F482021

General Info

Members Datasets Scaffolds Average Seq Length
815 384 810 84

Family's Representative Sequence

Representative Sequence 3300041461|Ga0451805_129914|Ga0451805_129914_281_580
Length 99
Sequence MAHKKGGGSVKNGRDSNAQRLGIKKFGGQKVISGNIIVRQRGTKFHPGENVGLGKDHTIFATIEGVVVFERMHGRDGQKQVHVMPVPVVAVADTTAKVQ

Samples

Sample ID Description Type Environment
1 2534681786 Brucella suis 92/29 Isolate Unclassified
2 2671180139 Chelativorans sp. A52C2 Isolate Unclassified
3 2854911287 Brucella lupini LUP21 Isolate Unclassified
4 2883291878 Hypericibacter terrae R5913 Isolate Rhizosphere
5 2897803580 Azospirillum doebereinerae GSF71 Isolate Unclassified
6 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
7 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
8 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
9 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
10 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
11 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
12 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
13 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
14 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
15 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
23 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
30 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
31 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
66 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
67 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
68 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
69 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
70 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
71 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
72 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
73 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
74 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
75 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
76 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
77 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
78 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
79 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
81 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
83 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
84 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
86 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
87 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
88 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
89 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
90 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
91 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
92 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
93 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
94 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
95 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
96 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
97 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
98 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
99 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
100 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
101 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
102 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
103 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
104 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
105 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
106 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
107 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
108 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
109 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
110 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
111 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
112 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
113 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
114 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
115 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
116 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
167 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
170 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
171 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
172 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
173 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
174 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
175 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
176 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
177 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
178 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
179 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
180 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
181 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
182 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
183 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
184 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
185 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
186 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
187 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
188 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
189 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
190 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
191 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
192 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
193 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
194 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
195 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
196 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
197 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
198 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
199 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
200 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
201 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
202 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
203 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
204 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
205 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
206 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
207 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
208 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
209 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
210 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
211 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
212 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
213 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
214 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
215 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
216 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
217 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
218 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
219 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
220 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
221 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
222 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
223 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
224 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
225 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
226 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
227 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
228 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
229 3300041461 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT Metatranscriptome Rhizoplane
230 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
231 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
232 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
233 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
234 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
235 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
236 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
237 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
238 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
239 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
240 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
241 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
242 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
243 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
244 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
245 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
246 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
247 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
248 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
249 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
250 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
251 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
252 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
253 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
254 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
255 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
256 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
257 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
258 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
259 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
260 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
261 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
262 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
263 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
264 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
265 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
266 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
267 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
268 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
269 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
270 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
271 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
272 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
273 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
274 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
275 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
276 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
277 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
278 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
279 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
280 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
281 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
282 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
283 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
284 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
285 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
286 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
287 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
288 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
289 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
290 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
291 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
292 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
293 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
294 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
295 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
296 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
297 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
298 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
299 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
300 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
301 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
302 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
303 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
304 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
305 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
306 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
307 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
308 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
309 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
310 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
311 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
312 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
313 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
314 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
315 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
316 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
317 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
318 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
319 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
320 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
321 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
322 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
323 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
324 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
325 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
326 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
327 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
328 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
329 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
330 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
331 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
332 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
333 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
334 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
335 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
336 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
337 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
338 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
339 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
340 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
341 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
342 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
343 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
344 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
345 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
346 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
347 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
348 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
349 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
350 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
351 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
352 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
353 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
354 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
355 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
356 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
357 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
358 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
359 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
360 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
361 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
362 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
363 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
364 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
365 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
366 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
367 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
368 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
369 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
370 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
371 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
372 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
373 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
374 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
375 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
376 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
377 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
378 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
379 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
380 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
381 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
382 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
383 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
384 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.37
Metatranscriptomes 6.01
Isolates 0.61

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.49
Nodule 0
Rhizoplane 5.03
Rhizosphere 91.78
Stem 0
Stem Tuber 0
Unclassified 2.7

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJNas_1020449 3300000546 Bacteria 706
2 JGI24034J26672_10000321 3300002239 Bacteria 6179
3 JGI24742J22300_10021444 3300002244 Bacteria 1103
4 JGI24751J29686_10108143 3300002459 Unclassified 582
5 JGI25407J50210_10032383 3300003373 Bacteria 1352
6 JGI25407J50210_10035157 3300003373 Bacteria 1292
7 JGI25407J50210_10049920 3300003373 Bacteria 1062
8 Ga0058859_11471263 3300004798 Unclassified 608
9 Ga0058861_11781935 3300004800 Bacteria 833
10 Ga0058862_12754643 3300004803 Bacteria 1197
11 Ga0058862_12833852 3300004803 Bacteria 1193
12 Ga0070658_11521906 3300005327 Bacteria 580
13 Ga0070676_10145657 3300005328 Unclassified 1512
14 Ga0068869_100258268 3300005334 Unclassified 1394
15 Ga0070680_100001829 3300005336 Bacteria 15622
16 Ga0070680_101951238 3300005336 Bacteria 509
17 Ga0070682_100000011 3300005337 Bacteria 266253
18 Ga0068868_100000445 3300005338 Bacteria 27750
19 Ga0068868_100534698 3300005338 Bacteria 1031
20 Ga0070660_100520061 3300005339 Bacteria 991
21 Ga0070689_100740479 3300005340 Bacteria 861
22 Ga0070691_10000270 3300005341 Bacteria 18137
23 Ga0070691_10075616 3300005341 Bacteria 1640
24 Ga0070687_100023591 3300005343 Bacteria 2925
25 Ga0070669_101234671 3300005353 Bacteria 646
26 Ga0070671_100091529 3300005355 Bacteria 2548
27 Ga0070674_100000004 3300005356 Bacteria 169446
28 Ga0070674_100077793 3300005356 Bacteria 2363
29 Ga0070674_100182647 3300005356 Bacteria 1608
30 Ga0070674_100879322 3300005356 Bacteria 779
31 Ga0070674_101757634 3300005356 Unclassified 562
32 Ga0070673_100004080 3300005364 Bacteria 9197
33 Ga0070688_100088147 3300005365 Bacteria 2023
34 Ga0070688_100422858 3300005365 Bacteria 991
35 Ga0070709_10442388 3300005434 Bacteria 978
36 Ga0070714_100035345 3300005435 Bacteria 4188
37 Ga0070714_100146725 3300005435 Bacteria 2123
38 Ga0070713_100022878 3300005436 Bacteria 4839
39 Ga0070713_100573889 3300005436 Bacteria 1070
40 Ga0070711_100012656 3300005439 Bacteria 5277
41 Ga0070700_100293555 3300005441 Bacteria 1184
42 Ga0070700_100502924 3300005441 Bacteria 932
43 Ga0070700_100759405 3300005441 Bacteria 777
44 Ga0070694_100177171 3300005444 Unclassified 1575
45 Ga0070708_100986814 3300005445 Bacteria 790
46 Ga0070678_100186781 3300005456 Bacteria 1701
47 Ga0070678_100691891 3300005456 Bacteria 918
48 Ga0070662_100000006 3300005457 Bacteria 169366
49 Ga0070662_100557677 3300005457 Bacteria 960
50 Ga0070681_10158384 3300005458 Bacteria 2188
51 Ga0070681_11400767 3300005458 Bacteria 623
52 Ga0070681_11479090 3300005458 Bacteria 604
53 Ga0068867_100059553 3300005459 Bacteria 2831
54 Ga0068867_100587438 3300005459 Bacteria 969
55 Ga0070685_10492296 3300005466 Bacteria 866
56 Ga0070679_100034456 3300005530 Bacteria 5018
57 Ga0070679_101098683 3300005530 Bacteria 740
58 Ga0070679_101788643 3300005530 Bacteria 563
59 Ga0070684_100039321 3300005535 Bacteria 4068
60 Ga0070684_101041007 3300005535 Bacteria 768
61 Ga0068853_100512817 3300005539 Bacteria 1133
62 Ga0070686_100336995 3300005544 Bacteria 1129
63 Ga0070686_100414792 3300005544 Bacteria 1027
64 Ga0070686_101052409 3300005544 Bacteria 670
65 Ga0070695_100066741 3300005545 Unclassified 2345
66 Ga0070695_100110996 3300005545 Bacteria 1861
67 Ga0070695_101736298 3300005545 Bacteria 523
68 Ga0070696_100624636 3300005546 Bacteria 871
69 Ga0070696_100957244 3300005546 Bacteria 713
70 Ga0070693_100003426 3300005547 Bacteria 7397
71 Ga0070693_100150494 3300005547 Bacteria 1474
72 Ga0070665_100365391 3300005548 Bacteria 1449
73 Ga0070665_102627909 3300005548 Bacteria 504
74 Ga0070704_100082194 3300005549 Bacteria 2375
75 Ga0068855_102112063 3300005563 Bacteria 567
76 Ga0070664_100405767 3300005564 Bacteria 1247
77 Ga0070664_100525220 3300005564 Bacteria 1093
78 Ga0068857_100065269 3300005577 Bacteria 3236
79 Ga0068857_100746874 3300005577 Bacteria 932
80 Ga0068854_100002872 3300005578 Bacteria 10717
81 Ga0068854_100005454 3300005578 Bacteria 8033
82 Ga0070702_100427270 3300005615 Bacteria 955
83 Ga0070702_100568294 3300005615 Bacteria 845
84 Ga0070702_100604300 3300005615 Bacteria 823
85 Ga0068852_101998906 3300005616 Bacteria 602
86 Ga0068859_101802608 3300005617 Bacteria 676
87 Ga0068864_100379393 3300005618 Bacteria 1339
88 Ga0068866_10000004 3300005718 Bacteria 202810
89 Ga0068866_10500581 3300005718 Bacteria 804
90 Ga0068866_10693725 3300005718 Bacteria 698
91 Ga0068861_100473614 3300005719 Bacteria 1127
92 Ga0068861_100977196 3300005719 Bacteria 807
93 Ga0068861_100981918 3300005719 Bacteria 805
94 Ga0068851_10007448 3300005834 Bacteria 5026
95 Ga0068863_100107123 3300005841 Bacteria 2659
96 Ga0068863_100459766 3300005841 Bacteria 1250
97 Ga0068858_100101660 3300005842 Bacteria 2681
98 Ga0068860_101250422 3300005843 Bacteria 763
99 Ga0068862_102333538 3300005844 Bacteria 547
100 Ga0081455_10036639 3300005937 Bacteria 4364
101 Ga0081538_10006799 3300005981 Bacteria 9984
102 Ga0081538_10008047 3300005981 Bacteria 9012
103 Ga0081538_10015130 3300005981 Bacteria 5992
104 Ga0081538_10019832 3300005981 Bacteria 4975
105 Ga0081538_10097866 3300005981 Bacteria 1489
106 Ga0081538_10132404 3300005981 Bacteria 1169
107 Ga0081540_1000129 3300005983 Bacteria 80446
108 Ga0081539_10002112 3300005985 Bacteria 29436
109 Ga0070717_10011077 3300006028 Bacteria 6833
110 Ga0075365_10385013 3300006038 Bacteria 989
111 Ga0070715_10000014 3300006163 Bacteria 154272
112 Ga0070712_100031071 3300006175 Bacteria 3595
113 Ga0068871_100732055 3300006358 Bacteria 908
114 Ga0075428_100232563 3300006844 Bacteria 1989
115 Ga0075428_100664991 3300006844 Bacteria 1110
116 Ga0075428_100694808 3300006844 Bacteria 1084
117 Ga0075430_100025109 3300006846 Bacteria 5069
118 Ga0075430_100802146 3300006846 Bacteria 776
119 Ga0075433_10000051 3300006852 Bacteria 49800
120 Ga0068865_100475483 3300006881 Bacteria 1037
121 Ga0075436_100779210 3300006914 Bacteria 711
122 Ga0097620_101802886 3300006931 Bacteria 676
123 Ga0105240_10360420 3300009093 Bacteria 1647
124 Ga0105240_11310515 3300009093 Bacteria 764
125 Ga0111539_10000483 3300009094 Bacteria 50415
126 Ga0111539_10098590 3300009094 Bacteria 3432
127 Ga0105245_10000104 3300009098 Bacteria 80951
128 Ga0105245_10013612 3300009098 Bacteria 7086
129 Ga0105245_10577520 3300009098 Bacteria 1148
130 Ga0105245_10632046 3300009098 Bacteria 1099
131 Ga0105247_10610920 3300009101 Unclassified 810
132 Ga0114129_12437476 3300009147 Bacteria 626
133 Ga0114129_13467244 3300009147 Bacteria 505
134 Ga0105243_10214134 3300009148 Bacteria 1698
135 Ga0105243_12567699 3300009148 Bacteria 549
136 Ga0105242_10000034 3300009176 Bacteria 95536
137 Ga0105242_10193921 3300009176 Bacteria 1800
138 Ga0105242_12862181 3300009176 Bacteria 533
139 Ga0105248_12092148 3300009177 Bacteria 644
140 Ga0105238_11032136 3300009551 Bacteria 844
141 Ga0105249_10165424 3300009553 Bacteria 2141
142 Ga0105249_10449203 3300009553 Unclassified 1327
143 Ga0105249_12466972 3300009553 Bacteria 592
144 Ga0105249_12872796 3300009553 Bacteria 553
145 Ga0105239_10061079 3300010375 Bacteria 4136
146 Ga0105239_10337335 3300010375 Bacteria 1701
147 Ga0105239_10669072 3300010375 Bacteria 1186
148 Ga0105239_13021716 3300010375 Bacteria 548
149 Ga0105246_10159752 3300011119 Bacteria 1716
150 Ga0157338_1022085 3300012515 Bacteria 750
151 Ga0157373_11001861 3300013100 Bacteria 623
152 Ga0157371_10789270 3300013102 Bacteria 715
153 Ga0157370_10117245 3300013104 Bacteria 2487
154 Ga0157374_10414140 3300013296 Bacteria 1346
155 Ga0163162_10372730 3300013306 Bacteria 1561
156 Ga0163162_11025623 3300013306 Bacteria 933
157 Ga0163162_11322943 3300013306 Bacteria 819
158 Ga0157372_10000210 3300013307 Bacteria 65290
159 Ga0157372_10032985 3300013307 Bacteria 5684
160 Ga0157375_10006231 3300013308 Bacteria 10388
161 Ga0157375_11324065 3300013308 Bacteria 847
162 Ga0163163_10231626 3300014325 Bacteria 1896
163 Ga0163163_10265292 3300014325 Bacteria 1768
164 Ga0163163_10609045 3300014325 Bacteria 1155
165 Ga0157380_10370261 3300014326 Unclassified 1348
166 Ga0157380_12170172 3300014326 Bacteria 619
167 Ga0157380_12318845 3300014326 Bacteria 601
168 Ga0182008_10187178 3300014497 Unclassified 1049
169 Ga0182008_10448028 3300014497 Unclassified 701
170 Ga0157379_11395269 3300014968 Bacteria 679
171 Ga0163161_10175529 3300017792 Unclassified 1640
172 Ga0163161_10272926 3300017792 Bacteria 1324
173 Ga0163161_10561304 3300017792 Bacteria 937
174 Ga0197907_10108296 3300020069 Bacteria 671
175 Ga0197907_10203191 3300020069 Bacteria 1178
176 Ga0197907_10599200 3300020069 Bacteria 1053
177 Ga0197907_11492123 3300020069 Unclassified 988
178 Ga0206356_10138750 3300020070 Unclassified 983
179 Ga0206356_10660827 3300020070 Bacteria 1198
180 Ga0206356_10738820 3300020070 Bacteria 726
181 Ga0206349_1061295 3300020075 Bacteria 530
182 Ga0206349_1308889 3300020075 Bacteria 1019
183 Ga0206349_1645124 3300020075 Bacteria 1254
184 Ga0206349_1785023 3300020075 Bacteria 507
185 Ga0206355_1007025 3300020076 Bacteria 1046
186 Ga0206355_1037541 3300020076 Bacteria 977
187 Ga0206351_10156800 3300020077 Bacteria 588
188 Ga0206351_10376218 3300020077 Bacteria 1197
189 Ga0206351_10956255 3300020077 Bacteria 657
190 Ga0206352_10054722 3300020078 Bacteria 1241
191 Ga0206352_10461982 3300020078 Bacteria 938
192 Ga0206350_10221184 3300020080 Bacteria 1145
193 Ga0206350_11267920 3300020080 Bacteria 1036
194 Ga0206354_10038488 3300020081 Bacteria 913
195 Ga0206354_10361875 3300020081 Bacteria 760
196 Ga0206354_10746139 3300020081 Bacteria 1523
197 Ga0206354_11070946 3300020081 Bacteria 848
198 Ga0206354_11163887 3300020081 Bacteria 781
199 Ga0206353_10523663 3300020082 Bacteria 1243
200 Ga0206353_11137416 3300020082 Bacteria 743
201 Ga0206353_11724054 3300020082 Bacteria 755
202 Ga0206353_11861206 3300020082 Bacteria 1043
203 Ga0213871_10092047 3300021441 Bacteria 879
204 Ga0224712_10090982 3300022467 Bacteria 1278
205 Ga0224712_10095648 3300022467 Bacteria 1251
206 Ga0224712_10302764 3300022467 Bacteria 748
207 Ga0224712_10311022 3300022467 Bacteria 738
208 Ga0224712_10388592 3300022467 Unclassified 664
209 Ga0207656_10004764 3300025321 Bacteria 4761
210 Ga0207642_10000005 3300025899 Bacteria 401934
211 Ga0207642_10139159 3300025899 Bacteria 1277
212 Ga0207710_10427302 3300025900 Bacteria 682
213 Ga0207688_10089068 3300025901 Bacteria 1770
214 Ga0207680_11032657 3300025903 Bacteria 588
215 Ga0207647_10232934 3300025904 Bacteria 1059
216 Ga0207685_10000025 3300025905 Bacteria 110358
217 Ga0207699_11116401 3300025906 Bacteria 584
218 Ga0207645_10140152 3300025907 Bacteria 1576
219 Ga0207705_11486894 3300025909 Bacteria 513
220 Ga0207707_10079437 3300025912 Bacteria 2864
221 Ga0207695_10185529 3300025913 Bacteria 1999
222 Ga0207693_10041345 3300025915 Bacteria 3628
223 Ga0207663_10010849 3300025916 Bacteria 4867
224 Ga0207660_10042447 3300025917 Bacteria 3193
225 Ga0207660_10062578 3300025917 Bacteria 2681
226 Ga0207662_10043963 3300025918 Bacteria 2636
227 Ga0207657_10361040 3300025919 Bacteria 1145
228 Ga0207657_10763015 3300025919 Bacteria 749
229 Ga0207652_10085390 3300025921 Bacteria 2766
230 Ga0207652_10512575 3300025921 Bacteria 1079
231 Ga0207681_10069968 3300025923 Bacteria 2443
232 Ga0207694_10000004 3300025924 Bacteria 967075
233 Ga0207694_10528476 3300025924 Bacteria 989
234 Ga0207650_11846397 3300025925 Unclassified 511
235 Ga0207687_10000015 3300025927 Bacteria 261701
236 Ga0207687_10006580 3300025927 Bacteria 7665
237 Ga0207687_10124555 3300025927 Bacteria 1932
238 Ga0207700_10106824 3300025928 Bacteria 2245
239 Ga0207700_10380491 3300025928 Bacteria 1234
240 Ga0207664_10061653 3300025929 Bacteria 2993
241 Ga0207664_11196899 3300025929 Bacteria 678
242 Ga0207644_10075439 3300025931 Bacteria 2478
243 Ga0207706_10000017 3300025933 Bacteria 169589
244 Ga0207706_10017951 3300025933 Bacteria 6368
245 Ga0207686_10002116 3300025934 Bacteria 10933
246 Ga0207686_10253757 3300025934 Bacteria 1286
247 Ga0207709_10227322 3300025935 Bacteria 1350
248 Ga0207669_10000056 3300025937 Bacteria 56304
249 Ga0207669_10181594 3300025937 Bacteria 1509
250 Ga0207669_10237489 3300025937 Bacteria 1349
251 Ga0207711_10233576 3300025941 Bacteria 1685
252 Ga0207679_10152448 3300025945 Bacteria 1883
253 Ga0207679_10230742 3300025945 Bacteria 1562
254 Ga0207679_11462441 3300025945 Bacteria 627
255 Ga0207667_10947050 3300025949 Bacteria 851
256 Ga0207651_10001711 3300025960 Bacteria 10131
257 Ga0207712_10089104 3300025961 Bacteria 2267
258 Ga0207712_10180299 3300025961 Bacteria 1658
259 Ga0207668_10755914 3300025972 Bacteria 858
260 Ga0207640_10001278 3300025981 Bacteria 13673
261 Ga0207640_10113727 3300025981 Bacteria 1924
262 Ga0207658_11224182 3300025986 Bacteria 686
263 Ga0207677_10000299 3300026023 Bacteria 37042
264 Ga0207677_10428297 3300026023 Bacteria 1129
265 Ga0207703_10134954 3300026035 Bacteria 2135
266 Ga0207639_10745298 3300026041 Bacteria 911
267 Ga0207708_10017895 3300026075 Bacteria 5333
268 Ga0207708_10212430 3300026075 Bacteria 1547
269 Ga0207708_11961971 3300026075 Bacteria 513
270 Ga0207641_10003646 3300026088 Bacteria 13583
271 Ga0207648_10084916 3300026089 Bacteria 2761
272 Ga0207648_10166478 3300026089 Bacteria 1948
273 Ga0207676_12549441 3300026095 Bacteria 508
274 Ga0207674_10001054 3300026116 Bacteria 35890
275 Ga0207674_11007377 3300026116 Bacteria 802
276 Ga0207675_100099600 3300026118 Bacteria 2737
277 Ga0207675_100180365 3300026118 Bacteria 2022
278 Ga0207675_100204736 3300026118 Bacteria 1896
279 Ga0207675_100613264 3300026118 Bacteria 1092
280 Ga0207683_10223569 3300026121 Bacteria 1716
281 Ga0207683_10636838 3300026121 Bacteria 987
282 Ga0207683_10689766 3300026121 Bacteria 947
283 Ga0207698_11901676 3300026142 Bacteria 610
284 Ga0210002_1027818 3300027617 Unclassified 932
285 Ga0209998_10063967 3300027717 Bacteria 870
286 Ga0209998_10090460 3300027717 Bacteria 750
287 Ga0207428_10096660 3300027907 Bacteria 2287
288 Ga0268265_11131663 3300028380 Bacteria 778
289 Ga0268264_10001292 3300028381 Bacteria 23636
290 Ga0268264_10179874 3300028381 Bacteria 1920
291 Ga0265319_1000035 3300028563 Bacteria 117269
292 Ga0265323_10254798 3300028653 Bacteria 546
293 Ga0265322_10107332 3300028654 Bacteria 794
294 Ga0265336_10216325 3300028666 Bacteria 569
295 Ga0265338_10000171 3300028800 Bacteria 120054
296 Ga0265338_10128094 3300028800 Bacteria 2010
297 Ga0265324_10107172 3300029957 Bacteria 949
298 Ga0268256_1053309 3300030500 Bacteria 842
299 Ga0265320_10128753 3300031240 Bacteria 1151
300 Ga0265325_10010611 3300031241 Bacteria 5325
301 Ga0265327_10317609 3300031251 Bacteria 684
302 Ga0307408_100085517 3300031548 Bacteria 2368
303 Ga0307408_100440213 3300031548 Bacteria 1128
304 Ga0265314_10335980 3300031711 Bacteria 836
305 Ga0265342_10459136 3300031712 Bacteria 653
306 Ga0316578_10337080 3300031728 Bacteria 899
307 Ga0307405_10036216 3300031731 Bacteria 2954
308 Ga0307405_10059393 3300031731 Bacteria 2410
309 Ga0316577_10817901 3300031733 Bacteria 528
310 Ga0307413_10024244 3300031824 Bacteria 3304
311 Ga0307410_10002132 3300031852 Bacteria 9402
312 Ga0307406_10150927 3300031901 Bacteria 1657
313 Ga0307406_11154075 3300031901 Bacteria 671
314 Ga0307407_10001268 3300031903 Bacteria 8992
315 Ga0307412_10560184 3300031911 Bacteria 961
316 Ga0307412_11371941 3300031911 Bacteria 639
317 Ga0307409_100101103 3300031995 Bacteria 2391
318 Ga0307416_100003017 3300032002 Bacteria 9834
319 Ga0307416_100852473 3300032002 Bacteria 1009
320 Ga0307416_101855517 3300032002 Unclassified 706
321 Ga0307416_102191830 3300032002 Bacteria 654
322 Ga0307414_10071892 3300032004 Bacteria 2497
323 Ga0307411_10025443 3300032005 Bacteria 3546
324 Ga0307411_10244186 3300032005 Bacteria 1408
325 Ga0307411_10621727 3300032005 Bacteria 931
326 Ga0307415_100029129 3300032126 Bacteria 3524
327 Ga0307415_101325721 3300032126 Bacteria 683
328 Ga0316593_10011204 3300032168 Bacteria 2599
329 Ga0316593_10065150 3300032168 Bacteria 1252
330 Ga0316593_10085467 3300032168 Bacteria 1106
331 Ga0316593_10168202 3300032168 Bacteria 803
332 Ga0316593_10290703 3300032168 Unclassified 617
333 Ga0316593_10352506 3300032168 Bacteria 563
334 Ga0316592_1058324 3300033524 Bacteria 865
335 Ga0316592_1118771 3300033524 Bacteria 613
336 Ga0316596_1085647 3300033541 Unclassified 848
337 Ga0373936_0580106 3300035113 Bacteria 526
338 Ga0373939_0218580 3300035114 Bacteria 729
339 Ga0373953_0262596 3300035117 Bacteria 751
340 Ga0373943_0085016 3300035170 Bacteria 1629
341 Ga0373943_0456594 3300035170 Bacteria 743
342 Ga0373962_0021242 3300035242 Bacteria 1711
343 Ga0316574_0504192 3300035398 Bacteria 754
344 Ga0373924_0161343 3300035410 Bacteria 983
345 Ga0373931_0607788 3300035691 Bacteria 715
346 Ga0373935_0202855 3300035692 Bacteria 1371
347 Ga0373935_1042206 3300035692 Bacteria 608
348 Ga0373937_0147835 3300036401 Bacteria 2200
349 Ga0373937_0849766 3300036401 Bacteria 861
350 Ga0373937_1036227 3300036401 Bacteria 769
351 Ga0373937_1599996 3300036401 Bacteria 599
352 Ga0316582_0978874 3300036647 Bacteria 578
353 Ga0316584_0341393 3300036712 Bacteria 1077
354 Ga0316584_1187171 3300036712 Bacteria 504
355 Ga0373925_0434135 3300037068 Bacteria 1074
356 Ga0373925_0702432 3300037068 Unclassified 834
357 Ga0395899_0985771 3300037312 Bacteria 509
358 Ga0395900_0586701 3300037418 Bacteria 1056
359 Ga0395900_0779044 3300037418 Bacteria 885
360 Ga0395898_1338292 3300037466 Bacteria 645
361 Ga0395905_0137603 3300037471 Bacteria 2298
362 Ga0436364_1305764 3300037853 Bacteria 1029
363 Ga0395901_0108382 3300038443 Bacteria 2916
364 Ga0395901_1058856 3300038443 Bacteria 784
365 Ga0242420_140503 3300038996 Bacteria 537
366 Ga0400483_158900 3300039062 Bacteria 1178
367 Ga0400489_52134 3300039093 Bacteria 1231
368 Ga0436365_1138802 3300039437 Bacteria 678
369 Ga0436360_0090361 3300039438 Bacteria 9969
370 Ga0436361_0509578 3300039447 Unclassified 775
371 Ga0436363_1473259 3300039450 Bacteria 511
372 Ga0439461_0126984 3300041410 Bacteria 642
373 Ga0439466_0072186 3300041411 Bacteria 1098
374 Ga0439465_0181790 3300041413 Bacteria 761
375 Ga0451800_0514641 3300041459 Bacteria 1254
376 Ga0451802_0732742 3300041460 Bacteria 657
377 Ga0451805_129914 3300041461 Bacteria 893
378 Ga0451807_0556699 3300041486 Bacteria 1268
379 Ga0451833_0079236 3300041491 Bacteria 1015
380 Ga0451837_1632582 3300041494 Bacteria 621
381 Ga0451839_0045583 3300041496 Bacteria 762
382 Ga0451849_0767292 3300041505 Bacteria 550
383 Ga0451849_1533487 3300041505 Bacteria 1047
384 Ga0451853_0315177 3300041512 Bacteria 1613
385 Ga0451853_2640337 3300041512 Bacteria 672
386 Ga0439448_0007299 3300042005 Bacteria 3200
387 Ga0439463_047501 3300042016 Bacteria 1094
388 Ga0439463_149134 3300042016 Bacteria 606
389 Ga0450920_001993 3300042122 Bacteria 3446
390 Ga0450920_140547 3300042122 Bacteria 511
391 Ga0450898_046728 3300042134 Bacteria 829
392 Ga0450910_020454 3300042147 Bacteria 998
393 Ga0439435_0136339 3300042436 Bacteria 779
394 Ga0439460_0160753 3300042461 Bacteria 753
395 Ga0466965_0281656 3300044683 Bacteria 898
396 Ga0466963_0000301 3300044694 Bacteria 22253
397 Ga0466963_0320595 3300044694 Bacteria 1091
398 Ga0466963_0491483 3300044694 Bacteria 866
399 Ga0466960_0116870 3300044901 Bacteria 1392
400 Ga0451576_0304077 3300045051 Bacteria 1668
401 Ga0466958_0711869 3300045836 Bacteria 654
402 Ga0466967_0523245 3300045976 Bacteria 1166
403 Ga0466967_1566981 3300045976 Bacteria 656
404 Ga0466967_2463417 3300045976 Bacteria 515
405 Ga0495592_0026085 3300046454 Bacteria 4433
406 Ga0495592_0109114 3300046454 Bacteria 1961
407 Ga0495603_0000938 3300046455 Bacteria 16778
408 Ga0495629_0002708 3300046459 Bacteria 13568
409 Ga0495629_0074689 3300046459 Bacteria 2367
410 Ga0495653_0713434 3300046463 Bacteria 608
411 Ga0495580_0776350 3300046472 Bacteria 623
412 Ga0495582_0000003 3300046473 Bacteria 168880
413 Ga0495605_0106513 3300046474 Bacteria 1283
414 Ga0495662_0198144 3300046476 Bacteria 990
415 Ga0495664_0125948 3300046477 Bacteria 1550
416 Ga0495584_0289845 3300046491 Bacteria 832
417 Ga0495594_0254464 3300046499 Bacteria 1000
418 Ga0495596_0327177 3300046500 Unclassified 596
419 Ga0495583_0119251 3300046506 Bacteria 1112
420 Ga0495608_0085004 3300046511 Bacteria 2051
421 Ga0495608_0444193 3300046511 Bacteria 790
422 Ga0495610_0315381 3300046512 Bacteria 599
423 Ga0495616_0144153 3300046513 Bacteria 1082
424 Ga0495618_0000144 3300046514 Bacteria 50904
425 Ga0495618_0881612 3300046514 Bacteria 517
426 Ga0495620_0000352 3300046515 Bacteria 31894
427 Ga0495620_0227046 3300046515 Bacteria 714
428 Ga0495628_0141048 3300046516 Bacteria 1839
429 Ga0495628_0150514 3300046516 Bacteria 1773
430 Ga0495630_0024086 3300046517 Bacteria 4502
431 Ga0495630_0656082 3300046517 Bacteria 803
432 Ga0495630_0922616 3300046517 Bacteria 665
433 Ga0495631_0256612 3300046518 Bacteria 745
434 Ga0495632_0199852 3300046519 Bacteria 911
435 Ga0495637_0069011 3300046520 Bacteria 1431
436 Ga0495663_0027657 3300046525 Bacteria 1665
437 Ga0495663_0329324 3300046525 Bacteria 554
438 Ga0495642_0163032 3300046528 Bacteria 967
439 Ga0495652_0000010 3300046529 Bacteria 261584
440 Ga0495652_0133453 3300046529 Bacteria 1962
441 Ga0495652_0352723 3300046529 Bacteria 1053
442 Ga0495652_0740646 3300046529 Unclassified 658
443 Ga0495654_0267910 3300046530 Bacteria 706
444 Ga0495640_0081700 3300046533 Bacteria 2148
445 Ga0495640_0159172 3300046533 Bacteria 1448
446 Ga0495586_0487960 3300046535 Bacteria 711
447 Ga0495587_0050595 3300046536 Bacteria 2458
448 Ga0495587_0104148 3300046536 Bacteria 1633
449 Ga0495587_0580277 3300046536 Bacteria 618
450 Ga0495609_0108944 3300046538 Bacteria 1196
451 Ga0495621_0155674 3300046539 Bacteria 901
452 Ga0495645_0002432 3300046543 Bacteria 12646
453 Ga0495645_0022178 3300046543 Bacteria 4592
454 Ga0495645_0028840 3300046543 Bacteria 4033
455 Ga0495645_0897881 3300046543 Bacteria 526
456 Ga0495633_0306633 3300046558 Bacteria 721
457 Ga0495667_0000505 3300046559 Bacteria 24881
458 Ga0495667_0435236 3300046559 Unclassified 825
459 Ga0495656_0568042 3300046615 Bacteria 605
460 Ga0495668_0084471 3300046616 Bacteria 1741
461 Ga0495634_0000638 3300046642 Bacteria 34084
462 Ga0495634_0002399 3300046642 Bacteria 15606
463 Ga0495634_0434404 3300046642 Bacteria 776
464 Ga0495634_0615291 3300046642 Bacteria 629
465 Ga0495611_0024895 3300046648 Bacteria 2605
466 Ga0495625_0000032 3300046660 Bacteria 233135
467 Ga0495635_0140929 3300046663 Bacteria 1642
468 Ga0495635_0334066 3300046663 Bacteria 1013
469 Ga0495635_1006634 3300046663 Bacteria 530
470 Ga0495659_0003146 3300046664 Bacteria 5294
471 Ga0495661_0193844 3300046665 Bacteria 1068
472 Ga0495646_0168339 3300046680 Bacteria 1209
473 Ga0495646_0552993 3300046680 Bacteria 587
474 Ga0495647_0001468 3300046681 Bacteria 7312
475 Ga0495647_0116643 3300046681 Bacteria 1119
476 Ga0495658_0000001 3300046683 Bacteria 385362
477 Ga0495658_0003950 3300046683 Bacteria 7317
478 Ga0495669_0010118 3300046684 Bacteria 3983
479 Ga0495669_0115857 3300046684 Bacteria 1254
480 Ga0495669_0168151 3300046684 Bacteria 1042
481 Ga0495624_0746873 3300046690 Unclassified 580
482 Ga0495670_0113667 3300046691 Bacteria 1402
483 Ga0495649_0310984 3300046694 Bacteria 801
484 Ga0495589_0107163 3300046794 Bacteria 1350
485 Ga0495589_0460660 3300046794 Bacteria 581
486 Ga0495600_0002554 3300046809 Bacteria 10488
487 Ga0495600_0807637 3300046809 Bacteria 558
488 Ga0495660_0108298 3300046810 Bacteria 1421
489 Ga0495604_0199701 3300047317 Bacteria 1388
490 Ga0495674_0000010 3300047319 Bacteria 285794
491 Ga0495674_0331901 3300047319 Bacteria 1237
492 Ga0495672_0000281 3300047320 Bacteria 70653
493 Ga0495676_0000346 3300047321 Bacteria 37821
494 Ga0495680_0023946 3300047322 Bacteria 5072
495 Ga0495680_0068558 3300047322 Bacteria 2709
496 Ga0495683_0232976 3300047323 Bacteria 816
497 Ga0495677_0021205 3300047445 Bacteria 2355
498 Ga0495679_102000 3300047446 Bacteria 796
499 Ga0495685_042986 3300047447 Bacteria 1542
500 Ga0495684_0202239 3300047471 Bacteria 1464
501 Ga0495686_0084442 3300047472 Bacteria 1935
502 Ga0495686_0307544 3300047472 Bacteria 873
503 Ga0495602_0163151 3300048088 Bacteria 1738
504 Ga0495615_0032706 3300048090 Bacteria 1256
505 Ga0495615_0209677 3300048090 Bacteria 604
506 Ga0496100_0000001 3300048903 Bacteria 530179
507 Ga0496100_0065413 3300048903 Unclassified 2409
508 Ga0496100_0296774 3300048903 Bacteria 1209
509 Ga0496100_1376951 3300048903 Bacteria 557
510 Ga0496101_0000028 3300048904 Bacteria 198664
511 Ga0496102_0000561 3300048905 Bacteria 39545
512 Ga0496102_0063392 3300048905 Bacteria 3384
513 Ga0496103_0000057 3300048906 Bacteria 142223
514 Ga0496103_0238753 3300048906 Bacteria 1169
515 Ga0496103_0348692 3300048906 Bacteria 952
516 Ga0496104_0000213 3300048907 Bacteria 51219
517 Ga0496104_0011173 3300048907 Bacteria 8036
518 Ga0496105_0001058 3300048908 Bacteria 19090
519 Ga0496105_0035285 3300048908 Bacteria 4116
520 Ga0496106_0000055 3300048909 Bacteria 91570
521 Ga0496107_0000002 3300048910 Bacteria 320871
522 Ga0496108_0000005 3300048911 Bacteria 535059
523 Ga0496109_0000002 3300048912 Bacteria 443393
524 Ga0496109_0165178 3300048912 Bacteria 2075
525 Ga0496109_0633654 3300048912 Bacteria 1006
526 Ga0496110_0004182 3300048913 Bacteria 11148
527 Ga0496110_0921887 3300048913 Bacteria 780
528 Ga0496110_1131692 3300048913 Bacteria 691
529 Ga0496110_1591970 3300048913 Bacteria 563
530 Ga0496110_1782697 3300048913 Bacteria 526
531 Ga0496111_0000117 3300048914 Bacteria 34553
532 Ga0496111_0462455 3300048914 Bacteria 936
533 Ga0496111_0615947 3300048914 Bacteria 794
534 Ga0496112_0000013 3300048915 Bacteria 237194
535 Ga0496112_1006690 3300048915 Bacteria 753
536 Ga0496113_0157328 3300048916 Bacteria 1795
537 Ga0496113_1205028 3300048916 Bacteria 591
538 Ga0496114_0000003 3300048917 Bacteria 630981
539 Ga0496114_1412892 3300048917 Bacteria 583
540 Ga0496115_0000031 3300048918 Bacteria 138258
541 Ga0496115_0459754 3300048918 Bacteria 1027
542 Ga0496115_0819923 3300048918 Bacteria 723
543 Ga0496118_0453632 3300048921 Unclassified 650
544 Ga0496119_0318582 3300048922 Bacteria 762
545 Ga0496126_0003365 3300048929 Bacteria 20276
546 Ga0496126_0188226 3300048929 Bacteria 1749
547 Ga0496126_1266830 3300048929 Bacteria 539
548 Ga0501307_034394 3300049162 Bacteria 716
549 Ga0501031_0000279 3300049568 Bacteria 28880
550 Ga0501031_0040039 3300049568 Bacteria 3059
551 Ga0501031_0681970 3300049568 Bacteria 660
552 Ga0501032_0000532 3300049569 Bacteria 30935
553 Ga0501032_0006256 3300049569 Bacteria 8765
554 Ga0501032_0209739 3300049569 Bacteria 1270
555 Ga0501033_0000635 3300049570 Bacteria 32423
556 Ga0501033_0032194 3300049570 Bacteria 3937
557 Ga0501033_0313147 3300049570 Bacteria 1103
558 Ga0501034_0043408 3300049571 Bacteria 4550
559 Ga0501034_0057117 3300049571 Bacteria 3924
560 Ga0501034_0100908 3300049571 Bacteria 2880
561 Ga0501034_0316488 3300049571 Bacteria 1494
562 Ga0501034_0362009 3300049571 Bacteria 1377
563 Ga0501034_0463293 3300049571 Bacteria 1184
564 Ga0501034_0512890 3300049571 Bacteria 1112
565 Ga0501036_0000109 3300049572 Bacteria 50975
566 Ga0501036_0094448 3300049572 Bacteria 2527
567 Ga0501036_0127828 3300049572 Bacteria 2146
568 Ga0501036_0235038 3300049572 Bacteria 1538
569 Ga0501036_0325146 3300049572 Bacteria 1285
570 Ga0501036_0502590 3300049572 Bacteria 1009
571 Ga0501036_0654111 3300049572 Bacteria 870
572 Ga0501036_0994959 3300049572 Bacteria 687
573 Ga0501037_0000601 3300049573 Bacteria 28089
574 Ga0501037_0003995 3300049573 Bacteria 10693
575 Ga0501037_0115612 3300049573 Bacteria 1931
576 Ga0501037_0937940 3300049573 Bacteria 566
577 Ga0501038_0000584 3300049574 Bacteria 32397
578 Ga0501038_0156137 3300049574 Bacteria 1858
579 Ga0501038_0188510 3300049574 Bacteria 1660
580 Ga0501038_0697984 3300049574 Bacteria 760
581 Ga0501039_0000274 3300049575 Bacteria 36859
582 Ga0501039_0040793 3300049575 Bacteria 3582
583 Ga0501039_0043256 3300049575 Bacteria 3479
584 Ga0501039_0119750 3300049575 Bacteria 2062
585 Ga0501039_1327507 3300049575 Bacteria 555
586 Ga0501040_0000041 3300049576 Bacteria 58334
587 Ga0501040_0013447 3300049576 Bacteria 5379
588 Ga0501040_0030810 3300049576 Bacteria 3624
589 Ga0501040_0120644 3300049576 Bacteria 1839
590 Ga0501040_0150376 3300049576 Bacteria 1643
591 Ga0501040_0154781 3300049576 Bacteria 1618
592 Ga0501040_0308703 3300049576 Bacteria 1131
593 Ga0501041_0000074 3300049577 Bacteria 38021
594 Ga0501041_0010875 3300049577 Bacteria 5369
595 Ga0501041_0027854 3300049577 Bacteria 3407
596 Ga0501041_0738890 3300049577 Bacteria 630
597 Ga0501042_0000032 3300049578 Bacteria 44524
598 Ga0501042_0002281 3300049578 Bacteria 11713
599 Ga0501042_0100032 3300049578 Bacteria 2084
600 Ga0501042_0169256 3300049578 Bacteria 1577
601 Ga0501043_0002422 3300049579 Bacteria 15787
602 Ga0501043_0015835 3300049579 Bacteria 5909
603 Ga0501043_0174063 3300049579 Bacteria 1678
604 Ga0501043_0222609 3300049579 Bacteria 1459
605 Ga0501043_0259435 3300049579 Bacteria 1337
606 Ga0501043_0721240 3300049579 Bacteria 727
607 Ga0501043_0799100 3300049579 Bacteria 682
608 Ga0501046_0023278 3300049580 Bacteria 5096
609 Ga0501046_0065747 3300049580 Bacteria 2828
610 Ga0501046_0069401 3300049580 Bacteria 2742
611 Ga0501046_0078574 3300049580 Bacteria 2552
612 Ga0501046_0088122 3300049580 Bacteria 2390
613 Ga0501046_0218994 3300049580 Bacteria 1410
614 Ga0501047_0000626 3300049581 Bacteria 37305
615 Ga0501047_0003717 3300049581 Bacteria 14367
616 Ga0501047_0026314 3300049581 Bacteria 5597
617 Ga0501047_0621292 3300049581 Bacteria 901
618 Ga0501047_0789523 3300049581 Bacteria 764
619 Ga0501048_0000229 3300049582 Bacteria 36840
620 Ga0501048_0003254 3300049582 Bacteria 12376
621 Ga0501048_0012815 3300049582 Bacteria 6230
622 Ga0501048_0053711 3300049582 Bacteria 2863
623 Ga0501048_1068455 3300049582 Bacteria 581
624 Ga0501067_0022285 3300049583 Bacteria 3505
625 Ga0501067_0028158 3300049583 Bacteria 3112
626 Ga0501067_0065893 3300049583 Bacteria 2005
627 Ga0501068_0000206 3300049584 Bacteria 28346
628 Ga0501068_0002695 3300049584 Bacteria 9416
629 Ga0501068_0002787 3300049584 Bacteria 9294
630 Ga0501068_0015476 3300049584 Bacteria 4382
631 Ga0501068_0045430 3300049584 Bacteria 2646
632 Ga0501069_0000346 3300049585 Bacteria 20954
633 Ga0501069_0008610 3300049585 Bacteria 5367
634 Ga0501069_0095508 3300049585 Bacteria 1683
635 Ga0501069_0104240 3300049585 Bacteria 1611
636 Ga0501069_0221826 3300049585 Bacteria 1099
637 Ga0501070_0004748 3300049586 Bacteria 11628
638 Ga0501070_0015220 3300049586 Bacteria 6474
639 Ga0501070_0057363 3300049586 Bacteria 3228
640 Ga0501070_0125487 3300049586 Bacteria 2121
641 Ga0501070_0285935 3300049586 Bacteria 1345
642 Ga0501070_0416881 3300049586 Bacteria 1085
643 Ga0501070_0689737 3300049586 Bacteria 808
644 Ga0501070_1095325 3300049586 Bacteria 615
645 Ga0501071_0000010 3300049587 Bacteria 67846
646 Ga0501071_0015171 3300049587 Bacteria 5284
647 Ga0501071_0044669 3300049587 Bacteria 3178
648 Ga0501071_0056046 3300049587 Bacteria 2846
649 Ga0501071_0056984 3300049587 Bacteria 2823
650 Ga0501071_0516239 3300049587 Bacteria 917
651 Ga0501071_0782077 3300049587 Bacteria 736
652 Ga0501071_1110459 3300049587 Bacteria 611
653 Ga0501071_1197016 3300049587 Bacteria 587
654 Ga0501071_1382957 3300049587 Bacteria 543
655 Ga0501072_0003756 3300049588 Bacteria 11460
656 Ga0501072_0006030 3300049588 Bacteria 9243
657 Ga0501072_0012212 3300049588 Bacteria 6563
658 Ga0501072_0016459 3300049588 Bacteria 5678
659 Ga0501072_0025595 3300049588 Bacteria 4596
660 Ga0501072_0090888 3300049588 Bacteria 2424
661 Ga0501072_0195176 3300049588 Bacteria 1614
662 Ga0501072_0304247 3300049588 Bacteria 1267
663 Ga0501072_0583374 3300049588 Bacteria 882
664 Ga0501072_0879890 3300049588 Bacteria 700
665 Ga0501072_1298497 3300049588 Unclassified 564
666 Ga0501072_1483277 3300049588 Bacteria 524
667 Ga0501073_0001677 3300049589 Bacteria 16418
668 Ga0501073_0006442 3300049589 Bacteria 8733
669 Ga0501073_0018235 3300049589 Bacteria 5071
670 Ga0501073_0201672 3300049589 Bacteria 1376
671 Ga0501074_0000437 3300049590 Bacteria 24878
672 Ga0501074_0045962 3300049590 Bacteria 3157
673 Ga0501074_0072904 3300049590 Bacteria 2466
674 Ga0501074_0128010 3300049590 Bacteria 1817
675 Ga0501074_0155372 3300049590 Bacteria 1634
676 Ga0501074_0165974 3300049590 Bacteria 1576
677 Ga0501074_0489497 3300049590 Bacteria 872
678 Ga0501074_0546987 3300049590 Bacteria 820
679 Ga0501074_0861787 3300049590 Bacteria 638
680 Ga0501074_0910440 3300049590 Bacteria 619
681 Ga0501075_0002279 3300049591 Bacteria 12723
682 Ga0501075_0007601 3300049591 Bacteria 7521
683 Ga0501075_0034158 3300049591 Bacteria 3785
684 Ga0501075_0036960 3300049591 Bacteria 3645
685 Ga0501075_0126563 3300049591 Bacteria 1945
686 Ga0501075_0286369 3300049591 Bacteria 1255
687 Ga0501075_1294103 3300049591 Bacteria 552
688 Ga0501076_0022848 3300049592 Bacteria 4812
689 Ga0501076_0035853 3300049592 Bacteria 3882
690 Ga0501076_0046939 3300049592 Bacteria 3413
691 Ga0501076_0069563 3300049592 Bacteria 2813
692 Ga0501076_0074637 3300049592 Bacteria 2717
693 Ga0501076_0100488 3300049592 Bacteria 2330
694 Ga0501076_0160439 3300049592 Bacteria 1831
695 Ga0501076_0169944 3300049592 Bacteria 1777
696 Ga0501076_0589648 3300049592 Bacteria 917
697 Ga0501076_0636730 3300049592 Bacteria 880
698 Ga0501076_0645994 3300049592 Bacteria 873
699 Ga0501076_0909309 3300049592 Bacteria 725
700 Ga0501076_1114196 3300049592 Bacteria 650
701 Ga0501077_0000209 3300049593 Bacteria 34106
702 Ga0501077_0002022 3300049593 Bacteria 12247
703 Ga0501077_0068050 3300049593 Bacteria 2257
704 Ga0501077_0216015 3300049593 Bacteria 1219
705 Ga0501077_0589351 3300049593 Bacteria 714
706 Ga0501077_0799913 3300049593 Bacteria 606
707 Ga0501077_1132571 3300049593 Bacteria 504
708 Ga0501079_0000048 3300049741 Bacteria 51859
709 Ga0501079_0004735 3300049741 Bacteria 10076
710 Ga0501079_0005171 3300049741 Bacteria 9700
711 Ga0501079_0032762 3300049741 Bacteria 3996
712 Ga0501079_0083902 3300049741 Bacteria 2465
713 Ga0501079_0264061 3300049741 Bacteria 1345
714 Ga0501079_0325807 3300049741 Bacteria 1203
715 Ga0501079_0387116 3300049741 Bacteria 1096
716 Ga0501079_0735460 3300049741 Bacteria 776
717 Ga0501079_1612606 3300049741 Bacteria 510
718 Ga0501080_0000229 3300049742 Bacteria 42083
719 Ga0501080_0040209 3300049742 Bacteria 4362
720 Ga0501080_0109081 3300049742 Bacteria 2565
721 Ga0501080_0855398 3300049742 Bacteria 795
722 Ga0501080_1075485 3300049742 Bacteria 695
723 Ga0501080_1152495 3300049742 Bacteria 668
724 Ga0501080_1196364 3300049742 Bacteria 653
725 Ga0501080_1227041 3300049742 Bacteria 644
726 Ga0501080_1731187 3300049742 Bacteria 527
727 Ga0501080_1831875 3300049742 Bacteria 509
728 Ga0501081_0000002 3300049743 Bacteria 102870
729 Ga0501081_0008759 3300049743 Bacteria 6575
730 Ga0501081_0043432 3300049743 Bacteria 3084
731 Ga0501081_0076962 3300049743 Bacteria 2330
732 Ga0501081_0086083 3300049743 Bacteria 2206
733 Ga0501081_0086271 3300049743 Bacteria 2204
734 Ga0501081_0087560 3300049743 Bacteria 2187
735 Ga0501083_0000160 3300049744 Bacteria 44202
736 Ga0501083_0004874 3300049744 Bacteria 9495
737 Ga0501083_0029750 3300049744 Bacteria 3753
738 Ga0501083_0130801 3300049744 Bacteria 1645
739 Ga0501083_0217935 3300049744 Bacteria 1244
740 Ga0501083_0595252 3300049744 Bacteria 719
741 Ga0501035_0000851 3300049822 Bacteria 32557
742 Ga0501035_0026503 3300049822 Bacteria 5302
743 Ga0501035_0179034 3300049822 Bacteria 1828
744 Ga0501035_0218688 3300049822 Bacteria 1627
745 Ga0501035_0371544 3300049822 Bacteria 1194
746 Ga0501044_0054048 3300049823 Bacteria 4129
747 Ga0501044_0169835 3300049823 Bacteria 2153
748 Ga0501044_0325183 3300049823 Bacteria 1461
749 Ga0501044_0488677 3300049823 Bacteria 1133
750 Ga0501044_0787155 3300049823 Bacteria 831
751 Ga0501045_0000030 3300049824 Bacteria 60324
752 Ga0501045_0003616 3300049824 Bacteria 10627
753 Ga0501045_0025990 3300049824 Bacteria 4209
754 Ga0501045_0403011 3300049824 Bacteria 1018
755 Ga0501045_0626453 3300049824 Bacteria 796
756 Ga0501045_0641500 3300049824 Bacteria 785
757 nmdc:mga0yw44_558733_c1 3300050492 Bacteria 777
758 nmdc:mga05p37_398960_c1 3300050507 Bacteria 1606
759 nmdc:mga0qj67_57173_c1 3300050509 Bacteria 3092
760 nmdc:mga08y16_12641_c1 3300050511 Bacteria 8881
761 nmdc:mga08y16_58347_c1 3300050511 Bacteria 4033
762 nmdc:mga0rr50_296329_c1 3300050513 Bacteria 1352
763 nmdc:mga0a205_94_c1 3300050515 Bacteria 50261
764 Ga0495601_0024071 3300053077 Bacteria 3747
765 Ga0495601_0736761 3300053077 Bacteria 628
766 Ga0495601_0773621 3300053077 Bacteria 610
767 Ga0495612_0000031 3300053078 Bacteria 80955
768 Ga0495612_0044806 3300053078 Bacteria 1810
769 Ga0495655_0000005 3300053083 Bacteria 257472
770 Ga0495595_0371949 3300053084 Bacteria 723
771 Ga0495595_0533120 3300053084 Bacteria 599
772 Ga0495595_0689070 3300053084 Bacteria 523
773 Ga0495619_0000144 3300053085 Bacteria 52554
774 Ga0495619_0000412 3300053085 Bacteria 29043
775 Ga0495619_0006971 3300053085 Bacteria 7152
776 Ga0495619_0075055 3300053085 Bacteria 2268
777 Ga0495619_0276200 3300053085 Bacteria 1164
778 Ga0495619_0752313 3300053085 Bacteria 661
779 Ga0500566_0087398 3300053094 Bacteria 1726
780 Ga0500628_000025 3300053129 Bacteria 62808
781 Ga0501084_0000207 3300054114 Bacteria 45680
782 Ga0501084_0003837 3300054114 Bacteria 12230
783 Ga0501084_0009901 3300054114 Bacteria 7879
784 Ga0501084_0037054 3300054114 Bacteria 4074
785 Ga0501084_0063259 3300054114 Bacteria 3097
786 Ga0501084_0075170 3300054114 Bacteria 2830
787 Ga0501084_0096036 3300054114 Bacteria 2489
788 Ga0501084_0196331 3300054114 Bacteria 1703
789 Ga0501084_0713147 3300054114 Bacteria 846
790 Ga0501084_1681742 3300054114 Bacteria 530
791 Ga0590071_207376 3300059421 Bacteria 516
792 Ga0501082_0004103 3300060353 Bacteria 12719
793 Ga0501082_0009851 3300060353 Bacteria 8234
794 Ga0501082_0033935 3300060353 Bacteria 4401
795 Ga0501082_0036007 3300060353 Bacteria 4264
796 Ga0501082_0042827 3300060353 Bacteria 3903
797 Ga0501082_0351194 3300060353 Unclassified 1286
798 Ga0501082_0415509 3300060353 Bacteria 1174
799 Ga0501082_0567790 3300060353 Bacteria 992
800 Ga0501082_0803124 3300060353 Bacteria 823
801 Ga0501082_1150348 3300060353 Bacteria 678
802 Ga0530510_0000881 3300061734 Bacteria 19771
803 Ga0530510_0001692 3300061734 Bacteria 14946
804 Ga0530510_0012637 3300061734 Bacteria 5935
805 Ga0530510_0072937 3300061734 Bacteria 2491
806 Ga0530510_0107220 3300061734 Bacteria 2044
807 Ga0530510_0181357 3300061734 Bacteria 1562
808 Ga0530510_0412193 3300061734 Bacteria 1019
809 Ga0530510_0612711 3300061734 Bacteria 828
810 Ga0530510_1108983 3300061734 Bacteria 606

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2883291878 2883296752 76
2 iso_pu_bacteria 2897803580 2897808184 79
3 3300005458 Ga0070681_11479090 Ga0070681_114790902 80
4 3300005530 Ga0070679_101788643 Ga0070679_1017886432 80
5 3300036401 Ga0373937_1599996 Ga0373937_1599996_27_281 80
6 iso_pu_bacteria 2534681786 2535485904 80
7 iso_pu_bacteria 2671180139 2671695023 80
8 iso_pu_bacteria 2854911287 2854913119 80
9 3300003373 JGI25407J50210_10032383 JGI25407J50210_100323831 81
10 3300003373 JGI25407J50210_10035157 JGI25407J50210_100351572 81
11 3300003373 JGI25407J50210_10049920 JGI25407J50210_100499202 81
12 3300005328 Ga0070676_10145657 Ga0070676_101456573 81
13 3300005334 Ga0068869_100258268 Ga0068869_1002582683 81
14 3300005338 Ga0068868_100534698 Ga0068868_1005346983 81
15 3300005341 Ga0070691_10075616 Ga0070691_100756162 81
16 3300005356 Ga0070674_100182647 Ga0070674_1001826472 81
17 3300005356 Ga0070674_101757634 Ga0070674_1017576341 81
18 3300005441 Ga0070700_100293555 Ga0070700_1002935552 81
19 3300005441 Ga0070700_100502924 Ga0070700_1005029241 81
20 3300005444 Ga0070694_100177171 Ga0070694_1001771712 81
21 3300005445 Ga0070708_100986814 Ga0070708_1009868142 81
22 3300005456 Ga0070678_100691891 Ga0070678_1006918912 81
23 3300005457 Ga0070662_100557677 Ga0070662_1005576772 81
24 3300005458 Ga0070681_11400767 Ga0070681_114007671 81
25 3300005459 Ga0068867_100059553 Ga0068867_1000595533 81
26 3300005459 Ga0068867_100587438 Ga0068867_1005874382 81
27 3300005530 Ga0070679_101098683 Ga0070679_1010986831 81
28 3300005535 Ga0070684_101041007 Ga0070684_1010410072 81
29 3300005544 Ga0070686_101052409 Ga0070686_1010524092 81
30 3300005545 Ga0070695_100110996 Ga0070695_1001109962 81
31 3300005545 Ga0070695_101736298 Ga0070695_1017362981 81
32 3300005546 Ga0070696_100624636 Ga0070696_1006246362 81
33 3300005547 Ga0070693_100150494 Ga0070693_1001504942 81
34 3300005549 Ga0070704_100082194 Ga0070704_1000821943 81
35 3300005564 Ga0070664_100405767 Ga0070664_1004057672 81
36 3300005577 Ga0068857_100065269 Ga0068857_1000652692 81
37 3300005578 Ga0068854_100005454 Ga0068854_1000054543 81
38 3300005615 Ga0070702_100427270 Ga0070702_1004272702 81
39 3300005615 Ga0070702_100604300 Ga0070702_1006043002 81
40 3300005616 Ga0068852_101998906 Ga0068852_1019989062 81
41 3300005719 Ga0068861_100473614 Ga0068861_1004736142 81
42 3300005841 Ga0068863_100459766 Ga0068863_1004597662 81
43 3300005844 Ga0068862_102333538 Ga0068862_1023335382 81
44 3300005937 Ga0081455_10036639 Ga0081455_100366393 81
45 3300005981 Ga0081538_10006799 Ga0081538_100067995 81
46 3300005981 Ga0081538_10008047 Ga0081538_100080477 81
47 3300005981 Ga0081538_10015130 Ga0081538_100151301 81
48 3300005981 Ga0081538_10019832 Ga0081538_100198324 81
49 3300005981 Ga0081538_10097866 Ga0081538_100978662 81
50 3300005981 Ga0081538_10132404 Ga0081538_101324043 81
51 3300006844 Ga0075428_100232563 Ga0075428_1002325633 81
52 3300006844 Ga0075428_100664991 Ga0075428_1006649912 81
53 3300009094 Ga0111539_10000483 Ga0111539_1000048338 81
54 3300009094 Ga0111539_10098590 Ga0111539_100985907 81
55 3300009098 Ga0105245_10013612 Ga0105245_100136123 81
56 3300009098 Ga0105245_10577520 Ga0105245_105775203 81
57 3300009147 Ga0114129_12437476 Ga0114129_124374762 81
58 3300009147 Ga0114129_13467244 Ga0114129_134672442 81
59 3300009148 Ga0105243_10214134 Ga0105243_102141342 81
60 3300009176 Ga0105242_10193921 Ga0105242_101939213 81
61 3300009551 Ga0105238_11032136 Ga0105238_110321363 81
62 3300009553 Ga0105249_10165424 Ga0105249_101654243 81
63 3300009553 Ga0105249_10449203 Ga0105249_104492032 81
64 3300010375 Ga0105239_10337335 Ga0105239_103373351 81
65 3300011119 Ga0105246_10159752 Ga0105246_101597522 81
66 3300012515 Ga0157338_1022085 Ga0157338_10220852 81
67 3300013100 Ga0157373_11001861 Ga0157373_110018612 81
68 3300013306 Ga0163162_10372730 Ga0163162_103727303 81
69 3300014326 Ga0157380_10370261 Ga0157380_103702612 81
70 3300014497 Ga0182008_10187178 Ga0182008_101871783 81
71 3300017792 Ga0163161_10561304 Ga0163161_105613042 81
72 3300025899 Ga0207642_10139159 Ga0207642_101391593 81
73 3300025901 Ga0207688_10089068 Ga0207688_100890682 81
74 3300025903 Ga0207680_11032657 Ga0207680_110326572 81
75 3300025904 Ga0207647_10232934 Ga0207647_102329343 81
76 3300025907 Ga0207645_10140152 Ga0207645_101401523 81
77 3300025917 Ga0207660_10042447 Ga0207660_100424473 81
78 3300025919 Ga0207657_10361040 Ga0207657_103610402 81
79 3300025921 Ga0207652_10512575 Ga0207652_105125752 81
80 3300025924 Ga0207694_10528476 Ga0207694_105284761 81
81 3300025927 Ga0207687_10006580 Ga0207687_100065807 81
82 3300025927 Ga0207687_10124555 Ga0207687_101245553 81
83 3300025933 Ga0207706_10017951 Ga0207706_100179519 81
84 3300025934 Ga0207686_10253757 Ga0207686_102537572 81
85 3300025935 Ga0207709_10227322 Ga0207709_102273222 81
86 3300025937 Ga0207669_10237489 Ga0207669_102374892 81
87 3300025945 Ga0207679_10230742 Ga0207679_102307422 81
88 3300025961 Ga0207712_10089104 Ga0207712_100891043 81
89 3300025961 Ga0207712_10180299 Ga0207712_101802993 81
90 3300025981 Ga0207640_10113727 Ga0207640_101137273 81
91 3300026023 Ga0207677_10428297 Ga0207677_104282972 81
92 3300026075 Ga0207708_10017895 Ga0207708_100178953 81
93 3300026089 Ga0207648_10084916 Ga0207648_100849164 81
94 3300026089 Ga0207648_10166478 Ga0207648_101664783 81
95 3300026116 Ga0207674_10001054 Ga0207674_1000105432 81
96 3300026118 Ga0207675_100099600 Ga0207675_1000996002 81
97 3300026118 Ga0207675_100204736 Ga0207675_1002047363 81
98 3300026121 Ga0207683_10636838 Ga0207683_106368382 81
99 3300026142 Ga0207698_11901676 Ga0207698_119016762 81
100 3300027617 Ga0210002_1027818 Ga0210002_10278182 81
101 3300027717 Ga0209998_10063967 Ga0209998_100639672 81
102 3300027907 Ga0207428_10096660 Ga0207428_100966603 81
103 3300028380 Ga0268265_11131663 Ga0268265_111316632 81
104 3300028381 Ga0268264_10179874 Ga0268264_101798742 81
105 3300028653 Ga0265323_10254798 Ga0265323_102547982 81
106 3300031548 Ga0307408_100085517 Ga0307408_1000855173 81
107 3300031548 Ga0307408_100440213 Ga0307408_1004402133 81
108 3300031731 Ga0307405_10036216 Ga0307405_100362162 81
109 3300031731 Ga0307405_10059393 Ga0307405_100593932 81
110 3300031824 Ga0307413_10024244 Ga0307413_100242443 81
111 3300031852 Ga0307410_10002132 Ga0307410_1000213214 81
112 3300031901 Ga0307406_10150927 Ga0307406_101509273 81
113 3300031901 Ga0307406_11154075 Ga0307406_111540752 81
114 3300031903 Ga0307407_10001268 Ga0307407_100012683 81
115 3300031911 Ga0307412_10560184 Ga0307412_105601842 81
116 3300031995 Ga0307409_100101103 Ga0307409_1001011032 81
117 3300032002 Ga0307416_100003017 Ga0307416_10000301713 81
118 3300032002 Ga0307416_100852473 Ga0307416_1008524732 81
119 3300032002 Ga0307416_101855517 Ga0307416_1018555172 81
120 3300032004 Ga0307414_10071892 Ga0307414_100718923 81
121 3300032005 Ga0307411_10025443 Ga0307411_100254433 81
122 3300032126 Ga0307415_100029129 Ga0307415_1000291295 81
123 3300032126 Ga0307415_101325721 Ga0307415_1013257212 81
124 3300035114 Ga0373939_0218580 Ga0373939_0218580_341_586 81
125 3300035242 Ga0373962_0021242 Ga0373962_0021242_18_263 81
126 3300035691 Ga0373931_0607788 Ga0373931_0607788_171_416 81
127 3300039447 Ga0436361_0509578 Ga0436361_0509578_156_437 81
128 3300042005 Ga0439448_0007299 Ga0439448_0007299_970_1215 81
129 3300042016 Ga0439463_047501 Ga0439463_047501_351_596 81
130 3300042016 Ga0439463_149134 Ga0439463_149134_50_295 81
131 3300042122 Ga0450920_001993 Ga0450920_001993_109_354 81
132 3300042436 Ga0439435_0136339 Ga0439435_0136339_134_379 81
133 3300042461 Ga0439460_0160753 Ga0439460_0160753_335_580 81
134 3300045051 Ga0451576_0304077 Ga0451576_0304077_361_606 81
135 3300046474 Ga0495605_0106513 Ga0495605_0106513_1012_1257 81
136 3300046500 Ga0495596_0327177 Ga0495596_0327177_275_520 81
137 3300046506 Ga0495583_0119251 Ga0495583_0119251_192_437 81
138 3300046512 Ga0495610_0315381 Ga0495610_0315381_153_398 81
139 3300046513 Ga0495616_0144153 Ga0495616_0144153_770_1015 81
140 3300046515 Ga0495620_0227046 Ga0495620_0227046_292_537 81
141 3300046518 Ga0495631_0256612 Ga0495631_0256612_112_357 81
142 3300046519 Ga0495632_0199852 Ga0495632_0199852_604_849 81
143 3300046520 Ga0495637_0069011 Ga0495637_0069011_768_1013 81
144 3300046525 Ga0495663_0027657 Ga0495663_0027657_1135_1380 81
145 3300046528 Ga0495642_0163032 Ga0495642_0163032_329_574 81
146 3300046530 Ga0495654_0267910 Ga0495654_0267910_153_398 81
147 3300046538 Ga0495609_0108944 Ga0495609_0108944_820_1065 81
148 3300046539 Ga0495621_0155674 Ga0495621_0155674_264_509 81
149 3300046558 Ga0495633_0306633 Ga0495633_0306633_261_506 81
150 3300046615 Ga0495656_0568042 Ga0495656_0568042_70_315 81
151 3300046616 Ga0495668_0084471 Ga0495668_0084471_376_621 81
152 3300046648 Ga0495611_0024895 Ga0495611_0024895_286_531 81
153 3300046664 Ga0495659_0003146 Ga0495659_0003146_4797_5042 81
154 3300046665 Ga0495661_0193844 Ga0495661_0193844_60_305 81
155 3300046684 Ga0495669_0115857 Ga0495669_0115857_113_358 81
156 3300046691 Ga0495670_0113667 Ga0495670_0113667_314_559 81
157 3300046694 Ga0495649_0310984 Ga0495649_0310984_129_374 81
158 3300046794 Ga0495589_0107163 Ga0495589_0107163_949_1194 81
159 3300046794 Ga0495589_0460660 Ga0495589_0460660_325_570 81
160 3300046810 Ga0495660_0108298 Ga0495660_0108298_134_379 81
161 3300047323 Ga0495683_0232976 Ga0495683_0232976_394_639 81
162 3300047445 Ga0495677_0021205 Ga0495677_0021205_1718_1963 81
163 3300047446 Ga0495679_102000 Ga0495679_102000_188_433 81
164 3300047447 Ga0495685_042986 Ga0495685_042986_521_766 81
165 3300048090 Ga0495615_0032706 Ga0495615_0032706_522_767 81
166 3300048906 Ga0496103_0238753 Ga0496103_0238753_337_582 81
167 3300049568 Ga0501031_0000279 Ga0501031_0000279_7833_8078 81
168 3300049568 Ga0501031_0040039 Ga0501031_0040039_890_1135 81
169 3300049568 Ga0501031_0681970 Ga0501031_0681970_76_321 81
170 3300049569 Ga0501032_0000532 Ga0501032_0000532_6129_6374 81
171 3300049569 Ga0501032_0006256 Ga0501032_0006256_1602_1847 81
172 3300049569 Ga0501032_0209739 Ga0501032_0209739_214_459 81
173 3300049570 Ga0501033_0000635 Ga0501033_0000635_3547_3792 81
174 3300049570 Ga0501033_0032194 Ga0501033_0032194_1828_2073 81
175 3300049570 Ga0501033_0313147 Ga0501033_0313147_171_416 81
176 3300049571 Ga0501034_0043408 Ga0501034_0043408_2890_3135 81
177 3300049571 Ga0501034_0100908 Ga0501034_0100908_1221_1466 81
178 3300049571 Ga0501034_0316488 Ga0501034_0316488_1028_1273 81
179 3300049572 Ga0501036_0000109 Ga0501036_0000109_3572_3817 81
180 3300049572 Ga0501036_0094448 Ga0501036_0094448_280_525 81
181 3300049572 Ga0501036_0502590 Ga0501036_0502590_259_504 81
182 3300049572 Ga0501036_0654111 Ga0501036_0654111_427_672 81
183 3300049572 Ga0501036_0994959 Ga0501036_0994959_29_274 81
184 3300049573 Ga0501037_0000601 Ga0501037_0000601_7141_7386 81
185 3300049573 Ga0501037_0003995 Ga0501037_0003995_1925_2170 81
186 3300049573 Ga0501037_0115612 Ga0501037_0115612_1435_1680 81
187 3300049574 Ga0501038_0000584 Ga0501038_0000584_28620_28865 81
188 3300049574 Ga0501038_0188510 Ga0501038_0188510_209_454 81
189 3300049575 Ga0501039_0000274 Ga0501039_0000274_20704_20949 81
190 3300049575 Ga0501039_0040793 Ga0501039_0040793_1221_1466 81
191 3300049575 Ga0501039_0043256 Ga0501039_0043256_1474_1719 81
192 3300049576 Ga0501040_0000041 Ga0501040_0000041_14202_14447 81
193 3300049576 Ga0501040_0013447 Ga0501040_0013447_2348_2593 81
194 3300049576 Ga0501040_0120644 Ga0501040_0120644_1328_1573 81
195 3300049576 Ga0501040_0150376 Ga0501040_0150376_316_561 81
196 3300049576 Ga0501040_0154781 Ga0501040_0154781_1185_1430 81
197 3300049577 Ga0501041_0000074 Ga0501041_0000074_24562_24807 81
198 3300049577 Ga0501041_0010875 Ga0501041_0010875_2253_2498 81
199 3300049577 Ga0501041_0027854 Ga0501041_0027854_1435_1680 81
200 3300049577 Ga0501041_0738890 Ga0501041_0738890_74_319 81
201 3300049578 Ga0501042_0000032 Ga0501042_0000032_8720_8965 81
202 3300049578 Ga0501042_0002281 Ga0501042_0002281_719_964 81
203 3300049578 Ga0501042_0100032 Ga0501042_0100032_471_716 81
204 3300049578 Ga0501042_0169256 Ga0501042_0169256_538_783 81
205 3300049579 Ga0501043_0002422 Ga0501043_0002422_1094_1339 81
206 3300049579 Ga0501043_0015835 Ga0501043_0015835_4191_4436 81
207 3300049579 Ga0501043_0174063 Ga0501043_0174063_1265_1510 81
208 3300049579 Ga0501043_0222609 Ga0501043_0222609_123_368 81
209 3300049580 Ga0501046_0023278 Ga0501046_0023278_3572_3817 81
210 3300049580 Ga0501046_0065747 Ga0501046_0065747_1865_2110 81
211 3300049580 Ga0501046_0078574 Ga0501046_0078574_903_1148 81
212 3300049580 Ga0501046_0088122 Ga0501046_0088122_275_520 81
213 3300049581 Ga0501047_0000626 Ga0501047_0000626_28616_28861 81
214 3300049581 Ga0501047_0003717 Ga0501047_0003717_6918_7163 81
215 3300049582 Ga0501048_0000229 Ga0501048_0000229_14168_14413 81
216 3300049582 Ga0501048_0003254 Ga0501048_0003254_2253_2498 81
217 3300049582 Ga0501048_0012815 Ga0501048_0012815_296_541 81
218 3300049582 Ga0501048_0053711 Ga0501048_0053711_1975_2220 81
219 3300049583 Ga0501067_0028158 Ga0501067_0028158_1353_1598 81
220 3300049583 Ga0501067_0065893 Ga0501067_0065893_511_756 81
221 3300049584 Ga0501068_0000206 Ga0501068_0000206_3568_3813 81
222 3300049584 Ga0501068_0002695 Ga0501068_0002695_2253_2498 81
223 3300049584 Ga0501068_0002787 Ga0501068_0002787_4089_4334 81
224 3300049584 Ga0501068_0045430 Ga0501068_0045430_1066_1311 81
225 3300049585 Ga0501069_0000346 Ga0501069_0000346_18847_19092 81
226 3300049585 Ga0501069_0008610 Ga0501069_0008610_1557_1802 81
227 3300049585 Ga0501069_0104240 Ga0501069_0104240_1105_1350 81
228 3300049586 Ga0501070_0004748 Ga0501070_0004748_3446_3691 81
229 3300049586 Ga0501070_0015220 Ga0501070_0015220_314_559 81
230 3300049586 Ga0501070_0416881 Ga0501070_0416881_409_654 81
231 3300049586 Ga0501070_0689737 Ga0501070_0689737_501_746 81
232 3300049586 Ga0501070_1095325 Ga0501070_1095325_341_586 81
233 3300049587 Ga0501071_0000010 Ga0501071_0000010_15914_16159 81
234 3300049587 Ga0501071_0015171 Ga0501071_0015171_1602_1847 81
235 3300049587 Ga0501071_0044669 Ga0501071_0044669_1213_1458 81
236 3300049587 Ga0501071_0056984 Ga0501071_0056984_442_687 81
237 3300049587 Ga0501071_0782077 Ga0501071_0782077_478_723 81
238 3300049587 Ga0501071_1382957 Ga0501071_1382957_271_516 81
239 3300049588 Ga0501072_0006030 Ga0501072_0006030_1229_1474 81
240 3300049588 Ga0501072_0012212 Ga0501072_0012212_2830_3075 81
241 3300049588 Ga0501072_0025595 Ga0501072_0025595_3572_3817 81
242 3300049588 Ga0501072_0195176 Ga0501072_0195176_1203_1448 81
243 3300049588 Ga0501072_0304247 Ga0501072_0304247_232_477 81
244 3300049588 Ga0501072_0583374 Ga0501072_0583374_289_534 81
245 3300049589 Ga0501073_0001677 Ga0501073_0001677_2047_2292 81
246 3300049589 Ga0501073_0018235 Ga0501073_0018235_1566_1811 81
247 3300049590 Ga0501074_0000437 Ga0501074_0000437_8720_8965 81
248 3300049590 Ga0501074_0045962 Ga0501074_0045962_1439_1684 81
249 3300049590 Ga0501074_0072904 Ga0501074_0072904_1880_2125 81
250 3300049590 Ga0501074_0155372 Ga0501074_0155372_937_1182 81
251 3300049590 Ga0501074_0861787 Ga0501074_0861787_122_367 81
252 3300049591 Ga0501075_0002279 Ga0501075_0002279_8907_9152 81
253 3300049591 Ga0501075_0007601 Ga0501075_0007601_3566_3811 81
254 3300049591 Ga0501075_0036960 Ga0501075_0036960_2166_2411 81
255 3300049591 Ga0501075_0126563 Ga0501075_0126563_1573_1818 81
256 3300049591 Ga0501075_1294103 Ga0501075_1294103_289_534 81
257 3300049592 Ga0501076_0035853 Ga0501076_0035853_3568_3813 81
258 3300049592 Ga0501076_0046939 Ga0501076_0046939_2040_2285 81
259 3300049592 Ga0501076_0100488 Ga0501076_0100488_551_796 81
260 3300049592 Ga0501076_0160439 Ga0501076_0160439_579_824 81
261 3300049592 Ga0501076_0909309 Ga0501076_0909309_18_263 81
262 3300049592 Ga0501076_1114196 Ga0501076_1114196_21_266 81
263 3300049593 Ga0501077_0000209 Ga0501077_0000209_30322_30567 81
264 3300049593 Ga0501077_0002022 Ga0501077_0002022_2124_2369 81
265 3300049593 Ga0501077_1132571 Ga0501077_1132571_117_362 81
266 3300049741 Ga0501079_0000048 Ga0501079_0000048_30322_30567 81
267 3300049741 Ga0501079_0004735 Ga0501079_0004735_2253_2498 81
268 3300049741 Ga0501079_0032762 Ga0501079_0032762_927_1172 81
269 3300049741 Ga0501079_0264061 Ga0501079_0264061_309_554 81
270 3300049741 Ga0501079_0735460 Ga0501079_0735460_339_584 81
271 3300049741 Ga0501079_1612606 Ga0501079_1612606_106_351 81
272 3300049742 Ga0501080_0000229 Ga0501080_0000229_14743_14988 81
273 3300049742 Ga0501080_0040209 Ga0501080_0040209_2253_2498 81
274 3300049742 Ga0501080_0855398 Ga0501080_0855398_483_728 81
275 3300049743 Ga0501081_0000002 Ga0501081_0000002_51047_51292 81
276 3300049743 Ga0501081_0008759 Ga0501081_0008759_4707_4952 81
277 3300049743 Ga0501081_0043432 Ga0501081_0043432_1271_1516 81
278 3300049743 Ga0501081_0076962 Ga0501081_0076962_1943_2188 81
279 3300049743 Ga0501081_0087560 Ga0501081_0087560_1439_1684 81
280 3300049744 Ga0501083_0000160 Ga0501083_0000160_70_315 81
281 3300049744 Ga0501083_0029750 Ga0501083_0029750_1018_1263 81
282 3300049744 Ga0501083_0130801 Ga0501083_0130801_1214_1459 81
283 3300049822 Ga0501035_0000851 Ga0501035_0000851_24547_24792 81
284 3300049822 Ga0501035_0026503 Ga0501035_0026503_504_749 81
285 3300049822 Ga0501035_0179034 Ga0501035_0179034_800_1045 81
286 3300049823 Ga0501044_0054048 Ga0501044_0054048_1761_2006 81
287 3300049823 Ga0501044_0169835 Ga0501044_0169835_330_575 81
288 3300049823 Ga0501044_0325183 Ga0501044_0325183_1111_1356 81
289 3300049824 Ga0501045_0000030 Ga0501045_0000030_20582_20827 81
290 3300049824 Ga0501045_0003616 Ga0501045_0003616_9879_10124 81
291 3300049824 Ga0501045_0025990 Ga0501045_0025990_1881_2126 81
292 3300049824 Ga0501045_0626453 Ga0501045_0626453_295_540 81
293 3300050507 nmdc:mga05p37_398960_c1 nmdc:mga05p37_398960_c1_831_1076 81
294 3300050511 nmdc:mga08y16_12641_c1 nmdc:mga08y16_12641_c1_1587_1832 81
295 3300050511 nmdc:mga08y16_58347_c1 nmdc:mga08y16_58347_c1_1537_1782 81
296 3300054114 Ga0501084_0000207 Ga0501084_0000207_24562_24807 81
297 3300054114 Ga0501084_0003837 Ga0501084_0003837_11354_11599 81
298 3300054114 Ga0501084_0009901 Ga0501084_0009901_4488_4733 81
299 3300054114 Ga0501084_0075170 Ga0501084_0075170_584_829 81
300 3300060353 Ga0501082_0004103 Ga0501082_0004103_3568_3813 81
301 3300060353 Ga0501082_0009851 Ga0501082_0009851_5198_5443 81
302 3300060353 Ga0501082_0033935 Ga0501082_0033935_3438_3683 81
303 3300060353 Ga0501082_0567790 Ga0501082_0567790_399_644 81
304 3300060353 Ga0501082_0803124 Ga0501082_0803124_565_810 81
305 3300060353 Ga0501082_1150348 Ga0501082_1150348_419_664 81
306 3300061734 Ga0530510_0000881 Ga0530510_0000881_3568_3813 81
307 3300061734 Ga0530510_0012637 Ga0530510_0012637_2253_2498 81
308 3300061734 Ga0530510_0072937 Ga0530510_0072937_2106_2351 81
309 3300061734 Ga0530510_0107220 Ga0530510_0107220_1137_1382 81
310 3300061734 Ga0530510_0412193 Ga0530510_0412193_740_985 81
311 3300005343 Ga0070687_100023591 Ga0070687_1000235913 82
312 3300021441 Ga0213871_10092047 Ga0213871_100920472 82
313 3300025918 Ga0207662_10043963 Ga0207662_100439633 82
314 3300032168 Ga0316593_10290703 Ga0316593_102907031 82
315 3300033524 Ga0316592_1118771 Ga0316592_11187712 82
316 3300036401 Ga0373937_0849766 Ga0373937_0849766_503_751 82
317 3300039438 Ga0436360_0090361 Ga0436360_0090361_4630_4887 82
318 3300046463 Ga0495653_0713434 Ga0495653_0713434_115_363 82
319 3300046511 Ga0495608_0085004 Ga0495608_0085004_1757_2005 82
320 3300046511 Ga0495608_0444193 Ga0495608_0444193_493_741 82
321 3300046516 Ga0495628_0141048 Ga0495628_0141048_881_1129 82
322 3300046517 Ga0495630_0656082 Ga0495630_0656082_469_717 82
323 3300046529 Ga0495652_0352723 Ga0495652_0352723_748_996 82
324 3300046533 Ga0495640_0081700 Ga0495640_0081700_746_994 82
325 3300046536 Ga0495587_0580277 Ga0495587_0580277_102_350 82
326 3300046543 Ga0495645_0028840 Ga0495645_0028840_1105_1353 82
327 3300046642 Ga0495634_0434404 Ga0495634_0434404_123_371 82
328 3300046663 Ga0495635_1006634 Ga0495635_1006634_123_371 82
329 3300046680 Ga0495646_0168339 Ga0495646_0168339_945_1193 82
330 3300046809 Ga0495600_0807637 Ga0495600_0807637_64_312 82
331 3300047317 Ga0495604_0199701 Ga0495604_0199701_92_340 82
332 3300048088 Ga0495602_0163151 Ga0495602_0163151_697_945 82
333 3300049162 Ga0501307_034394 Ga0501307_034394_240_527 82
334 3300049574 Ga0501038_0156137 Ga0501038_0156137_152_400 82
335 3300049575 Ga0501039_0119750 Ga0501039_0119750_1796_2044 82
336 3300049576 Ga0501040_0030810 Ga0501040_0030810_34_282 82
337 3300049579 Ga0501043_0721240 Ga0501043_0721240_186_434 82
338 3300049580 Ga0501046_0069401 Ga0501046_0069401_913_1161 82
339 3300049587 Ga0501071_0056046 Ga0501071_0056046_85_333 82
340 3300049588 Ga0501072_0003756 Ga0501072_0003756_5564_5812 82
341 3300049588 Ga0501072_1298497 Ga0501072_1298497_219_476 82
342 3300049590 Ga0501074_0128010 Ga0501074_0128010_1552_1800 82
343 3300049591 Ga0501075_0034158 Ga0501075_0034158_162_410 82
344 3300049591 Ga0501075_0286369 Ga0501075_0286369_298_555 82
345 3300049592 Ga0501076_0069563 Ga0501076_0069563_168_425 82
346 3300049592 Ga0501076_0074637 Ga0501076_0074637_1012_1260 82
347 3300049593 Ga0501077_0068050 Ga0501077_0068050_189_437 82
348 3300049593 Ga0501077_0589351 Ga0501077_0589351_109_357 82
349 3300049741 Ga0501079_0005171 Ga0501079_0005171_5159_5407 82
350 3300049741 Ga0501079_0325807 Ga0501079_0325807_609_866 82
351 3300049742 Ga0501080_1152495 Ga0501080_1152495_365_613 82
352 3300049743 Ga0501081_0086083 Ga0501081_0086083_322_570 82
353 3300053078 Ga0495612_0044806 Ga0495612_0044806_1547_1795 82
354 3300053084 Ga0495595_0689070 Ga0495595_0689070_225_473 82
355 3300053085 Ga0495619_0075055 Ga0495619_0075055_1064_1312 82
356 3300054114 Ga0501084_0037054 Ga0501084_0037054_3362_3610 82
357 3300059421 Ga0590071_207376 Ga0590071_207376_91_339 82
358 3300060353 Ga0501082_0351194 Ga0501082_0351194_644_901 82
359 3300061734 Ga0530510_0001692 Ga0530510_0001692_11246_11494 82
360 3300061734 Ga0530510_1108983 Ga0530510_1108983_78_335 82
361 3300002459 JGI24751J29686_10108143 JGI24751J29686_101081432 83
362 3300005336 Ga0070680_101951238 Ga0070680_1019512381 83
363 3300005337 Ga0070682_100000011 Ga0070682_100000011229 83
364 3300005338 Ga0068868_100000445 Ga0068868_10000044522 83
365 3300005340 Ga0070689_100740479 Ga0070689_1007404792 83
366 3300005341 Ga0070691_10000270 Ga0070691_100002709 83
367 3300005356 Ga0070674_100000004 Ga0070674_10000000463 83
368 3300005356 Ga0070674_100077793 Ga0070674_1000777932 83
369 3300005365 Ga0070688_100088147 Ga0070688_1000881473 83
370 3300005435 Ga0070714_100035345 Ga0070714_1000353455 83
371 3300005435 Ga0070714_100146725 Ga0070714_1001467252 83
372 3300005436 Ga0070713_100022878 Ga0070713_1000228784 83
373 3300005439 Ga0070711_100012656 Ga0070711_1000126565 83
374 3300005456 Ga0070678_100186781 Ga0070678_1001867811 83
375 3300005457 Ga0070662_100000006 Ga0070662_10000000681 83
376 3300005466 Ga0070685_10492296 Ga0070685_104922963 83
377 3300005535 Ga0070684_100039321 Ga0070684_1000393213 83
378 3300005539 Ga0068853_100512817 Ga0068853_1005128172 83
379 3300005545 Ga0070695_100066741 Ga0070695_1000667413 83
380 3300005546 Ga0070696_100957244 Ga0070696_1009572441 83
381 3300005547 Ga0070693_100003426 Ga0070693_1000034263 83
382 3300005564 Ga0070664_100525220 Ga0070664_1005252201 83
383 3300005577 Ga0068857_100746874 Ga0068857_1007468741 83
384 3300005578 Ga0068854_100002872 Ga0068854_1000028723 83
385 3300005718 Ga0068866_10000004 Ga0068866_10000004100 83
386 3300005718 Ga0068866_10693725 Ga0068866_106937252 83
387 3300005719 Ga0068861_100981918 Ga0068861_1009819181 83
388 3300005834 Ga0068851_10007448 Ga0068851_100074483 83
389 3300006163 Ga0070715_10000014 Ga0070715_1000001471 83
390 3300006175 Ga0070712_100031071 Ga0070712_1000310713 83
391 3300006852 Ga0075433_10000051 Ga0075433_1000005115 83
392 3300009093 Ga0105240_11310515 Ga0105240_113105152 83
393 3300009098 Ga0105245_10000104 Ga0105245_1000010472 83
394 3300009148 Ga0105243_12567699 Ga0105243_125676992 83
395 3300009553 Ga0105249_12466972 Ga0105249_124669721 83
396 3300010375 Ga0105239_10061079 Ga0105239_100610793 83
397 3300010375 Ga0105239_10669072 Ga0105239_106690721 83
398 3300013307 Ga0157372_10000210 Ga0157372_1000021062 83
399 3300013308 Ga0157375_11324065 Ga0157375_113240652 83
400 3300014325 Ga0163163_10231626 Ga0163163_102316263 83
401 3300014325 Ga0163163_10265292 Ga0163163_102652921 83
402 3300014326 Ga0157380_12318845 Ga0157380_123188452 83
403 3300014497 Ga0182008_10448028 Ga0182008_104480281 83
404 3300014968 Ga0157379_11395269 Ga0157379_113952691 83
405 3300017792 Ga0163161_10175529 Ga0163161_101755291 83
406 3300020081 Ga0206354_10746139 Ga0206354_107461392 83
407 3300020082 Ga0206353_11724054 Ga0206353_117240542 83
408 3300025321 Ga0207656_10004764 Ga0207656_100047645 83
409 3300025899 Ga0207642_10000005 Ga0207642_10000005106 83
410 3300025905 Ga0207685_10000025 Ga0207685_1000002594 83
411 3300025915 Ga0207693_10041345 Ga0207693_100413453 83
412 3300025916 Ga0207663_10010849 Ga0207663_100108492 83
413 3300025924 Ga0207694_10000004 Ga0207694_1000000478 83
414 3300025925 Ga0207650_11846397 Ga0207650_118463971 83
415 3300025927 Ga0207687_10000015 Ga0207687_10000015193 83
416 3300025928 Ga0207700_10106824 Ga0207700_101068243 83
417 3300025929 Ga0207664_10061653 Ga0207664_100616531 83
418 3300025929 Ga0207664_11196899 Ga0207664_111968992 83
419 3300025933 Ga0207706_10000017 Ga0207706_1000001781 83
420 3300025937 Ga0207669_10000056 Ga0207669_1000005647 83
421 3300025937 Ga0207669_10181594 Ga0207669_101815942 83
422 3300025945 Ga0207679_10152448 Ga0207679_101524481 83
423 3300025981 Ga0207640_10001278 Ga0207640_1000127812 83
424 3300026023 Ga0207677_10000299 Ga0207677_1000029933 83
425 3300026041 Ga0207639_10745298 Ga0207639_107452982 83
426 3300026116 Ga0207674_11007377 Ga0207674_110073771 83
427 3300026118 Ga0207675_100180365 Ga0207675_1001803651 83
428 3300026121 Ga0207683_10223569 Ga0207683_102235692 83
429 3300027717 Ga0209998_10090460 Ga0209998_100904602 83
430 3300031728 Ga0316578_10337080 Ga0316578_103370802 83
431 3300031733 Ga0316577_10817901 Ga0316577_108179012 83
432 3300031911 Ga0307412_11371941 Ga0307412_113719412 83
433 3300032002 Ga0307416_102191830 Ga0307416_1021918302 83
434 3300032005 Ga0307411_10244186 Ga0307411_102441861 83
435 3300032005 Ga0307411_10621727 Ga0307411_106217272 83
436 3300035113 Ga0373936_0580106 Ga0373936_0580106_217_474 83
437 3300035170 Ga0373943_0085016 Ga0373943_0085016_98_355 83
438 3300035170 Ga0373943_0456594 Ga0373943_0456594_251_502 83
439 3300035398 Ga0316574_0504192 Ga0316574_0504192_83_352 83
440 3300035692 Ga0373935_0202855 Ga0373935_0202855_174_431 83
441 3300036401 Ga0373937_1036227 Ga0373937_1036227_261_512 83
442 3300036712 Ga0316584_1187171 Ga0316584_1187171_106_375 83
443 3300037312 Ga0395899_0985771 Ga0395899_0985771_247_498 83
444 3300037418 Ga0395900_0779044 Ga0395900_0779044_334_585 83
445 3300038996 Ga0242420_140503 Ga0242420_140503_132_383 83
446 3300039062 Ga0400483_158900 Ga0400483_158900_505_774 83
447 3300039450 Ga0436363_1473259 Ga0436363_1473259_74_346 83
448 3300041410 Ga0439461_0126984 Ga0439461_0126984_149_415 83
449 3300041411 Ga0439466_0072186 Ga0439466_0072186_65_331 83
450 3300041413 Ga0439465_0181790 Ga0439465_0181790_258_524 83
451 3300041460 Ga0451802_0732742 Ga0451802_0732742_149_400 83
452 3300041491 Ga0451833_0079236 Ga0451833_0079236_650_901 83
453 3300041494 Ga0451837_1632582 Ga0451837_1632582_46_315 83
454 3300041505 Ga0451849_0767292 Ga0451849_0767292_58_309 83
455 3300041505 Ga0451849_1533487 Ga0451849_1533487_682_933 83
456 3300042122 Ga0450920_140547 Ga0450920_140547_168_434 83
457 3300042134 Ga0450898_046728 Ga0450898_046728_461_727 83
458 3300042147 Ga0450910_020454 Ga0450910_020454_409_675 83
459 3300044694 Ga0466963_0320595 Ga0466963_0320595_658_909 83
460 3300045976 Ga0466967_1566981 Ga0466967_1566981_131_403 83
461 3300045976 Ga0466967_2463417 Ga0466967_2463417_77_328 83
462 3300046454 Ga0495592_0026085 Ga0495592_0026085_336_587 83
463 3300046454 Ga0495592_0109114 Ga0495592_0109114_797_1048 83
464 3300046455 Ga0495603_0000938 Ga0495603_0000938_15079_15330 83
465 3300046473 Ga0495582_0000003 Ga0495582_0000003_130466_130717 83
466 3300046476 Ga0495662_0198144 Ga0495662_0198144_563_814 83
467 3300046477 Ga0495664_0125948 Ga0495664_0125948_581_832 83
468 3300046491 Ga0495584_0289845 Ga0495584_0289845_253_510 83
469 3300046516 Ga0495628_0150514 Ga0495628_0150514_961_1212 83
470 3300046517 Ga0495630_0024086 Ga0495630_0024086_3844_4101 83
471 3300046517 Ga0495630_0922616 Ga0495630_0922616_60_311 83
472 3300046529 Ga0495652_0133453 Ga0495652_0133453_141_392 83
473 3300046529 Ga0495652_0740646 Ga0495652_0740646_323_574 83
474 3300046535 Ga0495586_0487960 Ga0495586_0487960_220_471 83
475 3300046536 Ga0495587_0104148 Ga0495587_0104148_26_277 83
476 3300046543 Ga0495645_0002432 Ga0495645_0002432_1119_1370 83
477 3300046543 Ga0495645_0022178 Ga0495645_0022178_550_801 83
478 3300046559 Ga0495667_0435236 Ga0495667_0435236_432_689 83
479 3300046642 Ga0495634_0000638 Ga0495634_0000638_19567_19818 83
480 3300046642 Ga0495634_0002399 Ga0495634_0002399_7580_7831 83
481 3300046642 Ga0495634_0615291 Ga0495634_0615291_140_391 83
482 3300046663 Ga0495635_0140929 Ga0495635_0140929_847_1098 83
483 3300046663 Ga0495635_0334066 Ga0495635_0334066_69_320 83
484 3300046680 Ga0495646_0552993 Ga0495646_0552993_47_298 83
485 3300046681 Ga0495647_0116643 Ga0495647_0116643_315_566 83
486 3300046683 Ga0495658_0000001 Ga0495658_0000001_41694_41945 83
487 3300046683 Ga0495658_0003950 Ga0495658_0003950_7039_7290 83
488 3300046684 Ga0495669_0010118 Ga0495669_0010118_3635_3886 83
489 3300046684 Ga0495669_0168151 Ga0495669_0168151_728_979 83
490 3300046690 Ga0495624_0746873 Ga0495624_0746873_43_300 83
491 3300047319 Ga0495674_0331901 Ga0495674_0331901_362_613 83
492 3300047471 Ga0495684_0202239 Ga0495684_0202239_1092_1343 83
493 3300047472 Ga0495686_0084442 Ga0495686_0084442_1208_1459 83
494 3300048090 Ga0495615_0209677 Ga0495615_0209677_111_368 83
495 3300048903 Ga0496100_0065413 Ga0496100_0065413_1430_1687 83
496 3300048903 Ga0496100_1376951 Ga0496100_1376951_20_271 83
497 3300048907 Ga0496104_0000213 Ga0496104_0000213_10893_11144 83
498 3300048907 Ga0496104_0011173 Ga0496104_0011173_4581_4838 83
499 3300048908 Ga0496105_0001058 Ga0496105_0001058_16614_16865 83
500 3300048908 Ga0496105_0035285 Ga0496105_0035285_1788_2045 83
501 3300048911 Ga0496108_0000005 Ga0496108_0000005_154131_154382 83
502 3300048912 Ga0496109_0000002 Ga0496109_0000002_380710_380961 83
503 3300048912 Ga0496109_0165178 Ga0496109_0165178_659_910 83
504 3300048913 Ga0496110_0004182 Ga0496110_0004182_2383_2634 83
505 3300048913 Ga0496110_1131692 Ga0496110_1131692_111_368 83
506 3300048913 Ga0496110_1591970 Ga0496110_1591970_11_262 83
507 3300048913 Ga0496110_1782697 Ga0496110_1782697_203_454 83
508 3300048914 Ga0496111_0000117 Ga0496111_0000117_18913_19164 83
509 3300048914 Ga0496111_0615947 Ga0496111_0615947_109_360 83
510 3300048915 Ga0496112_0000013 Ga0496112_0000013_34772_35023 83
511 3300048915 Ga0496112_1006690 Ga0496112_1006690_458_709 83
512 3300048916 Ga0496113_0157328 Ga0496113_0157328_1192_1443 83
513 3300048916 Ga0496113_1205028 Ga0496113_1205028_240_491 83
514 3300048918 Ga0496115_0819923 Ga0496115_0819923_19_276 83
515 3300048922 Ga0496119_0318582 Ga0496119_0318582_168_419 83
516 3300049572 Ga0501036_0325146 Ga0501036_0325146_903_1154 83
517 3300049576 Ga0501040_0308703 Ga0501040_0308703_638_904 83
518 3300049582 Ga0501048_1068455 Ga0501048_1068455_71_322 83
519 3300049585 Ga0501069_0221826 Ga0501069_0221826_641_892 83
520 3300049587 Ga0501071_0516239 Ga0501071_0516239_73_342 83
521 3300049587 Ga0501071_1110459 Ga0501071_1110459_268_519 83
522 3300049588 Ga0501072_0016459 Ga0501072_0016459_3294_3545 83
523 3300049588 Ga0501072_1483277 Ga0501072_1483277_82_333 83
524 3300049590 Ga0501074_0489497 Ga0501074_0489497_487_753 83
525 3300049592 Ga0501076_0589648 Ga0501076_0589648_44_295 83
526 3300049592 Ga0501076_0636730 Ga0501076_0636730_153_404 83
527 3300049592 Ga0501076_0645994 Ga0501076_0645994_269_535 83
528 3300049742 Ga0501080_1831875 Ga0501080_1831875_109_375 83
529 3300049743 Ga0501081_0086271 Ga0501081_0086271_550_801 83
530 3300049824 Ga0501045_0403011 Ga0501045_0403011_601_867 83
531 3300049824 Ga0501045_0641500 Ga0501045_0641500_418_669 83
532 3300050492 nmdc:mga0yw44_558733_c1 nmdc:mga0yw44_558733_c1_118_369 83
533 3300050515 nmdc:mga0a205_94_c1 nmdc:mga0a205_94_c1_14632_14883 83
534 3300053077 Ga0495601_0024071 Ga0495601_0024071_2630_2881 83
535 3300053077 Ga0495601_0736761 Ga0495601_0736761_265_516 83
536 3300053077 Ga0495601_0773621 Ga0495601_0773621_322_573 83
537 3300053078 Ga0495612_0000031 Ga0495612_0000031_50658_50909 83
538 3300053083 Ga0495655_0000005 Ga0495655_0000005_90417_90668 83
539 3300053084 Ga0495595_0371949 Ga0495595_0371949_447_698 83
540 3300053084 Ga0495595_0533120 Ga0495595_0533120_65_322 83
541 3300053085 Ga0495619_0000144 Ga0495619_0000144_13867_14118 83
542 3300053085 Ga0495619_0000412 Ga0495619_0000412_10518_10769 83
543 3300053085 Ga0495619_0006971 Ga0495619_0006971_6875_7126 83
544 3300053085 Ga0495619_0276200 Ga0495619_0276200_810_1067 83
545 3300053085 Ga0495619_0752313 Ga0495619_0752313_159_410 83
546 3300053129 Ga0500628_000025 Ga0500628_000025_1686_1937 83
547 3300054114 Ga0501084_0196331 Ga0501084_0196331_901_1152 83
548 3300054114 Ga0501084_0713147 Ga0501084_0713147_57_323 83
549 3300000546 LJNas_1020449 LJNas_10204492 84
550 3300002239 JGI24034J26672_10000321 JGI24034J26672_100003215 84
551 3300002244 JGI24742J22300_10021444 JGI24742J22300_100214442 84
552 3300004798 Ga0058859_11471263 Ga0058859_114712632 84
553 3300004800 Ga0058861_11781935 Ga0058861_117819351 84
554 3300004803 Ga0058862_12754643 Ga0058862_127546432 84
555 3300004803 Ga0058862_12833852 Ga0058862_128338522 84
556 3300005327 Ga0070658_11521906 Ga0070658_115219061 84
557 3300005336 Ga0070680_100001829 Ga0070680_10000182919 84
558 3300005339 Ga0070660_100520061 Ga0070660_1005200612 84
559 3300005353 Ga0070669_101234671 Ga0070669_1012346712 84
560 3300005355 Ga0070671_100091529 Ga0070671_1000915292 84
561 3300005356 Ga0070674_100879322 Ga0070674_1008793222 84
562 3300005364 Ga0070673_100004080 Ga0070673_1000040802 84
563 3300005365 Ga0070688_100422858 Ga0070688_1004228582 84
564 3300005434 Ga0070709_10442388 Ga0070709_104423882 84
565 3300005436 Ga0070713_100573889 Ga0070713_1005738891 84
566 3300005441 Ga0070700_100759405 Ga0070700_1007594051 84
567 3300005458 Ga0070681_10158384 Ga0070681_101583843 84
568 3300005530 Ga0070679_100034456 Ga0070679_1000344565 84
569 3300005544 Ga0070686_100336995 Ga0070686_1003369951 84
570 3300005544 Ga0070686_100414792 Ga0070686_1004147922 84
571 3300005548 Ga0070665_100365391 Ga0070665_1003653912 84
572 3300005548 Ga0070665_102627909 Ga0070665_1026279092 84
573 3300005563 Ga0068855_102112063 Ga0068855_1021120631 84
574 3300005615 Ga0070702_100568294 Ga0070702_1005682942 84
575 3300005617 Ga0068859_101802608 Ga0068859_1018026082 84
576 3300005618 Ga0068864_100379393 Ga0068864_1003793934 84
577 3300005718 Ga0068866_10500581 Ga0068866_105005812 84
578 3300005719 Ga0068861_100977196 Ga0068861_1009771961 84
579 3300005841 Ga0068863_100107123 Ga0068863_1001071232 84
580 3300005842 Ga0068858_100101660 Ga0068858_1001016603 84
581 3300005843 Ga0068860_101250422 Ga0068860_1012504222 84
582 3300005983 Ga0081540_1000129 Ga0081540_100012977 84
583 3300005985 Ga0081539_10002112 Ga0081539_1000211219 84
584 3300006028 Ga0070717_10011077 Ga0070717_100110776 84
585 3300006038 Ga0075365_10385013 Ga0075365_103850132 84
586 3300006358 Ga0068871_100732055 Ga0068871_1007320551 84
587 3300006844 Ga0075428_100694808 Ga0075428_1006948081 84
588 3300006846 Ga0075430_100025109 Ga0075430_1000251093 84
589 3300006846 Ga0075430_100802146 Ga0075430_1008021462 84
590 3300006881 Ga0068865_100475483 Ga0068865_1004754832 84
591 3300006914 Ga0075436_100779210 Ga0075436_1007792102 84
592 3300006931 Ga0097620_101802886 Ga0097620_1018028862 84
593 3300009093 Ga0105240_10360420 Ga0105240_103604203 84
594 3300009098 Ga0105245_10632046 Ga0105245_106320462 84
595 3300009101 Ga0105247_10610920 Ga0105247_106109201 84
596 3300009176 Ga0105242_10000034 Ga0105242_1000003490 84
597 3300009176 Ga0105242_12862181 Ga0105242_128621811 84
598 3300009177 Ga0105248_12092148 Ga0105248_120921482 84
599 3300009553 Ga0105249_12872796 Ga0105249_128727961 84
600 3300010375 Ga0105239_13021716 Ga0105239_130217162 84
601 3300013102 Ga0157371_10789270 Ga0157371_107892702 84
602 3300013104 Ga0157370_10117245 Ga0157370_101172453 84
603 3300013296 Ga0157374_10414140 Ga0157374_104141402 84
604 3300013306 Ga0163162_11025623 Ga0163162_110256233 84
605 3300013306 Ga0163162_11322943 Ga0163162_113229432 84
606 3300013307 Ga0157372_10032985 Ga0157372_100329852 84
607 3300013308 Ga0157375_10006231 Ga0157375_1000623110 84
608 3300014325 Ga0163163_10609045 Ga0163163_106090451 84
609 3300014326 Ga0157380_12170172 Ga0157380_121701722 84
610 3300017792 Ga0163161_10272926 Ga0163161_102729262 84
611 3300020069 Ga0197907_10108296 Ga0197907_101082962 84
612 3300020069 Ga0197907_10203191 Ga0197907_102031912 84
613 3300020069 Ga0197907_10599200 Ga0197907_105992002 84
614 3300020069 Ga0197907_11492123 Ga0197907_114921233 84
615 3300020070 Ga0206356_10138750 Ga0206356_101387503 84
616 3300020070 Ga0206356_10660827 Ga0206356_106608272 84
617 3300020070 Ga0206356_10738820 Ga0206356_107388202 84
618 3300020075 Ga0206349_1061295 Ga0206349_10612952 84
619 3300020075 Ga0206349_1308889 Ga0206349_13088892 84
620 3300020075 Ga0206349_1645124 Ga0206349_16451242 84
621 3300020075 Ga0206349_1785023 Ga0206349_17850232 84
622 3300020076 Ga0206355_1007025 Ga0206355_10070252 84
623 3300020076 Ga0206355_1037541 Ga0206355_10375413 84
624 3300020077 Ga0206351_10156800 Ga0206351_101568001 84
625 3300020077 Ga0206351_10376218 Ga0206351_103762182 84
626 3300020077 Ga0206351_10956255 Ga0206351_109562552 84
627 3300020078 Ga0206352_10054722 Ga0206352_100547222 84
628 3300020078 Ga0206352_10461982 Ga0206352_104619822 84
629 3300020080 Ga0206350_10221184 Ga0206350_102211842 84
630 3300020080 Ga0206350_11267920 Ga0206350_112679202 84
631 3300020081 Ga0206354_10038488 Ga0206354_100384882 84
632 3300020081 Ga0206354_10361875 Ga0206354_103618752 84
633 3300020081 Ga0206354_11070946 Ga0206354_110709462 84
634 3300020081 Ga0206354_11163887 Ga0206354_111638871 84
635 3300020082 Ga0206353_10523663 Ga0206353_105236632 84
636 3300020082 Ga0206353_11137416 Ga0206353_111374162 84
637 3300020082 Ga0206353_11861206 Ga0206353_118612063 84
638 3300022467 Ga0224712_10090982 Ga0224712_100909822 84
639 3300022467 Ga0224712_10095648 Ga0224712_100956483 84
640 3300022467 Ga0224712_10302764 Ga0224712_103027642 84
641 3300022467 Ga0224712_10311022 Ga0224712_103110221 84
642 3300022467 Ga0224712_10388592 Ga0224712_103885922 84
643 3300025900 Ga0207710_10427302 Ga0207710_104273022 84
644 3300025906 Ga0207699_11116401 Ga0207699_111164012 84
645 3300025909 Ga0207705_11486894 Ga0207705_114868941 84
646 3300025912 Ga0207707_10079437 Ga0207707_100794373 84
647 3300025913 Ga0207695_10185529 Ga0207695_101855292 84
648 3300025917 Ga0207660_10062578 Ga0207660_100625784 84
649 3300025919 Ga0207657_10763015 Ga0207657_107630152 84
650 3300025921 Ga0207652_10085390 Ga0207652_100853904 84
651 3300025923 Ga0207681_10069968 Ga0207681_100699682 84
652 3300025928 Ga0207700_10380491 Ga0207700_103804912 84
653 3300025931 Ga0207644_10075439 Ga0207644_100754392 84
654 3300025934 Ga0207686_10002116 Ga0207686_1000211612 84
655 3300025941 Ga0207711_10233576 Ga0207711_102335763 84
656 3300025945 Ga0207679_11462441 Ga0207679_114624411 84
657 3300025949 Ga0207667_10947050 Ga0207667_109470502 84
658 3300025960 Ga0207651_10001711 Ga0207651_1000171110 84
659 3300025972 Ga0207668_10755914 Ga0207668_107559142 84
660 3300025986 Ga0207658_11224182 Ga0207658_112241822 84
661 3300026035 Ga0207703_10134954 Ga0207703_101349542 84
662 3300026075 Ga0207708_10212430 Ga0207708_102124302 84
663 3300026075 Ga0207708_11961971 Ga0207708_119619711 84
664 3300026088 Ga0207641_10003646 Ga0207641_100036467 84
665 3300026095 Ga0207676_12549441 Ga0207676_125494411 84
666 3300026118 Ga0207675_100613264 Ga0207675_1006132642 84
667 3300026121 Ga0207683_10689766 Ga0207683_106897661 84
668 3300028381 Ga0268264_10001292 Ga0268264_100012928 84
669 3300028563 Ga0265319_1000035 Ga0265319_100003521 84
670 3300028654 Ga0265322_10107332 Ga0265322_101073322 84
671 3300028666 Ga0265336_10216325 Ga0265336_102163252 84
672 3300028800 Ga0265338_10000171 Ga0265338_1000017124 84
673 3300028800 Ga0265338_10128094 Ga0265338_101280942 84
674 3300029957 Ga0265324_10107172 Ga0265324_101071722 84
675 3300030500 Ga0268256_1053309 Ga0268256_10533092 84
676 3300031240 Ga0265320_10128753 Ga0265320_101287532 84
677 3300031241 Ga0265325_10010611 Ga0265325_100106115 84
678 3300031251 Ga0265327_10317609 Ga0265327_103176092 84
679 3300031711 Ga0265314_10335980 Ga0265314_103359802 84
680 3300031712 Ga0265342_10459136 Ga0265342_104591361 84
681 3300032168 Ga0316593_10011204 Ga0316593_100112042 84
682 3300032168 Ga0316593_10065150 Ga0316593_100651502 84
683 3300032168 Ga0316593_10085467 Ga0316593_100854672 84
684 3300032168 Ga0316593_10168202 Ga0316593_101682022 84
685 3300032168 Ga0316593_10352506 Ga0316593_103525062 84
686 3300033524 Ga0316592_1058324 Ga0316592_10583242 84
687 3300033541 Ga0316596_1085647 Ga0316596_10856472 84
688 3300035117 Ga0373953_0262596 Ga0373953_0262596_380_649 84
689 3300035410 Ga0373924_0161343 Ga0373924_0161343_478_747 84
690 3300035692 Ga0373935_1042206 Ga0373935_1042206_100_369 84
691 3300036401 Ga0373937_0147835 Ga0373937_0147835_1077_1346 84
692 3300036647 Ga0316582_0978874 Ga0316582_0978874_148_429 84
693 3300036712 Ga0316584_0341393 Ga0316584_0341393_767_1021 84
694 3300037068 Ga0373925_0434135 Ga0373925_0434135_299_568 84
695 3300037068 Ga0373925_0702432 Ga0373925_0702432_548_817 84
696 3300037418 Ga0395900_0586701 Ga0395900_0586701_69_347 84
697 3300037466 Ga0395898_1338292 Ga0395898_1338292_354_608 84
698 3300037471 Ga0395905_0137603 Ga0395905_0137603_1653_1931 84
699 3300037853 Ga0436364_1305764 Ga0436364_1305764_408_677 84
700 3300038443 Ga0395901_0108382 Ga0395901_0108382_2322_2585 84
701 3300038443 Ga0395901_1058856 Ga0395901_1058856_445_732 84
702 3300039093 Ga0400489_52134 Ga0400489_52134_313_582 84
703 3300039437 Ga0436365_1138802 Ga0436365_1138802_42_311 84
704 3300041459 Ga0451800_0514641 Ga0451800_0514641_176_430 84
705 3300041461 Ga0451805_129914 Ga0451805_129914_281_580 84
706 3300041486 Ga0451807_0556699 Ga0451807_0556699_901_1155 84
707 3300041496 Ga0451839_0045583 Ga0451839_0045583_260_514 84
708 3300041512 Ga0451853_0315177 Ga0451853_0315177_149_403 84
709 3300041512 Ga0451853_2640337 Ga0451853_2640337_198_452 84
710 3300044683 Ga0466965_0281656 Ga0466965_0281656_344_613 84
711 3300044694 Ga0466963_0000301 Ga0466963_0000301_7192_7446 84
712 3300044694 Ga0466963_0491483 Ga0466963_0491483_214_483 84
713 3300044901 Ga0466960_0116870 Ga0466960_0116870_37_306 84
714 3300045836 Ga0466958_0711869 Ga0466958_0711869_44_313 84
715 3300045976 Ga0466967_0523245 Ga0466967_0523245_208_477 84
716 3300046459 Ga0495629_0002708 Ga0495629_0002708_2565_2819 84
717 3300046459 Ga0495629_0074689 Ga0495629_0074689_1812_2066 84
718 3300046472 Ga0495580_0776350 Ga0495580_0776350_208_477 84
719 3300046499 Ga0495594_0254464 Ga0495594_0254464_719_988 84
720 3300046514 Ga0495618_0000144 Ga0495618_0000144_6436_6690 84
721 3300046514 Ga0495618_0881612 Ga0495618_0881612_32_301 84
722 3300046515 Ga0495620_0000352 Ga0495620_0000352_17920_18174 84
723 3300046525 Ga0495663_0329324 Ga0495663_0329324_87_347 84
724 3300046529 Ga0495652_0000010 Ga0495652_0000010_16152_16406 84
725 3300046533 Ga0495640_0159172 Ga0495640_0159172_63_317 84
726 3300046536 Ga0495587_0050595 Ga0495587_0050595_2109_2363 84
727 3300046543 Ga0495645_0897881 Ga0495645_0897881_101_355 84
728 3300046559 Ga0495667_0000505 Ga0495667_0000505_21881_22135 84
729 3300046660 Ga0495625_0000032 Ga0495625_0000032_60199_60453 84
730 3300046681 Ga0495647_0001468 Ga0495647_0001468_1698_1952 84
731 3300046809 Ga0495600_0002554 Ga0495600_0002554_4508_4762 84
732 3300047319 Ga0495674_0000010 Ga0495674_0000010_193575_193832 84
733 3300047320 Ga0495672_0000281 Ga0495672_0000281_17762_18031 84
734 3300047321 Ga0495676_0000346 Ga0495676_0000346_6849_7103 84
735 3300047322 Ga0495680_0023946 Ga0495680_0023946_58_312 84
736 3300047322 Ga0495680_0068558 Ga0495680_0068558_1351_1605 84
737 3300047472 Ga0495686_0307544 Ga0495686_0307544_378_662 84
738 3300048903 Ga0496100_0000001 Ga0496100_0000001_177446_177700 84
739 3300048903 Ga0496100_0296774 Ga0496100_0296774_243_503 84
740 3300048904 Ga0496101_0000028 Ga0496101_0000028_177435_177689 84
741 3300048905 Ga0496102_0000561 Ga0496102_0000561_17607_17861 84
742 3300048905 Ga0496102_0063392 Ga0496102_0063392_1574_1831 84
743 3300048906 Ga0496103_0000057 Ga0496103_0000057_128136_128390 84
744 3300048906 Ga0496103_0348692 Ga0496103_0348692_267_527 84
745 3300048909 Ga0496106_0000055 Ga0496106_0000055_70365_70619 84
746 3300048910 Ga0496107_0000002 Ga0496107_0000002_70788_71042 84
747 3300048912 Ga0496109_0633654 Ga0496109_0633654_342_602 84
748 3300048913 Ga0496110_0921887 Ga0496110_0921887_280_549 84
749 3300048914 Ga0496111_0462455 Ga0496111_0462455_446_706 84
750 3300048917 Ga0496114_0000003 Ga0496114_0000003_613342_613596 84
751 3300048917 Ga0496114_1412892 Ga0496114_1412892_47_304 84
752 3300048918 Ga0496115_0000031 Ga0496115_0000031_37907_38161 84
753 3300048918 Ga0496115_0459754 Ga0496115_0459754_716_973 84
754 3300048921 Ga0496118_0453632 Ga0496118_0453632_84_338 84
755 3300048929 Ga0496126_0003365 Ga0496126_0003365_1850_2107 84
756 3300048929 Ga0496126_0188226 Ga0496126_0188226_69_326 84
757 3300048929 Ga0496126_1266830 Ga0496126_1266830_245_499 84
758 3300049571 Ga0501034_0057117 Ga0501034_0057117_1418_1687 84
759 3300049571 Ga0501034_0362009 Ga0501034_0362009_724_1002 84
760 3300049571 Ga0501034_0463293 Ga0501034_0463293_762_1037 84
761 3300049571 Ga0501034_0512890 Ga0501034_0512890_425_703 84
762 3300049572 Ga0501036_0127828 Ga0501036_0127828_1489_1767 84
763 3300049572 Ga0501036_0235038 Ga0501036_0235038_947_1216 84
764 3300049573 Ga0501037_0937940 Ga0501037_0937940_269_547 84
765 3300049574 Ga0501038_0697984 Ga0501038_0697984_238_516 84
766 3300049575 Ga0501039_1327507 Ga0501039_1327507_208_462 84
767 3300049579 Ga0501043_0259435 Ga0501043_0259435_1010_1288 84
768 3300049579 Ga0501043_0799100 Ga0501043_0799100_378_647 84
769 3300049580 Ga0501046_0218994 Ga0501046_0218994_818_1087 84
770 3300049581 Ga0501047_0026314 Ga0501047_0026314_1217_1495 84
771 3300049581 Ga0501047_0621292 Ga0501047_0621292_156_431 84
772 3300049581 Ga0501047_0789523 Ga0501047_0789523_263_532 84
773 3300049583 Ga0501067_0022285 Ga0501067_0022285_353_631 84
774 3300049584 Ga0501068_0015476 Ga0501068_0015476_2978_3247 84
775 3300049585 Ga0501069_0095508 Ga0501069_0095508_935_1204 84
776 3300049586 Ga0501070_0057363 Ga0501070_0057363_2286_2564 84
777 3300049586 Ga0501070_0125487 Ga0501070_0125487_978_1250 84
778 3300049586 Ga0501070_0285935 Ga0501070_0285935_307_594 84
779 3300049587 Ga0501071_1197016 Ga0501071_1197016_77_346 84
780 3300049588 Ga0501072_0090888 Ga0501072_0090888_182_451 84
781 3300049588 Ga0501072_0879890 Ga0501072_0879890_335_616 84
782 3300049589 Ga0501073_0006442 Ga0501073_0006442_1037_1318 84
783 3300049589 Ga0501073_0201672 Ga0501073_0201672_1056_1331 84
784 3300049590 Ga0501074_0165974 Ga0501074_0165974_66_347 84
785 3300049590 Ga0501074_0546987 Ga0501074_0546987_140_412 84
786 3300049590 Ga0501074_0910440 Ga0501074_0910440_61_339 84
787 3300049592 Ga0501076_0022848 Ga0501076_0022848_298_579 84
788 3300049592 Ga0501076_0169944 Ga0501076_0169944_1454_1723 84
789 3300049593 Ga0501077_0216015 Ga0501077_0216015_761_1030 84
790 3300049593 Ga0501077_0799913 Ga0501077_0799913_112_366 84
791 3300049741 Ga0501079_0083902 Ga0501079_0083902_1907_2176 84
792 3300049741 Ga0501079_0387116 Ga0501079_0387116_718_999 84
793 3300049742 Ga0501080_0109081 Ga0501080_0109081_2171_2449 84
794 3300049742 Ga0501080_1075485 Ga0501080_1075485_193_480 84
795 3300049742 Ga0501080_1196364 Ga0501080_1196364_103_372 84
796 3300049742 Ga0501080_1227041 Ga0501080_1227041_158_439 84
797 3300049742 Ga0501080_1731187 Ga0501080_1731187_225_497 84
798 3300049744 Ga0501083_0004874 Ga0501083_0004874_4264_4545 84
799 3300049744 Ga0501083_0217935 Ga0501083_0217935_397_684 84
800 3300049744 Ga0501083_0595252 Ga0501083_0595252_366_641 84
801 3300049822 Ga0501035_0218688 Ga0501035_0218688_714_992 84
802 3300049822 Ga0501035_0371544 Ga0501035_0371544_338_616 84
803 3300049823 Ga0501044_0488677 Ga0501044_0488677_588_866 84
804 3300049823 Ga0501044_0787155 Ga0501044_0787155_155_424 84
805 3300050509 nmdc:mga0qj67_57173_c1 nmdc:mga0qj67_57173_c1_1660_1914 84
806 3300050513 nmdc:mga0rr50_296329_c1 nmdc:mga0rr50_296329_c1_444_698 84
807 3300053094 Ga0500566_0087398 Ga0500566_0087398_46_300 84
808 3300054114 Ga0501084_0063259 Ga0501084_0063259_316_597 84
809 3300054114 Ga0501084_0096036 Ga0501084_0096036_1169_1444 84
810 3300054114 Ga0501084_1681742 Ga0501084_1681742_116_391 84
811 3300060353 Ga0501082_0036007 Ga0501082_0036007_2679_2960 84
812 3300060353 Ga0501082_0042827 Ga0501082_0042827_2950_3228 84
813 3300060353 Ga0501082_0415509 Ga0501082_0415509_643_912 84
814 3300061734 Ga0530510_0181357 Ga0530510_0181357_290_559 84
815 3300061734 Ga0530510_0612711 Ga0530510_0612711_43_324 84

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01016

Ribosomal_L27

Ribosomal L27 protein

2

83

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
1v8q-assembly1.cif.gz_A crystal structure of ribosomal protein l27 from thermus thermophilus hb8 0.9673 21 84
8c94-assembly1.cif.gz_W cryo-em captures early ribosome assembly in action 0.9505 21 83
8c95-assembly1.cif.gz_W cryo-em captures early ribosome assembly in action 0.9331 21 83
8c8z-assembly1.cif.gz_W cryo-em captures early ribosome assembly in action 0.9298 17 83
6ywv-assembly1.cif.gz_R the structure of the atp25 bound assembly intermediate of the mitoribosome from neurospora crassa 0.9283 17 81
ID Description Score Start End Superfamily
1v8qA00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9673 21 84 2.40.50.100
1v8qA00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9247 21 84 2.40.50.100
af_P0A7L8_6_84_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.8651 9 82 2.40.50.100
5oomW00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.8612 14 84 2.40.50.100
af_Q9U0I4_44_103_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.8545 28 84 2.40.50.100
ID Description Score Start End GO Terms
AF-A0A421K8E4-F1-model_v4 Large ribosomal subunit protein bL27 (50S ribosomal protein L27) 0.9933 21 84 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-I0R0V1-F1-model_v4 Large ribosomal subunit protein bL27 (50S ribosomal protein L27) 0.9904 23 82 GO:0003735
GO:0006412
GO:0022625
AF-A0A7Y5TEY2-F1-model_v4 Large ribosomal subunit protein bL27 (50S ribosomal protein L27) 0.988 21 84 GO:0003735
GO:0006412
GO:0022625
AF-A0A2D7PMC6-F1-model_v4 Large ribosomal subunit protein bL27 (50S ribosomal protein L27) 0.9866 23 84 GO:0003735
GO:0006412
GO:0022625
AF-A0A3D3VUF3-F1-model_v4 Large ribosomal subunit protein bL27 (50S ribosomal protein L27) 0.9845 23 84 GO:0003735
GO:0006412
GO:0022625

Feature Viewer

pLDDT pTM Quality
87.26 0.71 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map