |
| 559 | 3300014326 | Ga0157380_10383528 | Ga0157380_103835284 | 58 |
| 560 | 3300014326 | Ga0157380_12400474 | Ga0157380_124004742 | 58 |
| 561 | 3300014745 | Ga0157377_10044509 | Ga0157377_100445093 | 58 |
| 562 | 3300014968 | Ga0157379_10163599 | Ga0157379_101635993 | 58 |
| 563 | 3300014968 | Ga0157379_11618587 | Ga0157379_116185872 | 58 |
| 564 | 3300014969 | Ga0157376_10008899 | Ga0157376_100088998 | 58 |
| 565 | 3300014969 | Ga0157376_10019067 | Ga0157376_100190677 | 58 |
| 566 | 3300017792 | Ga0163161_11012719 | Ga0163161_110127192 | 58 |
| 567 | 3300025885 | Ga0207653_10008869 | Ga0207653_100088693 | 58 |
| 568 | 3300025898 | Ga0207692_10083260 | Ga0207692_100832602 | 58 |
| 569 | 3300025899 | Ga0207642_10002949 | Ga0207642_100029499 | 58 |
| 570 | 3300025901 | Ga0207688_10017544 | Ga0207688_100175445 | 58 |
| 571 | 3300025903 | Ga0207680_11292106 | Ga0207680_112921062 | 58 |
| 572 | 3300025907 | Ga0207645_10857355 | Ga0207645_108573552 | 58 |
| 573 | 3300025908 | Ga0207643_10005493 | Ga0207643_1000549312 | 58 |
| 574 | 3300025912 | Ga0207707_10300202 | Ga0207707_103002022 | 58 |
| 575 | 3300025912 | Ga0207707_10387605 | Ga0207707_103876052 | 58 |
| 576 | 3300025912 | Ga0207707_11232489 | Ga0207707_112324892 | 58 |
| 577 | 3300025916 | Ga0207663_10310873 | Ga0207663_103108731 | 58 |
| 578 | 3300025917 | Ga0207660_10001979 | Ga0207660_1000197920 | 58 |
| 579 | 3300025917 | Ga0207660_10558601 | Ga0207660_105586012 | 58 |
| 580 | 3300025918 | Ga0207662_10000006 | Ga0207662_1000000613 | 58 |
| 581 | 3300025918 | Ga0207662_10009139 | Ga0207662_100091399 | 58 |
| 582 | 3300025918 | Ga0207662_10547337 | Ga0207662_105473372 | 58 |
| 583 | 3300025921 | Ga0207652_10016184 | Ga0207652_100161849 | 58 |
| 584 | 3300025923 | Ga0207681_10590164 | Ga0207681_105901641 | 58 |
| 585 | 3300025926 | Ga0207659_10357490 | Ga0207659_103574902 | 58 |
| 586 | 3300025926 | Ga0207659_11385894 | Ga0207659_113858942 | 58 |
| 587 | 3300025927 | Ga0207687_10005454 | Ga0207687_1000545411 | 58 |
| 588 | 3300025928 | Ga0207700_10361588 | Ga0207700_103615882 | 58 |
| 589 | 3300025931 | Ga0207644_10021011 | Ga0207644_100210119 | 58 |
| 590 | 3300025934 | Ga0207686_10001285 | Ga0207686_1000128520 | 58 |
| 591 | 3300025935 | Ga0207709_10005880 | Ga0207709_100058803 | 58 |
| 592 | 3300025936 | Ga0207670_10005544 | Ga0207670_100055449 | 58 |
| 593 | 3300025936 | Ga0207670_10183639 | Ga0207670_101836393 | 58 |
| 594 | 3300025938 | Ga0207704_10000913 | Ga0207704_1000091313 | 58 |
| 595 | 3300025939 | Ga0207665_11464318 | Ga0207665_114643182 | 58 |
| 596 | 3300025941 | Ga0207711_10828529 | Ga0207711_108285292 | 58 |
| 597 | 3300025941 | Ga0207711_11222325 | Ga0207711_112223252 | 58 |
| 598 | 3300025942 | Ga0207689_10019913 | Ga0207689_1001991310 | 58 |
| 599 | 3300025944 | Ga0207661_10057404 | Ga0207661_100574043 | 58 |
| 600 | 3300025949 | Ga0207667_10002489 | Ga0207667_100024899 | 58 |
| 601 | 3300025961 | Ga0207712_10002872 | Ga0207712_1000287218 | 58 |
| 602 | 3300025961 | Ga0207712_12011474 | Ga0207712_120114741 | 58 |
| 603 | 3300025981 | Ga0207640_10005155 | Ga0207640_100051559 | 58 |
| 604 | 3300025981 | Ga0207640_11701493 | Ga0207640_117014932 | 58 |
| 605 | 3300025986 | Ga0207658_11381413 | Ga0207658_113814132 | 58 |
| 606 | 3300026023 | Ga0207677_10002702 | Ga0207677_100027023 | 58 |
| 607 | 3300026035 | Ga0207703_10004381 | Ga0207703_1000438112 | 58 |
| 608 | 3300026035 | Ga0207703_10060243 | Ga0207703_100602436 | 58 |
| 609 | 3300026075 | Ga0207708_10010574 | Ga0207708_1001057412 | 58 |
| 610 | 3300026075 | Ga0207708_10049162 | Ga0207708_100491627 | 58 |
| 611 | 3300026075 | Ga0207708_11019692 | Ga0207708_110196922 | 58 |
| 612 | 3300026078 | Ga0207702_10019596 | Ga0207702_100195962 | 58 |
| 613 | 3300026078 | Ga0207702_10333621 | Ga0207702_103336211 | 58 |
| 614 | 3300026088 | Ga0207641_10280061 | Ga0207641_102800612 | 58 |
| 615 | 3300026088 | Ga0207641_11076003 | Ga0207641_110760032 | 58 |
| 616 | 3300026088 | Ga0207641_12325455 | Ga0207641_123254551 | 58 |
| 617 | 3300026088 | Ga0207641_12373667 | Ga0207641_123736672 | 58 |
| 618 | 3300026089 | Ga0207648_10004560 | Ga0207648_1000456010 | 58 |
| 619 | 3300026095 | Ga0207676_10014207 | Ga0207676_100142074 | 58 |
| 620 | 3300026116 | Ga0207674_11680028 | Ga0207674_116800282 | 58 |
| 621 | 3300026118 | Ga0207675_100024184 | Ga0207675_1000241842 | 58 |
| 622 | 3300026118 | Ga0207675_100174415 | Ga0207675_1001744153 | 58 |
| 623 | 3300026121 | Ga0207683_11091757 | Ga0207683_110917571 | 58 |
| 624 | 3300026142 | Ga0207698_10183308 | Ga0207698_101833083 | 58 |
| 625 | 3300026142 | Ga0207698_11561593 | Ga0207698_115615932 | 58 |
| 626 | 3300027360 | Ga0209969_1001632 | Ga0209969_10016323 | 58 |
| 627 | 3300027364 | Ga0209967_1000358 | Ga0209967_100035812 | 58 |
| 628 | 3300027378 | Ga0209981_1002763 | Ga0209981_10027634 | 58 |
| 629 | 3300027395 | Ga0209996_1011883 | Ga0209996_10118831 | 58 |
| 630 | 3300027462 | Ga0210000_1034579 | Ga0210000_10345792 | 58 |
| 631 | 3300027471 | Ga0209995_1001135 | Ga0209995_10011357 | 58 |
| 632 | 3300027526 | Ga0209968_1001973 | Ga0209968_10019736 | 58 |
| 633 | 3300027543 | Ga0209999_1003266 | Ga0209999_10032664 | 58 |
| 634 | 3300027671 | Ga0209588_1269912 | Ga0209588_12699122 | 58 |
| 635 | 3300027695 | Ga0209966_1001758 | Ga0209966_10017583 | 58 |
| 636 | 3300027907 | Ga0207428_10009607 | Ga0207428_100096072 | 58 |
| 637 | 3300027907 | Ga0207428_10081909 | Ga0207428_100819092 | 58 |
| 638 | 3300028380 | Ga0268265_10004065 | Ga0268265_1000406514 | 58 |
| 639 | 3300028380 | Ga0268265_10159132 | Ga0268265_101591324 | 58 |
| 640 | 3300028380 | Ga0268265_10349690 | Ga0268265_103496903 | 58 |
| 641 | 3300028381 | Ga0268264_10003087 | Ga0268264_1000308710 | 58 |
| 642 | 3300028381 | Ga0268264_10325919 | Ga0268264_103259193 | 58 |
| 643 | 3300028794 | Ga0307515_10006150 | Ga0307515_1000615023 | 58 |
| 644 | 3300030522 | Ga0307512_10080686 | Ga0307512_100806863 | 58 |
| 645 | 3300031250 | Ga0265331_10149695 | Ga0265331_101496952 | 58 |
| 646 | 3300031456 | Ga0307513_10005218 | Ga0307513_1000521820 | 58 |
| 647 | 3300031548 | Ga0307408_100383599 | Ga0307408_1003835993 | 58 |
| 648 | 3300031548 | Ga0307408_100421256 | Ga0307408_1004212561 | 58 |
| 649 | 3300031548 | Ga0307408_100809011 | Ga0307408_1008090112 | 58 |
| 650 | 3300031649 | Ga0307514_10000530 | Ga0307514_1000053023 | 58 |
| 651 | 3300031665 | Ga0316575_10000771 | Ga0316575_1000077112 | 58 |
| 652 | 3300031665 | Ga0316575_10028250 | Ga0316575_100282502 | 58 |
| 653 | 3300031665 | Ga0316575_10339941 | Ga0316575_103399412 | 58 |
| 654 | 3300031691 | Ga0316579_10010128 | Ga0316579_100101287 | 58 |
| 655 | 3300031691 | Ga0316579_10010387 | Ga0316579_100103873 | 58 |
| 656 | 3300031727 | Ga0316576_10135201 | Ga0316576_101352013 | 58 |
| 657 | 3300031728 | Ga0316578_10044753 | Ga0316578_100447533 | 58 |
| 658 | 3300031728 | Ga0316578_10055271 | Ga0316578_100552714 | 58 |
| 659 | 3300031731 | Ga0307405_10023807 | Ga0307405_100238076 | 58 |
| 660 | 3300031731 | Ga0307405_11717345 | Ga0307405_117173452 | 58 |
| 661 | 3300031733 | Ga0316577_10033326 | Ga0316577_100333264 | 58 |
| 662 | 3300031733 | Ga0316577_10183925 | Ga0316577_101839253 | 58 |
| 663 | 3300031824 | Ga0307413_11006224 | Ga0307413_110062242 | 58 |
| 664 | 3300031824 | Ga0307413_11944083 | Ga0307413_119440831 | 58 |
| 665 | 3300031852 | Ga0307410_11296513 | Ga0307410_112965132 | 58 |
| 666 | 3300031901 | Ga0307406_11312373 | Ga0307406_113123732 | 58 |
| 667 | 3300031903 | Ga0307407_10567806 | Ga0307407_105678062 | 58 |
| 668 | 3300031903 | Ga0307407_10839262 | Ga0307407_108392622 | 58 |
| 669 | 3300031911 | Ga0307412_12309417 | Ga0307412_123094172 | 58 |
| 670 | 3300032002 | Ga0307416_100402979 | Ga0307416_1004029792 | 58 |
| 671 | 3300032002 | Ga0307416_100688901 | Ga0307416_1006889012 | 58 |
| 672 | 3300032002 | Ga0307416_100773172 | Ga0307416_1007731722 | 58 |
| 673 | 3300032005 | Ga0307411_10924742 | Ga0307411_109247422 | 58 |
| 674 | 3300032005 | Ga0307411_10989813 | Ga0307411_109898131 | 58 |
| 675 | 3300032126 | Ga0307415_102481850 | Ga0307415_1024818502 | 58 |
| 676 | 3300032133 | Ga0316583_10018653 | Ga0316583_100186532 | 58 |
| 677 | 3300032133 | Ga0316583_10022934 | Ga0316583_100229342 | 58 |
| 678 | 3300032137 | Ga0316585_10053551 | Ga0316585_100535512 | 58 |
| 679 | 3300032139 | Ga0316580_10021418 | Ga0316580_100214185 | 58 |
| 680 | 3300032139 | Ga0316580_10051025 | Ga0316580_100510252 | 58 |
| 681 | 3300032168 | Ga0316593_10004609 | Ga0316593_100046091 | 58 |
| 682 | 3300032168 | Ga0316593_10042198 | Ga0316593_100421983 | 58 |
| 683 | 3300032168 | Ga0316593_10223821 | Ga0316593_102238211 | 58 |
| 684 | 3300033180 | Ga0307510_10259489 | Ga0307510_102594892 | 58 |
| 685 | 3300033524 | Ga0316592_1007100 | Ga0316592_10071004 | 58 |
| 686 | 3300033527 | Ga0316586_1000300 | Ga0316586_10003005 | 58 |
| 687 | 3300033529 | Ga0316587_1041763 | Ga0316587_10417632 | 58 |
| 688 | 3300033541 | Ga0316596_1004696 | Ga0316596_10046963 | 58 |
| 689 | 3300034816 | Ga0373930_0029026 | Ga0373930_0029026_427_603 | 58 |
| 690 | 3300034817 | Ga0373948_0010756 | Ga0373948_0010756_769_945 | 58 |
| 691 | 3300034818 | Ga0373950_0012134 | Ga0373950_0012134_198_374 | 58 |
| 692 | 3300034819 | Ga0373958_0048463 | Ga0373958_0048463_433_609 | 58 |
| 693 | 3300034820 | Ga0373959_0109104 | Ga0373959_0109104_91_267 | 58 |
| 694 | 3300035084 | Ga0373928_0009124 | Ga0373928_0009124_95_271 | 58 |
| 695 | 3300035085 | Ga0373929_0089566 | Ga0373929_0089566_530_706 | 58 |
| 696 | 3300035088 | Ga0373940_0139052 | Ga0373940_0139052_125_301 | 58 |
| 697 | 3300035088 | Ga0373940_0203762 | Ga0373940_0203762_291_467 | 58 |
| 698 | 3300035088 | Ga0373940_0328001 | Ga0373940_0328001_42_230 | 58 |
| 699 | 3300035090 | Ga0373949_0022177 | Ga0373949_0022177_360_536 | 58 |
| 700 | 3300035092 | Ga0373952_0046971 | Ga0373952_0046971_114_290 | 58 |
| 701 | 3300035092 | Ga0373952_0078765 | Ga0373952_0078765_86_262 | 58 |
| 702 | 3300035111 | Ga0373923_0147248 | Ga0373923_0147248_497_673 | 58 |
| 703 | 3300035113 | Ga0373936_0077460 | Ga0373936_0077460_278_454 | 58 |
| 704 | 3300035114 | Ga0373939_0031815 | Ga0373939_0031815_1281_1472 | 58 |
| 705 | 3300035114 | Ga0373939_0047314 | Ga0373939_0047314_717_893 | 58 |
| 706 | 3300035114 | Ga0373939_0176349 | Ga0373939_0176349_517_693 | 58 |
| 707 | 3300035115 | Ga0373941_0007557 | Ga0373941_0007557_1220_1396 | 58 |
| 708 | 3300035117 | Ga0373953_0022203 | Ga0373953_0022203_1198_1374 | 58 |
| 709 | 3300035119 | Ga0373956_0053410 | Ga0373956_0053410_1552_1728 | 58 |
| 710 | 3300035120 | Ga0373957_0200461 | Ga0373957_0200461_387_563 | 58 |
| 711 | 3300035121 | Ga0373960_0093774 | Ga0373960_0093774_553_729 | 58 |
| 712 | 3300035121 | Ga0373960_0102246 | Ga0373960_0102246_337_513 | 58 |
| 713 | 3300035121 | Ga0373960_0130507 | Ga0373960_0130507_486_662 | 58 |
| 714 | 3300035172 | Ga0373955_0002904 | Ga0373955_0002904_3258_3434 | 58 |
| 715 | 3300035207 | Ga0373942_0002486 | Ga0373942_0002486_3050_3226 | 58 |
| 716 | 3300035207 | Ga0373942_0257773 | Ga0373942_0257773_133_309 | 58 |
| 717 | 3300035241 | Ga0373961_0298020 | Ga0373961_0298020_298_477 | 58 |
| 718 | 3300035242 | Ga0373962_0024426 | Ga0373962_0024426_1267_1443 | 58 |
| 719 | 3300035242 | Ga0373962_0144698 | Ga0373962_0144698_93_269 | 58 |
| 720 | 3300035410 | Ga0373924_0032565 | Ga0373924_0032565_920_1096 | 58 |
| 721 | 3300035691 | Ga0373931_0048665 | Ga0373931_0048665_138_314 | 58 |
| 722 | 3300035691 | Ga0373931_0051539 | Ga0373931_0051539_1861_2037 | 58 |
| 723 | 3300035691 | Ga0373931_0464538 | Ga0373931_0464538_553_729 | 58 |
| 724 | 3300035692 | Ga0373935_1184415 | Ga0373935_1184415_185_361 | 58 |
| 725 | 3300035724 | Ga0373933_0029527 | Ga0373933_0029527_2438_2614 | 58 |
| 726 | 3300036401 | Ga0373937_0002498 | Ga0373937_0002498_8848_9024 | 58 |
| 727 | 3300036647 | Ga0316582_0012337 | Ga0316582_0012337_2509_2694 | 58 |
| 728 | 3300036647 | Ga0316582_0034187 | Ga0316582_0034187_630_815 | 58 |
| 729 | 3300036647 | Ga0316582_0389217 | Ga0316582_0389217_660_857 | 58 |
| 730 | 3300036712 | Ga0316584_0077596 | Ga0316584_0077596_713_898 | 58 |
| 731 | 3300036712 | Ga0316584_0240898 | Ga0316584_0240898_333_518 | 58 |
| 732 | 3300037068 | Ga0373925_0472249 | Ga0373925_0472249_246_422 | 58 |
| 733 | 3300037588 | Ga0316581_0098634 | Ga0316581_0098634_277_462 | 58 |
| 734 | 3300037853 | Ga0436364_0587970 | Ga0436364_0587970_1173_1364 | 58 |
| 735 | 3300041404 | Ga0439436_0063088 | Ga0439436_0063088_500_676 | 58 |
| 736 | 3300041406 | Ga0439439_0066211 | Ga0439439_0066211_695_871 | 58 |
| 737 | 3300041410 | Ga0439461_0002934 | Ga0439461_0002934_1451_1627 | 58 |
| 738 | 3300041461 | Ga0451805_038163 | Ga0451805_038163_488_676 | 58 |
| 739 | 3300041486 | Ga0451807_1762141 | Ga0451807_1762141_159_335 | 58 |
| 740 | 3300041997 | Ga0439431_0044792 | Ga0439431_0044792_801_977 | 58 |
| 741 | 3300042001 | Ga0439441_031275 | Ga0439441_031275_287_478 | 58 |
| 742 | 3300042013 | Ga0439456_036841 | Ga0439456_036841_865_1041 | 58 |
| 743 | 3300042015 | Ga0439462_0188671 | Ga0439462_0188671_134_310 | 58 |
| 744 | 3300042435 | Ga0439434_0000888 | Ga0439434_0000888_947_1123 | 58 |
| 745 | 3300042436 | Ga0439435_0000151 | Ga0439435_0000151_9077_9253 | 58 |
| 746 | 3300042461 | Ga0439460_0072489 | Ga0439460_0072489_162_338 | 58 |
| 747 | 3300042876 | Ga0451577_0000013 | Ga0451577_0000013_423838_424038 | 58 |
| 748 | 3300042876 | Ga0451577_0081193 | Ga0451577_0081193_644_820 | 58 |
| 749 | 3300042876 | Ga0451577_0286581 | Ga0451577_0286581_619_819 | 58 |
| 750 | 3300042876 | Ga0451577_1055460 | Ga0451577_1055460_406_591 | 58 |
| 751 | 3300042876 | Ga0451577_1456937 | Ga0451577_1456937_280_456 | 58 |
| 752 | 3300044673 | Ga0453683_0000059 | Ga0453683_0000059_60307_60507 | 58 |
| 753 | 3300044673 | Ga0453683_0848729 | Ga0453683_0848729_398_589 | 58 |
| 754 | 3300044706 | Ga0466964_0550720 | Ga0466964_0550720_22_198 | 58 |
| 755 | 3300044712 | Ga0453684_0000585 | Ga0453684_0000585_8796_8996 | 58 |
| 756 | 3300044712 | Ga0453684_0000989 | Ga0453684_0000989_83838_84023 | 58 |
| 757 | 3300044712 | Ga0453684_0348092 | Ga0453684_0348092_234_419 | 58 |
| 758 | 3300044712 | Ga0453684_0799892 | Ga0453684_0799892_705_881 | 58 |
| 759 | 3300044735 | Ga0466968_0087772 | Ga0466968_0087772_496_672 | 58 |
| 760 | 3300044901 | Ga0466960_0432839 | Ga0466960_0432839_201_377 | 58 |
| 761 | 3300045051 | Ga0451576_0000018 | Ga0451576_0000018_126652_126852 | 58 |
| 762 | 3300045051 | Ga0451576_0001791 | Ga0451576_0001791_34888_35064 | 58 |
| 763 | 3300045051 | Ga0451576_0013761 | Ga0451576_0013761_5118_5309 | 58 |
| 764 | 3300045051 | Ga0451576_0430530 | Ga0451576_0430530_432_623 | 58 |
| 765 | 3300045051 | Ga0451576_0439305 | Ga0451576_0439305_1103_1279 | 58 |
| 766 | 3300045051 | Ga0451576_0451212 | Ga0451576_0451212_953_1144 | 58 |
| 767 | 3300045051 | Ga0451576_0694652 | Ga0451576_0694652_114_296 | 58 |
| 768 | 3300045051 | Ga0451576_1317612 | Ga0451576_1317612_238_423 | 58 |
| 769 | 3300045051 | Ga0451576_1904423 | Ga0451576_1904423_134_310 | 58 |
| 770 | 3300045051 | Ga0451576_2050312 | Ga0451576_2050312_157_342 | 58 |
| 771 | 3300045051 | Ga0451576_2672921 | Ga0451576_2672921_170_346 | 58 |
| 772 | 3300045836 | Ga0466958_0307647 | Ga0466958_0307647_393_569 | 58 |
| 773 | 3300045976 | Ga0466967_0016890 | Ga0466967_0016890_1263_1439 | 58 |
| 774 | 3300046454 | Ga0495592_0845073 | Ga0495592_0845073_67_243 | 58 |
| 775 | 3300046530 | Ga0495654_0001400 | Ga0495654_0001400_11007_11192 | 58 |
| 776 | 3300046559 | Ga0495667_0225459 | Ga0495667_0225459_760_936 | 58 |
| 777 | 3300046663 | Ga0495635_0132836 | Ga0495635_0132836_1288_1464 | 58 |
| 778 | 3300047322 | Ga0495680_0056613 | Ga0495680_0056613_2686_2862 | 58 |
| 779 | 3300048909 | Ga0496106_0166754 | Ga0496106_0166754_1429_1605 | 58 |
| 780 | 3300049568 | Ga0501031_0100062 | Ga0501031_0100062_854_1030 | 58 |
| 781 | 3300049575 | Ga0501039_0501708 | Ga0501039_0501708_261_437 | 58 |
| 782 | 3300049575 | Ga0501039_1136843 | Ga0501039_1136843_290_490 | 58 |
| 783 | 3300049577 | Ga0501041_0662843 | Ga0501041_0662843_453_629 | 58 |
| 784 | 3300049577 | Ga0501041_0686090 | Ga0501041_0686090_46_222 | 58 |
| 785 | 3300049583 | Ga0501067_0688056 | Ga0501067_0688056_92_268 | 58 |
| 786 | 3300049585 | Ga0501069_0080728 | Ga0501069_0080728_1423_1614 | 58 |
| 787 | 3300049588 | Ga0501072_0448210 | Ga0501072_0448210_29_205 | 58 |
| 788 | 3300049588 | Ga0501072_0497388 | Ga0501072_0497388_509_685 | 58 |
| 789 | 3300049592 | Ga0501076_1319131 | Ga0501076_1319131_280_471 | 58 |
| 790 | 3300049593 | Ga0501077_0272334 | Ga0501077_0272334_621_797 | 58 |
| 791 | 3300049656 | Ga0501209_159545 | Ga0501209_159545_285_461 | 58 |
| 792 | 3300049670 | Ga0501236_092588 | Ga0501236_092588_204_380 | 58 |
| 793 | 3300049705 | Ga0501225_0066433 | Ga0501225_0066433_197_373 | 58 |
| 794 | 3300049741 | Ga0501079_0274751 | Ga0501079_0274751_24_215 | 58 |
| 795 | 3300049744 | Ga0501083_0498399 | Ga0501083_0498399_424_615 | 58 |
| 796 | 3300049824 | Ga0501045_0383086 | Ga0501045_0383086_409_585 | 58 |
| 797 | 3300050507 | nmdc:mga05p37_275238_c1 | nmdc:mga05p37_275238_c1_1346_1522 | 58 |
| 798 | 3300050507 | nmdc:mga05p37_2800_c1 | nmdc:mga05p37_2800_c1_10763_10939 | 58 |
| 799 | 3300050508 | nmdc:mga09592_1477_c1 | nmdc:mga09592_1477_c1_8160_8336 | 58 |
| 800 | 3300050509 | nmdc:mga0qj67_1020781_c1 | nmdc:mga0qj67_1020781_c1_258_434 | 58 |
| 801 | 3300050510 | nmdc:mga06r32_1458863_c1 | nmdc:mga06r32_1458863_c1_293_502 | 58 |
| 802 | 3300050511 | nmdc:mga08y16_20591_c1 | nmdc:mga08y16_20591_c1_2045_2221 | 58 |
| 803 | 3300050511 | nmdc:mga08y16_4095_c1 | nmdc:mga08y16_4095_c1_3916_4092 | 58 |
| 804 | 3300050511 | nmdc:mga08y16_72548_c1 | nmdc:mga08y16_72548_c1_32_214 | 58 |
| 805 | 3300050511 | nmdc:mga08y16_997814_c1 | nmdc:mga08y16_997814_c1_463_645 | 58 |
| 806 | 3300050512 | nmdc:mga0n895_30950_c1 | nmdc:mga0n895_30950_c1_819_995 | 58 |
| 807 | 3300050512 | nmdc:mga0n895_691979_c1 | nmdc:mga0n895_691979_c1_441_617 | 58 |
| 808 | 3300050513 | nmdc:mga0rr50_1381268_c1 | nmdc:mga0rr50_1381268_c1_169_345 | 58 |
| 809 | 3300050513 | nmdc:mga0rr50_301_c1 | nmdc:mga0rr50_301_c1_1570_1746 | 58 |
| 810 | 3300050514 | nmdc:mga08x19_2636_c1 | nmdc:mga08x19_2636_c1_1295_1471 | 58 |
| 811 | 3300050514 | nmdc:mga08x19_64591_c1 | nmdc:mga08x19_64591_c1_195_371 | 58 |
| 812 | 3300050515 | nmdc:mga0a205_1167027_c1 | nmdc:mga0a205_1167027_c1_280_456 | 58 |
| 813 | 3300050515 | nmdc:mga0a205_217_c1 | nmdc:mga0a205_217_c1_9399_9575 | 58 |
| 814 | 3300050515 | nmdc:mga0a205_285553_c1 | nmdc:mga0a205_285553_c1_832_1023 | 58 |
| 815 | 3300053077 | Ga0495601_0588086 | Ga0495601_0588086_442_618 | 58 |
| 816 | 3300053090 | Ga0500646_0297648 | Ga0500646_0297648_119_304 | 58 |
| 817 | 3300053149 | Ga0500600_0129045 | Ga0500600_0129045_226_441 | 58 |
| 818 | 3300054114 | Ga0501084_0197300 | Ga0501084_0197300_1258_1434 | 58 |
| 819 | 3300060353 | Ga0501082_1060306 | Ga0501082_1060306_243_434 | 58 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5kpw-assembly1.cif.gz_Y | structure of rela bound to ribosome in presence of a/r trna (structure iii) | 0.9891 | 1 | 58 |
| 6enu-assembly1.cif.gz_Z | polyproline-stalled ribosome in the presence of elongation-factor p (ef-p) | 0.9865 | 1 | 58 |
| 8g34-assembly1.cif.gz_Z | time-resolved cryo-em study of the 70s recycling by the hflx:1st intermediate | 0.9857 | 1 | 58 |
| 5hl7-assembly1.cif.gz_W | the crystal structure of the large ribosomal subunit of staphylococcus aureus in complex with lefamulin | 0.9834 | 2 | 58 |
| 7unw-assembly1.cif.gz_2 | pseudomonas aeruginosa 70s ribosome initiation complex bound to if2-gdpcp (structure ii-b) | 0.9825 | 2 | 58 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4wfbW00 | Alpha Beta;2-Layer Sandwich;Ribosomal Protein L30; Chain: A,;Ribosomal protein L30/L7 | 0.9838 | 2 | 58 | 3.30.1390.20 |
| 5hl7W00 | Alpha Beta;2-Layer Sandwich;Ribosomal Protein L30; Chain: A,;Ribosomal protein L30/L7 | 0.9834 | 2 | 58 | 3.30.1390.20 |
| 4tomZ00 | Alpha Beta;2-Layer Sandwich;Ribosomal Protein L30; Chain: A,;Ribosomal protein L30/L7 | 0.9819 | 1 | 58 | 3.30.1390.20 |
| af_B6SIL2_19_102_3.30.1390.20 | Alpha Beta;2-Layer Sandwich;Ribosomal Protein L30; Chain: A,;Ribosomal protein L30/L7 | 0.9816 | 2 | 58 | 3.30.1390.20 |
| af_Q54GH8_53_110_3.30.1390.20 | Alpha Beta;2-Layer Sandwich;Ribosomal Protein L30; Chain: A,;Ribosomal protein L30/L7 | 0.9773 | 4 | 58 | 3.30.1390.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1F4BHL4-F1-model_v4 | Large ribosomal subunit protein uL30 | 1.007 | 3 | 58 |
GO:0003735
GO:0006412 GO:0022625 |
| AF-A0A1C9VJ53-F1-model_v4 | deleted | 1.007 | 3 | 57 |
|
| AF-A0A3B0ZPD2-F1-model_v4 | LSU ribosomal protein L30p (L7e) | 1.007 | 2 | 57 |
GO:0003735
GO:0006412 GO:0022625 |
| AF-B4RT46-F1-model_v4 | Large ribosomal subunit protein uL30 (50S ribosomal protein L30) | 1.007 | 1 | 56 |
GO:0003735
GO:0006412 GO:0022625 |
| AF-A0A5C9C4K1-F1-model_v4 | Multifunctional fusion protein [Includes: Small ribosomal subunit protein uS5; Large ribosomal subunit protein uL30] | 1.006 | 2 | 58 |
GO:0003735
GO:0005737 GO:0006412 GO:0015934 GO:0015935 GO:0019843 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar