F482162

General Info

Members Datasets Scaffolds Average Seq Length
819 431 810 60

Family's Representative Sequence

Representative Sequence 3300005578|Ga0068854_101666333|Ga0068854_1016663332
Length 69
Sequence MTQKQIKVTLVRSPIGTKQSHRDTVRGLGLRRINRSRVLQDTPEVRGMIRKVDYLVTATEVTPADAPQV

Samples

Sample ID Description Type Environment
1 2643221660 Methylibium sp. Root1272 Isolate Unclassified
2 2855730933 Achromobacter sp. HZ28 Isolate Nodule
3 2855767633 Achromobacter sp. HZ34 Isolate Nodule
4 2857542790 Achromobacter sp. R-72367 Isolate Unclassified
5 2881412998 Achromobacter aloeverae AVA-1 Isolate Unclassified
6 2904434214 Robbsia andropogonis 1567 Isolate Rhizosphere
7 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
8 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
9 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
10 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
11 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
12 3300003300 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
13 3300003347 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM Metagenome Rhizosphere
14 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
15 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
16 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
17 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
18 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
19 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
20 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
21 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
22 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
23 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
24 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
25 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
26 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
27 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
28 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
29 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
30 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
31 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
32 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
33 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
34 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
35 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
36 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
37 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
38 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
39 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
40 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
41 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
42 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
43 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
44 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
45 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
46 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
47 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
48 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
49 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
50 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
51 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
52 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
53 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
54 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
55 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
56 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
57 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
58 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
59 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
60 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
61 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
62 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
63 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
64 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
65 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
66 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
67 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
68 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
69 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
70 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
71 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
72 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
73 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
74 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
75 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
76 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
77 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
78 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
79 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
80 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
81 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
82 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
83 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
84 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
85 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
86 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
87 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
88 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
89 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
90 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
91 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
92 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
93 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
94 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
95 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
96 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
97 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
98 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
99 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
100 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
101 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
102 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
103 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
104 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
105 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
106 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
107 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
108 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
109 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
110 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
111 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
112 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
113 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
114 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
115 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
116 3300012503 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R Metagenome Rhizosphere
117 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
118 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
119 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
120 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
121 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
122 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
123 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
124 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
125 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
126 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
127 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
128 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
129 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
130 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
131 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
182 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
183 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
184 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
185 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
186 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
187 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
188 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
189 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
191 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
192 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
193 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
196 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
197 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
198 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
199 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
200 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
201 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
202 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
203 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
204 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
205 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
206 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
207 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
208 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
209 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
210 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
211 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
212 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
213 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
214 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
215 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
216 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
217 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
218 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
219 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
220 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
221 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
222 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
223 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
224 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
225 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
226 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
227 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
228 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
229 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
230 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
231 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
232 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
233 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
234 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
235 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
236 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
237 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
238 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
239 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
240 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
241 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
242 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
243 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
244 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
245 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
246 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
247 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
248 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
249 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
250 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
251 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
252 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
253 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
254 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
255 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
256 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
257 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
258 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
259 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
260 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
261 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
262 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
263 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
264 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
265 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
266 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
267 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
268 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
269 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
270 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
271 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
272 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
273 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
274 3300041461 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT Metatranscriptome Rhizoplane
275 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
276 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
277 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
278 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
279 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
280 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
281 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
282 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
283 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
284 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
285 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
286 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
287 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
288 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
289 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
290 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
291 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
292 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
293 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
294 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
295 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
296 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
297 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
298 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
299 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
300 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
301 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
302 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
303 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
304 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
305 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
306 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
307 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
308 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
309 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
310 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
311 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
312 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
313 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
314 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
315 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
316 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
317 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
318 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
319 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
320 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
321 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
322 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
323 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
324 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
325 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
326 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
327 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
328 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
329 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
330 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
331 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
332 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
333 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
334 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
335 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
336 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
337 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
338 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
339 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
340 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
341 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
342 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
343 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
344 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
345 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
346 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
347 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
348 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
349 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
350 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
351 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
352 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
353 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
354 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
355 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
356 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
357 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
358 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
359 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
360 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
361 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
362 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
363 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
364 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
365 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
366 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
367 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
368 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
369 3300049538 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
370 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
371 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
372 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
373 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
374 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
375 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
376 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
377 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
378 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
379 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
380 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
381 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
382 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
383 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
384 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
385 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
386 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
387 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
388 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
389 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
390 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
391 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
392 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
393 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
394 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
395 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
396 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
397 3300049678 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought Metagenome Rhizosphere
398 3300049684 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control Metagenome Rhizosphere
399 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
400 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
401 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
402 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
403 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
404 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
405 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
406 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
407 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
408 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
409 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
410 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
411 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
412 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
413 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
414 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
415 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
416 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
417 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
418 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
419 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
420 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
421 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
422 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
423 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
424 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
425 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
426 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
427 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
428 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
429 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
430 8048746797 Alcaligenes endophyticus DSM 100498 Isolate Unclassified
431 8055225921 Achromobacter panacis KCTC 42751 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.96
Metatranscriptomes 7.94
Isolates 1.1

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.37
Nodule 0.24
Rhizoplane 0.73
Rhizosphere 89.99
Stem 0
Stem Tuber 0
Unclassified 3.66

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 ARSoilOldRDRAFT_c011456 3300000044 Bacteria 743
2 JGI24750J21931_1058011 3300002070 Unclassified 615
3 JGI24034J26672_10110490 3300002239 Bacteria 525
4 JGI25151J46595_10000457 3300003187 Bacteria 39373
5 Ga0006758J48902_1026783 3300003300 Bacteria 1395
6 JGI26128J50194_1000120 3300003347 Bacteria 3224
7 Ga0058859_11182523 3300004798 Bacteria 771
8 Ga0058860_12156074 3300004801 Bacteria 1492
9 Ga0058862_12655437 3300004803 Bacteria 1020
10 Ga0065707_10014633 3300005295 Bacteria 2787
11 Ga0065707_10037915 3300005295 Bacteria 1017
12 Ga0065707_11006424 3300005295 Bacteria 537
13 Ga0070658_10069230 3300005327 Bacteria 2886
14 Ga0070676_10060920 3300005328 Bacteria 2242
15 Ga0070676_10241894 3300005328 Bacteria 1201
16 Ga0070683_100105419 3300005329 Bacteria 2658
17 Ga0070690_100001051 3300005330 Bacteria 14153
18 Ga0070690_100006945 3300005330 Bacteria 6443
19 Ga0070690_100211418 3300005330 Bacteria 1355
20 Ga0070690_100444857 3300005330 Bacteria 960
21 Ga0070670_100551381 3300005331 Bacteria 1028
22 Ga0070677_10852002 3300005333 Bacteria 524
23 Ga0068869_100006377 3300005334 Bacteria 7477
24 Ga0070666_10279744 3300005335 Bacteria 1186
25 Ga0070666_10808556 3300005335 Bacteria 691
26 Ga0070666_11388189 3300005335 Bacteria 525
27 Ga0070680_100024534 3300005336 Bacteria 4818
28 Ga0070682_100010140 3300005337 Bacteria 5341
29 Ga0068868_100001937 3300005338 Bacteria 14202
30 Ga0068868_100459194 3300005338 Bacteria 1109
31 Ga0070689_100001590 3300005340 Bacteria 14486
32 Ga0070689_101621954 3300005340 Bacteria 588
33 Ga0070691_10001529 3300005341 Bacteria 9951
34 Ga0070691_10960764 3300005341 Bacteria 531
35 Ga0070687_100000486 3300005343 Bacteria 13224
36 Ga0070687_100030365 3300005343 Bacteria 2641
37 Ga0070692_10002474 3300005345 Bacteria 7182
38 Ga0070692_10171877 3300005345 Bacteria 1250
39 Ga0070692_10642910 3300005345 Bacteria 707
40 Ga0070692_10813886 3300005345 Bacteria 639
41 Ga0070668_100410448 3300005347 Bacteria 1158
42 Ga0070668_100563465 3300005347 Bacteria 993
43 Ga0070669_100077546 3300005353 Bacteria 2469
44 Ga0070669_100208195 3300005353 Bacteria 1542
45 Ga0070669_100267967 3300005353 Bacteria 1365
46 Ga0070675_100415889 3300005354 Bacteria 1202
47 Ga0070675_100554307 3300005354 Bacteria 1040
48 Ga0070675_100614389 3300005354 Bacteria 986
49 Ga0070671_100071598 3300005355 Bacteria 2894
50 Ga0070671_100529069 3300005355 Bacteria 1015
51 Ga0070674_100039880 3300005356 Bacteria 3174
52 Ga0070674_100899720 3300005356 Bacteria 771
53 Ga0070673_100055764 3300005364 Bacteria 3115
54 Ga0070673_100450317 3300005364 Bacteria 1158
55 Ga0070673_101981655 3300005364 Bacteria 553
56 Ga0070688_101241677 3300005365 Bacteria 600
57 Ga0070688_101305742 3300005365 Bacteria 586
58 Ga0070667_100308597 3300005367 Bacteria 1426
59 Ga0070667_100337290 3300005367 Bacteria 1363
60 Ga0070703_10008050 3300005406 Bacteria 2963
61 Ga0070701_10002480 3300005438 Bacteria 7125
62 Ga0070701_10022859 3300005438 Bacteria 3003
63 Ga0070711_100158878 3300005439 Bacteria 1712
64 Ga0070705_100004302 3300005440 Bacteria 6941
65 Ga0070705_100403726 3300005440 Bacteria 1013
66 Ga0070700_100006166 3300005441 Bacteria 6387
67 Ga0070700_101126730 3300005441 Bacteria 652
68 Ga0070694_100001615 3300005444 Bacteria 13236
69 Ga0070694_100212985 3300005444 Bacteria 1446
70 Ga0070694_100881568 3300005444 Bacteria 738
71 Ga0070694_101713698 3300005444 Bacteria 535
72 Ga0070663_100121854 3300005455 Bacteria 1971
73 Ga0070678_100199417 3300005456 Bacteria 1651
74 Ga0070678_101220504 3300005456 Bacteria 698
75 Ga0070662_100060375 3300005457 Bacteria 2765
76 Ga0070681_10379200 3300005458 Bacteria 1325
77 Ga0070681_10687359 3300005458 Bacteria 939
78 Ga0068867_100002002 3300005459 Bacteria 14223
79 Ga0068867_100002598 3300005459 Bacteria 12737
80 Ga0070706_101952369 3300005467 Bacteria 532
81 Ga0070707_101411866 3300005468 Bacteria 663
82 Ga0070679_100073605 3300005530 Bacteria 3407
83 Ga0070679_100951429 3300005530 Bacteria 803
84 Ga0070684_100788461 3300005535 Bacteria 888
85 Ga0068853_100646245 3300005539 Bacteria 1007
86 Ga0068853_102139023 3300005539 Bacteria 542
87 Ga0070672_100070334 3300005543 Bacteria 2781
88 Ga0070672_100237690 3300005543 Bacteria 1532
89 Ga0070686_100008053 3300005544 Bacteria 5887
90 Ga0070686_100008478 3300005544 Bacteria 5757
91 Ga0070686_100975126 3300005544 Bacteria 694
92 Ga0070695_100002452 3300005545 Bacteria 10674
93 Ga0070696_100002331 3300005546 Bacteria 12524
94 Ga0070696_100006223 3300005546 Bacteria 7986
95 Ga0070693_100000371 3300005547 Bacteria 20420
96 Ga0070693_100156801 3300005547 Bacteria 1446
97 Ga0070704_100003415 3300005549 Bacteria 9103
98 Ga0070704_100029374 3300005549 Bacteria 3670
99 Ga0070704_100141749 3300005549 Bacteria 1878
100 Ga0070704_100538282 3300005549 Bacteria 1019
101 Ga0068855_100025005 3300005563 Bacteria 7148
102 Ga0068854_100044185 3300005578 Bacteria 3161
103 Ga0068854_100658960 3300005578 Bacteria 899
104 Ga0068854_101666333 3300005578 Bacteria 582
105 Ga0068854_102011181 3300005578 Bacteria 533
106 Ga0068856_100020864 3300005614 Bacteria 6368
107 Ga0068856_100246767 3300005614 Bacteria 1801
108 Ga0068856_102605820 3300005614 Bacteria 512
109 Ga0070702_100021043 3300005615 Bacteria 3426
110 Ga0070702_100906033 3300005615 Bacteria 691
111 Ga0068852_101153037 3300005616 Bacteria 796
112 Ga0068852_101159039 3300005616 Bacteria 794
113 Ga0068852_101714626 3300005616 Bacteria 651
114 Ga0068859_100011503 3300005617 Bacteria 8897
115 Ga0068859_100021700 3300005617 Bacteria 6443
116 Ga0068859_100158427 3300005617 Bacteria 2342
117 Ga0068859_100177088 3300005617 Bacteria 2214
118 Ga0068859_101947328 3300005617 Bacteria 649
119 Ga0068864_100127994 3300005618 Bacteria 2278
120 Ga0068866_10000800 3300005718 Bacteria 14106
121 Ga0068866_10377022 3300005718 Bacteria 909
122 Ga0068861_100001378 3300005719 Bacteria 15253
123 Ga0068861_100016735 3300005719 Bacteria 5194
124 Ga0068861_100107394 3300005719 Bacteria 2231
125 Ga0068861_101270836 3300005719 Bacteria 714
126 Ga0068851_10971253 3300005834 Bacteria 535
127 Ga0068870_10087184 3300005840 Bacteria 1738
128 Ga0068870_10170429 3300005840 Bacteria 1299
129 Ga0068870_11453171 3300005840 Bacteria 504
130 Ga0068863_100117575 3300005841 Bacteria 2533
131 Ga0068863_101629612 3300005841 Bacteria 655
132 Ga0068863_101849770 3300005841 Bacteria 614
133 Ga0068858_100003490 3300005842 Bacteria 15590
134 Ga0068858_100081023 3300005842 Bacteria 3017
135 Ga0068858_100155623 3300005842 Bacteria 2150
136 Ga0068860_100008442 3300005843 Bacteria 10260
137 Ga0068860_100017732 3300005843 Bacteria 6935
138 Ga0068860_100351103 3300005843 Bacteria 1451
139 Ga0068862_100006216 3300005844 Bacteria 9947
140 Ga0068862_100103203 3300005844 Bacteria 2497
141 Ga0068862_100304329 3300005844 Bacteria 1467
142 Ga0068862_101822540 3300005844 Bacteria 618
143 Ga0081455_10719063 3300005937 Bacteria 634
144 Ga0081539_10000233 3300005985 Bacteria 130647
145 Ga0075368_10404726 3300006042 Bacteria 600
146 Ga0075363_100070219 3300006048 Bacteria 1902
147 Ga0075364_10011108 3300006051 Bacteria 5468
148 Ga0075364_10344321 3300006051 Bacteria 1016
149 Ga0075432_10074382 3300006058 Bacteria 1224
150 Ga0070715_10801206 3300006163 Bacteria 572
151 Ga0070716_100158008 3300006173 Bacteria 1466
152 Ga0075362_10023034 3300006177 Bacteria 2630
153 Ga0075362_10075198 3300006177 Bacteria 1549
154 Ga0075362_10096208 3300006177 Bacteria 1380
155 Ga0075362_10134088 3300006177 Bacteria 1180
156 Ga0075362_10276050 3300006177 Bacteria 830
157 Ga0075362_10406739 3300006177 Bacteria 687
158 Ga0075367_10233591 3300006178 Bacteria 1152
159 Ga0075369_10564350 3300006186 Bacteria 544
160 Ga0075366_10005640 3300006195 Bacteria 6787
161 Ga0075366_10085328 3300006195 Bacteria 1888
162 Ga0075366_10123139 3300006195 Bacteria 1563
163 Ga0075366_10193121 3300006195 Bacteria 1237
164 Ga0075366_10295620 3300006195 Bacteria 990
165 Ga0075366_10437397 3300006195 Bacteria 806
166 Ga0075366_10638525 3300006195 Bacteria 660
167 Ga0075366_10661102 3300006195 Bacteria 648
168 Ga0097621_100001348 3300006237 Bacteria 16895
169 Ga0097621_100037976 3300006237 Bacteria 3862
170 Ga0075370_10279859 3300006353 Bacteria 991
171 Ga0075370_10739432 3300006353 Bacteria 599
172 Ga0075370_10749158 3300006353 Bacteria 595
173 Ga0068871_100000763 3300006358 Bacteria 21687
174 Ga0068871_100001793 3300006358 Bacteria 14486
175 Ga0068871_100586171 3300006358 Bacteria 1013
176 Ga0075428_100000047 3300006844 Bacteria 96882
177 Ga0075428_101335042 3300006844 Bacteria 754
178 Ga0075428_102264332 3300006844 Bacteria 560
179 Ga0075430_100211888 3300006846 Bacteria 1607
180 Ga0075430_101486354 3300006846 Bacteria 557
181 Ga0075431_100355207 3300006847 Bacteria 1473
182 Ga0075433_10020651 3300006852 Bacteria 5511
183 Ga0075433_10216266 3300006852 Bacteria 1703
184 Ga0075433_10949551 3300006852 Bacteria 749
185 Ga0075434_100012054 3300006871 Bacteria 8182
186 Ga0075434_100517439 3300006871 Bacteria 1214
187 Ga0075429_100000047 3300006880 Bacteria 56773
188 Ga0075429_100136853 3300006880 Bacteria 2144
189 Ga0068865_100001223 3300006881 Bacteria 14933
190 Ga0068865_100004060 3300006881 Bacteria 8794
191 Ga0075436_100002331 3300006914 Bacteria 13096
192 Ga0075436_100005646 3300006914 Bacteria 8587
193 Ga0097620_100011503 3300006931 Bacteria 8897
194 Ga0097620_100021700 3300006931 Bacteria 6443
195 Ga0097620_100158439 3300006931 Bacteria 2342
196 Ga0097620_100177092 3300006931 Bacteria 2214
197 Ga0097620_101947557 3300006931 Bacteria 649
198 Ga0075435_100005357 3300007076 Bacteria 8945
199 Ga0075435_100221707 3300007076 Bacteria 1606
200 Ga0075435_101309385 3300007076 Bacteria 635
201 Ga0099794_10057533 3300007265 Bacteria 1884
202 Ga0111539_10069166 3300009094 Bacteria 4169
203 Ga0111539_10150015 3300009094 Bacteria 2729
204 Ga0111539_10497859 3300009094 Bacteria 1419
205 Ga0111539_10614098 3300009094 Bacteria 1266
206 Ga0111539_11073136 3300009094 Bacteria 936
207 Ga0111539_12395326 3300009094 Bacteria 612
208 Ga0105245_10002556 3300009098 Bacteria 16384
209 Ga0114129_10008888 3300009147 Bacteria 14322
210 Ga0114129_10334228 3300009147 Bacteria 2011
211 Ga0105243_10003107 3300009148 Bacteria 13657
212 Ga0105243_10158093 3300009148 Bacteria 1951
213 Ga0105242_10002800 3300009176 Bacteria 13659
214 Ga0105242_10924217 3300009176 Bacteria 874
215 Ga0105248_10893186 3300009177 Bacteria 1003
216 Ga0105248_10910370 3300009177 Bacteria 993
217 Ga0105248_11329146 3300009177 Bacteria 813
218 Ga0105237_11829334 3300009545 Bacteria 615
219 Ga0105238_12583875 3300009551 Bacteria 544
220 Ga0105249_10022359 3300009553 Bacteria 5664
221 Ga0105249_10284435 3300009553 Bacteria 1653
222 Ga0105249_10432441 3300009553 Bacteria 1352
223 Ga0105249_10728482 3300009553 Bacteria 1053
224 Ga0105239_11177518 3300010375 Bacteria 883
225 Ga0105246_10121917 3300011119 Bacteria 1933
226 Ga0105246_10198792 3300011119 Bacteria 1557
227 Ga0157345_1026061 3300012498 Bacteria 627
228 Ga0157313_1018748 3300012503 Bacteria 684
229 Ga0157371_10918516 3300013102 Bacteria 664
230 Ga0157378_10007830 3300013297 Bacteria 9326
231 Ga0157378_10008661 3300013297 Bacteria 8856
232 Ga0163162_10004148 3300013306 Bacteria 13915
233 Ga0163162_10617606 3300013306 Bacteria 1209
234 Ga0157372_10486829 3300013307 Bacteria 1438
235 Ga0157375_10041626 3300013308 Bacteria 4438
236 Ga0157375_10889746 3300013308 Bacteria 1035
237 Ga0163163_11000923 3300014325 Bacteria 899
238 Ga0157380_10024376 3300014326 Bacteria 4579
239 Ga0157380_10383528 3300014326 Bacteria 1327
240 Ga0157380_12400474 3300014326 Bacteria 592
241 Ga0157377_10044509 3300014745 Bacteria 2475
242 Ga0157379_10069525 3300014968 Bacteria 3149
243 Ga0157379_10163599 3300014968 Bacteria 2008
244 Ga0157379_11618587 3300014968 Bacteria 633
245 Ga0157376_10008899 3300014969 Bacteria 7268
246 Ga0157376_10019067 3300014969 Bacteria 5277
247 Ga0163161_10021239 3300017792 Bacteria 4564
248 Ga0163161_10653042 3300017792 Bacteria 872
249 Ga0163161_10689708 3300017792 Bacteria 849
250 Ga0163161_11012719 3300017792 Bacteria 710
251 Ga0213872_10039057 3300021361 Bacteria 2166
252 Ga0209025_1000039 3300025294 Bacteria 377396
253 Ga0209564_1058966 3300025295 Bacteria 874
254 Ga0207697_10203172 3300025315 Bacteria 872
255 Ga0207653_10008869 3300025885 Bacteria 3136
256 Ga0207682_10570910 3300025893 Bacteria 534
257 Ga0207692_10083260 3300025898 Bacteria 1716
258 Ga0207642_10002949 3300025899 Bacteria 5327
259 Ga0207642_10018748 3300025899 Bacteria 2663
260 Ga0207688_10017544 3300025901 Bacteria 3891
261 Ga0207688_10689152 3300025901 Bacteria 646
262 Ga0207680_10281450 3300025903 Bacteria 1155
263 Ga0207680_11292106 3300025903 Bacteria 519
264 Ga0207645_10139908 3300025907 Bacteria 1577
265 Ga0207645_10857355 3300025907 Bacteria 617
266 Ga0207643_10005493 3300025908 Bacteria 6776
267 Ga0207705_10374636 3300025909 Bacteria 1099
268 Ga0207707_10300202 3300025912 Bacteria 1389
269 Ga0207707_10387605 3300025912 Bacteria 1201
270 Ga0207707_11232489 3300025912 Bacteria 604
271 Ga0207663_10310873 3300025916 Bacteria 1181
272 Ga0207660_10001979 3300025917 Bacteria 13656
273 Ga0207660_10558601 3300025917 Bacteria 931
274 Ga0207662_10000006 3300025918 Bacteria 105457
275 Ga0207662_10009139 3300025918 Bacteria 5448
276 Ga0207662_10547337 3300025918 Bacteria 801
277 Ga0207652_10016184 3300025921 Bacteria 6084
278 Ga0207681_10256446 3300025923 Bacteria 1367
279 Ga0207681_10590164 3300025923 Bacteria 917
280 Ga0207659_10339805 3300025926 Bacteria 1243
281 Ga0207659_10357490 3300025926 Bacteria 1213
282 Ga0207659_11385894 3300025926 Bacteria 603
283 Ga0207687_10005454 3300025927 Bacteria 8413
284 Ga0207700_10361588 3300025928 Bacteria 1266
285 Ga0207644_10021011 3300025931 Bacteria 4445
286 Ga0207644_10395553 3300025931 Bacteria 1129
287 Ga0207644_11658297 3300025931 Bacteria 536
288 Ga0207706_10254171 3300025933 Bacteria 1534
289 Ga0207686_10001285 3300025934 Bacteria 14428
290 Ga0207686_10725505 3300025934 Bacteria 792
291 Ga0207709_10005880 3300025935 Bacteria 6927
292 Ga0207709_10228947 3300025935 Bacteria 1345
293 Ga0207709_11048595 3300025935 Bacteria 668
294 Ga0207670_10005544 3300025936 Bacteria 6937
295 Ga0207670_10183639 3300025936 Bacteria 1577
296 Ga0207669_10027395 3300025937 Bacteria 3119
297 Ga0207704_10000913 3300025938 Bacteria 13073
298 Ga0207704_10006606 3300025938 Bacteria 5426
299 Ga0207704_10252372 3300025938 Bacteria 1325
300 Ga0207665_11464318 3300025939 Bacteria 543
301 Ga0207691_10119614 3300025940 Bacteria 2336
302 Ga0207691_10154910 3300025940 Bacteria 2013
303 Ga0207691_10304462 3300025940 Bacteria 1369
304 Ga0207711_10719917 3300025941 Bacteria 931
305 Ga0207711_10828529 3300025941 Bacteria 861
306 Ga0207711_11222325 3300025941 Bacteria 693
307 Ga0207689_10019913 3300025942 Bacteria 5651
308 Ga0207689_11751455 3300025942 Bacteria 514
309 Ga0207661_10057404 3300025944 Bacteria 3130
310 Ga0207667_10002489 3300025949 Bacteria 22959
311 Ga0207651_10059456 3300025960 Bacteria 2648
312 Ga0207712_10002872 3300025961 Bacteria 11017
313 Ga0207712_10070429 3300025961 Bacteria 2512
314 Ga0207712_10492500 3300025961 Bacteria 1047
315 Ga0207712_12011474 3300025961 Bacteria 517
316 Ga0207668_10181279 3300025972 Bacteria 1661
317 Ga0207668_10451257 3300025972 Bacteria 1097
318 Ga0207640_10005155 3300025981 Bacteria 7105
319 Ga0207640_11701493 3300025981 Bacteria 569
320 Ga0207658_10165595 3300025986 Bacteria 1816
321 Ga0207658_11381413 3300025986 Bacteria 644
322 Ga0207677_10002702 3300026023 Bacteria 9350
323 Ga0207703_10004381 3300026035 Bacteria 11604
324 Ga0207703_10027342 3300026035 Bacteria 4492
325 Ga0207703_10060243 3300026035 Bacteria 3103
326 Ga0207639_10092277 3300026041 Bacteria 2427
327 Ga0207678_10097661 3300026067 Bacteria 2510
328 Ga0207708_10010574 3300026075 Bacteria 6852
329 Ga0207708_10049162 3300026075 Bacteria 3210
330 Ga0207708_11019692 3300026075 Bacteria 720
331 Ga0207702_10019596 3300026078 Bacteria 5598
332 Ga0207702_10333621 3300026078 Bacteria 1447
333 Ga0207641_10280061 3300026088 Bacteria 1568
334 Ga0207641_10432785 3300026088 Bacteria 1269
335 Ga0207641_11076003 3300026088 Bacteria 802
336 Ga0207641_12325455 3300026088 Bacteria 535
337 Ga0207641_12373667 3300026088 Bacteria 529
338 Ga0207648_10004560 3300026089 Bacteria 14202
339 Ga0207648_10005939 3300026089 Bacteria 12211
340 Ga0207648_10186006 3300026089 Bacteria 1840
341 Ga0207648_10551344 3300026089 Bacteria 1059
342 Ga0207676_10014207 3300026095 Bacteria 5721
343 Ga0207674_11680028 3300026116 Bacteria 603
344 Ga0207675_100006663 3300026118 Bacteria 10927
345 Ga0207675_100024184 3300026118 Bacteria 5648
346 Ga0207675_100174415 3300026118 Bacteria 2057
347 Ga0207683_11091757 3300026121 Bacteria 740
348 Ga0207698_10183308 3300026142 Bacteria 1857
349 Ga0207698_11561593 3300026142 Bacteria 675
350 Ga0207698_11587902 3300026142 Bacteria 670
351 Ga0209969_1001632 3300027360 Bacteria 3101
352 Ga0209969_1047307 3300027360 Bacteria 673
353 Ga0209967_1000358 3300027364 Bacteria 6044
354 Ga0209981_1002763 3300027378 Bacteria 2251
355 Ga0209981_1003413 3300027378 Bacteria 2063
356 Ga0209996_1000729 3300027395 Bacteria 3938
357 Ga0209996_1011883 3300027395 Bacteria 1167
358 Ga0210000_1034579 3300027462 Bacteria 795
359 Ga0209995_1000242 3300027471 Bacteria 8706
360 Ga0209995_1001135 3300027471 Bacteria 4092
361 Ga0209968_1000130 3300027526 Bacteria 13315
362 Ga0209968_1001973 3300027526 Bacteria 3121
363 Ga0209968_1025750 3300027526 Bacteria 970
364 Ga0209999_1003266 3300027543 Bacteria 2893
365 Ga0209999_1007636 3300027543 Bacteria 1945
366 Ga0209588_1269912 3300027671 Bacteria 516
367 Ga0209966_1000117 3300027695 Bacteria 35145
368 Ga0209966_1001758 3300027695 Bacteria 3668
369 Ga0209998_10003290 3300027717 Bacteria 3551
370 Ga0207428_10009607 3300027907 Bacteria 8666
371 Ga0207428_10081909 3300027907 Bacteria 2519
372 Ga0268265_10004065 3300028380 Bacteria 10284
373 Ga0268265_10029280 3300028380 Bacteria 3951
374 Ga0268265_10158583 3300028380 Bacteria 1918
375 Ga0268265_10159132 3300028380 Bacteria 1916
376 Ga0268265_10349690 3300028380 Bacteria 1349
377 Ga0268265_11354509 3300028380 Bacteria 713
378 Ga0268264_10002318 3300028381 Bacteria 16843
379 Ga0268264_10003087 3300028381 Bacteria 14417
380 Ga0268264_10325919 3300028381 Bacteria 1454
381 Ga0307517_10547982 3300028786 Bacteria 579
382 Ga0307515_10000096 3300028794 Bacteria 206366
383 Ga0307515_10006150 3300028794 Bacteria 24126
384 Ga0307515_10012540 3300028794 Bacteria 15942
385 Ga0307515_10119204 3300028794 Bacteria 3004
386 Ga0307515_10124094 3300028794 Bacteria 2899
387 Ga0307515_10276308 3300028794 Bacteria 1393
388 Ga0265324_10017152 3300029957 Bacteria 2635
389 Ga0307512_10080686 3300030522 Bacteria 2340
390 Ga0265331_10149695 3300031250 Bacteria 1060
391 Ga0265327_10028075 3300031251 Bacteria 3226
392 Ga0265327_10299265 3300031251 Bacteria 708
393 Ga0265316_10000201 3300031344 Bacteria 69415
394 Ga0307513_10004080 3300031456 Bacteria 19563
395 Ga0307513_10005218 3300031456 Bacteria 17209
396 Ga0307513_10099285 3300031456 Bacteria 2940
397 Ga0307408_100013705 3300031548 Bacteria 5383
398 Ga0307408_100198260 3300031548 Bacteria 1623
399 Ga0307408_100383599 3300031548 Bacteria 1202
400 Ga0307408_100421256 3300031548 Bacteria 1151
401 Ga0307408_100559458 3300031548 Bacteria 1010
402 Ga0307408_100809011 3300031548 Bacteria 851
403 Ga0307514_10000530 3300031649 Bacteria 74660
404 Ga0316575_10000771 3300031665 Bacteria 9685
405 Ga0316575_10028250 3300031665 Bacteria 2186
406 Ga0316575_10339941 3300031665 Bacteria 638
407 Ga0316579_10010128 3300031691 Bacteria 3978
408 Ga0316579_10010387 3300031691 Bacteria 3935
409 Ga0316576_10135201 3300031727 Bacteria 1855
410 Ga0316578_10044753 3300031728 Bacteria 2575
411 Ga0316578_10055271 3300031728 Bacteria 2329
412 Ga0307516_10026535 3300031730 Bacteria 5881
413 Ga0307405_10023807 3300031731 Bacteria 3487
414 Ga0307405_10996488 3300031731 Bacteria 714
415 Ga0307405_10999450 3300031731 Bacteria 714
416 Ga0307405_11717345 3300031731 Bacteria 556
417 Ga0316577_10033326 3300031733 Bacteria 2877
418 Ga0316577_10183925 3300031733 Bacteria 1180
419 Ga0307413_10869981 3300031824 Bacteria 763
420 Ga0307413_11006224 3300031824 Bacteria 715
421 Ga0307413_11944083 3300031824 Bacteria 529
422 Ga0307410_11296513 3300031852 Bacteria 637
423 Ga0307406_10186243 3300031901 Bacteria 1516
424 Ga0307406_10819345 3300031901 Bacteria 787
425 Ga0307406_11312373 3300031901 Bacteria 632
426 Ga0307406_11867127 3300031901 Bacteria 535
427 Ga0307407_10567806 3300031903 Bacteria 841
428 Ga0307407_10839262 3300031903 Bacteria 701
429 Ga0307407_10923156 3300031903 Bacteria 671
430 Ga0307412_10555595 3300031911 Bacteria 965
431 Ga0307412_11556169 3300031911 Bacteria 603
432 Ga0307412_11614402 3300031911 Bacteria 592
433 Ga0307412_11837666 3300031911 Bacteria 558
434 Ga0307412_11962916 3300031911 Bacteria 541
435 Ga0307412_12102148 3300031911 Bacteria 524
436 Ga0307412_12309417 3300031911 Bacteria 502
437 Ga0307409_101808537 3300031995 Bacteria 640
438 Ga0307416_100164217 3300032002 Bacteria 2057
439 Ga0307416_100303075 3300032002 Bacteria 1589
440 Ga0307416_100402979 3300032002 Bacteria 1406
441 Ga0307416_100688901 3300032002 Bacteria 1110
442 Ga0307416_100773172 3300032002 Bacteria 1054
443 Ga0307416_101406681 3300032002 Bacteria 803
444 Ga0307416_102666251 3300032002 Bacteria 597
445 Ga0307416_103483122 3300032002 Bacteria 527
446 Ga0307414_10291090 3300032004 Bacteria 1377
447 Ga0307414_10649692 3300032004 Bacteria 951
448 Ga0307411_10211556 3300032005 Bacteria 1498
449 Ga0307411_10924742 3300032005 Bacteria 776
450 Ga0307411_10989813 3300032005 Bacteria 752
451 Ga0307411_11079767 3300032005 Bacteria 722
452 Ga0307415_101600920 3300032126 Bacteria 626
453 Ga0307415_102481850 3300032126 Bacteria 510
454 Ga0316583_10002317 3300032133 Bacteria 6567
455 Ga0316583_10018653 3300032133 Bacteria 2491
456 Ga0316583_10022934 3300032133 Bacteria 2232
457 Ga0316585_10053551 3300032137 Bacteria 1297
458 Ga0316580_10021418 3300032139 Bacteria 1992
459 Ga0316580_10051025 3300032139 Bacteria 1275
460 Ga0316593_10004609 3300032168 Bacteria 3555
461 Ga0316593_10042198 3300032168 Bacteria 1521
462 Ga0316593_10223821 3300032168 Bacteria 699
463 Ga0307510_10259489 3300033180 Bacteria 1220
464 Ga0316592_1007100 3300033524 Bacteria 2177
465 Ga0316586_1000300 3300033527 Bacteria 4509
466 Ga0316587_1041763 3300033529 Bacteria 829
467 Ga0316596_1004696 3300033541 Bacteria 3082
468 Ga0373930_0029026 3300034816 Bacteria 1128
469 Ga0373948_0010756 3300034817 Bacteria 1603
470 Ga0373950_0012134 3300034818 Bacteria 1419
471 Ga0373958_0048463 3300034819 Bacteria 891
472 Ga0373959_0109104 3300034820 Bacteria 666
473 Ga0373938_0055891 3300034957 Bacteria 912
474 Ga0373928_0009124 3300035084 Bacteria 1935
475 Ga0373929_0089566 3300035085 Bacteria 761
476 Ga0373940_0139052 3300035088 Bacteria 766
477 Ga0373940_0203762 3300035088 Bacteria 651
478 Ga0373940_0328001 3300035088 Bacteria 533
479 Ga0373949_0022177 3300035090 Bacteria 1462
480 Ga0373952_0046971 3300035092 Bacteria 1016
481 Ga0373952_0078765 3300035092 Bacteria 837
482 Ga0373923_0147248 3300035111 Bacteria 1067
483 Ga0373936_0077460 3300035113 Bacteria 1379
484 Ga0373939_0031815 3300035114 Bacteria 1528
485 Ga0373939_0047314 3300035114 Bacteria 1320
486 Ga0373939_0176349 3300035114 Bacteria 794
487 Ga0373941_0007557 3300035115 Bacteria 2662
488 Ga0373953_0022203 3300035117 Bacteria 2391
489 Ga0373956_0053410 3300035119 Bacteria 1819
490 Ga0373957_0200461 3300035120 Bacteria 831
491 Ga0373960_0093774 3300035121 Bacteria 963
492 Ga0373960_0102246 3300035121 Bacteria 930
493 Ga0373960_0130507 3300035121 Bacteria 842
494 Ga0373943_0283592 3300035170 Bacteria 937
495 Ga0373955_0002904 3300035172 Bacteria 7521
496 Ga0373955_0996417 3300035172 Bacteria 516
497 Ga0373942_0002486 3300035207 Bacteria 4471
498 Ga0373942_0257773 3300035207 Bacteria 594
499 Ga0373961_0298020 3300035241 Bacteria 596
500 Ga0373962_0024426 3300035242 Bacteria 1616
501 Ga0373962_0144698 3300035242 Bacteria 774
502 Ga0373924_0032565 3300035410 Bacteria 2100
503 Ga0373931_0002669 3300035691 Bacteria 7930
504 Ga0373931_0048665 3300035691 Bacteria 2248
505 Ga0373931_0051539 3300035691 Bacteria 2192
506 Ga0373931_0464538 3300035691 Bacteria 811
507 Ga0373935_1184415 3300035692 Bacteria 569
508 Ga0373927_0090861 3300035695 Bacteria 1983
509 Ga0373933_0029527 3300035724 Bacteria 3171
510 Ga0373947_0233084 3300035725 Bacteria 1213
511 Ga0373937_0002498 3300036401 Bacteria 15273
512 Ga0316582_0012337 3300036647 Bacteria 4764
513 Ga0316582_0034187 3300036647 Bacteria 3128
514 Ga0316582_0389217 3300036647 Bacteria 960
515 Ga0316584_0077596 3300036712 Bacteria 2488
516 Ga0316584_0240898 3300036712 Bacteria 1323
517 Ga0373925_0087096 3300037068 Bacteria 2383
518 Ga0373925_0472249 3300037068 Bacteria 1028
519 Ga0373925_1538293 3300037068 Bacteria 544
520 Ga0395905_0797396 3300037471 Bacteria 847
521 Ga0316581_0098634 3300037588 Bacteria 900
522 Ga0436364_0587970 3300037853 Bacteria 2503
523 Ga0436361_0482102 3300039447 Bacteria 1639
524 Ga0439436_0063088 3300041404 Bacteria 1036
525 Ga0439439_0066211 3300041406 Bacteria 964
526 Ga0439461_0002934 3300041410 Bacteria 2769
527 Ga0439461_0007483 3300041410 Bacteria 1936
528 Ga0439465_0093075 3300041413 Bacteria 1033
529 Ga0439465_0255073 3300041413 Bacteria 649
530 Ga0451797_1450145 3300041453 Bacteria 1063
531 Ga0451805_038163 3300041461 Bacteria 728
532 Ga0451807_1762141 3300041486 Bacteria 668
533 Ga0451833_1307539 3300041491 Bacteria 519
534 Ga0451837_1027358 3300041494 Bacteria 612
535 Ga0451843_0842857 3300041509 Bacteria 542
536 Ga0439431_0044792 3300041997 Bacteria 1135
537 Ga0439431_0048855 3300041997 Bacteria 1093
538 Ga0439431_0094685 3300041997 Bacteria 816
539 Ga0439437_010893 3300042000 Bacteria 1038
540 Ga0439437_026527 3300042000 Bacteria 717
541 Ga0439441_031275 3300042001 Bacteria 1033
542 Ga0439445_0055209 3300042004 Bacteria 1078
543 Ga0439445_0117097 3300042004 Bacteria 763
544 Ga0439432_052729 3300042006 Bacteria 1266
545 Ga0439449_0079765 3300042007 Bacteria 1207
546 Ga0439449_0197990 3300042007 Bacteria 752
547 Ga0439452_105424 3300042010 Bacteria 604
548 Ga0439455_0200498 3300042012 Bacteria 578
549 Ga0439456_036841 3300042013 Bacteria 1056
550 Ga0439457_178460 3300042014 Bacteria 518
551 Ga0439462_0133044 3300042015 Bacteria 695
552 Ga0439462_0174825 3300042015 Bacteria 608
553 Ga0439462_0188671 3300042015 Bacteria 585
554 Ga0450912_009544 3300042116 Bacteria 820
555 Ga0450888_006168 3300042126 Bacteria 1298
556 Ga0450890_015249 3300042127 Bacteria 1011
557 Ga0450891_019880 3300042129 Bacteria 655
558 Ga0450892_026137 3300042130 Bacteria 595
559 Ga0450896_012830 3300042133 Bacteria 1188
560 Ga0450898_025958 3300042134 Bacteria 1053
561 Ga0450898_155158 3300042134 Bacteria 502
562 Ga0450899_008179 3300042135 Bacteria 1144
563 Ga0450889_034540 3300042144 Bacteria 599
564 Ga0439446_0050577 3300042156 Bacteria 1240
565 Ga0439446_0139347 3300042156 Bacteria 791
566 Ga0439446_0332653 3300042156 Bacteria 538
567 Ga0439434_0000888 3300042435 Bacteria 8613
568 Ga0439434_0027368 3300042435 Bacteria 1723
569 Ga0439435_0000151 3300042436 Bacteria 9438
570 Ga0439460_0072489 3300042461 Bacteria 1069
571 Ga0439460_0117851 3300042461 Bacteria 866
572 Ga0450893_0032704 3300042532 Bacteria 931
573 Ga0451577_0000013 3300042876 Bacteria 550689
574 Ga0451577_0003495 3300042876 Bacteria 17459
575 Ga0451577_0069675 3300042876 Bacteria 3136
576 Ga0451577_0081193 3300042876 Bacteria 2891
577 Ga0451577_0213403 3300042876 Bacteria 1744
578 Ga0451577_0286581 3300042876 Bacteria 1492
579 Ga0451577_0352048 3300042876 Bacteria 1336
580 Ga0451577_0749480 3300042876 Bacteria 883
581 Ga0451577_1055460 3300042876 Bacteria 728
582 Ga0451577_1456937 3300042876 Bacteria 606
583 Ga0466969_0000018 3300044656 Bacteria 102911
584 Ga0466969_0001561 3300044656 Bacteria 12286
585 Ga0466972_0008302 3300044658 Bacteria 5206
586 Ga0466972_0040259 3300044658 Bacteria 2277
587 Ga0453683_0000059 3300044673 Bacteria 187158
588 Ga0453683_0211230 3300044673 Bacteria 1233
589 Ga0453683_0228165 3300044673 Bacteria 1185
590 Ga0453683_0848729 3300044673 Bacteria 602
591 Ga0466965_0021276 3300044683 Bacteria 3120
592 Ga0466965_0071050 3300044683 Bacteria 1750
593 Ga0466966_0009766 3300044684 Bacteria 6359
594 Ga0466966_0010593 3300044684 Bacteria 6129
595 Ga0466961_0004306 3300044693 Bacteria 8909
596 Ga0466961_0051858 3300044693 Bacteria 2619
597 Ga0466964_0272744 3300044706 Bacteria 842
598 Ga0466964_0550720 3300044706 Bacteria 626
599 Ga0453684_0000585 3300044712 Bacteria 135647
600 Ga0453684_0000989 3300044712 Bacteria 92793
601 Ga0453684_0242050 3300044712 Bacteria 2076
602 Ga0453684_0294967 3300044712 Bacteria 1845
603 Ga0453684_0348092 3300044712 Bacteria 1672
604 Ga0453684_0378031 3300044712 Bacteria 1591
605 Ga0453684_0799892 3300044712 Bacteria 1017
606 Ga0453684_0968886 3300044712 Bacteria 906
607 Ga0453684_1490577 3300044712 Bacteria 698
608 Ga0466971_0003261 3300044719 Bacteria 6925
609 Ga0466968_0087772 3300044735 Bacteria 1374
610 Ga0466968_0413688 3300044735 Bacteria 662
611 Ga0466970_0086890 3300044765 Bacteria 1695
612 Ga0466970_0744725 3300044765 Bacteria 572
613 Ga0466970_0850985 3300044765 Bacteria 535
614 Ga0466957_0112308 3300044842 Bacteria 1729
615 Ga0466960_0432839 3300044901 Bacteria 762
616 Ga0466959_0003145 3300045049 Bacteria 10707
617 Ga0466959_0074705 3300045049 Bacteria 2450
618 Ga0451576_0000013 3300045051 Bacteria 665120
619 Ga0451576_0000018 3300045051 Bacteria 550689
620 Ga0451576_0001791 3300045051 Bacteria 35197
621 Ga0451576_0003595 3300045051 Bacteria 21077
622 Ga0451576_0013761 3300045051 Bacteria 9038
623 Ga0451576_0075129 3300045051 Bacteria 3516
624 Ga0451576_0076007 3300045051 Bacteria 3495
625 Ga0451576_0430530 3300045051 Bacteria 1384
626 Ga0451576_0439305 3300045051 Bacteria 1369
627 Ga0451576_0451212 3300045051 Bacteria 1350
628 Ga0451576_0694652 3300045051 Bacteria 1069
629 Ga0451576_1317612 3300045051 Bacteria 753
630 Ga0451576_1904423 3300045051 Bacteria 613
631 Ga0451576_2050312 3300045051 Bacteria 589
632 Ga0451576_2672921 3300045051 Bacteria 508
633 Ga0466958_0194302 3300045836 Bacteria 1290
634 Ga0466958_0307647 3300045836 Bacteria 1018
635 Ga0466958_0697788 3300045836 Bacteria 661
636 Ga0466967_0016890 3300045976 Bacteria 5771
637 Ga0495592_0845073 3300046454 Bacteria 541
638 Ga0495650_0032266 3300046471 Bacteria 2344
639 Ga0495608_0682645 3300046511 Bacteria 612
640 Ga0495663_0015935 3300046525 Bacteria 2123
641 Ga0495642_0004003 3300046528 Bacteria 5759
642 Ga0495642_0475104 3300046528 Bacteria 553
643 Ga0495654_0001400 3300046530 Bacteria 16709
644 Ga0495586_0033259 3300046535 Bacteria 2767
645 Ga0495598_0020927 3300046537 Bacteria 1733
646 Ga0495598_0166025 3300046537 Bacteria 780
647 Ga0495621_0050465 3300046539 Bacteria 1487
648 Ga0495621_0183831 3300046539 Bacteria 835
649 Ga0495621_0235612 3300046539 Bacteria 744
650 Ga0495621_0529443 3300046539 Bacteria 510
651 Ga0495633_0176329 3300046558 Bacteria 984
652 Ga0495667_0225459 3300046559 Bacteria 1195
653 Ga0495656_0004795 3300046615 Bacteria 4654
654 Ga0495656_0036747 3300046615 Bacteria 2019
655 Ga0495635_0132836 3300046663 Bacteria 1697
656 Ga0495659_0332783 3300046664 Bacteria 646
657 Ga0495588_0011885 3300046674 Bacteria 4099
658 Ga0495588_0505682 3300046674 Bacteria 633
659 Ga0495647_0104279 3300046681 Bacteria 1177
660 Ga0495658_0406349 3300046683 Bacteria 868
661 Ga0495669_0035839 3300046684 Bacteria 2191
662 Ga0495670_0212705 3300046691 Bacteria 1026
663 Ga0495636_0032780 3300047318 Bacteria 2132
664 Ga0495636_0106143 3300047318 Bacteria 1232
665 Ga0495680_0056613 3300047322 Bacteria 3035
666 Ga0495685_020801 3300047447 Bacteria 2256
667 Ga0495681_0196945 3300047470 Bacteria 819
668 Ga0495615_0090636 3300048090 Bacteria 851
669 Ga0495615_0161699 3300048090 Bacteria 673
670 Ga0495615_0310777 3300048090 Bacteria 513
671 Ga0496106_0147203 3300048909 Bacteria 1856
672 Ga0496106_0166754 3300048909 Bacteria 1744
673 Ga0496107_0962909 3300048910 Bacteria 620
674 Ga0496121_0011225 3300048924 Bacteria 9983
675 Ga0496121_0049229 3300048924 Bacteria 3576
676 Ga0496122_0025868 3300048925 Bacteria 5081
677 Ga0496124_0000007 3300048927 Bacteria 883534
678 Ga0496124_0527405 3300048927 Bacteria 785
679 Ga0501306_028698 3300049127 Bacteria 817
680 Ga0501306_066993 3300049127 Bacteria 600
681 Ga0501306_079011 3300049127 Bacteria 565
682 Ga0501308_054895 3300049128 Bacteria 591
683 Ga0501308_056902 3300049128 Bacteria 583
684 Ga0501308_074204 3300049128 Bacteria 533
685 Ga0501309_005668 3300049129 Bacteria 1497
686 Ga0501309_044409 3300049129 Bacteria 686
687 Ga0501310_012788 3300049130 Bacteria 966
688 Ga0501310_013709 3300049130 Bacteria 944
689 Ga0501310_014405 3300049130 Bacteria 928
690 Ga0501310_072518 3300049130 Bacteria 529
691 Ga0501304_000459 3300049160 Bacteria 2107
692 Ga0501304_016247 3300049160 Bacteria 703
693 Ga0501304_043934 3300049160 Bacteria 506
694 Ga0501305_009452 3300049161 Bacteria 1282
695 Ga0501305_060313 3300049161 Bacteria 652
696 Ga0501305_070281 3300049161 Bacteria 615
697 Ga0501305_071331 3300049161 Bacteria 611
698 Ga0501305_083154 3300049161 Bacteria 578
699 Ga0501307_001882 3300049162 Bacteria 1876
700 Ga0501307_031865 3300049162 Bacteria 734
701 Ga0501307_093647 3300049162 Bacteria 504
702 Ga0501311_021806 3300049527 Bacteria 876
703 Ga0501312_002194 3300049528 Bacteria 2077
704 Ga0501312_011502 3300049528 Bacteria 1204
705 Ga0501312_019245 3300049528 Bacteria 1001
706 Ga0501312_048038 3300049528 Bacteria 714
707 Ga0501313_020312 3300049529 Bacteria 817
708 Ga0501313_070576 3300049529 Bacteria 506
709 Ga0501314_001080 3300049530 Bacteria 1885
710 Ga0501314_006685 3300049530 Bacteria 1010
711 Ga0501314_012337 3300049530 Bacteria 819
712 Ga0501314_024539 3300049530 Bacteria 644
713 Ga0501315_002433 3300049531 Bacteria 1749
714 Ga0501315_007565 3300049531 Bacteria 1241
715 Ga0501316_002875 3300049532 Bacteria 1631
716 Ga0501316_005899 3300049532 Bacteria 1286
717 Ga0501316_034002 3300049532 Bacteria 692
718 Ga0501316_056157 3300049532 Bacteria 575
719 Ga0501317_017647 3300049533 Bacteria 938
720 Ga0501318_027607 3300049534 Bacteria 756
721 Ga0501318_070882 3300049534 Bacteria 550
722 Ga0501319_014463 3300049535 Bacteria 663
723 Ga0501320_013490 3300049536 Bacteria 873
724 Ga0501320_036926 3300049536 Bacteria 628
725 Ga0501321_024738 3300049537 Bacteria 770
726 Ga0501322_016762 3300049538 Bacteria 616
727 Ga0501323_029573 3300049539 Bacteria 764
728 Ga0501324_004430 3300049540 Bacteria 1117
729 Ga0501335_031092 3300049551 Bacteria 603
730 Ga0501031_0100062 3300049568 Bacteria 1892
731 Ga0501032_0244711 3300049569 Bacteria 1165
732 Ga0501033_0032115 3300049570 Bacteria 3942
733 Ga0501034_1465083 3300049571 Bacteria 557
734 Ga0501036_0375199 3300049572 Bacteria 1187
735 Ga0501037_0904395 3300049573 Bacteria 578
736 Ga0501038_0681881 3300049574 Bacteria 771
737 Ga0501039_0501708 3300049575 Bacteria 953
738 Ga0501039_1136843 3300049575 Bacteria 605
739 Ga0501041_0662843 3300049577 Bacteria 667
740 Ga0501041_0686090 3300049577 Bacteria 655
741 Ga0501042_1264981 3300049578 Bacteria 538
742 Ga0501043_0694290 3300049579 Bacteria 744
743 Ga0501047_0017972 3300049581 Bacteria 6777
744 Ga0501048_0110710 3300049582 Bacteria 1939
745 Ga0501067_0688056 3300049583 Bacteria 575
746 Ga0501069_0080728 3300049585 Bacteria 1832
747 Ga0501071_0974516 3300049587 Bacteria 655
748 Ga0501072_0448210 3300049588 Bacteria 1022
749 Ga0501072_0497388 3300049588 Bacteria 964
750 Ga0501073_1047584 3300049589 Bacteria 561
751 Ga0501076_1319131 3300049592 Bacteria 593
752 Ga0501077_0272334 3300049593 Bacteria 1077
753 Ga0501198_000043 3300049649 Bacteria 44170
754 Ga0501209_159545 3300049656 Bacteria 682
755 Ga0501222_000051 3300049662 Bacteria 43800
756 Ga0501236_092588 3300049670 Bacteria 583
757 Ga0501248_035790 3300049678 Bacteria 588
758 Ga0501255_027380 3300049684 Bacteria 775
759 Ga0501225_0066433 3300049705 Bacteria 1020
760 Ga0501079_0274751 3300049741 Bacteria 1317
761 Ga0501083_0498399 3300049744 Bacteria 793
762 Ga0501035_0011202 3300049822 Bacteria 8305
763 Ga0501044_0024898 3300049823 Bacteria 6347
764 Ga0501045_0383086 3300049824 Bacteria 1047
765 nmdc:mga03683_111107_c1 3300050489 Bacteria 1212
766 nmdc:mga03683_72943_c1 3300050489 Bacteria 1471
767 nmdc:mga03n38_47560_c1 3300050490 Bacteria 1899
768 nmdc:mga00v17_12098_c1 3300050491 Bacteria 4754
769 nmdc:mga0k408_124759_c1 3300050493 Bacteria 1527
770 nmdc:mga0k408_1824_c2 3300050493 Bacteria 7032
771 nmdc:mga0k408_190921_c1 3300050493 Bacteria 1222
772 nmdc:mga0k408_23422_c1 3300050493 Bacteria 3483
773 nmdc:mga0k408_248690_c1 3300050493 Bacteria 1062
774 nmdc:mga0k408_409360_c1 3300050493 Bacteria 807
775 nmdc:mga0k408_87248_c1 3300050493 Bacteria 1832
776 nmdc:mga0k408_97182_c1 3300050493 Bacteria 1734
777 nmdc:mga07m45_146138_c1 3300050496 Bacteria 1370
778 nmdc:mga07m45_786486_c1 3300050496 Bacteria 546
779 nmdc:mga05p37_275238_c1 3300050507 Bacteria 2010
780 nmdc:mga05p37_2800_c1 3300050507 Bacteria 20274
781 nmdc:mga09592_1477_c1 3300050508 Bacteria 18889
782 nmdc:mga09592_280883_c1 3300050508 Bacteria 1444
783 nmdc:mga0qj67_1020781_c1 3300050509 Bacteria 648
784 nmdc:mga0qj67_263575_c1 3300050509 Bacteria 1398
785 nmdc:mga06r32_1458863_c1 3300050510 Bacteria 625
786 nmdc:mga08y16_20591_c1 3300050511 Bacteria 6962
787 nmdc:mga08y16_4095_c1 3300050511 Bacteria 15220
788 nmdc:mga08y16_72548_c1 3300050511 Bacteria 3587
789 nmdc:mga08y16_997814_c1 3300050511 Bacteria 817
790 nmdc:mga0n895_30950_c1 3300050512 Bacteria 5119
791 nmdc:mga0n895_691979_c1 3300050512 Bacteria 1016
792 nmdc:mga0rr50_1381268_c1 3300050513 Bacteria 596
793 nmdc:mga0rr50_301_c1 3300050513 Bacteria 26775
794 nmdc:mga08x19_2636_c1 3300050514 Bacteria 10849
795 nmdc:mga08x19_64591_c1 3300050514 Bacteria 2376
796 nmdc:mga0a205_1167027_c1 3300050515 Bacteria 618
797 nmdc:mga0a205_217_c1 3300050515 Bacteria 40547
798 nmdc:mga0a205_285553_c1 3300050515 Bacteria 1525
799 Ga0495601_0588086 3300053077 Bacteria 715
800 Ga0500644_0265983 3300053088 Bacteria 726
801 Ga0500646_0297648 3300053090 Bacteria 578
802 Ga0500600_0129045 3300053149 Bacteria 1290
803 Ga0500600_0277307 3300053149 Bacteria 733
804 Ga0501084_0197300 3300054114 Bacteria 1698
805 Ga0590071_162906 3300059421 Bacteria 581
806 Ga0587083_0000314 3300059505 Bacteria 3935
807 Ga0587101_000304 3300059623 Bacteria 3203
808 Ga0501082_1060306 3300060353 Bacteria 709
809 Ga0466962_0186260 3300061719 Bacteria 1012
810 Ga0530510_1093645 3300061734 Bacteria 611

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300003300 Ga0006758J48902_1026783 Ga0006758J48902_10267832 55
2 3300006177 Ga0075362_10276050 Ga0075362_102760502 55
3 3300031731 Ga0307405_10999450 Ga0307405_109994502 55
4 3300006042 Ga0075368_10404726 Ga0075368_104047261 56
5 3300032133 Ga0316583_10002317 Ga0316583_1000231712 56
6 3300042876 Ga0451577_0352048 Ga0451577_0352048_1003_1188 56
7 3300044673 Ga0453683_0211230 Ga0453683_0211230_418_603 56
8 3300045051 Ga0451576_0000013 Ga0451576_0000013_540318_540503 56
9 iso_pu_bacteria 2643221660 2644338015 56
10 iso_pu_bacteria 2855730933 2855735568 56
11 iso_pu_bacteria 2855767633 2855771351 56
12 iso_pu_bacteria 2857542790 2857543715 56
13 iso_pu_bacteria 2881412998 2881416787 56
14 iso_pu_bacteria 2904434214 2904438987 56
15 iso_pu_bacteria 2919704043 2919708816 56
16 iso_pu_bacteria 8048746797 8048749924 56
17 iso_pu_bacteria 8055225921 8055226492 56
18 3300003187 JGI25151J46595_10000457 JGI25151J46595_1000045730 57
19 3300003347 JGI26128J50194_1000120 JGI26128J50194_10001204 57
20 3300005327 Ga0070658_10069230 Ga0070658_100692304 57
21 3300005328 Ga0070676_10060920 Ga0070676_100609202 57
22 3300005328 Ga0070676_10241894 Ga0070676_102418942 57
23 3300005330 Ga0070690_100444857 Ga0070690_1004448572 57
24 3300005331 Ga0070670_100551381 Ga0070670_1005513811 57
25 3300005333 Ga0070677_10852002 Ga0070677_108520021 57
26 3300005335 Ga0070666_10808556 Ga0070666_108085562 57
27 3300005335 Ga0070666_11388189 Ga0070666_113881891 57
28 3300005341 Ga0070691_10960764 Ga0070691_109607642 57
29 3300005347 Ga0070668_100410448 Ga0070668_1004104482 57
30 3300005347 Ga0070668_100563465 Ga0070668_1005634652 57
31 3300005353 Ga0070669_100077546 Ga0070669_1000775465 57
32 3300005353 Ga0070669_100208195 Ga0070669_1002081951 57
33 3300005354 Ga0070675_100554307 Ga0070675_1005543073 57
34 3300005355 Ga0070671_100529069 Ga0070671_1005290691 57
35 3300005356 Ga0070674_100039880 Ga0070674_1000398802 57
36 3300005364 Ga0070673_100055764 Ga0070673_1000557642 57
37 3300005367 Ga0070667_100308597 Ga0070667_1003085972 57
38 3300005367 Ga0070667_100337290 Ga0070667_1003372901 57
39 3300005455 Ga0070663_100121854 Ga0070663_1001218542 57
40 3300005456 Ga0070678_100199417 Ga0070678_1001994172 57
41 3300005457 Ga0070662_100060375 Ga0070662_1000603755 57
42 3300005459 Ga0068867_100002598 Ga0068867_1000025987 57
43 3300005467 Ga0070706_101952369 Ga0070706_1019523692 57
44 3300005539 Ga0068853_100646245 Ga0068853_1006462452 57
45 3300005539 Ga0068853_102139023 Ga0068853_1021390231 57
46 3300005543 Ga0070672_100070334 Ga0070672_1000703343 57
47 3300005543 Ga0070672_100237690 Ga0070672_1002376903 57
48 3300005578 Ga0068854_100658960 Ga0068854_1006589603 57
49 3300005578 Ga0068854_101666333 Ga0068854_1016663332 57
50 3300005718 Ga0068866_10377022 Ga0068866_103770222 57
51 3300005719 Ga0068861_100016735 Ga0068861_1000167353 57
52 3300005840 Ga0068870_11453171 Ga0068870_114531712 57
53 3300005841 Ga0068863_101849770 Ga0068863_1018497701 57
54 3300005842 Ga0068858_100155623 Ga0068858_1001556233 57
55 3300005843 Ga0068860_100008442 Ga0068860_10000844213 57
56 3300005844 Ga0068862_100103203 Ga0068862_1001032035 57
57 3300005937 Ga0081455_10719063 Ga0081455_107190632 57
58 3300006048 Ga0075363_100070219 Ga0075363_1000702194 57
59 3300006051 Ga0075364_10011108 Ga0075364_100111082 57
60 3300006051 Ga0075364_10344321 Ga0075364_103443213 57
61 3300006177 Ga0075362_10023034 Ga0075362_100230342 57
62 3300006177 Ga0075362_10075198 Ga0075362_100751983 57
63 3300006177 Ga0075362_10096208 Ga0075362_100962082 57
64 3300006177 Ga0075362_10406739 Ga0075362_104067392 57
65 3300006178 Ga0075367_10233591 Ga0075367_102335913 57
66 3300006186 Ga0075369_10564350 Ga0075369_105643502 57
67 3300006195 Ga0075366_10005640 Ga0075366_1000564010 57
68 3300006195 Ga0075366_10085328 Ga0075366_100853284 57
69 3300006195 Ga0075366_10123139 Ga0075366_101231392 57
70 3300006195 Ga0075366_10193121 Ga0075366_101931212 57
71 3300006195 Ga0075366_10295620 Ga0075366_102956202 57
72 3300006195 Ga0075366_10437397 Ga0075366_104373972 57
73 3300006195 Ga0075366_10638525 Ga0075366_106385252 57
74 3300006195 Ga0075366_10661102 Ga0075366_106611022 57
75 3300006353 Ga0075370_10279859 Ga0075370_102798593 57
76 3300006353 Ga0075370_10739432 Ga0075370_107394322 57
77 3300006353 Ga0075370_10749158 Ga0075370_107491582 57
78 3300006844 Ga0075428_101335042 Ga0075428_1013350422 57
79 3300006846 Ga0075430_100211888 Ga0075430_1002118882 57
80 3300006880 Ga0075429_100136853 Ga0075429_1001368533 57
81 3300006881 Ga0068865_100004060 Ga0068865_1000040609 57
82 3300009094 Ga0111539_12395326 Ga0111539_123953262 57
83 3300009148 Ga0105243_10158093 Ga0105243_101580933 57
84 3300009176 Ga0105242_10924217 Ga0105242_109242172 57
85 3300009177 Ga0105248_10893186 Ga0105248_108931863 57
86 3300009545 Ga0105237_11829334 Ga0105237_118293341 57
87 3300009551 Ga0105238_12583875 Ga0105238_125838752 57
88 3300009553 Ga0105249_10284435 Ga0105249_102844353 57
89 3300011119 Ga0105246_10198792 Ga0105246_101987923 57
90 3300012503 Ga0157313_1018748 Ga0157313_10187482 57
91 3300013297 Ga0157378_10008661 Ga0157378_1000866110 57
92 3300013306 Ga0163162_10004148 Ga0163162_1000414812 57
93 3300013308 Ga0157375_10041626 Ga0157375_100416263 57
94 3300014325 Ga0163163_11000923 Ga0163163_110009232 57
95 3300014968 Ga0157379_10069525 Ga0157379_100695253 57
96 3300017792 Ga0163161_10021239 Ga0163161_1002123910 57
97 3300017792 Ga0163161_10653042 Ga0163161_106530422 57
98 3300017792 Ga0163161_10689708 Ga0163161_106897082 57
99 3300021361 Ga0213872_10039057 Ga0213872_100390573 57
100 3300025294 Ga0209025_1000039 Ga0209025_100003924 57
101 3300025295 Ga0209564_1058966 Ga0209564_10589662 57
102 3300025315 Ga0207697_10203172 Ga0207697_102031722 57
103 3300025893 Ga0207682_10570910 Ga0207682_105709102 57
104 3300025899 Ga0207642_10018748 Ga0207642_100187482 57
105 3300025901 Ga0207688_10689152 Ga0207688_106891522 57
106 3300025903 Ga0207680_10281450 Ga0207680_102814502 57
107 3300025907 Ga0207645_10139908 Ga0207645_101399082 57
108 3300025909 Ga0207705_10374636 Ga0207705_103746361 57
109 3300025923 Ga0207681_10256446 Ga0207681_102564462 57
110 3300025926 Ga0207659_10339805 Ga0207659_103398052 57
111 3300025931 Ga0207644_10395553 Ga0207644_103955533 57
112 3300025931 Ga0207644_11658297 Ga0207644_116582972 57
113 3300025933 Ga0207706_10254171 Ga0207706_102541714 57
114 3300025934 Ga0207686_10725505 Ga0207686_107255052 57
115 3300025935 Ga0207709_10228947 Ga0207709_102289473 57
116 3300025935 Ga0207709_11048595 Ga0207709_110485952 57
117 3300025937 Ga0207669_10027395 Ga0207669_100273957 57
118 3300025938 Ga0207704_10006606 Ga0207704_100066065 57
119 3300025938 Ga0207704_10252372 Ga0207704_102523723 57
120 3300025940 Ga0207691_10119614 Ga0207691_101196143 57
121 3300025940 Ga0207691_10154910 Ga0207691_101549102 57
122 3300025940 Ga0207691_10304462 Ga0207691_103044623 57
123 3300025941 Ga0207711_10719917 Ga0207711_107199173 57
124 3300025942 Ga0207689_11751455 Ga0207689_117514551 57
125 3300025960 Ga0207651_10059456 Ga0207651_100594562 57
126 3300025961 Ga0207712_10070429 Ga0207712_100704293 57
127 3300025961 Ga0207712_10492500 Ga0207712_104925002 57
128 3300025972 Ga0207668_10181279 Ga0207668_101812793 57
129 3300025972 Ga0207668_10451257 Ga0207668_104512572 57
130 3300025986 Ga0207658_10165595 Ga0207658_101655952 57
131 3300026035 Ga0207703_10027342 Ga0207703_100273423 57
132 3300026041 Ga0207639_10092277 Ga0207639_100922772 57
133 3300026067 Ga0207678_10097661 Ga0207678_100976613 57
134 3300026088 Ga0207641_10432785 Ga0207641_104327853 57
135 3300026089 Ga0207648_10005939 Ga0207648_1000593919 57
136 3300026089 Ga0207648_10186006 Ga0207648_101860064 57
137 3300026089 Ga0207648_10551344 Ga0207648_105513443 57
138 3300026118 Ga0207675_100006663 Ga0207675_1000066639 57
139 3300026142 Ga0207698_11587902 Ga0207698_115879022 57
140 3300027360 Ga0209969_1047307 Ga0209969_10473072 57
141 3300027378 Ga0209981_1003413 Ga0209981_10034135 57
142 3300027395 Ga0209996_1000729 Ga0209996_100072910 57
143 3300027471 Ga0209995_1000242 Ga0209995_10002427 57
144 3300027526 Ga0209968_1000130 Ga0209968_100013019 57
145 3300027526 Ga0209968_1025750 Ga0209968_10257503 57
146 3300027543 Ga0209999_1007636 Ga0209999_10076363 57
147 3300027695 Ga0209966_1000117 Ga0209966_100011731 57
148 3300027717 Ga0209998_10003290 Ga0209998_100032904 57
149 3300028380 Ga0268265_10029280 Ga0268265_100292804 57
150 3300028380 Ga0268265_10158583 Ga0268265_101585833 57
151 3300028380 Ga0268265_11354509 Ga0268265_113545092 57
152 3300028381 Ga0268264_10002318 Ga0268264_1000231814 57
153 3300028786 Ga0307517_10547982 Ga0307517_105479822 57
154 3300028794 Ga0307515_10000096 Ga0307515_10000096182 57
155 3300028794 Ga0307515_10012540 Ga0307515_100125409 57
156 3300028794 Ga0307515_10119204 Ga0307515_101192043 57
157 3300028794 Ga0307515_10124094 Ga0307515_101240946 57
158 3300028794 Ga0307515_10276308 Ga0307515_102763083 57
159 3300029957 Ga0265324_10017152 Ga0265324_100171522 57
160 3300031251 Ga0265327_10028075 Ga0265327_100280754 57
161 3300031251 Ga0265327_10299265 Ga0265327_102992651 57
162 3300031344 Ga0265316_10000201 Ga0265316_100002019 57
163 3300031456 Ga0307513_10004080 Ga0307513_1000408023 57
164 3300031456 Ga0307513_10099285 Ga0307513_100992853 57
165 3300031548 Ga0307408_100013705 Ga0307408_1000137053 57
166 3300031548 Ga0307408_100198260 Ga0307408_1001982604 57
167 3300031548 Ga0307408_100559458 Ga0307408_1005594583 57
168 3300031730 Ga0307516_10026535 Ga0307516_100265353 57
169 3300031731 Ga0307405_10996488 Ga0307405_109964882 57
170 3300031824 Ga0307413_10869981 Ga0307413_108699812 57
171 3300031901 Ga0307406_10186243 Ga0307406_101862432 57
172 3300031901 Ga0307406_10819345 Ga0307406_108193452 57
173 3300031901 Ga0307406_11867127 Ga0307406_118671272 57
174 3300031903 Ga0307407_10923156 Ga0307407_109231562 57
175 3300031911 Ga0307412_10555595 Ga0307412_105555953 57
176 3300031911 Ga0307412_11556169 Ga0307412_115561692 57
177 3300031911 Ga0307412_11614402 Ga0307412_116144022 57
178 3300031911 Ga0307412_11837666 Ga0307412_118376662 57
179 3300031911 Ga0307412_11962916 Ga0307412_119629162 57
180 3300031911 Ga0307412_12102148 Ga0307412_121021482 57
181 3300031995 Ga0307409_101808537 Ga0307409_1018085371 57
182 3300032002 Ga0307416_100164217 Ga0307416_1001642173 57
183 3300032002 Ga0307416_100303075 Ga0307416_1003030753 57
184 3300032002 Ga0307416_101406681 Ga0307416_1014066812 57
185 3300032002 Ga0307416_102666251 Ga0307416_1026662511 57
186 3300032002 Ga0307416_103483122 Ga0307416_1034831222 57
187 3300032004 Ga0307414_10291090 Ga0307414_102910902 57
188 3300032004 Ga0307414_10649692 Ga0307414_106496922 57
189 3300032005 Ga0307411_10211556 Ga0307411_102115563 57
190 3300032005 Ga0307411_11079767 Ga0307411_110797672 57
191 3300032126 Ga0307415_101600920 Ga0307415_1016009202 57
192 3300034957 Ga0373938_0055891 Ga0373938_0055891_660_842 57
193 3300035170 Ga0373943_0283592 Ga0373943_0283592_480_668 57
194 3300035172 Ga0373955_0996417 Ga0373955_0996417_191_373 57
195 3300035691 Ga0373931_0002669 Ga0373931_0002669_3771_3953 57
196 3300035695 Ga0373927_0090861 Ga0373927_0090861_1621_1809 57
197 3300035725 Ga0373947_0233084 Ga0373947_0233084_66_254 57
198 3300037068 Ga0373925_0087096 Ga0373925_0087096_380_568 57
199 3300037068 Ga0373925_1538293 Ga0373925_1538293_125_307 57
200 3300037471 Ga0395905_0797396 Ga0395905_0797396_490_672 57
201 3300039447 Ga0436361_0482102 Ga0436361_0482102_1136_1321 57
202 3300041410 Ga0439461_0007483 Ga0439461_0007483_811_993 57
203 3300041413 Ga0439465_0093075 Ga0439465_0093075_715_897 57
204 3300041413 Ga0439465_0255073 Ga0439465_0255073_455_637 57
205 3300041453 Ga0451797_1450145 Ga0451797_1450145_64_249 57
206 3300041491 Ga0451833_1307539 Ga0451833_1307539_309_491 57
207 3300041494 Ga0451837_1027358 Ga0451837_1027358_331_513 57
208 3300041509 Ga0451843_0842857 Ga0451843_0842857_299_487 57
209 3300041997 Ga0439431_0048855 Ga0439431_0048855_757_939 57
210 3300041997 Ga0439431_0094685 Ga0439431_0094685_10_192 57
211 3300042000 Ga0439437_010893 Ga0439437_010893_211_396 57
212 3300042000 Ga0439437_026527 Ga0439437_026527_78_263 57
213 3300042004 Ga0439445_0055209 Ga0439445_0055209_663_845 57
214 3300042004 Ga0439445_0117097 Ga0439445_0117097_278_460 57
215 3300042006 Ga0439432_052729 Ga0439432_052729_41_223 57
216 3300042007 Ga0439449_0079765 Ga0439449_0079765_673_855 57
217 3300042007 Ga0439449_0197990 Ga0439449_0197990_348_530 57
218 3300042010 Ga0439452_105424 Ga0439452_105424_323_505 57
219 3300042012 Ga0439455_0200498 Ga0439455_0200498_214_399 57
220 3300042014 Ga0439457_178460 Ga0439457_178460_206_388 57
221 3300042015 Ga0439462_0133044 Ga0439462_0133044_143_325 57
222 3300042015 Ga0439462_0174825 Ga0439462_0174825_216_398 57
223 3300042116 Ga0450912_009544 Ga0450912_009544_76_258 57
224 3300042126 Ga0450888_006168 Ga0450888_006168_492_674 57
225 3300042127 Ga0450890_015249 Ga0450890_015249_470_661 57
226 3300042129 Ga0450891_019880 Ga0450891_019880_263_448 57
227 3300042130 Ga0450892_026137 Ga0450892_026137_303_488 57
228 3300042133 Ga0450896_012830 Ga0450896_012830_240_422 57
229 3300042134 Ga0450898_025958 Ga0450898_025958_525_707 57
230 3300042134 Ga0450898_155158 Ga0450898_155158_217_399 57
231 3300042135 Ga0450899_008179 Ga0450899_008179_381_563 57
232 3300042144 Ga0450889_034540 Ga0450889_034540_166_348 57
233 3300042156 Ga0439446_0050577 Ga0439446_0050577_280_462 57
234 3300042156 Ga0439446_0139347 Ga0439446_0139347_213_395 57
235 3300042156 Ga0439446_0332653 Ga0439446_0332653_62_247 57
236 3300042435 Ga0439434_0027368 Ga0439434_0027368_1318_1500 57
237 3300042461 Ga0439460_0117851 Ga0439460_0117851_552_737 57
238 3300042532 Ga0450893_0032704 Ga0450893_0032704_612_794 57
239 3300042876 Ga0451577_0003495 Ga0451577_0003495_1248_1430 57
240 3300042876 Ga0451577_0069675 Ga0451577_0069675_57_239 57
241 3300042876 Ga0451577_0213403 Ga0451577_0213403_1459_1650 57
242 3300042876 Ga0451577_0749480 Ga0451577_0749480_275_469 57
243 3300044656 Ga0466969_0000018 Ga0466969_0000018_4430_4615 57
244 3300044656 Ga0466969_0001561 Ga0466969_0001561_10178_10360 57
245 3300044658 Ga0466972_0008302 Ga0466972_0008302_991_1176 57
246 3300044658 Ga0466972_0040259 Ga0466972_0040259_1412_1600 57
247 3300044673 Ga0453683_0228165 Ga0453683_0228165_588_770 57
248 3300044683 Ga0466965_0021276 Ga0466965_0021276_2075_2260 57
249 3300044683 Ga0466965_0071050 Ga0466965_0071050_1500_1682 57
250 3300044684 Ga0466966_0009766 Ga0466966_0009766_3637_3822 57
251 3300044684 Ga0466966_0010593 Ga0466966_0010593_385_567 57
252 3300044693 Ga0466961_0004306 Ga0466961_0004306_5236_5418 57
253 3300044693 Ga0466961_0051858 Ga0466961_0051858_2146_2331 57
254 3300044706 Ga0466964_0272744 Ga0466964_0272744_243_425 57
255 3300044712 Ga0453684_0242050 Ga0453684_0242050_251_433 57
256 3300044712 Ga0453684_0294967 Ga0453684_0294967_349_531 57
257 3300044712 Ga0453684_0378031 Ga0453684_0378031_1133_1315 57
258 3300044712 Ga0453684_0968886 Ga0453684_0968886_393_575 57
259 3300044712 Ga0453684_1490577 Ga0453684_1490577_230_421 57
260 3300044719 Ga0466971_0003261 Ga0466971_0003261_5837_6019 57
261 3300044735 Ga0466968_0413688 Ga0466968_0413688_286_468 57
262 3300044765 Ga0466970_0086890 Ga0466970_0086890_452_637 57
263 3300044765 Ga0466970_0744725 Ga0466970_0744725_119_301 57
264 3300044765 Ga0466970_0850985 Ga0466970_0850985_66_251 57
265 3300044842 Ga0466957_0112308 Ga0466957_0112308_214_396 57
266 3300045049 Ga0466959_0003145 Ga0466959_0003145_4242_4424 57
267 3300045049 Ga0466959_0074705 Ga0466959_0074705_402_587 57
268 3300045051 Ga0451576_0003595 Ga0451576_0003595_15619_15801 57
269 3300045051 Ga0451576_0075129 Ga0451576_0075129_409_591 57
270 3300045051 Ga0451576_0076007 Ga0451576_0076007_1223_1417 57
271 3300045836 Ga0466958_0194302 Ga0466958_0194302_940_1122 57
272 3300045836 Ga0466958_0697788 Ga0466958_0697788_412_600 57
273 3300046471 Ga0495650_0032266 Ga0495650_0032266_220_411 57
274 3300046511 Ga0495608_0682645 Ga0495608_0682645_226_408 57
275 3300046525 Ga0495663_0015935 Ga0495663_0015935_637_822 57
276 3300046528 Ga0495642_0004003 Ga0495642_0004003_1407_1592 57
277 3300046528 Ga0495642_0475104 Ga0495642_0475104_197_382 57
278 3300046535 Ga0495586_0033259 Ga0495586_0033259_1460_1642 57
279 3300046537 Ga0495598_0020927 Ga0495598_0020927_1037_1219 57
280 3300046537 Ga0495598_0166025 Ga0495598_0166025_293_478 57
281 3300046539 Ga0495621_0050465 Ga0495621_0050465_1093_1278 57
282 3300046539 Ga0495621_0183831 Ga0495621_0183831_168_350 57
283 3300046539 Ga0495621_0235612 Ga0495621_0235612_266_448 57
284 3300046539 Ga0495621_0529443 Ga0495621_0529443_18_200 57
285 3300046558 Ga0495633_0176329 Ga0495633_0176329_685_870 57
286 3300046615 Ga0495656_0004795 Ga0495656_0004795_3236_3421 57
287 3300046615 Ga0495656_0036747 Ga0495656_0036747_1794_1976 57
288 3300046664 Ga0495659_0332783 Ga0495659_0332783_208_393 57
289 3300046674 Ga0495588_0011885 Ga0495588_0011885_3514_3699 57
290 3300046674 Ga0495588_0505682 Ga0495588_0505682_100_288 57
291 3300046681 Ga0495647_0104279 Ga0495647_0104279_240_428 57
292 3300046683 Ga0495658_0406349 Ga0495658_0406349_361_549 57
293 3300046684 Ga0495669_0035839 Ga0495669_0035839_1191_1376 57
294 3300046691 Ga0495670_0212705 Ga0495670_0212705_728_913 57
295 3300047318 Ga0495636_0032780 Ga0495636_0032780_1522_1707 57
296 3300047318 Ga0495636_0106143 Ga0495636_0106143_279_464 57
297 3300047447 Ga0495685_020801 Ga0495685_020801_1100_1285 57
298 3300047470 Ga0495681_0196945 Ga0495681_0196945_453_638 57
299 3300048090 Ga0495615_0090636 Ga0495615_0090636_599_781 57
300 3300048090 Ga0495615_0161699 Ga0495615_0161699_128_313 57
301 3300048090 Ga0495615_0310777 Ga0495615_0310777_235_417 57
302 3300048909 Ga0496106_0147203 Ga0496106_0147203_16_201 57
303 3300048910 Ga0496107_0962909 Ga0496107_0962909_252_437 57
304 3300048924 Ga0496121_0011225 Ga0496121_0011225_6959_7144 57
305 3300048924 Ga0496121_0049229 Ga0496121_0049229_701_886 57
306 3300048925 Ga0496122_0025868 Ga0496122_0025868_4710_4895 57
307 3300048927 Ga0496124_0000007 Ga0496124_0000007_14593_14778 57
308 3300048927 Ga0496124_0527405 Ga0496124_0527405_289_471 57
309 3300049127 Ga0501306_028698 Ga0501306_028698_603_791 57
310 3300049127 Ga0501306_066993 Ga0501306_066993_301_489 57
311 3300049127 Ga0501306_079011 Ga0501306_079011_298_486 57
312 3300049128 Ga0501308_054895 Ga0501308_054895_22_204 57
313 3300049128 Ga0501308_056902 Ga0501308_056902_356_538 57
314 3300049128 Ga0501308_074204 Ga0501308_074204_135_317 57
315 3300049129 Ga0501309_005668 Ga0501309_005668_390_575 57
316 3300049129 Ga0501309_044409 Ga0501309_044409_152_334 57
317 3300049130 Ga0501310_012788 Ga0501310_012788_282_464 57
318 3300049130 Ga0501310_013709 Ga0501310_013709_735_917 57
319 3300049130 Ga0501310_014405 Ga0501310_014405_735_917 57
320 3300049130 Ga0501310_072518 Ga0501310_072518_271_459 57
321 3300049160 Ga0501304_000459 Ga0501304_000459_1027_1209 57
322 3300049160 Ga0501304_016247 Ga0501304_016247_468_656 57
323 3300049160 Ga0501304_043934 Ga0501304_043934_198_389 57
324 3300049161 Ga0501305_009452 Ga0501305_009452_849_1031 57
325 3300049161 Ga0501305_060313 Ga0501305_060313_132_317 57
326 3300049161 Ga0501305_070281 Ga0501305_070281_72_254 57
327 3300049161 Ga0501305_071331 Ga0501305_071331_104_292 57
328 3300049161 Ga0501305_083154 Ga0501305_083154_158_343 57
329 3300049162 Ga0501307_001882 Ga0501307_001882_533_715 57
330 3300049162 Ga0501307_031865 Ga0501307_031865_242_430 57
331 3300049162 Ga0501307_093647 Ga0501307_093647_107_292 57
332 3300049527 Ga0501311_021806 Ga0501311_021806_659_841 57
333 3300049528 Ga0501312_002194 Ga0501312_002194_646_831 57
334 3300049528 Ga0501312_011502 Ga0501312_011502_442_630 57
335 3300049528 Ga0501312_019245 Ga0501312_019245_477_659 57
336 3300049528 Ga0501312_048038 Ga0501312_048038_182_364 57
337 3300049529 Ga0501313_020312 Ga0501313_020312_497_679 57
338 3300049529 Ga0501313_070576 Ga0501313_070576_41_223 57
339 3300049530 Ga0501314_001080 Ga0501314_001080_1154_1336 57
340 3300049530 Ga0501314_006685 Ga0501314_006685_284_466 57
341 3300049530 Ga0501314_012337 Ga0501314_012337_535_726 57
342 3300049530 Ga0501314_024539 Ga0501314_024539_26_208 57
343 3300049531 Ga0501315_002433 Ga0501315_002433_1018_1200 57
344 3300049531 Ga0501315_007565 Ga0501315_007565_592_777 57
345 3300049532 Ga0501316_002875 Ga0501316_002875_1153_1338 57
346 3300049532 Ga0501316_005899 Ga0501316_005899_489_677 57
347 3300049532 Ga0501316_034002 Ga0501316_034002_362_550 57
348 3300049532 Ga0501316_056157 Ga0501316_056157_137_322 57
349 3300049533 Ga0501317_017647 Ga0501317_017647_388_570 57
350 3300049534 Ga0501318_027607 Ga0501318_027607_181_363 57
351 3300049534 Ga0501318_070882 Ga0501318_070882_58_240 57
352 3300049535 Ga0501319_014463 Ga0501319_014463_449_631 57
353 3300049536 Ga0501320_013490 Ga0501320_013490_107_295 57
354 3300049536 Ga0501320_036926 Ga0501320_036926_319_501 57
355 3300049537 Ga0501321_024738 Ga0501321_024738_127_312 57
356 3300049538 Ga0501322_016762 Ga0501322_016762_61_243 57
357 3300049539 Ga0501323_029573 Ga0501323_029573_537_722 57
358 3300049540 Ga0501324_004430 Ga0501324_004430_293_475 57
359 3300049551 Ga0501335_031092 Ga0501335_031092_351_536 57
360 3300049569 Ga0501032_0244711 Ga0501032_0244711_339_524 57
361 3300049570 Ga0501033_0032115 Ga0501033_0032115_2252_2437 57
362 3300049571 Ga0501034_1465083 Ga0501034_1465083_16_201 57
363 3300049572 Ga0501036_0375199 Ga0501036_0375199_54_239 57
364 3300049573 Ga0501037_0904395 Ga0501037_0904395_377_562 57
365 3300049574 Ga0501038_0681881 Ga0501038_0681881_32_217 57
366 3300049578 Ga0501042_1264981 Ga0501042_1264981_273_467 57
367 3300049579 Ga0501043_0694290 Ga0501043_0694290_296_481 57
368 3300049581 Ga0501047_0017972 Ga0501047_0017972_3691_3876 57
369 3300049582 Ga0501048_0110710 Ga0501048_0110710_548_733 57
370 3300049587 Ga0501071_0974516 Ga0501071_0974516_201_383 57
371 3300049589 Ga0501073_1047584 Ga0501073_1047584_168_350 57
372 3300049649 Ga0501198_000043 Ga0501198_000043_34526_34708 57
373 3300049662 Ga0501222_000051 Ga0501222_000051_9463_9645 57
374 3300049678 Ga0501248_035790 Ga0501248_035790_171_356 57
375 3300049684 Ga0501255_027380 Ga0501255_027380_478_666 57
376 3300049822 Ga0501035_0011202 Ga0501035_0011202_2033_2218 57
377 3300049823 Ga0501044_0024898 Ga0501044_0024898_2270_2455 57
378 3300050489 nmdc:mga03683_111107_c1 nmdc:mga03683_111107_c1_571_753 57
379 3300050489 nmdc:mga03683_72943_c1 nmdc:mga03683_72943_c1_943_1125 57
380 3300050490 nmdc:mga03n38_47560_c1 nmdc:mga03n38_47560_c1_1084_1266 57
381 3300050491 nmdc:mga00v17_12098_c1 nmdc:mga00v17_12098_c1_3555_3743 57
382 3300050493 nmdc:mga0k408_124759_c1 nmdc:mga0k408_124759_c1_1020_1202 57
383 3300050493 nmdc:mga0k408_1824_c2 nmdc:mga0k408_1824_c2_5998_6180 57
384 3300050493 nmdc:mga0k408_190921_c1 nmdc:mga0k408_190921_c1_269_451 57
385 3300050493 nmdc:mga0k408_23422_c1 nmdc:mga0k408_23422_c1_434_616 57
386 3300050493 nmdc:mga0k408_248690_c1 nmdc:mga0k408_248690_c1_96_278 57
387 3300050493 nmdc:mga0k408_409360_c1 nmdc:mga0k408_409360_c1_428_616 57
388 3300050493 nmdc:mga0k408_87248_c1 nmdc:mga0k408_87248_c1_1364_1552 57
389 3300050493 nmdc:mga0k408_97182_c1 nmdc:mga0k408_97182_c1_1417_1605 57
390 3300050496 nmdc:mga07m45_146138_c1 nmdc:mga07m45_146138_c1_253_435 57
391 3300050496 nmdc:mga07m45_786486_c1 nmdc:mga07m45_786486_c1_117_305 57
392 3300050508 nmdc:mga09592_280883_c1 nmdc:mga09592_280883_c1_1137_1322 57
393 3300050509 nmdc:mga0qj67_263575_c1 nmdc:mga0qj67_263575_c1_881_1066 57
394 3300053088 Ga0500644_0265983 Ga0500644_0265983_109_291 57
395 3300053149 Ga0500600_0277307 Ga0500600_0277307_125_331 57
396 3300059421 Ga0590071_162906 Ga0590071_162906_130_321 57
397 3300059505 Ga0587083_0000314 Ga0587083_0000314_3618_3803 57
398 3300059623 Ga0587101_000304 Ga0587101_000304_2882_3067 57
399 3300061719 Ga0466962_0186260 Ga0466962_0186260_249_434 57
400 3300061734 Ga0530510_1093645 Ga0530510_1093645_73_258 57
401 3300000044 ARSoilOldRDRAFT_c011456 ARSoilOldRDRAFT_0114562 58
402 3300002070 JGI24750J21931_1058011 JGI24750J21931_10580112 58
403 3300002239 JGI24034J26672_10110490 JGI24034J26672_101104901 58
404 3300004798 Ga0058859_11182523 Ga0058859_111825231 58
405 3300004801 Ga0058860_12156074 Ga0058860_121560744 58
406 3300004803 Ga0058862_12655437 Ga0058862_126554372 58
407 3300005295 Ga0065707_10014633 Ga0065707_100146331 58
408 3300005295 Ga0065707_10037915 Ga0065707_100379152 58
409 3300005295 Ga0065707_11006424 Ga0065707_110064242 58
410 3300005329 Ga0070683_100105419 Ga0070683_1001054193 58
411 3300005330 Ga0070690_100001051 Ga0070690_10000105120 58
412 3300005330 Ga0070690_100006945 Ga0070690_1000069458 58
413 3300005330 Ga0070690_100211418 Ga0070690_1002114183 58
414 3300005334 Ga0068869_100006377 Ga0068869_1000063779 58
415 3300005335 Ga0070666_10279744 Ga0070666_102797442 58
416 3300005336 Ga0070680_100024534 Ga0070680_1000245348 58
417 3300005337 Ga0070682_100010140 Ga0070682_1000101409 58
418 3300005338 Ga0068868_100001937 Ga0068868_10000193720 58
419 3300005338 Ga0068868_100459194 Ga0068868_1004591941 58
420 3300005340 Ga0070689_100001590 Ga0070689_1000015909 58
421 3300005340 Ga0070689_101621954 Ga0070689_1016219542 58
422 3300005341 Ga0070691_10001529 Ga0070691_100015298 58
423 3300005343 Ga0070687_100000486 Ga0070687_10000048616 58
424 3300005343 Ga0070687_100030365 Ga0070687_1000303654 58
425 3300005345 Ga0070692_10002474 Ga0070692_100024747 58
426 3300005345 Ga0070692_10171877 Ga0070692_101718772 58
427 3300005345 Ga0070692_10642910 Ga0070692_106429102 58
428 3300005345 Ga0070692_10813886 Ga0070692_108138861 58
429 3300005353 Ga0070669_100267967 Ga0070669_1002679673 58
430 3300005354 Ga0070675_100415889 Ga0070675_1004158893 58
431 3300005354 Ga0070675_100614389 Ga0070675_1006143893 58
432 3300005355 Ga0070671_100071598 Ga0070671_1000715985 58
433 3300005356 Ga0070674_100899720 Ga0070674_1008997202 58
434 3300005364 Ga0070673_100450317 Ga0070673_1004503173 58
435 3300005364 Ga0070673_101981655 Ga0070673_1019816552 58
436 3300005365 Ga0070688_101241677 Ga0070688_1012416772 58
437 3300005365 Ga0070688_101305742 Ga0070688_1013057422 58
438 3300005406 Ga0070703_10008050 Ga0070703_100080505 58
439 3300005438 Ga0070701_10002480 Ga0070701_100024808 58
440 3300005438 Ga0070701_10022859 Ga0070701_100228592 58
441 3300005439 Ga0070711_100158878 Ga0070711_1001588782 58
442 3300005440 Ga0070705_100004302 Ga0070705_1000043027 58
443 3300005440 Ga0070705_100403726 Ga0070705_1004037262 58
444 3300005441 Ga0070700_100006166 Ga0070700_10000616610 58
445 3300005441 Ga0070700_101126730 Ga0070700_1011267301 58
446 3300005444 Ga0070694_100001615 Ga0070694_10000161520 58
447 3300005444 Ga0070694_100212985 Ga0070694_1002129852 58
448 3300005444 Ga0070694_100881568 Ga0070694_1008815682 58
449 3300005444 Ga0070694_101713698 Ga0070694_1017136982 58
450 3300005456 Ga0070678_101220504 Ga0070678_1012205042 58
451 3300005458 Ga0070681_10379200 Ga0070681_103792001 58
452 3300005458 Ga0070681_10687359 Ga0070681_106873592 58
453 3300005459 Ga0068867_100002002 Ga0068867_10000200220 58
454 3300005468 Ga0070707_101411866 Ga0070707_1014118662 58
455 3300005530 Ga0070679_100073605 Ga0070679_1000736054 58
456 3300005530 Ga0070679_100951429 Ga0070679_1009514292 58
457 3300005535 Ga0070684_100788461 Ga0070684_1007884612 58
458 3300005544 Ga0070686_100008053 Ga0070686_10000805313 58
459 3300005544 Ga0070686_100008478 Ga0070686_1000084787 58
460 3300005544 Ga0070686_100975126 Ga0070686_1009751262 58
461 3300005545 Ga0070695_100002452 Ga0070695_1000024523 58
462 3300005546 Ga0070696_100002331 Ga0070696_10000233123 58
463 3300005546 Ga0070696_100006223 Ga0070696_1000062239 58
464 3300005547 Ga0070693_100000371 Ga0070693_1000003717 58
465 3300005547 Ga0070693_100156801 Ga0070693_1001568012 58
466 3300005549 Ga0070704_100003415 Ga0070704_10000341512 58
467 3300005549 Ga0070704_100029374 Ga0070704_1000293749 58
468 3300005549 Ga0070704_100141749 Ga0070704_1001417492 58
469 3300005549 Ga0070704_100538282 Ga0070704_1005382822 58
470 3300005563 Ga0068855_100025005 Ga0068855_1000250059 58
471 3300005578 Ga0068854_100044185 Ga0068854_1000441857 58
472 3300005578 Ga0068854_102011181 Ga0068854_1020111812 58
473 3300005614 Ga0068856_100020864 Ga0068856_1000208645 58
474 3300005614 Ga0068856_100246767 Ga0068856_1002467673 58
475 3300005614 Ga0068856_102605820 Ga0068856_1026058202 58
476 3300005615 Ga0070702_100021043 Ga0070702_1000210437 58
477 3300005615 Ga0070702_100906033 Ga0070702_1009060331 58
478 3300005616 Ga0068852_101153037 Ga0068852_1011530372 58
479 3300005616 Ga0068852_101159039 Ga0068852_1011590392 58
480 3300005616 Ga0068852_101714626 Ga0068852_1017146262 58
481 3300005617 Ga0068859_100011503 Ga0068859_1000115037 58
482 3300005617 Ga0068859_100021700 Ga0068859_10002170013 58
483 3300005617 Ga0068859_100158427 Ga0068859_1001584275 58
484 3300005617 Ga0068859_100177088 Ga0068859_1001770883 58
485 3300005617 Ga0068859_101947328 Ga0068859_1019473282 58
486 3300005618 Ga0068864_100127994 Ga0068864_1001279944 58
487 3300005718 Ga0068866_10000800 Ga0068866_1000080020 58
488 3300005719 Ga0068861_100001378 Ga0068861_10000137819 58
489 3300005719 Ga0068861_100107394 Ga0068861_1001073944 58
490 3300005719 Ga0068861_101270836 Ga0068861_1012708361 58
491 3300005834 Ga0068851_10971253 Ga0068851_109712532 58
492 3300005840 Ga0068870_10087184 Ga0068870_100871843 58
493 3300005840 Ga0068870_10170429 Ga0068870_101704292 58
494 3300005841 Ga0068863_100117575 Ga0068863_1001175755 58
495 3300005841 Ga0068863_101629612 Ga0068863_1016296122 58
496 3300005842 Ga0068858_100003490 Ga0068858_10000349018 58
497 3300005842 Ga0068858_100081023 Ga0068858_1000810232 58
498 3300005843 Ga0068860_100017732 Ga0068860_1000177325 58
499 3300005843 Ga0068860_100351103 Ga0068860_1003511032 58
500 3300005844 Ga0068862_100006216 Ga0068862_10000621613 58
501 3300005844 Ga0068862_100304329 Ga0068862_1003043292 58
502 3300005844 Ga0068862_101822540 Ga0068862_1018225401 58
503 3300005985 Ga0081539_10000233 Ga0081539_100002335 58
504 3300006058 Ga0075432_10074382 Ga0075432_100743822 58
505 3300006163 Ga0070715_10801206 Ga0070715_108012062 58
506 3300006173 Ga0070716_100158008 Ga0070716_1001580084 58
507 3300006177 Ga0075362_10134088 Ga0075362_101340883 58
508 3300006237 Ga0097621_100001348 Ga0097621_10000134813 58
509 3300006237 Ga0097621_100037976 Ga0097621_1000379767 58
510 3300006358 Ga0068871_100000763 Ga0068871_10000076319 58
511 3300006358 Ga0068871_100001793 Ga0068871_10000179321 58
512 3300006358 Ga0068871_100586171 Ga0068871_1005861712 58
513 3300006844 Ga0075428_100000047 Ga0075428_10000004795 58
514 3300006844 Ga0075428_102264332 Ga0075428_1022643322 58
515 3300006846 Ga0075430_101486354 Ga0075430_1014863542 58
516 3300006847 Ga0075431_100355207 Ga0075431_1003552072 58
517 3300006852 Ga0075433_10020651 Ga0075433_100206513 58
518 3300006852 Ga0075433_10216266 Ga0075433_102162663 58
519 3300006852 Ga0075433_10949551 Ga0075433_109495512 58
520 3300006871 Ga0075434_100012054 Ga0075434_1000120549 58
521 3300006871 Ga0075434_100517439 Ga0075434_1005174392 58
522 3300006880 Ga0075429_100000047 Ga0075429_10000004756 58
523 3300006881 Ga0068865_100001223 Ga0068865_10000122320 58
524 3300006914 Ga0075436_100002331 Ga0075436_10000233122 58
525 3300006914 Ga0075436_100005646 Ga0075436_10000564613 58
526 3300006931 Ga0097620_100011503 Ga0097620_1000115037 58
527 3300006931 Ga0097620_100021700 Ga0097620_1000217003 58
528 3300006931 Ga0097620_100158439 Ga0097620_1001584395 58
529 3300006931 Ga0097620_100177092 Ga0097620_1001770923 58
530 3300006931 Ga0097620_101947557 Ga0097620_1019475572 58
531 3300007076 Ga0075435_100005357 Ga0075435_1000053578 58
532 3300007076 Ga0075435_100221707 Ga0075435_1002217074 58
533 3300007076 Ga0075435_101309385 Ga0075435_1013093852 58
534 3300007265 Ga0099794_10057533 Ga0099794_100575333 58
535 3300009094 Ga0111539_10069166 Ga0111539_100691669 58
536 3300009094 Ga0111539_10150015 Ga0111539_101500153 58
537 3300009094 Ga0111539_10497859 Ga0111539_104978592 58
538 3300009094 Ga0111539_10614098 Ga0111539_106140983 58
539 3300009094 Ga0111539_11073136 Ga0111539_110731362 58
540 3300009098 Ga0105245_10002556 Ga0105245_1000255613 58
541 3300009147 Ga0114129_10008888 Ga0114129_1000888821 58
542 3300009147 Ga0114129_10334228 Ga0114129_103342282 58
543 3300009148 Ga0105243_10003107 Ga0105243_1000310720 58
544 3300009176 Ga0105242_10002800 Ga0105242_100028009 58
545 3300009177 Ga0105248_10910370 Ga0105248_109103702 58
546 3300009177 Ga0105248_11329146 Ga0105248_113291462 58
547 3300009553 Ga0105249_10022359 Ga0105249_100223598 58
548 3300009553 Ga0105249_10432441 Ga0105249_104324412 58
549 3300009553 Ga0105249_10728482 Ga0105249_107284821 58
550 3300010375 Ga0105239_11177518 Ga0105239_111775182 58
551 3300011119 Ga0105246_10121917 Ga0105246_101219174 58
552 3300012498 Ga0157345_1026061 Ga0157345_10260612 58
553 3300013102 Ga0157371_10918516 Ga0157371_109185162 58
554 3300013297 Ga0157378_10007830 Ga0157378_1000783010 58
555 3300013306 Ga0163162_10617606 Ga0163162_106176063 58
556 3300013307 Ga0157372_10486829 Ga0157372_104868293 58
557 3300013308 Ga0157375_10889746 Ga0157375_108897462 58
558 3300014326 Ga0157380_10024376 Ga0157380_100243769 58
559 3300014326 Ga0157380_10383528 Ga0157380_103835284 58
560 3300014326 Ga0157380_12400474 Ga0157380_124004742 58
561 3300014745 Ga0157377_10044509 Ga0157377_100445093 58
562 3300014968 Ga0157379_10163599 Ga0157379_101635993 58
563 3300014968 Ga0157379_11618587 Ga0157379_116185872 58
564 3300014969 Ga0157376_10008899 Ga0157376_100088998 58
565 3300014969 Ga0157376_10019067 Ga0157376_100190677 58
566 3300017792 Ga0163161_11012719 Ga0163161_110127192 58
567 3300025885 Ga0207653_10008869 Ga0207653_100088693 58
568 3300025898 Ga0207692_10083260 Ga0207692_100832602 58
569 3300025899 Ga0207642_10002949 Ga0207642_100029499 58
570 3300025901 Ga0207688_10017544 Ga0207688_100175445 58
571 3300025903 Ga0207680_11292106 Ga0207680_112921062 58
572 3300025907 Ga0207645_10857355 Ga0207645_108573552 58
573 3300025908 Ga0207643_10005493 Ga0207643_1000549312 58
574 3300025912 Ga0207707_10300202 Ga0207707_103002022 58
575 3300025912 Ga0207707_10387605 Ga0207707_103876052 58
576 3300025912 Ga0207707_11232489 Ga0207707_112324892 58
577 3300025916 Ga0207663_10310873 Ga0207663_103108731 58
578 3300025917 Ga0207660_10001979 Ga0207660_1000197920 58
579 3300025917 Ga0207660_10558601 Ga0207660_105586012 58
580 3300025918 Ga0207662_10000006 Ga0207662_1000000613 58
581 3300025918 Ga0207662_10009139 Ga0207662_100091399 58
582 3300025918 Ga0207662_10547337 Ga0207662_105473372 58
583 3300025921 Ga0207652_10016184 Ga0207652_100161849 58
584 3300025923 Ga0207681_10590164 Ga0207681_105901641 58
585 3300025926 Ga0207659_10357490 Ga0207659_103574902 58
586 3300025926 Ga0207659_11385894 Ga0207659_113858942 58
587 3300025927 Ga0207687_10005454 Ga0207687_1000545411 58
588 3300025928 Ga0207700_10361588 Ga0207700_103615882 58
589 3300025931 Ga0207644_10021011 Ga0207644_100210119 58
590 3300025934 Ga0207686_10001285 Ga0207686_1000128520 58
591 3300025935 Ga0207709_10005880 Ga0207709_100058803 58
592 3300025936 Ga0207670_10005544 Ga0207670_100055449 58
593 3300025936 Ga0207670_10183639 Ga0207670_101836393 58
594 3300025938 Ga0207704_10000913 Ga0207704_1000091313 58
595 3300025939 Ga0207665_11464318 Ga0207665_114643182 58
596 3300025941 Ga0207711_10828529 Ga0207711_108285292 58
597 3300025941 Ga0207711_11222325 Ga0207711_112223252 58
598 3300025942 Ga0207689_10019913 Ga0207689_1001991310 58
599 3300025944 Ga0207661_10057404 Ga0207661_100574043 58
600 3300025949 Ga0207667_10002489 Ga0207667_100024899 58
601 3300025961 Ga0207712_10002872 Ga0207712_1000287218 58
602 3300025961 Ga0207712_12011474 Ga0207712_120114741 58
603 3300025981 Ga0207640_10005155 Ga0207640_100051559 58
604 3300025981 Ga0207640_11701493 Ga0207640_117014932 58
605 3300025986 Ga0207658_11381413 Ga0207658_113814132 58
606 3300026023 Ga0207677_10002702 Ga0207677_100027023 58
607 3300026035 Ga0207703_10004381 Ga0207703_1000438112 58
608 3300026035 Ga0207703_10060243 Ga0207703_100602436 58
609 3300026075 Ga0207708_10010574 Ga0207708_1001057412 58
610 3300026075 Ga0207708_10049162 Ga0207708_100491627 58
611 3300026075 Ga0207708_11019692 Ga0207708_110196922 58
612 3300026078 Ga0207702_10019596 Ga0207702_100195962 58
613 3300026078 Ga0207702_10333621 Ga0207702_103336211 58
614 3300026088 Ga0207641_10280061 Ga0207641_102800612 58
615 3300026088 Ga0207641_11076003 Ga0207641_110760032 58
616 3300026088 Ga0207641_12325455 Ga0207641_123254551 58
617 3300026088 Ga0207641_12373667 Ga0207641_123736672 58
618 3300026089 Ga0207648_10004560 Ga0207648_1000456010 58
619 3300026095 Ga0207676_10014207 Ga0207676_100142074 58
620 3300026116 Ga0207674_11680028 Ga0207674_116800282 58
621 3300026118 Ga0207675_100024184 Ga0207675_1000241842 58
622 3300026118 Ga0207675_100174415 Ga0207675_1001744153 58
623 3300026121 Ga0207683_11091757 Ga0207683_110917571 58
624 3300026142 Ga0207698_10183308 Ga0207698_101833083 58
625 3300026142 Ga0207698_11561593 Ga0207698_115615932 58
626 3300027360 Ga0209969_1001632 Ga0209969_10016323 58
627 3300027364 Ga0209967_1000358 Ga0209967_100035812 58
628 3300027378 Ga0209981_1002763 Ga0209981_10027634 58
629 3300027395 Ga0209996_1011883 Ga0209996_10118831 58
630 3300027462 Ga0210000_1034579 Ga0210000_10345792 58
631 3300027471 Ga0209995_1001135 Ga0209995_10011357 58
632 3300027526 Ga0209968_1001973 Ga0209968_10019736 58
633 3300027543 Ga0209999_1003266 Ga0209999_10032664 58
634 3300027671 Ga0209588_1269912 Ga0209588_12699122 58
635 3300027695 Ga0209966_1001758 Ga0209966_10017583 58
636 3300027907 Ga0207428_10009607 Ga0207428_100096072 58
637 3300027907 Ga0207428_10081909 Ga0207428_100819092 58
638 3300028380 Ga0268265_10004065 Ga0268265_1000406514 58
639 3300028380 Ga0268265_10159132 Ga0268265_101591324 58
640 3300028380 Ga0268265_10349690 Ga0268265_103496903 58
641 3300028381 Ga0268264_10003087 Ga0268264_1000308710 58
642 3300028381 Ga0268264_10325919 Ga0268264_103259193 58
643 3300028794 Ga0307515_10006150 Ga0307515_1000615023 58
644 3300030522 Ga0307512_10080686 Ga0307512_100806863 58
645 3300031250 Ga0265331_10149695 Ga0265331_101496952 58
646 3300031456 Ga0307513_10005218 Ga0307513_1000521820 58
647 3300031548 Ga0307408_100383599 Ga0307408_1003835993 58
648 3300031548 Ga0307408_100421256 Ga0307408_1004212561 58
649 3300031548 Ga0307408_100809011 Ga0307408_1008090112 58
650 3300031649 Ga0307514_10000530 Ga0307514_1000053023 58
651 3300031665 Ga0316575_10000771 Ga0316575_1000077112 58
652 3300031665 Ga0316575_10028250 Ga0316575_100282502 58
653 3300031665 Ga0316575_10339941 Ga0316575_103399412 58
654 3300031691 Ga0316579_10010128 Ga0316579_100101287 58
655 3300031691 Ga0316579_10010387 Ga0316579_100103873 58
656 3300031727 Ga0316576_10135201 Ga0316576_101352013 58
657 3300031728 Ga0316578_10044753 Ga0316578_100447533 58
658 3300031728 Ga0316578_10055271 Ga0316578_100552714 58
659 3300031731 Ga0307405_10023807 Ga0307405_100238076 58
660 3300031731 Ga0307405_11717345 Ga0307405_117173452 58
661 3300031733 Ga0316577_10033326 Ga0316577_100333264 58
662 3300031733 Ga0316577_10183925 Ga0316577_101839253 58
663 3300031824 Ga0307413_11006224 Ga0307413_110062242 58
664 3300031824 Ga0307413_11944083 Ga0307413_119440831 58
665 3300031852 Ga0307410_11296513 Ga0307410_112965132 58
666 3300031901 Ga0307406_11312373 Ga0307406_113123732 58
667 3300031903 Ga0307407_10567806 Ga0307407_105678062 58
668 3300031903 Ga0307407_10839262 Ga0307407_108392622 58
669 3300031911 Ga0307412_12309417 Ga0307412_123094172 58
670 3300032002 Ga0307416_100402979 Ga0307416_1004029792 58
671 3300032002 Ga0307416_100688901 Ga0307416_1006889012 58
672 3300032002 Ga0307416_100773172 Ga0307416_1007731722 58
673 3300032005 Ga0307411_10924742 Ga0307411_109247422 58
674 3300032005 Ga0307411_10989813 Ga0307411_109898131 58
675 3300032126 Ga0307415_102481850 Ga0307415_1024818502 58
676 3300032133 Ga0316583_10018653 Ga0316583_100186532 58
677 3300032133 Ga0316583_10022934 Ga0316583_100229342 58
678 3300032137 Ga0316585_10053551 Ga0316585_100535512 58
679 3300032139 Ga0316580_10021418 Ga0316580_100214185 58
680 3300032139 Ga0316580_10051025 Ga0316580_100510252 58
681 3300032168 Ga0316593_10004609 Ga0316593_100046091 58
682 3300032168 Ga0316593_10042198 Ga0316593_100421983 58
683 3300032168 Ga0316593_10223821 Ga0316593_102238211 58
684 3300033180 Ga0307510_10259489 Ga0307510_102594892 58
685 3300033524 Ga0316592_1007100 Ga0316592_10071004 58
686 3300033527 Ga0316586_1000300 Ga0316586_10003005 58
687 3300033529 Ga0316587_1041763 Ga0316587_10417632 58
688 3300033541 Ga0316596_1004696 Ga0316596_10046963 58
689 3300034816 Ga0373930_0029026 Ga0373930_0029026_427_603 58
690 3300034817 Ga0373948_0010756 Ga0373948_0010756_769_945 58
691 3300034818 Ga0373950_0012134 Ga0373950_0012134_198_374 58
692 3300034819 Ga0373958_0048463 Ga0373958_0048463_433_609 58
693 3300034820 Ga0373959_0109104 Ga0373959_0109104_91_267 58
694 3300035084 Ga0373928_0009124 Ga0373928_0009124_95_271 58
695 3300035085 Ga0373929_0089566 Ga0373929_0089566_530_706 58
696 3300035088 Ga0373940_0139052 Ga0373940_0139052_125_301 58
697 3300035088 Ga0373940_0203762 Ga0373940_0203762_291_467 58
698 3300035088 Ga0373940_0328001 Ga0373940_0328001_42_230 58
699 3300035090 Ga0373949_0022177 Ga0373949_0022177_360_536 58
700 3300035092 Ga0373952_0046971 Ga0373952_0046971_114_290 58
701 3300035092 Ga0373952_0078765 Ga0373952_0078765_86_262 58
702 3300035111 Ga0373923_0147248 Ga0373923_0147248_497_673 58
703 3300035113 Ga0373936_0077460 Ga0373936_0077460_278_454 58
704 3300035114 Ga0373939_0031815 Ga0373939_0031815_1281_1472 58
705 3300035114 Ga0373939_0047314 Ga0373939_0047314_717_893 58
706 3300035114 Ga0373939_0176349 Ga0373939_0176349_517_693 58
707 3300035115 Ga0373941_0007557 Ga0373941_0007557_1220_1396 58
708 3300035117 Ga0373953_0022203 Ga0373953_0022203_1198_1374 58
709 3300035119 Ga0373956_0053410 Ga0373956_0053410_1552_1728 58
710 3300035120 Ga0373957_0200461 Ga0373957_0200461_387_563 58
711 3300035121 Ga0373960_0093774 Ga0373960_0093774_553_729 58
712 3300035121 Ga0373960_0102246 Ga0373960_0102246_337_513 58
713 3300035121 Ga0373960_0130507 Ga0373960_0130507_486_662 58
714 3300035172 Ga0373955_0002904 Ga0373955_0002904_3258_3434 58
715 3300035207 Ga0373942_0002486 Ga0373942_0002486_3050_3226 58
716 3300035207 Ga0373942_0257773 Ga0373942_0257773_133_309 58
717 3300035241 Ga0373961_0298020 Ga0373961_0298020_298_477 58
718 3300035242 Ga0373962_0024426 Ga0373962_0024426_1267_1443 58
719 3300035242 Ga0373962_0144698 Ga0373962_0144698_93_269 58
720 3300035410 Ga0373924_0032565 Ga0373924_0032565_920_1096 58
721 3300035691 Ga0373931_0048665 Ga0373931_0048665_138_314 58
722 3300035691 Ga0373931_0051539 Ga0373931_0051539_1861_2037 58
723 3300035691 Ga0373931_0464538 Ga0373931_0464538_553_729 58
724 3300035692 Ga0373935_1184415 Ga0373935_1184415_185_361 58
725 3300035724 Ga0373933_0029527 Ga0373933_0029527_2438_2614 58
726 3300036401 Ga0373937_0002498 Ga0373937_0002498_8848_9024 58
727 3300036647 Ga0316582_0012337 Ga0316582_0012337_2509_2694 58
728 3300036647 Ga0316582_0034187 Ga0316582_0034187_630_815 58
729 3300036647 Ga0316582_0389217 Ga0316582_0389217_660_857 58
730 3300036712 Ga0316584_0077596 Ga0316584_0077596_713_898 58
731 3300036712 Ga0316584_0240898 Ga0316584_0240898_333_518 58
732 3300037068 Ga0373925_0472249 Ga0373925_0472249_246_422 58
733 3300037588 Ga0316581_0098634 Ga0316581_0098634_277_462 58
734 3300037853 Ga0436364_0587970 Ga0436364_0587970_1173_1364 58
735 3300041404 Ga0439436_0063088 Ga0439436_0063088_500_676 58
736 3300041406 Ga0439439_0066211 Ga0439439_0066211_695_871 58
737 3300041410 Ga0439461_0002934 Ga0439461_0002934_1451_1627 58
738 3300041461 Ga0451805_038163 Ga0451805_038163_488_676 58
739 3300041486 Ga0451807_1762141 Ga0451807_1762141_159_335 58
740 3300041997 Ga0439431_0044792 Ga0439431_0044792_801_977 58
741 3300042001 Ga0439441_031275 Ga0439441_031275_287_478 58
742 3300042013 Ga0439456_036841 Ga0439456_036841_865_1041 58
743 3300042015 Ga0439462_0188671 Ga0439462_0188671_134_310 58
744 3300042435 Ga0439434_0000888 Ga0439434_0000888_947_1123 58
745 3300042436 Ga0439435_0000151 Ga0439435_0000151_9077_9253 58
746 3300042461 Ga0439460_0072489 Ga0439460_0072489_162_338 58
747 3300042876 Ga0451577_0000013 Ga0451577_0000013_423838_424038 58
748 3300042876 Ga0451577_0081193 Ga0451577_0081193_644_820 58
749 3300042876 Ga0451577_0286581 Ga0451577_0286581_619_819 58
750 3300042876 Ga0451577_1055460 Ga0451577_1055460_406_591 58
751 3300042876 Ga0451577_1456937 Ga0451577_1456937_280_456 58
752 3300044673 Ga0453683_0000059 Ga0453683_0000059_60307_60507 58
753 3300044673 Ga0453683_0848729 Ga0453683_0848729_398_589 58
754 3300044706 Ga0466964_0550720 Ga0466964_0550720_22_198 58
755 3300044712 Ga0453684_0000585 Ga0453684_0000585_8796_8996 58
756 3300044712 Ga0453684_0000989 Ga0453684_0000989_83838_84023 58
757 3300044712 Ga0453684_0348092 Ga0453684_0348092_234_419 58
758 3300044712 Ga0453684_0799892 Ga0453684_0799892_705_881 58
759 3300044735 Ga0466968_0087772 Ga0466968_0087772_496_672 58
760 3300044901 Ga0466960_0432839 Ga0466960_0432839_201_377 58
761 3300045051 Ga0451576_0000018 Ga0451576_0000018_126652_126852 58
762 3300045051 Ga0451576_0001791 Ga0451576_0001791_34888_35064 58
763 3300045051 Ga0451576_0013761 Ga0451576_0013761_5118_5309 58
764 3300045051 Ga0451576_0430530 Ga0451576_0430530_432_623 58
765 3300045051 Ga0451576_0439305 Ga0451576_0439305_1103_1279 58
766 3300045051 Ga0451576_0451212 Ga0451576_0451212_953_1144 58
767 3300045051 Ga0451576_0694652 Ga0451576_0694652_114_296 58
768 3300045051 Ga0451576_1317612 Ga0451576_1317612_238_423 58
769 3300045051 Ga0451576_1904423 Ga0451576_1904423_134_310 58
770 3300045051 Ga0451576_2050312 Ga0451576_2050312_157_342 58
771 3300045051 Ga0451576_2672921 Ga0451576_2672921_170_346 58
772 3300045836 Ga0466958_0307647 Ga0466958_0307647_393_569 58
773 3300045976 Ga0466967_0016890 Ga0466967_0016890_1263_1439 58
774 3300046454 Ga0495592_0845073 Ga0495592_0845073_67_243 58
775 3300046530 Ga0495654_0001400 Ga0495654_0001400_11007_11192 58
776 3300046559 Ga0495667_0225459 Ga0495667_0225459_760_936 58
777 3300046663 Ga0495635_0132836 Ga0495635_0132836_1288_1464 58
778 3300047322 Ga0495680_0056613 Ga0495680_0056613_2686_2862 58
779 3300048909 Ga0496106_0166754 Ga0496106_0166754_1429_1605 58
780 3300049568 Ga0501031_0100062 Ga0501031_0100062_854_1030 58
781 3300049575 Ga0501039_0501708 Ga0501039_0501708_261_437 58
782 3300049575 Ga0501039_1136843 Ga0501039_1136843_290_490 58
783 3300049577 Ga0501041_0662843 Ga0501041_0662843_453_629 58
784 3300049577 Ga0501041_0686090 Ga0501041_0686090_46_222 58
785 3300049583 Ga0501067_0688056 Ga0501067_0688056_92_268 58
786 3300049585 Ga0501069_0080728 Ga0501069_0080728_1423_1614 58
787 3300049588 Ga0501072_0448210 Ga0501072_0448210_29_205 58
788 3300049588 Ga0501072_0497388 Ga0501072_0497388_509_685 58
789 3300049592 Ga0501076_1319131 Ga0501076_1319131_280_471 58
790 3300049593 Ga0501077_0272334 Ga0501077_0272334_621_797 58
791 3300049656 Ga0501209_159545 Ga0501209_159545_285_461 58
792 3300049670 Ga0501236_092588 Ga0501236_092588_204_380 58
793 3300049705 Ga0501225_0066433 Ga0501225_0066433_197_373 58
794 3300049741 Ga0501079_0274751 Ga0501079_0274751_24_215 58
795 3300049744 Ga0501083_0498399 Ga0501083_0498399_424_615 58
796 3300049824 Ga0501045_0383086 Ga0501045_0383086_409_585 58
797 3300050507 nmdc:mga05p37_275238_c1 nmdc:mga05p37_275238_c1_1346_1522 58
798 3300050507 nmdc:mga05p37_2800_c1 nmdc:mga05p37_2800_c1_10763_10939 58
799 3300050508 nmdc:mga09592_1477_c1 nmdc:mga09592_1477_c1_8160_8336 58
800 3300050509 nmdc:mga0qj67_1020781_c1 nmdc:mga0qj67_1020781_c1_258_434 58
801 3300050510 nmdc:mga06r32_1458863_c1 nmdc:mga06r32_1458863_c1_293_502 58
802 3300050511 nmdc:mga08y16_20591_c1 nmdc:mga08y16_20591_c1_2045_2221 58
803 3300050511 nmdc:mga08y16_4095_c1 nmdc:mga08y16_4095_c1_3916_4092 58
804 3300050511 nmdc:mga08y16_72548_c1 nmdc:mga08y16_72548_c1_32_214 58
805 3300050511 nmdc:mga08y16_997814_c1 nmdc:mga08y16_997814_c1_463_645 58
806 3300050512 nmdc:mga0n895_30950_c1 nmdc:mga0n895_30950_c1_819_995 58
807 3300050512 nmdc:mga0n895_691979_c1 nmdc:mga0n895_691979_c1_441_617 58
808 3300050513 nmdc:mga0rr50_1381268_c1 nmdc:mga0rr50_1381268_c1_169_345 58
809 3300050513 nmdc:mga0rr50_301_c1 nmdc:mga0rr50_301_c1_1570_1746 58
810 3300050514 nmdc:mga08x19_2636_c1 nmdc:mga08x19_2636_c1_1295_1471 58
811 3300050514 nmdc:mga08x19_64591_c1 nmdc:mga08x19_64591_c1_195_371 58
812 3300050515 nmdc:mga0a205_1167027_c1 nmdc:mga0a205_1167027_c1_280_456 58
813 3300050515 nmdc:mga0a205_217_c1 nmdc:mga0a205_217_c1_9399_9575 58
814 3300050515 nmdc:mga0a205_285553_c1 nmdc:mga0a205_285553_c1_832_1023 58
815 3300053077 Ga0495601_0588086 Ga0495601_0588086_442_618 58
816 3300053090 Ga0500646_0297648 Ga0500646_0297648_119_304 58
817 3300053149 Ga0500600_0129045 Ga0500600_0129045_226_441 58
818 3300054114 Ga0501084_0197300 Ga0501084_0197300_1258_1434 58
819 3300060353 Ga0501082_1060306 Ga0501082_1060306_243_434 58

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00327

Ribosomal_L30

Ribosomal protein L30p/L7e

6

56

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
5kpw-assembly1.cif.gz_Y structure of rela bound to ribosome in presence of a/r trna (structure iii) 0.9891 1 58
6enu-assembly1.cif.gz_Z polyproline-stalled ribosome in the presence of elongation-factor p (ef-p) 0.9865 1 58
8g34-assembly1.cif.gz_Z time-resolved cryo-em study of the 70s recycling by the hflx:1st intermediate 0.9857 1 58
5hl7-assembly1.cif.gz_W the crystal structure of the large ribosomal subunit of staphylococcus aureus in complex with lefamulin 0.9834 2 58
7unw-assembly1.cif.gz_2 pseudomonas aeruginosa 70s ribosome initiation complex bound to if2-gdpcp (structure ii-b) 0.9825 2 58
ID Description Score Start End Superfamily
4wfbW00 Alpha Beta;2-Layer Sandwich;Ribosomal Protein L30; Chain: A,;Ribosomal protein L30/L7 0.9838 2 58 3.30.1390.20
5hl7W00 Alpha Beta;2-Layer Sandwich;Ribosomal Protein L30; Chain: A,;Ribosomal protein L30/L7 0.9834 2 58 3.30.1390.20
4tomZ00 Alpha Beta;2-Layer Sandwich;Ribosomal Protein L30; Chain: A,;Ribosomal protein L30/L7 0.9819 1 58 3.30.1390.20
af_B6SIL2_19_102_3.30.1390.20 Alpha Beta;2-Layer Sandwich;Ribosomal Protein L30; Chain: A,;Ribosomal protein L30/L7 0.9816 2 58 3.30.1390.20
af_Q54GH8_53_110_3.30.1390.20 Alpha Beta;2-Layer Sandwich;Ribosomal Protein L30; Chain: A,;Ribosomal protein L30/L7 0.9773 4 58 3.30.1390.20
ID Description Score Start End GO Terms
AF-A0A1F4BHL4-F1-model_v4 Large ribosomal subunit protein uL30 1.007 3 58 GO:0003735
GO:0006412
GO:0022625
AF-A0A1C9VJ53-F1-model_v4 deleted 1.007 3 57
AF-A0A3B0ZPD2-F1-model_v4 LSU ribosomal protein L30p (L7e) 1.007 2 57 GO:0003735
GO:0006412
GO:0022625
AF-B4RT46-F1-model_v4 Large ribosomal subunit protein uL30 (50S ribosomal protein L30) 1.007 1 56 GO:0003735
GO:0006412
GO:0022625
AF-A0A5C9C4K1-F1-model_v4 Multifunctional fusion protein [Includes: Small ribosomal subunit protein uS5; Large ribosomal subunit protein uL30] 1.006 2 58 GO:0003735
GO:0005737
GO:0006412
GO:0015934
GO:0015935
GO:0019843

Feature Viewer

pLDDT pTM Quality
91.22 0.67 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map