F482021
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 815 | 384 | 810 | 84 |
Family's Representative Sequence
| Representative Sequence | 3300041461|Ga0451805_129914|Ga0451805_129914_281_580 |
| Length | 99 |
| Sequence | MAHKKGGGSVKNGRDSNAQRLGIKKFGGQKVISGNIIVRQRGTKFHPGENVGLGKDHTIFATIEGVVVFERMHGRDGQKQVHVMPVPVVAVADTTAKVQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2534681786 | Brucella suis 92/29 | Isolate | Unclassified |
| 2 | 2671180139 | Chelativorans sp. A52C2 | Isolate | Unclassified |
| 3 | 2854911287 | Brucella lupini LUP21 | Isolate | Unclassified |
| 4 | 2883291878 | Hypericibacter terrae R5913 | Isolate | Rhizosphere |
| 5 | 2897803580 | Azospirillum doebereinerae GSF71 | Isolate | Unclassified |
| 6 | 3300000546 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled | Metagenome | Rhizosphere |
| 7 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 8 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 9 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 10 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 11 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 12 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 13 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 14 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 17 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 18 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 20 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 29 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 40 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 44 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 51 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 53 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 54 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 56 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 57 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 58 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 59 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 60 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 61 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 62 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 63 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 64 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 65 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 66 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 67 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 68 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 69 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 71 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 72 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 73 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 74 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 75 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 76 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 77 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 78 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 79 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300012515 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 | Metagenome | Rhizosphere |
| 93 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 103 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 106 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 107 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 108 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 109 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 110 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 111 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 112 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 113 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 114 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 115 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 116 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 167 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 170 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 171 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 172 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 173 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 174 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 175 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 176 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 177 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 178 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 179 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 180 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 181 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 182 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 183 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 184 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 185 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 186 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 187 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 188 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 189 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 190 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 191 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 192 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 193 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 194 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 195 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 196 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 197 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 198 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 199 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 200 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 201 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 202 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 203 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 204 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 205 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 206 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 207 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 208 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 209 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 210 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 211 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 212 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 213 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 214 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 215 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 216 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 217 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 218 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 219 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 220 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 221 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 222 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 223 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 224 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 225 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 226 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 227 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 228 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 229 | 3300041461 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT | Metatranscriptome | Rhizoplane |
| 230 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 231 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 232 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 233 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 234 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 235 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 236 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 237 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 238 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 239 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 240 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 241 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 242 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 243 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 244 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 245 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 246 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 247 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 248 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 249 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 316 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 317 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 318 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 319 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 320 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 321 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 322 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 323 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 324 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 325 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 326 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 327 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 328 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 329 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 330 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 331 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 332 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 333 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 334 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 335 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 336 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 337 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 338 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 339 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 340 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 341 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 342 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 343 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 344 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 345 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 346 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 347 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 348 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 349 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 350 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 351 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 352 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 353 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 354 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 355 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 356 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 357 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 358 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 359 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 360 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 361 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 362 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 363 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 364 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 365 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 366 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 367 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 368 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 369 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 370 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 371 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 372 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 373 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 374 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 380 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 381 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 382 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 383 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 384 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.37 |
| Metatranscriptomes | 6.01 |
| Isolates | 0.61 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.49 |
| Nodule | 0 |
| Rhizoplane | 5.03 |
| Rhizosphere | 91.78 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.7 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | LJNas_1020449 | 3300000546 | Bacteria | 706 |
| 2 | JGI24034J26672_10000321 | 3300002239 | Bacteria | 6179 |
| 3 | JGI24742J22300_10021444 | 3300002244 | Bacteria | 1103 |
| 4 | JGI24751J29686_10108143 | 3300002459 | Unclassified | 582 |
| 5 | JGI25407J50210_10032383 | 3300003373 | Bacteria | 1352 |
| 6 | JGI25407J50210_10035157 | 3300003373 | Bacteria | 1292 |
| 7 | JGI25407J50210_10049920 | 3300003373 | Bacteria | 1062 |
| 8 | Ga0058859_11471263 | 3300004798 | Unclassified | 608 |
| 9 | Ga0058861_11781935 | 3300004800 | Bacteria | 833 |
| 10 | Ga0058862_12754643 | 3300004803 | Bacteria | 1197 |
| 11 | Ga0058862_12833852 | 3300004803 | Bacteria | 1193 |
| 12 | Ga0070658_11521906 | 3300005327 | Bacteria | 580 |
| 13 | Ga0070676_10145657 | 3300005328 | Unclassified | 1512 |
| 14 | Ga0068869_100258268 | 3300005334 | Unclassified | 1394 |
| 15 | Ga0070680_100001829 | 3300005336 | Bacteria | 15622 |
| 16 | Ga0070680_101951238 | 3300005336 | Bacteria | 509 |
| 17 | Ga0070682_100000011 | 3300005337 | Bacteria | 266253 |
| 18 | Ga0068868_100000445 | 3300005338 | Bacteria | 27750 |
| 19 | Ga0068868_100534698 | 3300005338 | Bacteria | 1031 |
| 20 | Ga0070660_100520061 | 3300005339 | Bacteria | 991 |
| 21 | Ga0070689_100740479 | 3300005340 | Bacteria | 861 |
| 22 | Ga0070691_10000270 | 3300005341 | Bacteria | 18137 |
| 23 | Ga0070691_10075616 | 3300005341 | Bacteria | 1640 |
| 24 | Ga0070687_100023591 | 3300005343 | Bacteria | 2925 |
| 25 | Ga0070669_101234671 | 3300005353 | Bacteria | 646 |
| 26 | Ga0070671_100091529 | 3300005355 | Bacteria | 2548 |
| 27 | Ga0070674_100000004 | 3300005356 | Bacteria | 169446 |
| 28 | Ga0070674_100077793 | 3300005356 | Bacteria | 2363 |
| 29 | Ga0070674_100182647 | 3300005356 | Bacteria | 1608 |
| 30 | Ga0070674_100879322 | 3300005356 | Bacteria | 779 |
| 31 | Ga0070674_101757634 | 3300005356 | Unclassified | 562 |
| 32 | Ga0070673_100004080 | 3300005364 | Bacteria | 9197 |
| 33 | Ga0070688_100088147 | 3300005365 | Bacteria | 2023 |
| 34 | Ga0070688_100422858 | 3300005365 | Bacteria | 991 |
| 35 | Ga0070709_10442388 | 3300005434 | Bacteria | 978 |
| 36 | Ga0070714_100035345 | 3300005435 | Bacteria | 4188 |
| 37 | Ga0070714_100146725 | 3300005435 | Bacteria | 2123 |
| 38 | Ga0070713_100022878 | 3300005436 | Bacteria | 4839 |
| 39 | Ga0070713_100573889 | 3300005436 | Bacteria | 1070 |
| 40 | Ga0070711_100012656 | 3300005439 | Bacteria | 5277 |
| 41 | Ga0070700_100293555 | 3300005441 | Bacteria | 1184 |
| 42 | Ga0070700_100502924 | 3300005441 | Bacteria | 932 |
| 43 | Ga0070700_100759405 | 3300005441 | Bacteria | 777 |
| 44 | Ga0070694_100177171 | 3300005444 | Unclassified | 1575 |
| 45 | Ga0070708_100986814 | 3300005445 | Bacteria | 790 |
| 46 | Ga0070678_100186781 | 3300005456 | Bacteria | 1701 |
| 47 | Ga0070678_100691891 | 3300005456 | Bacteria | 918 |
| 48 | Ga0070662_100000006 | 3300005457 | Bacteria | 169366 |
| 49 | Ga0070662_100557677 | 3300005457 | Bacteria | 960 |
| 50 | Ga0070681_10158384 | 3300005458 | Bacteria | 2188 |
| 51 | Ga0070681_11400767 | 3300005458 | Bacteria | 623 |
| 52 | Ga0070681_11479090 | 3300005458 | Bacteria | 604 |
| 53 | Ga0068867_100059553 | 3300005459 | Bacteria | 2831 |
| 54 | Ga0068867_100587438 | 3300005459 | Bacteria | 969 |
| 55 | Ga0070685_10492296 | 3300005466 | Bacteria | 866 |
| 56 | Ga0070679_100034456 | 3300005530 | Bacteria | 5018 |
| 57 | Ga0070679_101098683 | 3300005530 | Bacteria | 740 |
| 58 | Ga0070679_101788643 | 3300005530 | Bacteria | 563 |
| 59 | Ga0070684_100039321 | 3300005535 | Bacteria | 4068 |
| 60 | Ga0070684_101041007 | 3300005535 | Bacteria | 768 |
| 61 | Ga0068853_100512817 | 3300005539 | Bacteria | 1133 |
| 62 | Ga0070686_100336995 | 3300005544 | Bacteria | 1129 |
| 63 | Ga0070686_100414792 | 3300005544 | Bacteria | 1027 |
| 64 | Ga0070686_101052409 | 3300005544 | Bacteria | 670 |
| 65 | Ga0070695_100066741 | 3300005545 | Unclassified | 2345 |
| 66 | Ga0070695_100110996 | 3300005545 | Bacteria | 1861 |
| 67 | Ga0070695_101736298 | 3300005545 | Bacteria | 523 |
| 68 | Ga0070696_100624636 | 3300005546 | Bacteria | 871 |
| 69 | Ga0070696_100957244 | 3300005546 | Bacteria | 713 |
| 70 | Ga0070693_100003426 | 3300005547 | Bacteria | 7397 |
| 71 | Ga0070693_100150494 | 3300005547 | Bacteria | 1474 |
| 72 | Ga0070665_100365391 | 3300005548 | Bacteria | 1449 |
| 73 | Ga0070665_102627909 | 3300005548 | Bacteria | 504 |
| 74 | Ga0070704_100082194 | 3300005549 | Bacteria | 2375 |
| 75 | Ga0068855_102112063 | 3300005563 | Bacteria | 567 |
| 76 | Ga0070664_100405767 | 3300005564 | Bacteria | 1247 |
| 77 | Ga0070664_100525220 | 3300005564 | Bacteria | 1093 |
| 78 | Ga0068857_100065269 | 3300005577 | Bacteria | 3236 |
| 79 | Ga0068857_100746874 | 3300005577 | Bacteria | 932 |
| 80 | Ga0068854_100002872 | 3300005578 | Bacteria | 10717 |
| 81 | Ga0068854_100005454 | 3300005578 | Bacteria | 8033 |
| 82 | Ga0070702_100427270 | 3300005615 | Bacteria | 955 |
| 83 | Ga0070702_100568294 | 3300005615 | Bacteria | 845 |
| 84 | Ga0070702_100604300 | 3300005615 | Bacteria | 823 |
| 85 | Ga0068852_101998906 | 3300005616 | Bacteria | 602 |
| 86 | Ga0068859_101802608 | 3300005617 | Bacteria | 676 |
| 87 | Ga0068864_100379393 | 3300005618 | Bacteria | 1339 |
| 88 | Ga0068866_10000004 | 3300005718 | Bacteria | 202810 |
| 89 | Ga0068866_10500581 | 3300005718 | Bacteria | 804 |
| 90 | Ga0068866_10693725 | 3300005718 | Bacteria | 698 |
| 91 | Ga0068861_100473614 | 3300005719 | Bacteria | 1127 |
| 92 | Ga0068861_100977196 | 3300005719 | Bacteria | 807 |
| 93 | Ga0068861_100981918 | 3300005719 | Bacteria | 805 |
| 94 | Ga0068851_10007448 | 3300005834 | Bacteria | 5026 |
| 95 | Ga0068863_100107123 | 3300005841 | Bacteria | 2659 |
| 96 | Ga0068863_100459766 | 3300005841 | Bacteria | 1250 |
| 97 | Ga0068858_100101660 | 3300005842 | Bacteria | 2681 |
| 98 | Ga0068860_101250422 | 3300005843 | Bacteria | 763 |
| 99 | Ga0068862_102333538 | 3300005844 | Bacteria | 547 |
| 100 | Ga0081455_10036639 | 3300005937 | Bacteria | 4364 |
| 101 | Ga0081538_10006799 | 3300005981 | Bacteria | 9984 |
| 102 | Ga0081538_10008047 | 3300005981 | Bacteria | 9012 |
| 103 | Ga0081538_10015130 | 3300005981 | Bacteria | 5992 |
| 104 | Ga0081538_10019832 | 3300005981 | Bacteria | 4975 |
| 105 | Ga0081538_10097866 | 3300005981 | Bacteria | 1489 |
| 106 | Ga0081538_10132404 | 3300005981 | Bacteria | 1169 |
| 107 | Ga0081540_1000129 | 3300005983 | Bacteria | 80446 |
| 108 | Ga0081539_10002112 | 3300005985 | Bacteria | 29436 |
| 109 | Ga0070717_10011077 | 3300006028 | Bacteria | 6833 |
| 110 | Ga0075365_10385013 | 3300006038 | Bacteria | 989 |
| 111 | Ga0070715_10000014 | 3300006163 | Bacteria | 154272 |
| 112 | Ga0070712_100031071 | 3300006175 | Bacteria | 3595 |
| 113 | Ga0068871_100732055 | 3300006358 | Bacteria | 908 |
| 114 | Ga0075428_100232563 | 3300006844 | Bacteria | 1989 |
| 115 | Ga0075428_100664991 | 3300006844 | Bacteria | 1110 |
| 116 | Ga0075428_100694808 | 3300006844 | Bacteria | 1084 |
| 117 | Ga0075430_100025109 | 3300006846 | Bacteria | 5069 |
| 118 | Ga0075430_100802146 | 3300006846 | Bacteria | 776 |
| 119 | Ga0075433_10000051 | 3300006852 | Bacteria | 49800 |
| 120 | Ga0068865_100475483 | 3300006881 | Bacteria | 1037 |
| 121 | Ga0075436_100779210 | 3300006914 | Bacteria | 711 |
| 122 | Ga0097620_101802886 | 3300006931 | Bacteria | 676 |
| 123 | Ga0105240_10360420 | 3300009093 | Bacteria | 1647 |
| 124 | Ga0105240_11310515 | 3300009093 | Bacteria | 764 |
| 125 | Ga0111539_10000483 | 3300009094 | Bacteria | 50415 |
| 126 | Ga0111539_10098590 | 3300009094 | Bacteria | 3432 |
| 127 | Ga0105245_10000104 | 3300009098 | Bacteria | 80951 |
| 128 | Ga0105245_10013612 | 3300009098 | Bacteria | 7086 |
| 129 | Ga0105245_10577520 | 3300009098 | Bacteria | 1148 |
| 130 | Ga0105245_10632046 | 3300009098 | Bacteria | 1099 |
| 131 | Ga0105247_10610920 | 3300009101 | Unclassified | 810 |
| 132 | Ga0114129_12437476 | 3300009147 | Bacteria | 626 |
| 133 | Ga0114129_13467244 | 3300009147 | Bacteria | 505 |
| 134 | Ga0105243_10214134 | 3300009148 | Bacteria | 1698 |
| 135 | Ga0105243_12567699 | 3300009148 | Bacteria | 549 |
| 136 | Ga0105242_10000034 | 3300009176 | Bacteria | 95536 |
| 137 | Ga0105242_10193921 | 3300009176 | Bacteria | 1800 |
| 138 | Ga0105242_12862181 | 3300009176 | Bacteria | 533 |
| 139 | Ga0105248_12092148 | 3300009177 | Bacteria | 644 |
| 140 | Ga0105238_11032136 | 3300009551 | Bacteria | 844 |
| 141 | Ga0105249_10165424 | 3300009553 | Bacteria | 2141 |
| 142 | Ga0105249_10449203 | 3300009553 | Unclassified | 1327 |
| 143 | Ga0105249_12466972 | 3300009553 | Bacteria | 592 |
| 144 | Ga0105249_12872796 | 3300009553 | Bacteria | 553 |
| 145 | Ga0105239_10061079 | 3300010375 | Bacteria | 4136 |
| 146 | Ga0105239_10337335 | 3300010375 | Bacteria | 1701 |
| 147 | Ga0105239_10669072 | 3300010375 | Bacteria | 1186 |
| 148 | Ga0105239_13021716 | 3300010375 | Bacteria | 548 |
| 149 | Ga0105246_10159752 | 3300011119 | Bacteria | 1716 |
| 150 | Ga0157338_1022085 | 3300012515 | Bacteria | 750 |
| 151 | Ga0157373_11001861 | 3300013100 | Bacteria | 623 |
| 152 | Ga0157371_10789270 | 3300013102 | Bacteria | 715 |
| 153 | Ga0157370_10117245 | 3300013104 | Bacteria | 2487 |
| 154 | Ga0157374_10414140 | 3300013296 | Bacteria | 1346 |
| 155 | Ga0163162_10372730 | 3300013306 | Bacteria | 1561 |
| 156 | Ga0163162_11025623 | 3300013306 | Bacteria | 933 |
| 157 | Ga0163162_11322943 | 3300013306 | Bacteria | 819 |
| 158 | Ga0157372_10000210 | 3300013307 | Bacteria | 65290 |
| 159 | Ga0157372_10032985 | 3300013307 | Bacteria | 5684 |
| 160 | Ga0157375_10006231 | 3300013308 | Bacteria | 10388 |
| 161 | Ga0157375_11324065 | 3300013308 | Bacteria | 847 |
| 162 | Ga0163163_10231626 | 3300014325 | Bacteria | 1896 |
| 163 | Ga0163163_10265292 | 3300014325 | Bacteria | 1768 |
| 164 | Ga0163163_10609045 | 3300014325 | Bacteria | 1155 |
| 165 | Ga0157380_10370261 | 3300014326 | Unclassified | 1348 |
| 166 | Ga0157380_12170172 | 3300014326 | Bacteria | 619 |
| 167 | Ga0157380_12318845 | 3300014326 | Bacteria | 601 |
| 168 | Ga0182008_10187178 | 3300014497 | Unclassified | 1049 |
| 169 | Ga0182008_10448028 | 3300014497 | Unclassified | 701 |
| 170 | Ga0157379_11395269 | 3300014968 | Bacteria | 679 |
| 171 | Ga0163161_10175529 | 3300017792 | Unclassified | 1640 |
| 172 | Ga0163161_10272926 | 3300017792 | Bacteria | 1324 |
| 173 | Ga0163161_10561304 | 3300017792 | Bacteria | 937 |
| 174 | Ga0197907_10108296 | 3300020069 | Bacteria | 671 |
| 175 | Ga0197907_10203191 | 3300020069 | Bacteria | 1178 |
| 176 | Ga0197907_10599200 | 3300020069 | Bacteria | 1053 |
| 177 | Ga0197907_11492123 | 3300020069 | Unclassified | 988 |
| 178 | Ga0206356_10138750 | 3300020070 | Unclassified | 983 |
| 179 | Ga0206356_10660827 | 3300020070 | Bacteria | 1198 |
| 180 | Ga0206356_10738820 | 3300020070 | Bacteria | 726 |
| 181 | Ga0206349_1061295 | 3300020075 | Bacteria | 530 |
| 182 | Ga0206349_1308889 | 3300020075 | Bacteria | 1019 |
| 183 | Ga0206349_1645124 | 3300020075 | Bacteria | 1254 |
| 184 | Ga0206349_1785023 | 3300020075 | Bacteria | 507 |
| 185 | Ga0206355_1007025 | 3300020076 | Bacteria | 1046 |
| 186 | Ga0206355_1037541 | 3300020076 | Bacteria | 977 |
| 187 | Ga0206351_10156800 | 3300020077 | Bacteria | 588 |
| 188 | Ga0206351_10376218 | 3300020077 | Bacteria | 1197 |
| 189 | Ga0206351_10956255 | 3300020077 | Bacteria | 657 |
| 190 | Ga0206352_10054722 | 3300020078 | Bacteria | 1241 |
| 191 | Ga0206352_10461982 | 3300020078 | Bacteria | 938 |
| 192 | Ga0206350_10221184 | 3300020080 | Bacteria | 1145 |
| 193 | Ga0206350_11267920 | 3300020080 | Bacteria | 1036 |
| 194 | Ga0206354_10038488 | 3300020081 | Bacteria | 913 |
| 195 | Ga0206354_10361875 | 3300020081 | Bacteria | 760 |
| 196 | Ga0206354_10746139 | 3300020081 | Bacteria | 1523 |
| 197 | Ga0206354_11070946 | 3300020081 | Bacteria | 848 |
| 198 | Ga0206354_11163887 | 3300020081 | Bacteria | 781 |
| 199 | Ga0206353_10523663 | 3300020082 | Bacteria | 1243 |
| 200 | Ga0206353_11137416 | 3300020082 | Bacteria | 743 |
| 201 | Ga0206353_11724054 | 3300020082 | Bacteria | 755 |
| 202 | Ga0206353_11861206 | 3300020082 | Bacteria | 1043 |
| 203 | Ga0213871_10092047 | 3300021441 | Bacteria | 879 |
| 204 | Ga0224712_10090982 | 3300022467 | Bacteria | 1278 |
| 205 | Ga0224712_10095648 | 3300022467 | Bacteria | 1251 |
| 206 | Ga0224712_10302764 | 3300022467 | Bacteria | 748 |
| 207 | Ga0224712_10311022 | 3300022467 | Bacteria | 738 |
| 208 | Ga0224712_10388592 | 3300022467 | Unclassified | 664 |
| 209 | Ga0207656_10004764 | 3300025321 | Bacteria | 4761 |
| 210 | Ga0207642_10000005 | 3300025899 | Bacteria | 401934 |
| 211 | Ga0207642_10139159 | 3300025899 | Bacteria | 1277 |
| 212 | Ga0207710_10427302 | 3300025900 | Bacteria | 682 |
| 213 | Ga0207688_10089068 | 3300025901 | Bacteria | 1770 |
| 214 | Ga0207680_11032657 | 3300025903 | Bacteria | 588 |
| 215 | Ga0207647_10232934 | 3300025904 | Bacteria | 1059 |
| 216 | Ga0207685_10000025 | 3300025905 | Bacteria | 110358 |
| 217 | Ga0207699_11116401 | 3300025906 | Bacteria | 584 |
| 218 | Ga0207645_10140152 | 3300025907 | Bacteria | 1576 |
| 219 | Ga0207705_11486894 | 3300025909 | Bacteria | 513 |
| 220 | Ga0207707_10079437 | 3300025912 | Bacteria | 2864 |
| 221 | Ga0207695_10185529 | 3300025913 | Bacteria | 1999 |
| 222 | Ga0207693_10041345 | 3300025915 | Bacteria | 3628 |
| 223 | Ga0207663_10010849 | 3300025916 | Bacteria | 4867 |
| 224 | Ga0207660_10042447 | 3300025917 | Bacteria | 3193 |
| 225 | Ga0207660_10062578 | 3300025917 | Bacteria | 2681 |
| 226 | Ga0207662_10043963 | 3300025918 | Bacteria | 2636 |
| 227 | Ga0207657_10361040 | 3300025919 | Bacteria | 1145 |
| 228 | Ga0207657_10763015 | 3300025919 | Bacteria | 749 |
| 229 | Ga0207652_10085390 | 3300025921 | Bacteria | 2766 |
| 230 | Ga0207652_10512575 | 3300025921 | Bacteria | 1079 |
| 231 | Ga0207681_10069968 | 3300025923 | Bacteria | 2443 |
| 232 | Ga0207694_10000004 | 3300025924 | Bacteria | 967075 |
| 233 | Ga0207694_10528476 | 3300025924 | Bacteria | 989 |
| 234 | Ga0207650_11846397 | 3300025925 | Unclassified | 511 |
| 235 | Ga0207687_10000015 | 3300025927 | Bacteria | 261701 |
| 236 | Ga0207687_10006580 | 3300025927 | Bacteria | 7665 |
| 237 | Ga0207687_10124555 | 3300025927 | Bacteria | 1932 |
| 238 | Ga0207700_10106824 | 3300025928 | Bacteria | 2245 |
| 239 | Ga0207700_10380491 | 3300025928 | Bacteria | 1234 |
| 240 | Ga0207664_10061653 | 3300025929 | Bacteria | 2993 |
| 241 | Ga0207664_11196899 | 3300025929 | Bacteria | 678 |
| 242 | Ga0207644_10075439 | 3300025931 | Bacteria | 2478 |
| 243 | Ga0207706_10000017 | 3300025933 | Bacteria | 169589 |
| 244 | Ga0207706_10017951 | 3300025933 | Bacteria | 6368 |
| 245 | Ga0207686_10002116 | 3300025934 | Bacteria | 10933 |
| 246 | Ga0207686_10253757 | 3300025934 | Bacteria | 1286 |
| 247 | Ga0207709_10227322 | 3300025935 | Bacteria | 1350 |
| 248 | Ga0207669_10000056 | 3300025937 | Bacteria | 56304 |
| 249 | Ga0207669_10181594 | 3300025937 | Bacteria | 1509 |
| 250 | Ga0207669_10237489 | 3300025937 | Bacteria | 1349 |
| 251 | Ga0207711_10233576 | 3300025941 | Bacteria | 1685 |
| 252 | Ga0207679_10152448 | 3300025945 | Bacteria | 1883 |
| 253 | Ga0207679_10230742 | 3300025945 | Bacteria | 1562 |
| 254 | Ga0207679_11462441 | 3300025945 | Bacteria | 627 |
| 255 | Ga0207667_10947050 | 3300025949 | Bacteria | 851 |
| 256 | Ga0207651_10001711 | 3300025960 | Bacteria | 10131 |
| 257 | Ga0207712_10089104 | 3300025961 | Bacteria | 2267 |
| 258 | Ga0207712_10180299 | 3300025961 | Bacteria | 1658 |
| 259 | Ga0207668_10755914 | 3300025972 | Bacteria | 858 |
| 260 | Ga0207640_10001278 | 3300025981 | Bacteria | 13673 |
| 261 | Ga0207640_10113727 | 3300025981 | Bacteria | 1924 |
| 262 | Ga0207658_11224182 | 3300025986 | Bacteria | 686 |
| 263 | Ga0207677_10000299 | 3300026023 | Bacteria | 37042 |
| 264 | Ga0207677_10428297 | 3300026023 | Bacteria | 1129 |
| 265 | Ga0207703_10134954 | 3300026035 | Bacteria | 2135 |
| 266 | Ga0207639_10745298 | 3300026041 | Bacteria | 911 |
| 267 | Ga0207708_10017895 | 3300026075 | Bacteria | 5333 |
| 268 | Ga0207708_10212430 | 3300026075 | Bacteria | 1547 |
| 269 | Ga0207708_11961971 | 3300026075 | Bacteria | 513 |
| 270 | Ga0207641_10003646 | 3300026088 | Bacteria | 13583 |
| 271 | Ga0207648_10084916 | 3300026089 | Bacteria | 2761 |
| 272 | Ga0207648_10166478 | 3300026089 | Bacteria | 1948 |
| 273 | Ga0207676_12549441 | 3300026095 | Bacteria | 508 |
| 274 | Ga0207674_10001054 | 3300026116 | Bacteria | 35890 |
| 275 | Ga0207674_11007377 | 3300026116 | Bacteria | 802 |
| 276 | Ga0207675_100099600 | 3300026118 | Bacteria | 2737 |
| 277 | Ga0207675_100180365 | 3300026118 | Bacteria | 2022 |
| 278 | Ga0207675_100204736 | 3300026118 | Bacteria | 1896 |
| 279 | Ga0207675_100613264 | 3300026118 | Bacteria | 1092 |
| 280 | Ga0207683_10223569 | 3300026121 | Bacteria | 1716 |
| 281 | Ga0207683_10636838 | 3300026121 | Bacteria | 987 |
| 282 | Ga0207683_10689766 | 3300026121 | Bacteria | 947 |
| 283 | Ga0207698_11901676 | 3300026142 | Bacteria | 610 |
| 284 | Ga0210002_1027818 | 3300027617 | Unclassified | 932 |
| 285 | Ga0209998_10063967 | 3300027717 | Bacteria | 870 |
| 286 | Ga0209998_10090460 | 3300027717 | Bacteria | 750 |
| 287 | Ga0207428_10096660 | 3300027907 | Bacteria | 2287 |
| 288 | Ga0268265_11131663 | 3300028380 | Bacteria | 778 |
| 289 | Ga0268264_10001292 | 3300028381 | Bacteria | 23636 |
| 290 | Ga0268264_10179874 | 3300028381 | Bacteria | 1920 |
| 291 | Ga0265319_1000035 | 3300028563 | Bacteria | 117269 |
| 292 | Ga0265323_10254798 | 3300028653 | Bacteria | 546 |
| 293 | Ga0265322_10107332 | 3300028654 | Bacteria | 794 |
| 294 | Ga0265336_10216325 | 3300028666 | Bacteria | 569 |
| 295 | Ga0265338_10000171 | 3300028800 | Bacteria | 120054 |
| 296 | Ga0265338_10128094 | 3300028800 | Bacteria | 2010 |
| 297 | Ga0265324_10107172 | 3300029957 | Bacteria | 949 |
| 298 | Ga0268256_1053309 | 3300030500 | Bacteria | 842 |
| 299 | Ga0265320_10128753 | 3300031240 | Bacteria | 1151 |
| 300 | Ga0265325_10010611 | 3300031241 | Bacteria | 5325 |
| 301 | Ga0265327_10317609 | 3300031251 | Bacteria | 684 |
| 302 | Ga0307408_100085517 | 3300031548 | Bacteria | 2368 |
| 303 | Ga0307408_100440213 | 3300031548 | Bacteria | 1128 |
| 304 | Ga0265314_10335980 | 3300031711 | Bacteria | 836 |
| 305 | Ga0265342_10459136 | 3300031712 | Bacteria | 653 |
| 306 | Ga0316578_10337080 | 3300031728 | Bacteria | 899 |
| 307 | Ga0307405_10036216 | 3300031731 | Bacteria | 2954 |
| 308 | Ga0307405_10059393 | 3300031731 | Bacteria | 2410 |
| 309 | Ga0316577_10817901 | 3300031733 | Bacteria | 528 |
| 310 | Ga0307413_10024244 | 3300031824 | Bacteria | 3304 |
| 311 | Ga0307410_10002132 | 3300031852 | Bacteria | 9402 |
| 312 | Ga0307406_10150927 | 3300031901 | Bacteria | 1657 |
| 313 | Ga0307406_11154075 | 3300031901 | Bacteria | 671 |
| 314 | Ga0307407_10001268 | 3300031903 | Bacteria | 8992 |
| 315 | Ga0307412_10560184 | 3300031911 | Bacteria | 961 |
| 316 | Ga0307412_11371941 | 3300031911 | Bacteria | 639 |
| 317 | Ga0307409_100101103 | 3300031995 | Bacteria | 2391 |
| 318 | Ga0307416_100003017 | 3300032002 | Bacteria | 9834 |
| 319 | Ga0307416_100852473 | 3300032002 | Bacteria | 1009 |
| 320 | Ga0307416_101855517 | 3300032002 | Unclassified | 706 |
| 321 | Ga0307416_102191830 | 3300032002 | Bacteria | 654 |
| 322 | Ga0307414_10071892 | 3300032004 | Bacteria | 2497 |
| 323 | Ga0307411_10025443 | 3300032005 | Bacteria | 3546 |
| 324 | Ga0307411_10244186 | 3300032005 | Bacteria | 1408 |
| 325 | Ga0307411_10621727 | 3300032005 | Bacteria | 931 |
| 326 | Ga0307415_100029129 | 3300032126 | Bacteria | 3524 |
| 327 | Ga0307415_101325721 | 3300032126 | Bacteria | 683 |
| 328 | Ga0316593_10011204 | 3300032168 | Bacteria | 2599 |
| 329 | Ga0316593_10065150 | 3300032168 | Bacteria | 1252 |
| 330 | Ga0316593_10085467 | 3300032168 | Bacteria | 1106 |
| 331 | Ga0316593_10168202 | 3300032168 | Bacteria | 803 |
| 332 | Ga0316593_10290703 | 3300032168 | Unclassified | 617 |
| 333 | Ga0316593_10352506 | 3300032168 | Bacteria | 563 |
| 334 | Ga0316592_1058324 | 3300033524 | Bacteria | 865 |
| 335 | Ga0316592_1118771 | 3300033524 | Bacteria | 613 |
| 336 | Ga0316596_1085647 | 3300033541 | Unclassified | 848 |
| 337 | Ga0373936_0580106 | 3300035113 | Bacteria | 526 |
| 338 | Ga0373939_0218580 | 3300035114 | Bacteria | 729 |
| 339 | Ga0373953_0262596 | 3300035117 | Bacteria | 751 |
| 340 | Ga0373943_0085016 | 3300035170 | Bacteria | 1629 |
| 341 | Ga0373943_0456594 | 3300035170 | Bacteria | 743 |
| 342 | Ga0373962_0021242 | 3300035242 | Bacteria | 1711 |
| 343 | Ga0316574_0504192 | 3300035398 | Bacteria | 754 |
| 344 | Ga0373924_0161343 | 3300035410 | Bacteria | 983 |
| 345 | Ga0373931_0607788 | 3300035691 | Bacteria | 715 |
| 346 | Ga0373935_0202855 | 3300035692 | Bacteria | 1371 |
| 347 | Ga0373935_1042206 | 3300035692 | Bacteria | 608 |
| 348 | Ga0373937_0147835 | 3300036401 | Bacteria | 2200 |
| 349 | Ga0373937_0849766 | 3300036401 | Bacteria | 861 |
| 350 | Ga0373937_1036227 | 3300036401 | Bacteria | 769 |
| 351 | Ga0373937_1599996 | 3300036401 | Bacteria | 599 |
| 352 | Ga0316582_0978874 | 3300036647 | Bacteria | 578 |
| 353 | Ga0316584_0341393 | 3300036712 | Bacteria | 1077 |
| 354 | Ga0316584_1187171 | 3300036712 | Bacteria | 504 |
| 355 | Ga0373925_0434135 | 3300037068 | Bacteria | 1074 |
| 356 | Ga0373925_0702432 | 3300037068 | Unclassified | 834 |
| 357 | Ga0395899_0985771 | 3300037312 | Bacteria | 509 |
| 358 | Ga0395900_0586701 | 3300037418 | Bacteria | 1056 |
| 359 | Ga0395900_0779044 | 3300037418 | Bacteria | 885 |
| 360 | Ga0395898_1338292 | 3300037466 | Bacteria | 645 |
| 361 | Ga0395905_0137603 | 3300037471 | Bacteria | 2298 |
| 362 | Ga0436364_1305764 | 3300037853 | Bacteria | 1029 |
| 363 | Ga0395901_0108382 | 3300038443 | Bacteria | 2916 |
| 364 | Ga0395901_1058856 | 3300038443 | Bacteria | 784 |
| 365 | Ga0242420_140503 | 3300038996 | Bacteria | 537 |
| 366 | Ga0400483_158900 | 3300039062 | Bacteria | 1178 |
| 367 | Ga0400489_52134 | 3300039093 | Bacteria | 1231 |
| 368 | Ga0436365_1138802 | 3300039437 | Bacteria | 678 |
| 369 | Ga0436360_0090361 | 3300039438 | Bacteria | 9969 |
| 370 | Ga0436361_0509578 | 3300039447 | Unclassified | 775 |
| 371 | Ga0436363_1473259 | 3300039450 | Bacteria | 511 |
| 372 | Ga0439461_0126984 | 3300041410 | Bacteria | 642 |
| 373 | Ga0439466_0072186 | 3300041411 | Bacteria | 1098 |
| 374 | Ga0439465_0181790 | 3300041413 | Bacteria | 761 |
| 375 | Ga0451800_0514641 | 3300041459 | Bacteria | 1254 |
| 376 | Ga0451802_0732742 | 3300041460 | Bacteria | 657 |
| 377 | Ga0451805_129914 | 3300041461 | Bacteria | 893 |
| 378 | Ga0451807_0556699 | 3300041486 | Bacteria | 1268 |
| 379 | Ga0451833_0079236 | 3300041491 | Bacteria | 1015 |
| 380 | Ga0451837_1632582 | 3300041494 | Bacteria | 621 |
| 381 | Ga0451839_0045583 | 3300041496 | Bacteria | 762 |
| 382 | Ga0451849_0767292 | 3300041505 | Bacteria | 550 |
| 383 | Ga0451849_1533487 | 3300041505 | Bacteria | 1047 |
| 384 | Ga0451853_0315177 | 3300041512 | Bacteria | 1613 |
| 385 | Ga0451853_2640337 | 3300041512 | Bacteria | 672 |
| 386 | Ga0439448_0007299 | 3300042005 | Bacteria | 3200 |
| 387 | Ga0439463_047501 | 3300042016 | Bacteria | 1094 |
| 388 | Ga0439463_149134 | 3300042016 | Bacteria | 606 |
| 389 | Ga0450920_001993 | 3300042122 | Bacteria | 3446 |
| 390 | Ga0450920_140547 | 3300042122 | Bacteria | 511 |
| 391 | Ga0450898_046728 | 3300042134 | Bacteria | 829 |
| 392 | Ga0450910_020454 | 3300042147 | Bacteria | 998 |
| 393 | Ga0439435_0136339 | 3300042436 | Bacteria | 779 |
| 394 | Ga0439460_0160753 | 3300042461 | Bacteria | 753 |
| 395 | Ga0466965_0281656 | 3300044683 | Bacteria | 898 |
| 396 | Ga0466963_0000301 | 3300044694 | Bacteria | 22253 |
| 397 | Ga0466963_0320595 | 3300044694 | Bacteria | 1091 |
| 398 | Ga0466963_0491483 | 3300044694 | Bacteria | 866 |
| 399 | Ga0466960_0116870 | 3300044901 | Bacteria | 1392 |
| 400 | Ga0451576_0304077 | 3300045051 | Bacteria | 1668 |
| 401 | Ga0466958_0711869 | 3300045836 | Bacteria | 654 |
| 402 | Ga0466967_0523245 | 3300045976 | Bacteria | 1166 |
| 403 | Ga0466967_1566981 | 3300045976 | Bacteria | 656 |
| 404 | Ga0466967_2463417 | 3300045976 | Bacteria | 515 |
| 405 | Ga0495592_0026085 | 3300046454 | Bacteria | 4433 |
| 406 | Ga0495592_0109114 | 3300046454 | Bacteria | 1961 |
| 407 | Ga0495603_0000938 | 3300046455 | Bacteria | 16778 |
| 408 | Ga0495629_0002708 | 3300046459 | Bacteria | 13568 |
| 409 | Ga0495629_0074689 | 3300046459 | Bacteria | 2367 |
| 410 | Ga0495653_0713434 | 3300046463 | Bacteria | 608 |
| 411 | Ga0495580_0776350 | 3300046472 | Bacteria | 623 |
| 412 | Ga0495582_0000003 | 3300046473 | Bacteria | 168880 |
| 413 | Ga0495605_0106513 | 3300046474 | Bacteria | 1283 |
| 414 | Ga0495662_0198144 | 3300046476 | Bacteria | 990 |
| 415 | Ga0495664_0125948 | 3300046477 | Bacteria | 1550 |
| 416 | Ga0495584_0289845 | 3300046491 | Bacteria | 832 |
| 417 | Ga0495594_0254464 | 3300046499 | Bacteria | 1000 |
| 418 | Ga0495596_0327177 | 3300046500 | Unclassified | 596 |
| 419 | Ga0495583_0119251 | 3300046506 | Bacteria | 1112 |
| 420 | Ga0495608_0085004 | 3300046511 | Bacteria | 2051 |
| 421 | Ga0495608_0444193 | 3300046511 | Bacteria | 790 |
| 422 | Ga0495610_0315381 | 3300046512 | Bacteria | 599 |
| 423 | Ga0495616_0144153 | 3300046513 | Bacteria | 1082 |
| 424 | Ga0495618_0000144 | 3300046514 | Bacteria | 50904 |
| 425 | Ga0495618_0881612 | 3300046514 | Bacteria | 517 |
| 426 | Ga0495620_0000352 | 3300046515 | Bacteria | 31894 |
| 427 | Ga0495620_0227046 | 3300046515 | Bacteria | 714 |
| 428 | Ga0495628_0141048 | 3300046516 | Bacteria | 1839 |
| 429 | Ga0495628_0150514 | 3300046516 | Bacteria | 1773 |
| 430 | Ga0495630_0024086 | 3300046517 | Bacteria | 4502 |
| 431 | Ga0495630_0656082 | 3300046517 | Bacteria | 803 |
| 432 | Ga0495630_0922616 | 3300046517 | Bacteria | 665 |
| 433 | Ga0495631_0256612 | 3300046518 | Bacteria | 745 |
| 434 | Ga0495632_0199852 | 3300046519 | Bacteria | 911 |
| 435 | Ga0495637_0069011 | 3300046520 | Bacteria | 1431 |
| 436 | Ga0495663_0027657 | 3300046525 | Bacteria | 1665 |
| 437 | Ga0495663_0329324 | 3300046525 | Bacteria | 554 |
| 438 | Ga0495642_0163032 | 3300046528 | Bacteria | 967 |
| 439 | Ga0495652_0000010 | 3300046529 | Bacteria | 261584 |
| 440 | Ga0495652_0133453 | 3300046529 | Bacteria | 1962 |
| 441 | Ga0495652_0352723 | 3300046529 | Bacteria | 1053 |
| 442 | Ga0495652_0740646 | 3300046529 | Unclassified | 658 |
| 443 | Ga0495654_0267910 | 3300046530 | Bacteria | 706 |
| 444 | Ga0495640_0081700 | 3300046533 | Bacteria | 2148 |
| 445 | Ga0495640_0159172 | 3300046533 | Bacteria | 1448 |
| 446 | Ga0495586_0487960 | 3300046535 | Bacteria | 711 |
| 447 | Ga0495587_0050595 | 3300046536 | Bacteria | 2458 |
| 448 | Ga0495587_0104148 | 3300046536 | Bacteria | 1633 |
| 449 | Ga0495587_0580277 | 3300046536 | Bacteria | 618 |
| 450 | Ga0495609_0108944 | 3300046538 | Bacteria | 1196 |
| 451 | Ga0495621_0155674 | 3300046539 | Bacteria | 901 |
| 452 | Ga0495645_0002432 | 3300046543 | Bacteria | 12646 |
| 453 | Ga0495645_0022178 | 3300046543 | Bacteria | 4592 |
| 454 | Ga0495645_0028840 | 3300046543 | Bacteria | 4033 |
| 455 | Ga0495645_0897881 | 3300046543 | Bacteria | 526 |
| 456 | Ga0495633_0306633 | 3300046558 | Bacteria | 721 |
| 457 | Ga0495667_0000505 | 3300046559 | Bacteria | 24881 |
| 458 | Ga0495667_0435236 | 3300046559 | Unclassified | 825 |
| 459 | Ga0495656_0568042 | 3300046615 | Bacteria | 605 |
| 460 | Ga0495668_0084471 | 3300046616 | Bacteria | 1741 |
| 461 | Ga0495634_0000638 | 3300046642 | Bacteria | 34084 |
| 462 | Ga0495634_0002399 | 3300046642 | Bacteria | 15606 |
| 463 | Ga0495634_0434404 | 3300046642 | Bacteria | 776 |
| 464 | Ga0495634_0615291 | 3300046642 | Bacteria | 629 |
| 465 | Ga0495611_0024895 | 3300046648 | Bacteria | 2605 |
| 466 | Ga0495625_0000032 | 3300046660 | Bacteria | 233135 |
| 467 | Ga0495635_0140929 | 3300046663 | Bacteria | 1642 |
| 468 | Ga0495635_0334066 | 3300046663 | Bacteria | 1013 |
| 469 | Ga0495635_1006634 | 3300046663 | Bacteria | 530 |
| 470 | Ga0495659_0003146 | 3300046664 | Bacteria | 5294 |
| 471 | Ga0495661_0193844 | 3300046665 | Bacteria | 1068 |
| 472 | Ga0495646_0168339 | 3300046680 | Bacteria | 1209 |
| 473 | Ga0495646_0552993 | 3300046680 | Bacteria | 587 |
| 474 | Ga0495647_0001468 | 3300046681 | Bacteria | 7312 |
| 475 | Ga0495647_0116643 | 3300046681 | Bacteria | 1119 |
| 476 | Ga0495658_0000001 | 3300046683 | Bacteria | 385362 |
| 477 | Ga0495658_0003950 | 3300046683 | Bacteria | 7317 |
| 478 | Ga0495669_0010118 | 3300046684 | Bacteria | 3983 |
| 479 | Ga0495669_0115857 | 3300046684 | Bacteria | 1254 |
| 480 | Ga0495669_0168151 | 3300046684 | Bacteria | 1042 |
| 481 | Ga0495624_0746873 | 3300046690 | Unclassified | 580 |
| 482 | Ga0495670_0113667 | 3300046691 | Bacteria | 1402 |
| 483 | Ga0495649_0310984 | 3300046694 | Bacteria | 801 |
| 484 | Ga0495589_0107163 | 3300046794 | Bacteria | 1350 |
| 485 | Ga0495589_0460660 | 3300046794 | Bacteria | 581 |
| 486 | Ga0495600_0002554 | 3300046809 | Bacteria | 10488 |
| 487 | Ga0495600_0807637 | 3300046809 | Bacteria | 558 |
| 488 | Ga0495660_0108298 | 3300046810 | Bacteria | 1421 |
| 489 | Ga0495604_0199701 | 3300047317 | Bacteria | 1388 |
| 490 | Ga0495674_0000010 | 3300047319 | Bacteria | 285794 |
| 491 | Ga0495674_0331901 | 3300047319 | Bacteria | 1237 |
| 492 | Ga0495672_0000281 | 3300047320 | Bacteria | 70653 |
| 493 | Ga0495676_0000346 | 3300047321 | Bacteria | 37821 |
| 494 | Ga0495680_0023946 | 3300047322 | Bacteria | 5072 |
| 495 | Ga0495680_0068558 | 3300047322 | Bacteria | 2709 |
| 496 | Ga0495683_0232976 | 3300047323 | Bacteria | 816 |
| 497 | Ga0495677_0021205 | 3300047445 | Bacteria | 2355 |
| 498 | Ga0495679_102000 | 3300047446 | Bacteria | 796 |
| 499 | Ga0495685_042986 | 3300047447 | Bacteria | 1542 |
| 500 | Ga0495684_0202239 | 3300047471 | Bacteria | 1464 |
| 501 | Ga0495686_0084442 | 3300047472 | Bacteria | 1935 |
| 502 | Ga0495686_0307544 | 3300047472 | Bacteria | 873 |
| 503 | Ga0495602_0163151 | 3300048088 | Bacteria | 1738 |
| 504 | Ga0495615_0032706 | 3300048090 | Bacteria | 1256 |
| 505 | Ga0495615_0209677 | 3300048090 | Bacteria | 604 |
| 506 | Ga0496100_0000001 | 3300048903 | Bacteria | 530179 |
| 507 | Ga0496100_0065413 | 3300048903 | Unclassified | 2409 |
| 508 | Ga0496100_0296774 | 3300048903 | Bacteria | 1209 |
| 509 | Ga0496100_1376951 | 3300048903 | Bacteria | 557 |
| 510 | Ga0496101_0000028 | 3300048904 | Bacteria | 198664 |
| 511 | Ga0496102_0000561 | 3300048905 | Bacteria | 39545 |
| 512 | Ga0496102_0063392 | 3300048905 | Bacteria | 3384 |
| 513 | Ga0496103_0000057 | 3300048906 | Bacteria | 142223 |
| 514 | Ga0496103_0238753 | 3300048906 | Bacteria | 1169 |
| 515 | Ga0496103_0348692 | 3300048906 | Bacteria | 952 |
| 516 | Ga0496104_0000213 | 3300048907 | Bacteria | 51219 |
| 517 | Ga0496104_0011173 | 3300048907 | Bacteria | 8036 |
| 518 | Ga0496105_0001058 | 3300048908 | Bacteria | 19090 |
| 519 | Ga0496105_0035285 | 3300048908 | Bacteria | 4116 |
| 520 | Ga0496106_0000055 | 3300048909 | Bacteria | 91570 |
| 521 | Ga0496107_0000002 | 3300048910 | Bacteria | 320871 |
| 522 | Ga0496108_0000005 | 3300048911 | Bacteria | 535059 |
| 523 | Ga0496109_0000002 | 3300048912 | Bacteria | 443393 |
| 524 | Ga0496109_0165178 | 3300048912 | Bacteria | 2075 |
| 525 | Ga0496109_0633654 | 3300048912 | Bacteria | 1006 |
| 526 | Ga0496110_0004182 | 3300048913 | Bacteria | 11148 |
| 527 | Ga0496110_0921887 | 3300048913 | Bacteria | 780 |
| 528 | Ga0496110_1131692 | 3300048913 | Bacteria | 691 |
| 529 | Ga0496110_1591970 | 3300048913 | Bacteria | 563 |
| 530 | Ga0496110_1782697 | 3300048913 | Bacteria | 526 |
| 531 | Ga0496111_0000117 | 3300048914 | Bacteria | 34553 |
| 532 | Ga0496111_0462455 | 3300048914 | Bacteria | 936 |
| 533 | Ga0496111_0615947 | 3300048914 | Bacteria | 794 |
| 534 | Ga0496112_0000013 | 3300048915 | Bacteria | 237194 |
| 535 | Ga0496112_1006690 | 3300048915 | Bacteria | 753 |
| 536 | Ga0496113_0157328 | 3300048916 | Bacteria | 1795 |
| 537 | Ga0496113_1205028 | 3300048916 | Bacteria | 591 |
| 538 | Ga0496114_0000003 | 3300048917 | Bacteria | 630981 |
| 539 | Ga0496114_1412892 | 3300048917 | Bacteria | 583 |
| 540 | Ga0496115_0000031 | 3300048918 | Bacteria | 138258 |
| 541 | Ga0496115_0459754 | 3300048918 | Bacteria | 1027 |
| 542 | Ga0496115_0819923 | 3300048918 | Bacteria | 723 |
| 543 | Ga0496118_0453632 | 3300048921 | Unclassified | 650 |
| 544 | Ga0496119_0318582 | 3300048922 | Bacteria | 762 |
| 545 | Ga0496126_0003365 | 3300048929 | Bacteria | 20276 |
| 546 | Ga0496126_0188226 | 3300048929 | Bacteria | 1749 |
| 547 | Ga0496126_1266830 | 3300048929 | Bacteria | 539 |
| 548 | Ga0501307_034394 | 3300049162 | Bacteria | 716 |
| 549 | Ga0501031_0000279 | 3300049568 | Bacteria | 28880 |
| 550 | Ga0501031_0040039 | 3300049568 | Bacteria | 3059 |
| 551 | Ga0501031_0681970 | 3300049568 | Bacteria | 660 |
| 552 | Ga0501032_0000532 | 3300049569 | Bacteria | 30935 |
| 553 | Ga0501032_0006256 | 3300049569 | Bacteria | 8765 |
| 554 | Ga0501032_0209739 | 3300049569 | Bacteria | 1270 |
| 555 | Ga0501033_0000635 | 3300049570 | Bacteria | 32423 |
| 556 | Ga0501033_0032194 | 3300049570 | Bacteria | 3937 |
| 557 | Ga0501033_0313147 | 3300049570 | Bacteria | 1103 |
| 558 | Ga0501034_0043408 | 3300049571 | Bacteria | 4550 |
| 559 | Ga0501034_0057117 | 3300049571 | Bacteria | 3924 |
| 560 | Ga0501034_0100908 | 3300049571 | Bacteria | 2880 |
| 561 | Ga0501034_0316488 | 3300049571 | Bacteria | 1494 |
| 562 | Ga0501034_0362009 | 3300049571 | Bacteria | 1377 |
| 563 | Ga0501034_0463293 | 3300049571 | Bacteria | 1184 |
| 564 | Ga0501034_0512890 | 3300049571 | Bacteria | 1112 |
| 565 | Ga0501036_0000109 | 3300049572 | Bacteria | 50975 |
| 566 | Ga0501036_0094448 | 3300049572 | Bacteria | 2527 |
| 567 | Ga0501036_0127828 | 3300049572 | Bacteria | 2146 |
| 568 | Ga0501036_0235038 | 3300049572 | Bacteria | 1538 |
| 569 | Ga0501036_0325146 | 3300049572 | Bacteria | 1285 |
| 570 | Ga0501036_0502590 | 3300049572 | Bacteria | 1009 |
| 571 | Ga0501036_0654111 | 3300049572 | Bacteria | 870 |
| 572 | Ga0501036_0994959 | 3300049572 | Bacteria | 687 |
| 573 | Ga0501037_0000601 | 3300049573 | Bacteria | 28089 |
| 574 | Ga0501037_0003995 | 3300049573 | Bacteria | 10693 |
| 575 | Ga0501037_0115612 | 3300049573 | Bacteria | 1931 |
| 576 | Ga0501037_0937940 | 3300049573 | Bacteria | 566 |
| 577 | Ga0501038_0000584 | 3300049574 | Bacteria | 32397 |
| 578 | Ga0501038_0156137 | 3300049574 | Bacteria | 1858 |
| 579 | Ga0501038_0188510 | 3300049574 | Bacteria | 1660 |
| 580 | Ga0501038_0697984 | 3300049574 | Bacteria | 760 |
| 581 | Ga0501039_0000274 | 3300049575 | Bacteria | 36859 |
| 582 | Ga0501039_0040793 | 3300049575 | Bacteria | 3582 |
| 583 | Ga0501039_0043256 | 3300049575 | Bacteria | 3479 |
| 584 | Ga0501039_0119750 | 3300049575 | Bacteria | 2062 |
| 585 | Ga0501039_1327507 | 3300049575 | Bacteria | 555 |
| 586 | Ga0501040_0000041 | 3300049576 | Bacteria | 58334 |
| 587 | Ga0501040_0013447 | 3300049576 | Bacteria | 5379 |
| 588 | Ga0501040_0030810 | 3300049576 | Bacteria | 3624 |
| 589 | Ga0501040_0120644 | 3300049576 | Bacteria | 1839 |
| 590 | Ga0501040_0150376 | 3300049576 | Bacteria | 1643 |
| 591 | Ga0501040_0154781 | 3300049576 | Bacteria | 1618 |
| 592 | Ga0501040_0308703 | 3300049576 | Bacteria | 1131 |
| 593 | Ga0501041_0000074 | 3300049577 | Bacteria | 38021 |
| 594 | Ga0501041_0010875 | 3300049577 | Bacteria | 5369 |
| 595 | Ga0501041_0027854 | 3300049577 | Bacteria | 3407 |
| 596 | Ga0501041_0738890 | 3300049577 | Bacteria | 630 |
| 597 | Ga0501042_0000032 | 3300049578 | Bacteria | 44524 |
| 598 | Ga0501042_0002281 | 3300049578 | Bacteria | 11713 |
| 599 | Ga0501042_0100032 | 3300049578 | Bacteria | 2084 |
| 600 | Ga0501042_0169256 | 3300049578 | Bacteria | 1577 |
| 601 | Ga0501043_0002422 | 3300049579 | Bacteria | 15787 |
| 602 | Ga0501043_0015835 | 3300049579 | Bacteria | 5909 |
| 603 | Ga0501043_0174063 | 3300049579 | Bacteria | 1678 |
| 604 | Ga0501043_0222609 | 3300049579 | Bacteria | 1459 |
| 605 | Ga0501043_0259435 | 3300049579 | Bacteria | 1337 |
| 606 | Ga0501043_0721240 | 3300049579 | Bacteria | 727 |
| 607 | Ga0501043_0799100 | 3300049579 | Bacteria | 682 |
| 608 | Ga0501046_0023278 | 3300049580 | Bacteria | 5096 |
| 609 | Ga0501046_0065747 | 3300049580 | Bacteria | 2828 |
| 610 | Ga0501046_0069401 | 3300049580 | Bacteria | 2742 |
| 611 | Ga0501046_0078574 | 3300049580 | Bacteria | 2552 |
| 612 | Ga0501046_0088122 | 3300049580 | Bacteria | 2390 |
| 613 | Ga0501046_0218994 | 3300049580 | Bacteria | 1410 |
| 614 | Ga0501047_0000626 | 3300049581 | Bacteria | 37305 |
| 615 | Ga0501047_0003717 | 3300049581 | Bacteria | 14367 |
| 616 | Ga0501047_0026314 | 3300049581 | Bacteria | 5597 |
| 617 | Ga0501047_0621292 | 3300049581 | Bacteria | 901 |
| 618 | Ga0501047_0789523 | 3300049581 | Bacteria | 764 |
| 619 | Ga0501048_0000229 | 3300049582 | Bacteria | 36840 |
| 620 | Ga0501048_0003254 | 3300049582 | Bacteria | 12376 |
| 621 | Ga0501048_0012815 | 3300049582 | Bacteria | 6230 |
| 622 | Ga0501048_0053711 | 3300049582 | Bacteria | 2863 |
| 623 | Ga0501048_1068455 | 3300049582 | Bacteria | 581 |
| 624 | Ga0501067_0022285 | 3300049583 | Bacteria | 3505 |
| 625 | Ga0501067_0028158 | 3300049583 | Bacteria | 3112 |
| 626 | Ga0501067_0065893 | 3300049583 | Bacteria | 2005 |
| 627 | Ga0501068_0000206 | 3300049584 | Bacteria | 28346 |
| 628 | Ga0501068_0002695 | 3300049584 | Bacteria | 9416 |
| 629 | Ga0501068_0002787 | 3300049584 | Bacteria | 9294 |
| 630 | Ga0501068_0015476 | 3300049584 | Bacteria | 4382 |
| 631 | Ga0501068_0045430 | 3300049584 | Bacteria | 2646 |
| 632 | Ga0501069_0000346 | 3300049585 | Bacteria | 20954 |
| 633 | Ga0501069_0008610 | 3300049585 | Bacteria | 5367 |
| 634 | Ga0501069_0095508 | 3300049585 | Bacteria | 1683 |
| 635 | Ga0501069_0104240 | 3300049585 | Bacteria | 1611 |
| 636 | Ga0501069_0221826 | 3300049585 | Bacteria | 1099 |
| 637 | Ga0501070_0004748 | 3300049586 | Bacteria | 11628 |
| 638 | Ga0501070_0015220 | 3300049586 | Bacteria | 6474 |
| 639 | Ga0501070_0057363 | 3300049586 | Bacteria | 3228 |
| 640 | Ga0501070_0125487 | 3300049586 | Bacteria | 2121 |
| 641 | Ga0501070_0285935 | 3300049586 | Bacteria | 1345 |
| 642 | Ga0501070_0416881 | 3300049586 | Bacteria | 1085 |
| 643 | Ga0501070_0689737 | 3300049586 | Bacteria | 808 |
| 644 | Ga0501070_1095325 | 3300049586 | Bacteria | 615 |
| 645 | Ga0501071_0000010 | 3300049587 | Bacteria | 67846 |
| 646 | Ga0501071_0015171 | 3300049587 | Bacteria | 5284 |
| 647 | Ga0501071_0044669 | 3300049587 | Bacteria | 3178 |
| 648 | Ga0501071_0056046 | 3300049587 | Bacteria | 2846 |
| 649 | Ga0501071_0056984 | 3300049587 | Bacteria | 2823 |
| 650 | Ga0501071_0516239 | 3300049587 | Bacteria | 917 |
| 651 | Ga0501071_0782077 | 3300049587 | Bacteria | 736 |
| 652 | Ga0501071_1110459 | 3300049587 | Bacteria | 611 |
| 653 | Ga0501071_1197016 | 3300049587 | Bacteria | 587 |
| 654 | Ga0501071_1382957 | 3300049587 | Bacteria | 543 |
| 655 | Ga0501072_0003756 | 3300049588 | Bacteria | 11460 |
| 656 | Ga0501072_0006030 | 3300049588 | Bacteria | 9243 |
| 657 | Ga0501072_0012212 | 3300049588 | Bacteria | 6563 |
| 658 | Ga0501072_0016459 | 3300049588 | Bacteria | 5678 |
| 659 | Ga0501072_0025595 | 3300049588 | Bacteria | 4596 |
| 660 | Ga0501072_0090888 | 3300049588 | Bacteria | 2424 |
| 661 | Ga0501072_0195176 | 3300049588 | Bacteria | 1614 |
| 662 | Ga0501072_0304247 | 3300049588 | Bacteria | 1267 |
| 663 | Ga0501072_0583374 | 3300049588 | Bacteria | 882 |
| 664 | Ga0501072_0879890 | 3300049588 | Bacteria | 700 |
| 665 | Ga0501072_1298497 | 3300049588 | Unclassified | 564 |
| 666 | Ga0501072_1483277 | 3300049588 | Bacteria | 524 |
| 667 | Ga0501073_0001677 | 3300049589 | Bacteria | 16418 |
| 668 | Ga0501073_0006442 | 3300049589 | Bacteria | 8733 |
| 669 | Ga0501073_0018235 | 3300049589 | Bacteria | 5071 |
| 670 | Ga0501073_0201672 | 3300049589 | Bacteria | 1376 |
| 671 | Ga0501074_0000437 | 3300049590 | Bacteria | 24878 |
| 672 | Ga0501074_0045962 | 3300049590 | Bacteria | 3157 |
| 673 | Ga0501074_0072904 | 3300049590 | Bacteria | 2466 |
| 674 | Ga0501074_0128010 | 3300049590 | Bacteria | 1817 |
| 675 | Ga0501074_0155372 | 3300049590 | Bacteria | 1634 |
| 676 | Ga0501074_0165974 | 3300049590 | Bacteria | 1576 |
| 677 | Ga0501074_0489497 | 3300049590 | Bacteria | 872 |
| 678 | Ga0501074_0546987 | 3300049590 | Bacteria | 820 |
| 679 | Ga0501074_0861787 | 3300049590 | Bacteria | 638 |
| 680 | Ga0501074_0910440 | 3300049590 | Bacteria | 619 |
| 681 | Ga0501075_0002279 | 3300049591 | Bacteria | 12723 |
| 682 | Ga0501075_0007601 | 3300049591 | Bacteria | 7521 |
| 683 | Ga0501075_0034158 | 3300049591 | Bacteria | 3785 |
| 684 | Ga0501075_0036960 | 3300049591 | Bacteria | 3645 |
| 685 | Ga0501075_0126563 | 3300049591 | Bacteria | 1945 |
| 686 | Ga0501075_0286369 | 3300049591 | Bacteria | 1255 |
| 687 | Ga0501075_1294103 | 3300049591 | Bacteria | 552 |
| 688 | Ga0501076_0022848 | 3300049592 | Bacteria | 4812 |
| 689 | Ga0501076_0035853 | 3300049592 | Bacteria | 3882 |
| 690 | Ga0501076_0046939 | 3300049592 | Bacteria | 3413 |
| 691 | Ga0501076_0069563 | 3300049592 | Bacteria | 2813 |
| 692 | Ga0501076_0074637 | 3300049592 | Bacteria | 2717 |
| 693 | Ga0501076_0100488 | 3300049592 | Bacteria | 2330 |
| 694 | Ga0501076_0160439 | 3300049592 | Bacteria | 1831 |
| 695 | Ga0501076_0169944 | 3300049592 | Bacteria | 1777 |
| 696 | Ga0501076_0589648 | 3300049592 | Bacteria | 917 |
| 697 | Ga0501076_0636730 | 3300049592 | Bacteria | 880 |
| 698 | Ga0501076_0645994 | 3300049592 | Bacteria | 873 |
| 699 | Ga0501076_0909309 | 3300049592 | Bacteria | 725 |
| 700 | Ga0501076_1114196 | 3300049592 | Bacteria | 650 |
| 701 | Ga0501077_0000209 | 3300049593 | Bacteria | 34106 |
| 702 | Ga0501077_0002022 | 3300049593 | Bacteria | 12247 |
| 703 | Ga0501077_0068050 | 3300049593 | Bacteria | 2257 |
| 704 | Ga0501077_0216015 | 3300049593 | Bacteria | 1219 |
| 705 | Ga0501077_0589351 | 3300049593 | Bacteria | 714 |
| 706 | Ga0501077_0799913 | 3300049593 | Bacteria | 606 |
| 707 | Ga0501077_1132571 | 3300049593 | Bacteria | 504 |
| 708 | Ga0501079_0000048 | 3300049741 | Bacteria | 51859 |
| 709 | Ga0501079_0004735 | 3300049741 | Bacteria | 10076 |
| 710 | Ga0501079_0005171 | 3300049741 | Bacteria | 9700 |
| 711 | Ga0501079_0032762 | 3300049741 | Bacteria | 3996 |
| 712 | Ga0501079_0083902 | 3300049741 | Bacteria | 2465 |
| 713 | Ga0501079_0264061 | 3300049741 | Bacteria | 1345 |
| 714 | Ga0501079_0325807 | 3300049741 | Bacteria | 1203 |
| 715 | Ga0501079_0387116 | 3300049741 | Bacteria | 1096 |
| 716 | Ga0501079_0735460 | 3300049741 | Bacteria | 776 |
| 717 | Ga0501079_1612606 | 3300049741 | Bacteria | 510 |
| 718 | Ga0501080_0000229 | 3300049742 | Bacteria | 42083 |
| 719 | Ga0501080_0040209 | 3300049742 | Bacteria | 4362 |
| 720 | Ga0501080_0109081 | 3300049742 | Bacteria | 2565 |
| 721 | Ga0501080_0855398 | 3300049742 | Bacteria | 795 |
| 722 | Ga0501080_1075485 | 3300049742 | Bacteria | 695 |
| 723 | Ga0501080_1152495 | 3300049742 | Bacteria | 668 |
| 724 | Ga0501080_1196364 | 3300049742 | Bacteria | 653 |
| 725 | Ga0501080_1227041 | 3300049742 | Bacteria | 644 |
| 726 | Ga0501080_1731187 | 3300049742 | Bacteria | 527 |
| 727 | Ga0501080_1831875 | 3300049742 | Bacteria | 509 |
| 728 | Ga0501081_0000002 | 3300049743 | Bacteria | 102870 |
| 729 | Ga0501081_0008759 | 3300049743 | Bacteria | 6575 |
| 730 | Ga0501081_0043432 | 3300049743 | Bacteria | 3084 |
| 731 | Ga0501081_0076962 | 3300049743 | Bacteria | 2330 |
| 732 | Ga0501081_0086083 | 3300049743 | Bacteria | 2206 |
| 733 | Ga0501081_0086271 | 3300049743 | Bacteria | 2204 |
| 734 | Ga0501081_0087560 | 3300049743 | Bacteria | 2187 |
| 735 | Ga0501083_0000160 | 3300049744 | Bacteria | 44202 |
| 736 | Ga0501083_0004874 | 3300049744 | Bacteria | 9495 |
| 737 | Ga0501083_0029750 | 3300049744 | Bacteria | 3753 |
| 738 | Ga0501083_0130801 | 3300049744 | Bacteria | 1645 |
| 739 | Ga0501083_0217935 | 3300049744 | Bacteria | 1244 |
| 740 | Ga0501083_0595252 | 3300049744 | Bacteria | 719 |
| 741 | Ga0501035_0000851 | 3300049822 | Bacteria | 32557 |
| 742 | Ga0501035_0026503 | 3300049822 | Bacteria | 5302 |
| 743 | Ga0501035_0179034 | 3300049822 | Bacteria | 1828 |
| 744 | Ga0501035_0218688 | 3300049822 | Bacteria | 1627 |
| 745 | Ga0501035_0371544 | 3300049822 | Bacteria | 1194 |
| 746 | Ga0501044_0054048 | 3300049823 | Bacteria | 4129 |
| 747 | Ga0501044_0169835 | 3300049823 | Bacteria | 2153 |
| 748 | Ga0501044_0325183 | 3300049823 | Bacteria | 1461 |
| 749 | Ga0501044_0488677 | 3300049823 | Bacteria | 1133 |
| 750 | Ga0501044_0787155 | 3300049823 | Bacteria | 831 |
| 751 | Ga0501045_0000030 | 3300049824 | Bacteria | 60324 |
| 752 | Ga0501045_0003616 | 3300049824 | Bacteria | 10627 |
| 753 | Ga0501045_0025990 | 3300049824 | Bacteria | 4209 |
| 754 | Ga0501045_0403011 | 3300049824 | Bacteria | 1018 |
| 755 | Ga0501045_0626453 | 3300049824 | Bacteria | 796 |
| 756 | Ga0501045_0641500 | 3300049824 | Bacteria | 785 |
| 757 | nmdc:mga0yw44_558733_c1 | 3300050492 | Bacteria | 777 |
| 758 | nmdc:mga05p37_398960_c1 | 3300050507 | Bacteria | 1606 |
| 759 | nmdc:mga0qj67_57173_c1 | 3300050509 | Bacteria | 3092 |
| 760 | nmdc:mga08y16_12641_c1 | 3300050511 | Bacteria | 8881 |
| 761 | nmdc:mga08y16_58347_c1 | 3300050511 | Bacteria | 4033 |
| 762 | nmdc:mga0rr50_296329_c1 | 3300050513 | Bacteria | 1352 |
| 763 | nmdc:mga0a205_94_c1 | 3300050515 | Bacteria | 50261 |
| 764 | Ga0495601_0024071 | 3300053077 | Bacteria | 3747 |
| 765 | Ga0495601_0736761 | 3300053077 | Bacteria | 628 |
| 766 | Ga0495601_0773621 | 3300053077 | Bacteria | 610 |
| 767 | Ga0495612_0000031 | 3300053078 | Bacteria | 80955 |
| 768 | Ga0495612_0044806 | 3300053078 | Bacteria | 1810 |
| 769 | Ga0495655_0000005 | 3300053083 | Bacteria | 257472 |
| 770 | Ga0495595_0371949 | 3300053084 | Bacteria | 723 |
| 771 | Ga0495595_0533120 | 3300053084 | Bacteria | 599 |
| 772 | Ga0495595_0689070 | 3300053084 | Bacteria | 523 |
| 773 | Ga0495619_0000144 | 3300053085 | Bacteria | 52554 |
| 774 | Ga0495619_0000412 | 3300053085 | Bacteria | 29043 |
| 775 | Ga0495619_0006971 | 3300053085 | Bacteria | 7152 |
| 776 | Ga0495619_0075055 | 3300053085 | Bacteria | 2268 |
| 777 | Ga0495619_0276200 | 3300053085 | Bacteria | 1164 |
| 778 | Ga0495619_0752313 | 3300053085 | Bacteria | 661 |
| 779 | Ga0500566_0087398 | 3300053094 | Bacteria | 1726 |
| 780 | Ga0500628_000025 | 3300053129 | Bacteria | 62808 |
| 781 | Ga0501084_0000207 | 3300054114 | Bacteria | 45680 |
| 782 | Ga0501084_0003837 | 3300054114 | Bacteria | 12230 |
| 783 | Ga0501084_0009901 | 3300054114 | Bacteria | 7879 |
| 784 | Ga0501084_0037054 | 3300054114 | Bacteria | 4074 |
| 785 | Ga0501084_0063259 | 3300054114 | Bacteria | 3097 |
| 786 | Ga0501084_0075170 | 3300054114 | Bacteria | 2830 |
| 787 | Ga0501084_0096036 | 3300054114 | Bacteria | 2489 |
| 788 | Ga0501084_0196331 | 3300054114 | Bacteria | 1703 |
| 789 | Ga0501084_0713147 | 3300054114 | Bacteria | 846 |
| 790 | Ga0501084_1681742 | 3300054114 | Bacteria | 530 |
| 791 | Ga0590071_207376 | 3300059421 | Bacteria | 516 |
| 792 | Ga0501082_0004103 | 3300060353 | Bacteria | 12719 |
| 793 | Ga0501082_0009851 | 3300060353 | Bacteria | 8234 |
| 794 | Ga0501082_0033935 | 3300060353 | Bacteria | 4401 |
| 795 | Ga0501082_0036007 | 3300060353 | Bacteria | 4264 |
| 796 | Ga0501082_0042827 | 3300060353 | Bacteria | 3903 |
| 797 | Ga0501082_0351194 | 3300060353 | Unclassified | 1286 |
| 798 | Ga0501082_0415509 | 3300060353 | Bacteria | 1174 |
| 799 | Ga0501082_0567790 | 3300060353 | Bacteria | 992 |
| 800 | Ga0501082_0803124 | 3300060353 | Bacteria | 823 |
| 801 | Ga0501082_1150348 | 3300060353 | Bacteria | 678 |
| 802 | Ga0530510_0000881 | 3300061734 | Bacteria | 19771 |
| 803 | Ga0530510_0001692 | 3300061734 | Bacteria | 14946 |
| 804 | Ga0530510_0012637 | 3300061734 | Bacteria | 5935 |
| 805 | Ga0530510_0072937 | 3300061734 | Bacteria | 2491 |
| 806 | Ga0530510_0107220 | 3300061734 | Bacteria | 2044 |
| 807 | Ga0530510_0181357 | 3300061734 | Bacteria | 1562 |
| 808 | Ga0530510_0412193 | 3300061734 | Bacteria | 1019 |
| 809 | Ga0530510_0612711 | 3300061734 | Bacteria | 828 |
| 810 | Ga0530510_1108983 | 3300061734 | Bacteria | 606 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | iso_pu_bacteria | 2883291878 | 2883296752 | 76 |
| 2 | iso_pu_bacteria | 2897803580 | 2897808184 | 79 |
| 3 | 3300005458 | Ga0070681_11479090 | Ga0070681_114790902 | 80 |
| 4 | 3300005530 | Ga0070679_101788643 | Ga0070679_1017886432 | 80 |
| 5 | 3300036401 | Ga0373937_1599996 | Ga0373937_1599996_27_281 | 80 |
| 6 | iso_pu_bacteria | 2534681786 | 2535485904 | 80 |
| 7 | iso_pu_bacteria | 2671180139 | 2671695023 | 80 |
| 8 | iso_pu_bacteria | 2854911287 | 2854913119 | 80 |
| 9 | 3300003373 | JGI25407J50210_10032383 | JGI25407J50210_100323831 | 81 |
| 10 | 3300003373 | JGI25407J50210_10035157 | JGI25407J50210_100351572 | 81 |
| 11 | 3300003373 | JGI25407J50210_10049920 | JGI25407J50210_100499202 | 81 |
| 12 | 3300005328 | Ga0070676_10145657 | Ga0070676_101456573 | 81 |
| 13 | 3300005334 | Ga0068869_100258268 | Ga0068869_1002582683 | 81 |
| 14 | 3300005338 | Ga0068868_100534698 | Ga0068868_1005346983 | 81 |
| 15 | 3300005341 | Ga0070691_10075616 | Ga0070691_100756162 | 81 |
| 16 | 3300005356 | Ga0070674_100182647 | Ga0070674_1001826472 | 81 |
| 17 | 3300005356 | Ga0070674_101757634 | Ga0070674_1017576341 | 81 |
| 18 | 3300005441 | Ga0070700_100293555 | Ga0070700_1002935552 | 81 |
| 19 | 3300005441 | Ga0070700_100502924 | Ga0070700_1005029241 | 81 |
| 20 | 3300005444 | Ga0070694_100177171 | Ga0070694_1001771712 | 81 |
| 21 | 3300005445 | Ga0070708_100986814 | Ga0070708_1009868142 | 81 |
| 22 | 3300005456 | Ga0070678_100691891 | Ga0070678_1006918912 | 81 |
| 23 | 3300005457 | Ga0070662_100557677 | Ga0070662_1005576772 | 81 |
| 24 | 3300005458 | Ga0070681_11400767 | Ga0070681_114007671 | 81 |
| 25 | 3300005459 | Ga0068867_100059553 | Ga0068867_1000595533 | 81 |
| 26 | 3300005459 | Ga0068867_100587438 | Ga0068867_1005874382 | 81 |
| 27 | 3300005530 | Ga0070679_101098683 | Ga0070679_1010986831 | 81 |
| 28 | 3300005535 | Ga0070684_101041007 | Ga0070684_1010410072 | 81 |
| 29 | 3300005544 | Ga0070686_101052409 | Ga0070686_1010524092 | 81 |
| 30 | 3300005545 | Ga0070695_100110996 | Ga0070695_1001109962 | 81 |
| 31 | 3300005545 | Ga0070695_101736298 | Ga0070695_1017362981 | 81 |
| 32 | 3300005546 | Ga0070696_100624636 | Ga0070696_1006246362 | 81 |
| 33 | 3300005547 | Ga0070693_100150494 | Ga0070693_1001504942 | 81 |
| 34 | 3300005549 | Ga0070704_100082194 | Ga0070704_1000821943 | 81 |
| 35 | 3300005564 | Ga0070664_100405767 | Ga0070664_1004057672 | 81 |
| 36 | 3300005577 | Ga0068857_100065269 | Ga0068857_1000652692 | 81 |
| 37 | 3300005578 | Ga0068854_100005454 | Ga0068854_1000054543 | 81 |
| 38 | 3300005615 | Ga0070702_100427270 | Ga0070702_1004272702 | 81 |
| 39 | 3300005615 | Ga0070702_100604300 | Ga0070702_1006043002 | 81 |
| 40 | 3300005616 | Ga0068852_101998906 | Ga0068852_1019989062 | 81 |
| 41 | 3300005719 | Ga0068861_100473614 | Ga0068861_1004736142 | 81 |
| 42 | 3300005841 | Ga0068863_100459766 | Ga0068863_1004597662 | 81 |
| 43 | 3300005844 | Ga0068862_102333538 | Ga0068862_1023335382 | 81 |
| 44 | 3300005937 | Ga0081455_10036639 | Ga0081455_100366393 | 81 |
| 45 | 3300005981 | Ga0081538_10006799 | Ga0081538_100067995 | 81 |
| 46 | 3300005981 | Ga0081538_10008047 | Ga0081538_100080477 | 81 |
| 47 | 3300005981 | Ga0081538_10015130 | Ga0081538_100151301 | 81 |
| 48 | 3300005981 | Ga0081538_10019832 | Ga0081538_100198324 | 81 |
| 49 | 3300005981 | Ga0081538_10097866 | Ga0081538_100978662 | 81 |
| 50 | 3300005981 | Ga0081538_10132404 | Ga0081538_101324043 | 81 |
| 51 | 3300006844 | Ga0075428_100232563 | Ga0075428_1002325633 | 81 |
| 52 | 3300006844 | Ga0075428_100664991 | Ga0075428_1006649912 | 81 |
| 53 | 3300009094 | Ga0111539_10000483 | Ga0111539_1000048338 | 81 |
| 54 | 3300009094 | Ga0111539_10098590 | Ga0111539_100985907 | 81 |
| 55 | 3300009098 | Ga0105245_10013612 | Ga0105245_100136123 | 81 |
| 56 | 3300009098 | Ga0105245_10577520 | Ga0105245_105775203 | 81 |
| 57 | 3300009147 | Ga0114129_12437476 | Ga0114129_124374762 | 81 |
| 58 | 3300009147 | Ga0114129_13467244 | Ga0114129_134672442 | 81 |
| 59 | 3300009148 | Ga0105243_10214134 | Ga0105243_102141342 | 81 |
| 60 | 3300009176 | Ga0105242_10193921 | Ga0105242_101939213 | 81 |
| 61 | 3300009551 | Ga0105238_11032136 | Ga0105238_110321363 | 81 |
| 62 | 3300009553 | Ga0105249_10165424 | Ga0105249_101654243 | 81 |
| 63 | 3300009553 | Ga0105249_10449203 | Ga0105249_104492032 | 81 |
| 64 | 3300010375 | Ga0105239_10337335 | Ga0105239_103373351 | 81 |
| 65 | 3300011119 | Ga0105246_10159752 | Ga0105246_101597522 | 81 |
| 66 | 3300012515 | Ga0157338_1022085 | Ga0157338_10220852 | 81 |
| 67 | 3300013100 | Ga0157373_11001861 | Ga0157373_110018612 | 81 |
| 68 | 3300013306 | Ga0163162_10372730 | Ga0163162_103727303 | 81 |
| 69 | 3300014326 | Ga0157380_10370261 | Ga0157380_103702612 | 81 |
| 70 | 3300014497 | Ga0182008_10187178 | Ga0182008_101871783 | 81 |
| 71 | 3300017792 | Ga0163161_10561304 | Ga0163161_105613042 | 81 |
| 72 | 3300025899 | Ga0207642_10139159 | Ga0207642_101391593 | 81 |
| 73 | 3300025901 | Ga0207688_10089068 | Ga0207688_100890682 | 81 |
| 74 | 3300025903 | Ga0207680_11032657 | Ga0207680_110326572 | 81 |
| 75 | 3300025904 | Ga0207647_10232934 | Ga0207647_102329343 | 81 |
| 76 | 3300025907 | Ga0207645_10140152 | Ga0207645_101401523 | 81 |
| 77 | 3300025917 | Ga0207660_10042447 | Ga0207660_100424473 | 81 |
| 78 | 3300025919 | Ga0207657_10361040 | Ga0207657_103610402 | 81 |
| 79 | 3300025921 | Ga0207652_10512575 | Ga0207652_105125752 | 81 |
| 80 | 3300025924 | Ga0207694_10528476 | Ga0207694_105284761 | 81 |
| 81 | 3300025927 | Ga0207687_10006580 | Ga0207687_100065807 | 81 |
| 82 | 3300025927 | Ga0207687_10124555 | Ga0207687_101245553 | 81 |
| 83 | 3300025933 | Ga0207706_10017951 | Ga0207706_100179519 | 81 |
| 84 | 3300025934 | Ga0207686_10253757 | Ga0207686_102537572 | 81 |
| 85 | 3300025935 | Ga0207709_10227322 | Ga0207709_102273222 | 81 |
| 86 | 3300025937 | Ga0207669_10237489 | Ga0207669_102374892 | 81 |
| 87 | 3300025945 | Ga0207679_10230742 | Ga0207679_102307422 | 81 |
| 88 | 3300025961 | Ga0207712_10089104 | Ga0207712_100891043 | 81 |
| 89 | 3300025961 | Ga0207712_10180299 | Ga0207712_101802993 | 81 |
| 90 | 3300025981 | Ga0207640_10113727 | Ga0207640_101137273 | 81 |
| 91 | 3300026023 | Ga0207677_10428297 | Ga0207677_104282972 | 81 |
| 92 | 3300026075 | Ga0207708_10017895 | Ga0207708_100178953 | 81 |
| 93 | 3300026089 | Ga0207648_10084916 | Ga0207648_100849164 | 81 |
| 94 | 3300026089 | Ga0207648_10166478 | Ga0207648_101664783 | 81 |
| 95 | 3300026116 | Ga0207674_10001054 | Ga0207674_1000105432 | 81 |
| 96 | 3300026118 | Ga0207675_100099600 | Ga0207675_1000996002 | 81 |
| 97 | 3300026118 | Ga0207675_100204736 | Ga0207675_1002047363 | 81 |
| 98 | 3300026121 | Ga0207683_10636838 | Ga0207683_106368382 | 81 |
| 99 | 3300026142 | Ga0207698_11901676 | Ga0207698_119016762 | 81 |
| 100 | 3300027617 | Ga0210002_1027818 | Ga0210002_10278182 | 81 |
| 101 | 3300027717 | Ga0209998_10063967 | Ga0209998_100639672 | 81 |
| 102 | 3300027907 | Ga0207428_10096660 | Ga0207428_100966603 | 81 |
| 103 | 3300028380 | Ga0268265_11131663 | Ga0268265_111316632 | 81 |
| 104 | 3300028381 | Ga0268264_10179874 | Ga0268264_101798742 | 81 |
| 105 | 3300028653 | Ga0265323_10254798 | Ga0265323_102547982 | 81 |
| 106 | 3300031548 | Ga0307408_100085517 | Ga0307408_1000855173 | 81 |
| 107 | 3300031548 | Ga0307408_100440213 | Ga0307408_1004402133 | 81 |
| 108 | 3300031731 | Ga0307405_10036216 | Ga0307405_100362162 | 81 |
| 109 | 3300031731 | Ga0307405_10059393 | Ga0307405_100593932 | 81 |
| 110 | 3300031824 | Ga0307413_10024244 | Ga0307413_100242443 | 81 |
| 111 | 3300031852 | Ga0307410_10002132 | Ga0307410_1000213214 | 81 |
| 112 | 3300031901 | Ga0307406_10150927 | Ga0307406_101509273 | 81 |
| 113 | 3300031901 | Ga0307406_11154075 | Ga0307406_111540752 | 81 |
| 114 | 3300031903 | Ga0307407_10001268 | Ga0307407_100012683 | 81 |
| 115 | 3300031911 | Ga0307412_10560184 | Ga0307412_105601842 | 81 |
| 116 | 3300031995 | Ga0307409_100101103 | Ga0307409_1001011032 | 81 |
| 117 | 3300032002 | Ga0307416_100003017 | Ga0307416_10000301713 | 81 |
| 118 | 3300032002 | Ga0307416_100852473 | Ga0307416_1008524732 | 81 |
| 119 | 3300032002 | Ga0307416_101855517 | Ga0307416_1018555172 | 81 |
| 120 | 3300032004 | Ga0307414_10071892 | Ga0307414_100718923 | 81 |
| 121 | 3300032005 | Ga0307411_10025443 | Ga0307411_100254433 | 81 |
| 122 | 3300032126 | Ga0307415_100029129 | Ga0307415_1000291295 | 81 |
| 123 | 3300032126 | Ga0307415_101325721 | Ga0307415_1013257212 | 81 |
| 124 | 3300035114 | Ga0373939_0218580 | Ga0373939_0218580_341_586 | 81 |
| 125 | 3300035242 | Ga0373962_0021242 | Ga0373962_0021242_18_263 | 81 |
| 126 | 3300035691 | Ga0373931_0607788 | Ga0373931_0607788_171_416 | 81 |
| 127 | 3300039447 | Ga0436361_0509578 | Ga0436361_0509578_156_437 | 81 |
| 128 | 3300042005 | Ga0439448_0007299 | Ga0439448_0007299_970_1215 | 81 |
| 129 | 3300042016 | Ga0439463_047501 | Ga0439463_047501_351_596 | 81 |
| 130 | 3300042016 | Ga0439463_149134 | Ga0439463_149134_50_295 | 81 |
| 131 | 3300042122 | Ga0450920_001993 | Ga0450920_001993_109_354 | 81 |
| 132 | 3300042436 | Ga0439435_0136339 | Ga0439435_0136339_134_379 | 81 |
| 133 | 3300042461 | Ga0439460_0160753 | Ga0439460_0160753_335_580 | 81 |
| 134 | 3300045051 | Ga0451576_0304077 | Ga0451576_0304077_361_606 | 81 |
| 135 | 3300046474 | Ga0495605_0106513 | Ga0495605_0106513_1012_1257 | 81 |
| 136 | 3300046500 | Ga0495596_0327177 | Ga0495596_0327177_275_520 | 81 |
| 137 | 3300046506 | Ga0495583_0119251 | Ga0495583_0119251_192_437 | 81 |
| 138 | 3300046512 | Ga0495610_0315381 | Ga0495610_0315381_153_398 | 81 |
| 139 | 3300046513 | Ga0495616_0144153 | Ga0495616_0144153_770_1015 | 81 |
| 140 | 3300046515 | Ga0495620_0227046 | Ga0495620_0227046_292_537 | 81 |
| 141 | 3300046518 | Ga0495631_0256612 | Ga0495631_0256612_112_357 | 81 |
| 142 | 3300046519 | Ga0495632_0199852 | Ga0495632_0199852_604_849 | 81 |
| 143 | 3300046520 | Ga0495637_0069011 | Ga0495637_0069011_768_1013 | 81 |
| 144 | 3300046525 | Ga0495663_0027657 | Ga0495663_0027657_1135_1380 | 81 |
| 145 | 3300046528 | Ga0495642_0163032 | Ga0495642_0163032_329_574 | 81 |
| 146 | 3300046530 | Ga0495654_0267910 | Ga0495654_0267910_153_398 | 81 |
| 147 | 3300046538 | Ga0495609_0108944 | Ga0495609_0108944_820_1065 | 81 |
| 148 | 3300046539 | Ga0495621_0155674 | Ga0495621_0155674_264_509 | 81 |
| 149 | 3300046558 | Ga0495633_0306633 | Ga0495633_0306633_261_506 | 81 |
| 150 | 3300046615 | Ga0495656_0568042 | Ga0495656_0568042_70_315 | 81 |
| 151 | 3300046616 | Ga0495668_0084471 | Ga0495668_0084471_376_621 | 81 |
| 152 | 3300046648 | Ga0495611_0024895 | Ga0495611_0024895_286_531 | 81 |
| 153 | 3300046664 | Ga0495659_0003146 | Ga0495659_0003146_4797_5042 | 81 |
| 154 | 3300046665 | Ga0495661_0193844 | Ga0495661_0193844_60_305 | 81 |
| 155 | 3300046684 | Ga0495669_0115857 | Ga0495669_0115857_113_358 | 81 |
| 156 | 3300046691 | Ga0495670_0113667 | Ga0495670_0113667_314_559 | 81 |
| 157 | 3300046694 | Ga0495649_0310984 | Ga0495649_0310984_129_374 | 81 |
| 158 | 3300046794 | Ga0495589_0107163 | Ga0495589_0107163_949_1194 | 81 |
| 159 | 3300046794 | Ga0495589_0460660 | Ga0495589_0460660_325_570 | 81 |
| 160 | 3300046810 | Ga0495660_0108298 | Ga0495660_0108298_134_379 | 81 |
| 161 | 3300047323 | Ga0495683_0232976 | Ga0495683_0232976_394_639 | 81 |
| 162 | 3300047445 | Ga0495677_0021205 | Ga0495677_0021205_1718_1963 | 81 |
| 163 | 3300047446 | Ga0495679_102000 | Ga0495679_102000_188_433 | 81 |
| 164 | 3300047447 | Ga0495685_042986 | Ga0495685_042986_521_766 | 81 |
| 165 | 3300048090 | Ga0495615_0032706 | Ga0495615_0032706_522_767 | 81 |
| 166 | 3300048906 | Ga0496103_0238753 | Ga0496103_0238753_337_582 | 81 |
| 167 | 3300049568 | Ga0501031_0000279 | Ga0501031_0000279_7833_8078 | 81 |
| 168 | 3300049568 | Ga0501031_0040039 | Ga0501031_0040039_890_1135 | 81 |
| 169 | 3300049568 | Ga0501031_0681970 | Ga0501031_0681970_76_321 | 81 |
| 170 | 3300049569 | Ga0501032_0000532 | Ga0501032_0000532_6129_6374 | 81 |
| 171 | 3300049569 | Ga0501032_0006256 | Ga0501032_0006256_1602_1847 | 81 |
| 172 | 3300049569 | Ga0501032_0209739 | Ga0501032_0209739_214_459 | 81 |
| 173 | 3300049570 | Ga0501033_0000635 | Ga0501033_0000635_3547_3792 | 81 |
| 174 | 3300049570 | Ga0501033_0032194 | Ga0501033_0032194_1828_2073 | 81 |
| 175 | 3300049570 | Ga0501033_0313147 | Ga0501033_0313147_171_416 | 81 |
| 176 | 3300049571 | Ga0501034_0043408 | Ga0501034_0043408_2890_3135 | 81 |
| 177 | 3300049571 | Ga0501034_0100908 | Ga0501034_0100908_1221_1466 | 81 |
| 178 | 3300049571 | Ga0501034_0316488 | Ga0501034_0316488_1028_1273 | 81 |
| 179 | 3300049572 | Ga0501036_0000109 | Ga0501036_0000109_3572_3817 | 81 |
| 180 | 3300049572 | Ga0501036_0094448 | Ga0501036_0094448_280_525 | 81 |
| 181 | 3300049572 | Ga0501036_0502590 | Ga0501036_0502590_259_504 | 81 |
| 182 | 3300049572 | Ga0501036_0654111 | Ga0501036_0654111_427_672 | 81 |
| 183 | 3300049572 | Ga0501036_0994959 | Ga0501036_0994959_29_274 | 81 |
| 184 | 3300049573 | Ga0501037_0000601 | Ga0501037_0000601_7141_7386 | 81 |
| 185 | 3300049573 | Ga0501037_0003995 | Ga0501037_0003995_1925_2170 | 81 |
| 186 | 3300049573 | Ga0501037_0115612 | Ga0501037_0115612_1435_1680 | 81 |
| 187 | 3300049574 | Ga0501038_0000584 | Ga0501038_0000584_28620_28865 | 81 |
| 188 | 3300049574 | Ga0501038_0188510 | Ga0501038_0188510_209_454 | 81 |
| 189 | 3300049575 | Ga0501039_0000274 | Ga0501039_0000274_20704_20949 | 81 |
| 190 | 3300049575 | Ga0501039_0040793 | Ga0501039_0040793_1221_1466 | 81 |
| 191 | 3300049575 | Ga0501039_0043256 | Ga0501039_0043256_1474_1719 | 81 |
| 192 | 3300049576 | Ga0501040_0000041 | Ga0501040_0000041_14202_14447 | 81 |
| 193 | 3300049576 | Ga0501040_0013447 | Ga0501040_0013447_2348_2593 | 81 |
| 194 | 3300049576 | Ga0501040_0120644 | Ga0501040_0120644_1328_1573 | 81 |
| 195 | 3300049576 | Ga0501040_0150376 | Ga0501040_0150376_316_561 | 81 |
| 196 | 3300049576 | Ga0501040_0154781 | Ga0501040_0154781_1185_1430 | 81 |
| 197 | 3300049577 | Ga0501041_0000074 | Ga0501041_0000074_24562_24807 | 81 |
| 198 | 3300049577 | Ga0501041_0010875 | Ga0501041_0010875_2253_2498 | 81 |
| 199 | 3300049577 | Ga0501041_0027854 | Ga0501041_0027854_1435_1680 | 81 |
| 200 | 3300049577 | Ga0501041_0738890 | Ga0501041_0738890_74_319 | 81 |
| 201 | 3300049578 | Ga0501042_0000032 | Ga0501042_0000032_8720_8965 | 81 |
| 202 | 3300049578 | Ga0501042_0002281 | Ga0501042_0002281_719_964 | 81 |
| 203 | 3300049578 | Ga0501042_0100032 | Ga0501042_0100032_471_716 | 81 |
| 204 | 3300049578 | Ga0501042_0169256 | Ga0501042_0169256_538_783 | 81 |
| 205 | 3300049579 | Ga0501043_0002422 | Ga0501043_0002422_1094_1339 | 81 |
| 206 | 3300049579 | Ga0501043_0015835 | Ga0501043_0015835_4191_4436 | 81 |
| 207 | 3300049579 | Ga0501043_0174063 | Ga0501043_0174063_1265_1510 | 81 |
| 208 | 3300049579 | Ga0501043_0222609 | Ga0501043_0222609_123_368 | 81 |
| 209 | 3300049580 | Ga0501046_0023278 | Ga0501046_0023278_3572_3817 | 81 |
| 210 | 3300049580 | Ga0501046_0065747 | Ga0501046_0065747_1865_2110 | 81 |
| 211 | 3300049580 | Ga0501046_0078574 | Ga0501046_0078574_903_1148 | 81 |
| 212 | 3300049580 | Ga0501046_0088122 | Ga0501046_0088122_275_520 | 81 |
| 213 | 3300049581 | Ga0501047_0000626 | Ga0501047_0000626_28616_28861 | 81 |
| 214 | 3300049581 | Ga0501047_0003717 | Ga0501047_0003717_6918_7163 | 81 |
| 215 | 3300049582 | Ga0501048_0000229 | Ga0501048_0000229_14168_14413 | 81 |
| 216 | 3300049582 | Ga0501048_0003254 | Ga0501048_0003254_2253_2498 | 81 |
| 217 | 3300049582 | Ga0501048_0012815 | Ga0501048_0012815_296_541 | 81 |
| 218 | 3300049582 | Ga0501048_0053711 | Ga0501048_0053711_1975_2220 | 81 |
| 219 | 3300049583 | Ga0501067_0028158 | Ga0501067_0028158_1353_1598 | 81 |
| 220 | 3300049583 | Ga0501067_0065893 | Ga0501067_0065893_511_756 | 81 |
| 221 | 3300049584 | Ga0501068_0000206 | Ga0501068_0000206_3568_3813 | 81 |
| 222 | 3300049584 | Ga0501068_0002695 | Ga0501068_0002695_2253_2498 | 81 |
| 223 | 3300049584 | Ga0501068_0002787 | Ga0501068_0002787_4089_4334 | 81 |
| 224 | 3300049584 | Ga0501068_0045430 | Ga0501068_0045430_1066_1311 | 81 |
| 225 | 3300049585 | Ga0501069_0000346 | Ga0501069_0000346_18847_19092 | 81 |
| 226 | 3300049585 | Ga0501069_0008610 | Ga0501069_0008610_1557_1802 | 81 |
| 227 | 3300049585 | Ga0501069_0104240 | Ga0501069_0104240_1105_1350 | 81 |
| 228 | 3300049586 | Ga0501070_0004748 | Ga0501070_0004748_3446_3691 | 81 |
| 229 | 3300049586 | Ga0501070_0015220 | Ga0501070_0015220_314_559 | 81 |
| 230 | 3300049586 | Ga0501070_0416881 | Ga0501070_0416881_409_654 | 81 |
| 231 | 3300049586 | Ga0501070_0689737 | Ga0501070_0689737_501_746 | 81 |
| 232 | 3300049586 | Ga0501070_1095325 | Ga0501070_1095325_341_586 | 81 |
| 233 | 3300049587 | Ga0501071_0000010 | Ga0501071_0000010_15914_16159 | 81 |
| 234 | 3300049587 | Ga0501071_0015171 | Ga0501071_0015171_1602_1847 | 81 |
| 235 | 3300049587 | Ga0501071_0044669 | Ga0501071_0044669_1213_1458 | 81 |
| 236 | 3300049587 | Ga0501071_0056984 | Ga0501071_0056984_442_687 | 81 |
| 237 | 3300049587 | Ga0501071_0782077 | Ga0501071_0782077_478_723 | 81 |
| 238 | 3300049587 | Ga0501071_1382957 | Ga0501071_1382957_271_516 | 81 |
| 239 | 3300049588 | Ga0501072_0006030 | Ga0501072_0006030_1229_1474 | 81 |
| 240 | 3300049588 | Ga0501072_0012212 | Ga0501072_0012212_2830_3075 | 81 |
| 241 | 3300049588 | Ga0501072_0025595 | Ga0501072_0025595_3572_3817 | 81 |
| 242 | 3300049588 | Ga0501072_0195176 | Ga0501072_0195176_1203_1448 | 81 |
| 243 | 3300049588 | Ga0501072_0304247 | Ga0501072_0304247_232_477 | 81 |
| 244 | 3300049588 | Ga0501072_0583374 | Ga0501072_0583374_289_534 | 81 |
| 245 | 3300049589 | Ga0501073_0001677 | Ga0501073_0001677_2047_2292 | 81 |
| 246 | 3300049589 | Ga0501073_0018235 | Ga0501073_0018235_1566_1811 | 81 |
| 247 | 3300049590 | Ga0501074_0000437 | Ga0501074_0000437_8720_8965 | 81 |
| 248 | 3300049590 | Ga0501074_0045962 | Ga0501074_0045962_1439_1684 | 81 |
| 249 | 3300049590 | Ga0501074_0072904 | Ga0501074_0072904_1880_2125 | 81 |
| 250 | 3300049590 | Ga0501074_0155372 | Ga0501074_0155372_937_1182 | 81 |
| 251 | 3300049590 | Ga0501074_0861787 | Ga0501074_0861787_122_367 | 81 |
| 252 | 3300049591 | Ga0501075_0002279 | Ga0501075_0002279_8907_9152 | 81 |
| 253 | 3300049591 | Ga0501075_0007601 | Ga0501075_0007601_3566_3811 | 81 |
| 254 | 3300049591 | Ga0501075_0036960 | Ga0501075_0036960_2166_2411 | 81 |
| 255 | 3300049591 | Ga0501075_0126563 | Ga0501075_0126563_1573_1818 | 81 |
| 256 | 3300049591 | Ga0501075_1294103 | Ga0501075_1294103_289_534 | 81 |
| 257 | 3300049592 | Ga0501076_0035853 | Ga0501076_0035853_3568_3813 | 81 |
| 258 | 3300049592 | Ga0501076_0046939 | Ga0501076_0046939_2040_2285 | 81 |
| 259 | 3300049592 | Ga0501076_0100488 | Ga0501076_0100488_551_796 | 81 |
| 260 | 3300049592 | Ga0501076_0160439 | Ga0501076_0160439_579_824 | 81 |
| 261 | 3300049592 | Ga0501076_0909309 | Ga0501076_0909309_18_263 | 81 |
| 262 | 3300049592 | Ga0501076_1114196 | Ga0501076_1114196_21_266 | 81 |
| 263 | 3300049593 | Ga0501077_0000209 | Ga0501077_0000209_30322_30567 | 81 |
| 264 | 3300049593 | Ga0501077_0002022 | Ga0501077_0002022_2124_2369 | 81 |
| 265 | 3300049593 | Ga0501077_1132571 | Ga0501077_1132571_117_362 | 81 |
| 266 | 3300049741 | Ga0501079_0000048 | Ga0501079_0000048_30322_30567 | 81 |
| 267 | 3300049741 | Ga0501079_0004735 | Ga0501079_0004735_2253_2498 | 81 |
| 268 | 3300049741 | Ga0501079_0032762 | Ga0501079_0032762_927_1172 | 81 |
| 269 | 3300049741 | Ga0501079_0264061 | Ga0501079_0264061_309_554 | 81 |
| 270 | 3300049741 | Ga0501079_0735460 | Ga0501079_0735460_339_584 | 81 |
| 271 | 3300049741 | Ga0501079_1612606 | Ga0501079_1612606_106_351 | 81 |
| 272 | 3300049742 | Ga0501080_0000229 | Ga0501080_0000229_14743_14988 | 81 |
| 273 | 3300049742 | Ga0501080_0040209 | Ga0501080_0040209_2253_2498 | 81 |
| 274 | 3300049742 | Ga0501080_0855398 | Ga0501080_0855398_483_728 | 81 |
| 275 | 3300049743 | Ga0501081_0000002 | Ga0501081_0000002_51047_51292 | 81 |
| 276 | 3300049743 | Ga0501081_0008759 | Ga0501081_0008759_4707_4952 | 81 |
| 277 | 3300049743 | Ga0501081_0043432 | Ga0501081_0043432_1271_1516 | 81 |
| 278 | 3300049743 | Ga0501081_0076962 | Ga0501081_0076962_1943_2188 | 81 |
| 279 | 3300049743 | Ga0501081_0087560 | Ga0501081_0087560_1439_1684 | 81 |
| 280 | 3300049744 | Ga0501083_0000160 | Ga0501083_0000160_70_315 | 81 |
| 281 | 3300049744 | Ga0501083_0029750 | Ga0501083_0029750_1018_1263 | 81 |
| 282 | 3300049744 | Ga0501083_0130801 | Ga0501083_0130801_1214_1459 | 81 |
| 283 | 3300049822 | Ga0501035_0000851 | Ga0501035_0000851_24547_24792 | 81 |
| 284 | 3300049822 | Ga0501035_0026503 | Ga0501035_0026503_504_749 | 81 |
| 285 | 3300049822 | Ga0501035_0179034 | Ga0501035_0179034_800_1045 | 81 |
| 286 | 3300049823 | Ga0501044_0054048 | Ga0501044_0054048_1761_2006 | 81 |
| 287 | 3300049823 | Ga0501044_0169835 | Ga0501044_0169835_330_575 | 81 |
| 288 | 3300049823 | Ga0501044_0325183 | Ga0501044_0325183_1111_1356 | 81 |
| 289 | 3300049824 | Ga0501045_0000030 | Ga0501045_0000030_20582_20827 | 81 |
| 290 | 3300049824 | Ga0501045_0003616 | Ga0501045_0003616_9879_10124 | 81 |
| 291 | 3300049824 | Ga0501045_0025990 | Ga0501045_0025990_1881_2126 | 81 |
| 292 | 3300049824 | Ga0501045_0626453 | Ga0501045_0626453_295_540 | 81 |
| 293 | 3300050507 | nmdc:mga05p37_398960_c1 | nmdc:mga05p37_398960_c1_831_1076 | 81 |
| 294 | 3300050511 | nmdc:mga08y16_12641_c1 | nmdc:mga08y16_12641_c1_1587_1832 | 81 |
| 295 | 3300050511 | nmdc:mga08y16_58347_c1 | nmdc:mga08y16_58347_c1_1537_1782 | 81 |
| 296 | 3300054114 | Ga0501084_0000207 | Ga0501084_0000207_24562_24807 | 81 |
| 297 | 3300054114 | Ga0501084_0003837 | Ga0501084_0003837_11354_11599 | 81 |
| 298 | 3300054114 | Ga0501084_0009901 | Ga0501084_0009901_4488_4733 | 81 |
| 299 | 3300054114 | Ga0501084_0075170 | Ga0501084_0075170_584_829 | 81 |
| 300 | 3300060353 | Ga0501082_0004103 | Ga0501082_0004103_3568_3813 | 81 |
| 301 | 3300060353 | Ga0501082_0009851 | Ga0501082_0009851_5198_5443 | 81 |
| 302 | 3300060353 | Ga0501082_0033935 | Ga0501082_0033935_3438_3683 | 81 |
| 303 | 3300060353 | Ga0501082_0567790 | Ga0501082_0567790_399_644 | 81 |
| 304 | 3300060353 | Ga0501082_0803124 | Ga0501082_0803124_565_810 | 81 |
| 305 | 3300060353 | Ga0501082_1150348 | Ga0501082_1150348_419_664 | 81 |
| 306 | 3300061734 | Ga0530510_0000881 | Ga0530510_0000881_3568_3813 | 81 |
| 307 | 3300061734 | Ga0530510_0012637 | Ga0530510_0012637_2253_2498 | 81 |
| 308 | 3300061734 | Ga0530510_0072937 | Ga0530510_0072937_2106_2351 | 81 |
| 309 | 3300061734 | Ga0530510_0107220 | Ga0530510_0107220_1137_1382 | 81 |
| 310 | 3300061734 | Ga0530510_0412193 | Ga0530510_0412193_740_985 | 81 |
| 311 | 3300005343 | Ga0070687_100023591 | Ga0070687_1000235913 | 82 |
| 312 | 3300021441 | Ga0213871_10092047 | Ga0213871_100920472 | 82 |
| 313 | 3300025918 | Ga0207662_10043963 | Ga0207662_100439633 | 82 |
| 314 | 3300032168 | Ga0316593_10290703 | Ga0316593_102907031 | 82 |
| 315 | 3300033524 | Ga0316592_1118771 | Ga0316592_11187712 | 82 |
| 316 | 3300036401 | Ga0373937_0849766 | Ga0373937_0849766_503_751 | 82 |
| 317 | 3300039438 | Ga0436360_0090361 | Ga0436360_0090361_4630_4887 | 82 |
| 318 | 3300046463 | Ga0495653_0713434 | Ga0495653_0713434_115_363 | 82 |
| 319 | 3300046511 | Ga0495608_0085004 | Ga0495608_0085004_1757_2005 | 82 |
| 320 | 3300046511 | Ga0495608_0444193 | Ga0495608_0444193_493_741 | 82 |
| 321 | 3300046516 | Ga0495628_0141048 | Ga0495628_0141048_881_1129 | 82 |
| 322 | 3300046517 | Ga0495630_0656082 | Ga0495630_0656082_469_717 | 82 |
| 323 | 3300046529 | Ga0495652_0352723 | Ga0495652_0352723_748_996 | 82 |
| 324 | 3300046533 | Ga0495640_0081700 | Ga0495640_0081700_746_994 | 82 |
| 325 | 3300046536 | Ga0495587_0580277 | Ga0495587_0580277_102_350 | 82 |
| 326 | 3300046543 | Ga0495645_0028840 | Ga0495645_0028840_1105_1353 | 82 |
| 327 | 3300046642 | Ga0495634_0434404 | Ga0495634_0434404_123_371 | 82 |
| 328 | 3300046663 | Ga0495635_1006634 | Ga0495635_1006634_123_371 | 82 |
| 329 | 3300046680 | Ga0495646_0168339 | Ga0495646_0168339_945_1193 | 82 |
| 330 | 3300046809 | Ga0495600_0807637 | Ga0495600_0807637_64_312 | 82 |
| 331 | 3300047317 | Ga0495604_0199701 | Ga0495604_0199701_92_340 | 82 |
| 332 | 3300048088 | Ga0495602_0163151 | Ga0495602_0163151_697_945 | 82 |
| 333 | 3300049162 | Ga0501307_034394 | Ga0501307_034394_240_527 | 82 |
| 334 | 3300049574 | Ga0501038_0156137 | Ga0501038_0156137_152_400 | 82 |
| 335 | 3300049575 | Ga0501039_0119750 | Ga0501039_0119750_1796_2044 | 82 |
| 336 | 3300049576 | Ga0501040_0030810 | Ga0501040_0030810_34_282 | 82 |
| 337 | 3300049579 | Ga0501043_0721240 | Ga0501043_0721240_186_434 | 82 |
| 338 | 3300049580 | Ga0501046_0069401 | Ga0501046_0069401_913_1161 | 82 |
| 339 | 3300049587 | Ga0501071_0056046 | Ga0501071_0056046_85_333 | 82 |
| 340 | 3300049588 | Ga0501072_0003756 | Ga0501072_0003756_5564_5812 | 82 |
| 341 | 3300049588 | Ga0501072_1298497 | Ga0501072_1298497_219_476 | 82 |
| 342 | 3300049590 | Ga0501074_0128010 | Ga0501074_0128010_1552_1800 | 82 |
| 343 | 3300049591 | Ga0501075_0034158 | Ga0501075_0034158_162_410 | 82 |
| 344 | 3300049591 | Ga0501075_0286369 | Ga0501075_0286369_298_555 | 82 |
| 345 | 3300049592 | Ga0501076_0069563 | Ga0501076_0069563_168_425 | 82 |
| 346 | 3300049592 | Ga0501076_0074637 | Ga0501076_0074637_1012_1260 | 82 |
| 347 | 3300049593 | Ga0501077_0068050 | Ga0501077_0068050_189_437 | 82 |
| 348 | 3300049593 | Ga0501077_0589351 | Ga0501077_0589351_109_357 | 82 |
| 349 | 3300049741 | Ga0501079_0005171 | Ga0501079_0005171_5159_5407 | 82 |
| 350 | 3300049741 | Ga0501079_0325807 | Ga0501079_0325807_609_866 | 82 |
| 351 | 3300049742 | Ga0501080_1152495 | Ga0501080_1152495_365_613 | 82 |
| 352 | 3300049743 | Ga0501081_0086083 | Ga0501081_0086083_322_570 | 82 |
| 353 | 3300053078 | Ga0495612_0044806 | Ga0495612_0044806_1547_1795 | 82 |
| 354 | 3300053084 | Ga0495595_0689070 | Ga0495595_0689070_225_473 | 82 |
| 355 | 3300053085 | Ga0495619_0075055 | Ga0495619_0075055_1064_1312 | 82 |
| 356 | 3300054114 | Ga0501084_0037054 | Ga0501084_0037054_3362_3610 | 82 |
| 357 | 3300059421 | Ga0590071_207376 | Ga0590071_207376_91_339 | 82 |
| 358 | 3300060353 | Ga0501082_0351194 | Ga0501082_0351194_644_901 | 82 |
| 359 | 3300061734 | Ga0530510_0001692 | Ga0530510_0001692_11246_11494 | 82 |
| 360 | 3300061734 | Ga0530510_1108983 | Ga0530510_1108983_78_335 | 82 |
| 361 | 3300002459 | JGI24751J29686_10108143 | JGI24751J29686_101081432 | 83 |
| 362 | 3300005336 | Ga0070680_101951238 | Ga0070680_1019512381 | 83 |
| 363 | 3300005337 | Ga0070682_100000011 | Ga0070682_100000011229 | 83 |
| 364 | 3300005338 | Ga0068868_100000445 | Ga0068868_10000044522 | 83 |
| 365 | 3300005340 | Ga0070689_100740479 | Ga0070689_1007404792 | 83 |
| 366 | 3300005341 | Ga0070691_10000270 | Ga0070691_100002709 | 83 |
| 367 | 3300005356 | Ga0070674_100000004 | Ga0070674_10000000463 | 83 |
| 368 | 3300005356 | Ga0070674_100077793 | Ga0070674_1000777932 | 83 |
| 369 | 3300005365 | Ga0070688_100088147 | Ga0070688_1000881473 | 83 |
| 370 | 3300005435 | Ga0070714_100035345 | Ga0070714_1000353455 | 83 |
| 371 | 3300005435 | Ga0070714_100146725 | Ga0070714_1001467252 | 83 |
| 372 | 3300005436 | Ga0070713_100022878 | Ga0070713_1000228784 | 83 |
| 373 | 3300005439 | Ga0070711_100012656 | Ga0070711_1000126565 | 83 |
| 374 | 3300005456 | Ga0070678_100186781 | Ga0070678_1001867811 | 83 |
| 375 | 3300005457 | Ga0070662_100000006 | Ga0070662_10000000681 | 83 |
| 376 | 3300005466 | Ga0070685_10492296 | Ga0070685_104922963 | 83 |
| 377 | 3300005535 | Ga0070684_100039321 | Ga0070684_1000393213 | 83 |
| 378 | 3300005539 | Ga0068853_100512817 | Ga0068853_1005128172 | 83 |
| 379 | 3300005545 | Ga0070695_100066741 | Ga0070695_1000667413 | 83 |
| 380 | 3300005546 | Ga0070696_100957244 | Ga0070696_1009572441 | 83 |
| 381 | 3300005547 | Ga0070693_100003426 | Ga0070693_1000034263 | 83 |
| 382 | 3300005564 | Ga0070664_100525220 | Ga0070664_1005252201 | 83 |
| 383 | 3300005577 | Ga0068857_100746874 | Ga0068857_1007468741 | 83 |
| 384 | 3300005578 | Ga0068854_100002872 | Ga0068854_1000028723 | 83 |
| 385 | 3300005718 | Ga0068866_10000004 | Ga0068866_10000004100 | 83 |
| 386 | 3300005718 | Ga0068866_10693725 | Ga0068866_106937252 | 83 |
| 387 | 3300005719 | Ga0068861_100981918 | Ga0068861_1009819181 | 83 |
| 388 | 3300005834 | Ga0068851_10007448 | Ga0068851_100074483 | 83 |
| 389 | 3300006163 | Ga0070715_10000014 | Ga0070715_1000001471 | 83 |
| 390 | 3300006175 | Ga0070712_100031071 | Ga0070712_1000310713 | 83 |
| 391 | 3300006852 | Ga0075433_10000051 | Ga0075433_1000005115 | 83 |
| 392 | 3300009093 | Ga0105240_11310515 | Ga0105240_113105152 | 83 |
| 393 | 3300009098 | Ga0105245_10000104 | Ga0105245_1000010472 | 83 |
| 394 | 3300009148 | Ga0105243_12567699 | Ga0105243_125676992 | 83 |
| 395 | 3300009553 | Ga0105249_12466972 | Ga0105249_124669721 | 83 |
| 396 | 3300010375 | Ga0105239_10061079 | Ga0105239_100610793 | 83 |
| 397 | 3300010375 | Ga0105239_10669072 | Ga0105239_106690721 | 83 |
| 398 | 3300013307 | Ga0157372_10000210 | Ga0157372_1000021062 | 83 |
| 399 | 3300013308 | Ga0157375_11324065 | Ga0157375_113240652 | 83 |
| 400 | 3300014325 | Ga0163163_10231626 | Ga0163163_102316263 | 83 |
| 401 | 3300014325 | Ga0163163_10265292 | Ga0163163_102652921 | 83 |
| 402 | 3300014326 | Ga0157380_12318845 | Ga0157380_123188452 | 83 |
| 403 | 3300014497 | Ga0182008_10448028 | Ga0182008_104480281 | 83 |
| 404 | 3300014968 | Ga0157379_11395269 | Ga0157379_113952691 | 83 |
| 405 | 3300017792 | Ga0163161_10175529 | Ga0163161_101755291 | 83 |
| 406 | 3300020081 | Ga0206354_10746139 | Ga0206354_107461392 | 83 |
| 407 | 3300020082 | Ga0206353_11724054 | Ga0206353_117240542 | 83 |
| 408 | 3300025321 | Ga0207656_10004764 | Ga0207656_100047645 | 83 |
| 409 | 3300025899 | Ga0207642_10000005 | Ga0207642_10000005106 | 83 |
| 410 | 3300025905 | Ga0207685_10000025 | Ga0207685_1000002594 | 83 |
| 411 | 3300025915 | Ga0207693_10041345 | Ga0207693_100413453 | 83 |
| 412 | 3300025916 | Ga0207663_10010849 | Ga0207663_100108492 | 83 |
| 413 | 3300025924 | Ga0207694_10000004 | Ga0207694_1000000478 | 83 |
| 414 | 3300025925 | Ga0207650_11846397 | Ga0207650_118463971 | 83 |
| 415 | 3300025927 | Ga0207687_10000015 | Ga0207687_10000015193 | 83 |
| 416 | 3300025928 | Ga0207700_10106824 | Ga0207700_101068243 | 83 |
| 417 | 3300025929 | Ga0207664_10061653 | Ga0207664_100616531 | 83 |
| 418 | 3300025929 | Ga0207664_11196899 | Ga0207664_111968992 | 83 |
| 419 | 3300025933 | Ga0207706_10000017 | Ga0207706_1000001781 | 83 |
| 420 | 3300025937 | Ga0207669_10000056 | Ga0207669_1000005647 | 83 |
| 421 | 3300025937 | Ga0207669_10181594 | Ga0207669_101815942 | 83 |
| 422 | 3300025945 | Ga0207679_10152448 | Ga0207679_101524481 | 83 |
| 423 | 3300025981 | Ga0207640_10001278 | Ga0207640_1000127812 | 83 |
| 424 | 3300026023 | Ga0207677_10000299 | Ga0207677_1000029933 | 83 |
| 425 | 3300026041 | Ga0207639_10745298 | Ga0207639_107452982 | 83 |
| 426 | 3300026116 | Ga0207674_11007377 | Ga0207674_110073771 | 83 |
| 427 | 3300026118 | Ga0207675_100180365 | Ga0207675_1001803651 | 83 |
| 428 | 3300026121 | Ga0207683_10223569 | Ga0207683_102235692 | 83 |
| 429 | 3300027717 | Ga0209998_10090460 | Ga0209998_100904602 | 83 |
| 430 | 3300031728 | Ga0316578_10337080 | Ga0316578_103370802 | 83 |
| 431 | 3300031733 | Ga0316577_10817901 | Ga0316577_108179012 | 83 |
| 432 | 3300031911 | Ga0307412_11371941 | Ga0307412_113719412 | 83 |
| 433 | 3300032002 | Ga0307416_102191830 | Ga0307416_1021918302 | 83 |
| 434 | 3300032005 | Ga0307411_10244186 | Ga0307411_102441861 | 83 |
| 435 | 3300032005 | Ga0307411_10621727 | Ga0307411_106217272 | 83 |
| 436 | 3300035113 | Ga0373936_0580106 | Ga0373936_0580106_217_474 | 83 |
| 437 | 3300035170 | Ga0373943_0085016 | Ga0373943_0085016_98_355 | 83 |
| 438 | 3300035170 | Ga0373943_0456594 | Ga0373943_0456594_251_502 | 83 |
| 439 | 3300035398 | Ga0316574_0504192 | Ga0316574_0504192_83_352 | 83 |
| 440 | 3300035692 | Ga0373935_0202855 | Ga0373935_0202855_174_431 | 83 |
| 441 | 3300036401 | Ga0373937_1036227 | Ga0373937_1036227_261_512 | 83 |
| 442 | 3300036712 | Ga0316584_1187171 | Ga0316584_1187171_106_375 | 83 |
| 443 | 3300037312 | Ga0395899_0985771 | Ga0395899_0985771_247_498 | 83 |
| 444 | 3300037418 | Ga0395900_0779044 | Ga0395900_0779044_334_585 | 83 |
| 445 | 3300038996 | Ga0242420_140503 | Ga0242420_140503_132_383 | 83 |
| 446 | 3300039062 | Ga0400483_158900 | Ga0400483_158900_505_774 | 83 |
| 447 | 3300039450 | Ga0436363_1473259 | Ga0436363_1473259_74_346 | 83 |
| 448 | 3300041410 | Ga0439461_0126984 | Ga0439461_0126984_149_415 | 83 |
| 449 | 3300041411 | Ga0439466_0072186 | Ga0439466_0072186_65_331 | 83 |
| 450 | 3300041413 | Ga0439465_0181790 | Ga0439465_0181790_258_524 | 83 |
| 451 | 3300041460 | Ga0451802_0732742 | Ga0451802_0732742_149_400 | 83 |
| 452 | 3300041491 | Ga0451833_0079236 | Ga0451833_0079236_650_901 | 83 |
| 453 | 3300041494 | Ga0451837_1632582 | Ga0451837_1632582_46_315 | 83 |
| 454 | 3300041505 | Ga0451849_0767292 | Ga0451849_0767292_58_309 | 83 |
| 455 | 3300041505 | Ga0451849_1533487 | Ga0451849_1533487_682_933 | 83 |
| 456 | 3300042122 | Ga0450920_140547 | Ga0450920_140547_168_434 | 83 |
| 457 | 3300042134 | Ga0450898_046728 | Ga0450898_046728_461_727 | 83 |
| 458 | 3300042147 | Ga0450910_020454 | Ga0450910_020454_409_675 | 83 |
| 459 | 3300044694 | Ga0466963_0320595 | Ga0466963_0320595_658_909 | 83 |
| 460 | 3300045976 | Ga0466967_1566981 | Ga0466967_1566981_131_403 | 83 |
| 461 | 3300045976 | Ga0466967_2463417 | Ga0466967_2463417_77_328 | 83 |
| 462 | 3300046454 | Ga0495592_0026085 | Ga0495592_0026085_336_587 | 83 |
| 463 | 3300046454 | Ga0495592_0109114 | Ga0495592_0109114_797_1048 | 83 |
| 464 | 3300046455 | Ga0495603_0000938 | Ga0495603_0000938_15079_15330 | 83 |
| 465 | 3300046473 | Ga0495582_0000003 | Ga0495582_0000003_130466_130717 | 83 |
| 466 | 3300046476 | Ga0495662_0198144 | Ga0495662_0198144_563_814 | 83 |
| 467 | 3300046477 | Ga0495664_0125948 | Ga0495664_0125948_581_832 | 83 |
| 468 | 3300046491 | Ga0495584_0289845 | Ga0495584_0289845_253_510 | 83 |
| 469 | 3300046516 | Ga0495628_0150514 | Ga0495628_0150514_961_1212 | 83 |
| 470 | 3300046517 | Ga0495630_0024086 | Ga0495630_0024086_3844_4101 | 83 |
| 471 | 3300046517 | Ga0495630_0922616 | Ga0495630_0922616_60_311 | 83 |
| 472 | 3300046529 | Ga0495652_0133453 | Ga0495652_0133453_141_392 | 83 |
| 473 | 3300046529 | Ga0495652_0740646 | Ga0495652_0740646_323_574 | 83 |
| 474 | 3300046535 | Ga0495586_0487960 | Ga0495586_0487960_220_471 | 83 |
| 475 | 3300046536 | Ga0495587_0104148 | Ga0495587_0104148_26_277 | 83 |
| 476 | 3300046543 | Ga0495645_0002432 | Ga0495645_0002432_1119_1370 | 83 |
| 477 | 3300046543 | Ga0495645_0022178 | Ga0495645_0022178_550_801 | 83 |
| 478 | 3300046559 | Ga0495667_0435236 | Ga0495667_0435236_432_689 | 83 |
| 479 | 3300046642 | Ga0495634_0000638 | Ga0495634_0000638_19567_19818 | 83 |
| 480 | 3300046642 | Ga0495634_0002399 | Ga0495634_0002399_7580_7831 | 83 |
| 481 | 3300046642 | Ga0495634_0615291 | Ga0495634_0615291_140_391 | 83 |
| 482 | 3300046663 | Ga0495635_0140929 | Ga0495635_0140929_847_1098 | 83 |
| 483 | 3300046663 | Ga0495635_0334066 | Ga0495635_0334066_69_320 | 83 |
| 484 | 3300046680 | Ga0495646_0552993 | Ga0495646_0552993_47_298 | 83 |
| 485 | 3300046681 | Ga0495647_0116643 | Ga0495647_0116643_315_566 | 83 |
| 486 | 3300046683 | Ga0495658_0000001 | Ga0495658_0000001_41694_41945 | 83 |
| 487 | 3300046683 | Ga0495658_0003950 | Ga0495658_0003950_7039_7290 | 83 |
| 488 | 3300046684 | Ga0495669_0010118 | Ga0495669_0010118_3635_3886 | 83 |
| 489 | 3300046684 | Ga0495669_0168151 | Ga0495669_0168151_728_979 | 83 |
| 490 | 3300046690 | Ga0495624_0746873 | Ga0495624_0746873_43_300 | 83 |
| 491 | 3300047319 | Ga0495674_0331901 | Ga0495674_0331901_362_613 | 83 |
| 492 | 3300047471 | Ga0495684_0202239 | Ga0495684_0202239_1092_1343 | 83 |
| 493 | 3300047472 | Ga0495686_0084442 | Ga0495686_0084442_1208_1459 | 83 |
| 494 | 3300048090 | Ga0495615_0209677 | Ga0495615_0209677_111_368 | 83 |
| 495 | 3300048903 | Ga0496100_0065413 | Ga0496100_0065413_1430_1687 | 83 |
| 496 | 3300048903 | Ga0496100_1376951 | Ga0496100_1376951_20_271 | 83 |
| 497 | 3300048907 | Ga0496104_0000213 | Ga0496104_0000213_10893_11144 | 83 |
| 498 | 3300048907 | Ga0496104_0011173 | Ga0496104_0011173_4581_4838 | 83 |
| 499 | 3300048908 | Ga0496105_0001058 | Ga0496105_0001058_16614_16865 | 83 |
| 500 | 3300048908 | Ga0496105_0035285 | Ga0496105_0035285_1788_2045 | 83 |
| 501 | 3300048911 | Ga0496108_0000005 | Ga0496108_0000005_154131_154382 | 83 |
| 502 | 3300048912 | Ga0496109_0000002 | Ga0496109_0000002_380710_380961 | 83 |
| 503 | 3300048912 | Ga0496109_0165178 | Ga0496109_0165178_659_910 | 83 |
| 504 | 3300048913 | Ga0496110_0004182 | Ga0496110_0004182_2383_2634 | 83 |
| 505 | 3300048913 | Ga0496110_1131692 | Ga0496110_1131692_111_368 | 83 |
| 506 | 3300048913 | Ga0496110_1591970 | Ga0496110_1591970_11_262 | 83 |
| 507 | 3300048913 | Ga0496110_1782697 | Ga0496110_1782697_203_454 | 83 |
| 508 | 3300048914 | Ga0496111_0000117 | Ga0496111_0000117_18913_19164 | 83 |
| 509 | 3300048914 | Ga0496111_0615947 | Ga0496111_0615947_109_360 | 83 |
| 510 | 3300048915 | Ga0496112_0000013 | Ga0496112_0000013_34772_35023 | 83 |
| 511 | 3300048915 | Ga0496112_1006690 | Ga0496112_1006690_458_709 | 83 |
| 512 | 3300048916 | Ga0496113_0157328 | Ga0496113_0157328_1192_1443 | 83 |
| 513 | 3300048916 | Ga0496113_1205028 | Ga0496113_1205028_240_491 | 83 |
| 514 | 3300048918 | Ga0496115_0819923 | Ga0496115_0819923_19_276 | 83 |
| 515 | 3300048922 | Ga0496119_0318582 | Ga0496119_0318582_168_419 | 83 |
| 516 | 3300049572 | Ga0501036_0325146 | Ga0501036_0325146_903_1154 | 83 |
| 517 | 3300049576 | Ga0501040_0308703 | Ga0501040_0308703_638_904 | 83 |
| 518 | 3300049582 | Ga0501048_1068455 | Ga0501048_1068455_71_322 | 83 |
| 519 | 3300049585 | Ga0501069_0221826 | Ga0501069_0221826_641_892 | 83 |
| 520 | 3300049587 | Ga0501071_0516239 | Ga0501071_0516239_73_342 | 83 |
| 521 | 3300049587 | Ga0501071_1110459 | Ga0501071_1110459_268_519 | 83 |
| 522 | 3300049588 | Ga0501072_0016459 | Ga0501072_0016459_3294_3545 | 83 |
| 523 | 3300049588 | Ga0501072_1483277 | Ga0501072_1483277_82_333 | 83 |
| 524 | 3300049590 | Ga0501074_0489497 | Ga0501074_0489497_487_753 | 83 |
| 525 | 3300049592 | Ga0501076_0589648 | Ga0501076_0589648_44_295 | 83 |
| 526 | 3300049592 | Ga0501076_0636730 | Ga0501076_0636730_153_404 | 83 |
| 527 | 3300049592 | Ga0501076_0645994 | Ga0501076_0645994_269_535 | 83 |
| 528 | 3300049742 | Ga0501080_1831875 | Ga0501080_1831875_109_375 | 83 |
| 529 | 3300049743 | Ga0501081_0086271 | Ga0501081_0086271_550_801 | 83 |
| 530 | 3300049824 | Ga0501045_0403011 | Ga0501045_0403011_601_867 | 83 |
| 531 | 3300049824 | Ga0501045_0641500 | Ga0501045_0641500_418_669 | 83 |
| 532 | 3300050492 | nmdc:mga0yw44_558733_c1 | nmdc:mga0yw44_558733_c1_118_369 | 83 |
| 533 | 3300050515 | nmdc:mga0a205_94_c1 | nmdc:mga0a205_94_c1_14632_14883 | 83 |
| 534 | 3300053077 | Ga0495601_0024071 | Ga0495601_0024071_2630_2881 | 83 |
| 535 | 3300053077 | Ga0495601_0736761 | Ga0495601_0736761_265_516 | 83 |
| 536 | 3300053077 | Ga0495601_0773621 | Ga0495601_0773621_322_573 | 83 |
| 537 | 3300053078 | Ga0495612_0000031 | Ga0495612_0000031_50658_50909 | 83 |
| 538 | 3300053083 | Ga0495655_0000005 | Ga0495655_0000005_90417_90668 | 83 |
| 539 | 3300053084 | Ga0495595_0371949 | Ga0495595_0371949_447_698 | 83 |
| 540 | 3300053084 | Ga0495595_0533120 | Ga0495595_0533120_65_322 | 83 |
| 541 | 3300053085 | Ga0495619_0000144 | Ga0495619_0000144_13867_14118 | 83 |
| 542 | 3300053085 | Ga0495619_0000412 | Ga0495619_0000412_10518_10769 | 83 |
| 543 | 3300053085 | Ga0495619_0006971 | Ga0495619_0006971_6875_7126 | 83 |
| 544 | 3300053085 | Ga0495619_0276200 | Ga0495619_0276200_810_1067 | 83 |
| 545 | 3300053085 | Ga0495619_0752313 | Ga0495619_0752313_159_410 | 83 |
| 546 | 3300053129 | Ga0500628_000025 | Ga0500628_000025_1686_1937 | 83 |
| 547 | 3300054114 | Ga0501084_0196331 | Ga0501084_0196331_901_1152 | 83 |
| 548 | 3300054114 | Ga0501084_0713147 | Ga0501084_0713147_57_323 | 83 |
| 549 | 3300000546 | LJNas_1020449 | LJNas_10204492 | 84 |
| 550 | 3300002239 | JGI24034J26672_10000321 | JGI24034J26672_100003215 | 84 |
| 551 | 3300002244 | JGI24742J22300_10021444 | JGI24742J22300_100214442 | 84 |
| 552 | 3300004798 | Ga0058859_11471263 | Ga0058859_114712632 | 84 |
| 553 | 3300004800 | Ga0058861_11781935 | Ga0058861_117819351 | 84 |
| 554 | 3300004803 | Ga0058862_12754643 | Ga0058862_127546432 | 84 |
| 555 | 3300004803 | Ga0058862_12833852 | Ga0058862_128338522 | 84 |
| 556 | 3300005327 | Ga0070658_11521906 | Ga0070658_115219061 | 84 |
| 557 | 3300005336 | Ga0070680_100001829 | Ga0070680_10000182919 | 84 |
| 558 | 3300005339 | Ga0070660_100520061 | Ga0070660_1005200612 | 84 |
| 559 | 3300005353 | Ga0070669_101234671 | Ga0070669_1012346712 | 84 |
| 560 | 3300005355 | Ga0070671_100091529 | Ga0070671_1000915292 | 84 |
| 561 | 3300005356 | Ga0070674_100879322 | Ga0070674_1008793222 | 84 |
| 562 | 3300005364 | Ga0070673_100004080 | Ga0070673_1000040802 | 84 |
| 563 | 3300005365 | Ga0070688_100422858 | Ga0070688_1004228582 | 84 |
| 564 | 3300005434 | Ga0070709_10442388 | Ga0070709_104423882 | 84 |
| 565 | 3300005436 | Ga0070713_100573889 | Ga0070713_1005738891 | 84 |
| 566 | 3300005441 | Ga0070700_100759405 | Ga0070700_1007594051 | 84 |
| 567 | 3300005458 | Ga0070681_10158384 | Ga0070681_101583843 | 84 |
| 568 | 3300005530 | Ga0070679_100034456 | Ga0070679_1000344565 | 84 |
| 569 | 3300005544 | Ga0070686_100336995 | Ga0070686_1003369951 | 84 |
| 570 | 3300005544 | Ga0070686_100414792 | Ga0070686_1004147922 | 84 |
| 571 | 3300005548 | Ga0070665_100365391 | Ga0070665_1003653912 | 84 |
| 572 | 3300005548 | Ga0070665_102627909 | Ga0070665_1026279092 | 84 |
| 573 | 3300005563 | Ga0068855_102112063 | Ga0068855_1021120631 | 84 |
| 574 | 3300005615 | Ga0070702_100568294 | Ga0070702_1005682942 | 84 |
| 575 | 3300005617 | Ga0068859_101802608 | Ga0068859_1018026082 | 84 |
| 576 | 3300005618 | Ga0068864_100379393 | Ga0068864_1003793934 | 84 |
| 577 | 3300005718 | Ga0068866_10500581 | Ga0068866_105005812 | 84 |
| 578 | 3300005719 | Ga0068861_100977196 | Ga0068861_1009771961 | 84 |
| 579 | 3300005841 | Ga0068863_100107123 | Ga0068863_1001071232 | 84 |
| 580 | 3300005842 | Ga0068858_100101660 | Ga0068858_1001016603 | 84 |
| 581 | 3300005843 | Ga0068860_101250422 | Ga0068860_1012504222 | 84 |
| 582 | 3300005983 | Ga0081540_1000129 | Ga0081540_100012977 | 84 |
| 583 | 3300005985 | Ga0081539_10002112 | Ga0081539_1000211219 | 84 |
| 584 | 3300006028 | Ga0070717_10011077 | Ga0070717_100110776 | 84 |
| 585 | 3300006038 | Ga0075365_10385013 | Ga0075365_103850132 | 84 |
| 586 | 3300006358 | Ga0068871_100732055 | Ga0068871_1007320551 | 84 |
| 587 | 3300006844 | Ga0075428_100694808 | Ga0075428_1006948081 | 84 |
| 588 | 3300006846 | Ga0075430_100025109 | Ga0075430_1000251093 | 84 |
| 589 | 3300006846 | Ga0075430_100802146 | Ga0075430_1008021462 | 84 |
| 590 | 3300006881 | Ga0068865_100475483 | Ga0068865_1004754832 | 84 |
| 591 | 3300006914 | Ga0075436_100779210 | Ga0075436_1007792102 | 84 |
| 592 | 3300006931 | Ga0097620_101802886 | Ga0097620_1018028862 | 84 |
| 593 | 3300009093 | Ga0105240_10360420 | Ga0105240_103604203 | 84 |
| 594 | 3300009098 | Ga0105245_10632046 | Ga0105245_106320462 | 84 |
| 595 | 3300009101 | Ga0105247_10610920 | Ga0105247_106109201 | 84 |
| 596 | 3300009176 | Ga0105242_10000034 | Ga0105242_1000003490 | 84 |
| 597 | 3300009176 | Ga0105242_12862181 | Ga0105242_128621811 | 84 |
| 598 | 3300009177 | Ga0105248_12092148 | Ga0105248_120921482 | 84 |
| 599 | 3300009553 | Ga0105249_12872796 | Ga0105249_128727961 | 84 |
| 600 | 3300010375 | Ga0105239_13021716 | Ga0105239_130217162 | 84 |
| 601 | 3300013102 | Ga0157371_10789270 | Ga0157371_107892702 | 84 |
| 602 | 3300013104 | Ga0157370_10117245 | Ga0157370_101172453 | 84 |
| 603 | 3300013296 | Ga0157374_10414140 | Ga0157374_104141402 | 84 |
| 604 | 3300013306 | Ga0163162_11025623 | Ga0163162_110256233 | 84 |
| 605 | 3300013306 | Ga0163162_11322943 | Ga0163162_113229432 | 84 |
| 606 | 3300013307 | Ga0157372_10032985 | Ga0157372_100329852 | 84 |
| 607 | 3300013308 | Ga0157375_10006231 | Ga0157375_1000623110 | 84 |
| 608 | 3300014325 | Ga0163163_10609045 | Ga0163163_106090451 | 84 |
| 609 | 3300014326 | Ga0157380_12170172 | Ga0157380_121701722 | 84 |
| 610 | 3300017792 | Ga0163161_10272926 | Ga0163161_102729262 | 84 |
| 611 | 3300020069 | Ga0197907_10108296 | Ga0197907_101082962 | 84 |
| 612 | 3300020069 | Ga0197907_10203191 | Ga0197907_102031912 | 84 |
| 613 | 3300020069 | Ga0197907_10599200 | Ga0197907_105992002 | 84 |
| 614 | 3300020069 | Ga0197907_11492123 | Ga0197907_114921233 | 84 |
| 615 | 3300020070 | Ga0206356_10138750 | Ga0206356_101387503 | 84 |
| 616 | 3300020070 | Ga0206356_10660827 | Ga0206356_106608272 | 84 |
| 617 | 3300020070 | Ga0206356_10738820 | Ga0206356_107388202 | 84 |
| 618 | 3300020075 | Ga0206349_1061295 | Ga0206349_10612952 | 84 |
| 619 | 3300020075 | Ga0206349_1308889 | Ga0206349_13088892 | 84 |
| 620 | 3300020075 | Ga0206349_1645124 | Ga0206349_16451242 | 84 |
| 621 | 3300020075 | Ga0206349_1785023 | Ga0206349_17850232 | 84 |
| 622 | 3300020076 | Ga0206355_1007025 | Ga0206355_10070252 | 84 |
| 623 | 3300020076 | Ga0206355_1037541 | Ga0206355_10375413 | 84 |
| 624 | 3300020077 | Ga0206351_10156800 | Ga0206351_101568001 | 84 |
| 625 | 3300020077 | Ga0206351_10376218 | Ga0206351_103762182 | 84 |
| 626 | 3300020077 | Ga0206351_10956255 | Ga0206351_109562552 | 84 |
| 627 | 3300020078 | Ga0206352_10054722 | Ga0206352_100547222 | 84 |
| 628 | 3300020078 | Ga0206352_10461982 | Ga0206352_104619822 | 84 |
| 629 | 3300020080 | Ga0206350_10221184 | Ga0206350_102211842 | 84 |
| 630 | 3300020080 | Ga0206350_11267920 | Ga0206350_112679202 | 84 |
| 631 | 3300020081 | Ga0206354_10038488 | Ga0206354_100384882 | 84 |
| 632 | 3300020081 | Ga0206354_10361875 | Ga0206354_103618752 | 84 |
| 633 | 3300020081 | Ga0206354_11070946 | Ga0206354_110709462 | 84 |
| 634 | 3300020081 | Ga0206354_11163887 | Ga0206354_111638871 | 84 |
| 635 | 3300020082 | Ga0206353_10523663 | Ga0206353_105236632 | 84 |
| 636 | 3300020082 | Ga0206353_11137416 | Ga0206353_111374162 | 84 |
| 637 | 3300020082 | Ga0206353_11861206 | Ga0206353_118612063 | 84 |
| 638 | 3300022467 | Ga0224712_10090982 | Ga0224712_100909822 | 84 |
| 639 | 3300022467 | Ga0224712_10095648 | Ga0224712_100956483 | 84 |
| 640 | 3300022467 | Ga0224712_10302764 | Ga0224712_103027642 | 84 |
| 641 | 3300022467 | Ga0224712_10311022 | Ga0224712_103110221 | 84 |
| 642 | 3300022467 | Ga0224712_10388592 | Ga0224712_103885922 | 84 |
| 643 | 3300025900 | Ga0207710_10427302 | Ga0207710_104273022 | 84 |
| 644 | 3300025906 | Ga0207699_11116401 | Ga0207699_111164012 | 84 |
| 645 | 3300025909 | Ga0207705_11486894 | Ga0207705_114868941 | 84 |
| 646 | 3300025912 | Ga0207707_10079437 | Ga0207707_100794373 | 84 |
| 647 | 3300025913 | Ga0207695_10185529 | Ga0207695_101855292 | 84 |
| 648 | 3300025917 | Ga0207660_10062578 | Ga0207660_100625784 | 84 |
| 649 | 3300025919 | Ga0207657_10763015 | Ga0207657_107630152 | 84 |
| 650 | 3300025921 | Ga0207652_10085390 | Ga0207652_100853904 | 84 |
| 651 | 3300025923 | Ga0207681_10069968 | Ga0207681_100699682 | 84 |
| 652 | 3300025928 | Ga0207700_10380491 | Ga0207700_103804912 | 84 |
| 653 | 3300025931 | Ga0207644_10075439 | Ga0207644_100754392 | 84 |
| 654 | 3300025934 | Ga0207686_10002116 | Ga0207686_1000211612 | 84 |
| 655 | 3300025941 | Ga0207711_10233576 | Ga0207711_102335763 | 84 |
| 656 | 3300025945 | Ga0207679_11462441 | Ga0207679_114624411 | 84 |
| 657 | 3300025949 | Ga0207667_10947050 | Ga0207667_109470502 | 84 |
| 658 | 3300025960 | Ga0207651_10001711 | Ga0207651_1000171110 | 84 |
| 659 | 3300025972 | Ga0207668_10755914 | Ga0207668_107559142 | 84 |
| 660 | 3300025986 | Ga0207658_11224182 | Ga0207658_112241822 | 84 |
| 661 | 3300026035 | Ga0207703_10134954 | Ga0207703_101349542 | 84 |
| 662 | 3300026075 | Ga0207708_10212430 | Ga0207708_102124302 | 84 |
| 663 | 3300026075 | Ga0207708_11961971 | Ga0207708_119619711 | 84 |
| 664 | 3300026088 | Ga0207641_10003646 | Ga0207641_100036467 | 84 |
| 665 | 3300026095 | Ga0207676_12549441 | Ga0207676_125494411 | 84 |
| 666 | 3300026118 | Ga0207675_100613264 | Ga0207675_1006132642 | 84 |
| 667 | 3300026121 | Ga0207683_10689766 | Ga0207683_106897661 | 84 |
| 668 | 3300028381 | Ga0268264_10001292 | Ga0268264_100012928 | 84 |
| 669 | 3300028563 | Ga0265319_1000035 | Ga0265319_100003521 | 84 |
| 670 | 3300028654 | Ga0265322_10107332 | Ga0265322_101073322 | 84 |
| 671 | 3300028666 | Ga0265336_10216325 | Ga0265336_102163252 | 84 |
| 672 | 3300028800 | Ga0265338_10000171 | Ga0265338_1000017124 | 84 |
| 673 | 3300028800 | Ga0265338_10128094 | Ga0265338_101280942 | 84 |
| 674 | 3300029957 | Ga0265324_10107172 | Ga0265324_101071722 | 84 |
| 675 | 3300030500 | Ga0268256_1053309 | Ga0268256_10533092 | 84 |
| 676 | 3300031240 | Ga0265320_10128753 | Ga0265320_101287532 | 84 |
| 677 | 3300031241 | Ga0265325_10010611 | Ga0265325_100106115 | 84 |
| 678 | 3300031251 | Ga0265327_10317609 | Ga0265327_103176092 | 84 |
| 679 | 3300031711 | Ga0265314_10335980 | Ga0265314_103359802 | 84 |
| 680 | 3300031712 | Ga0265342_10459136 | Ga0265342_104591361 | 84 |
| 681 | 3300032168 | Ga0316593_10011204 | Ga0316593_100112042 | 84 |
| 682 | 3300032168 | Ga0316593_10065150 | Ga0316593_100651502 | 84 |
| 683 | 3300032168 | Ga0316593_10085467 | Ga0316593_100854672 | 84 |
| 684 | 3300032168 | Ga0316593_10168202 | Ga0316593_101682022 | 84 |
| 685 | 3300032168 | Ga0316593_10352506 | Ga0316593_103525062 | 84 |
| 686 | 3300033524 | Ga0316592_1058324 | Ga0316592_10583242 | 84 |
| 687 | 3300033541 | Ga0316596_1085647 | Ga0316596_10856472 | 84 |
| 688 | 3300035117 | Ga0373953_0262596 | Ga0373953_0262596_380_649 | 84 |
| 689 | 3300035410 | Ga0373924_0161343 | Ga0373924_0161343_478_747 | 84 |
| 690 | 3300035692 | Ga0373935_1042206 | Ga0373935_1042206_100_369 | 84 |
| 691 | 3300036401 | Ga0373937_0147835 | Ga0373937_0147835_1077_1346 | 84 |
| 692 | 3300036647 | Ga0316582_0978874 | Ga0316582_0978874_148_429 | 84 |
| 693 | 3300036712 | Ga0316584_0341393 | Ga0316584_0341393_767_1021 | 84 |
| 694 | 3300037068 | Ga0373925_0434135 | Ga0373925_0434135_299_568 | 84 |
| 695 | 3300037068 | Ga0373925_0702432 | Ga0373925_0702432_548_817 | 84 |
| 696 | 3300037418 | Ga0395900_0586701 | Ga0395900_0586701_69_347 | 84 |
| 697 | 3300037466 | Ga0395898_1338292 | Ga0395898_1338292_354_608 | 84 |
| 698 | 3300037471 | Ga0395905_0137603 | Ga0395905_0137603_1653_1931 | 84 |
| 699 | 3300037853 | Ga0436364_1305764 | Ga0436364_1305764_408_677 | 84 |
| 700 | 3300038443 | Ga0395901_0108382 | Ga0395901_0108382_2322_2585 | 84 |
| 701 | 3300038443 | Ga0395901_1058856 | Ga0395901_1058856_445_732 | 84 |
| 702 | 3300039093 | Ga0400489_52134 | Ga0400489_52134_313_582 | 84 |
| 703 | 3300039437 | Ga0436365_1138802 | Ga0436365_1138802_42_311 | 84 |
| 704 | 3300041459 | Ga0451800_0514641 | Ga0451800_0514641_176_430 | 84 |
| 705 | 3300041461 | Ga0451805_129914 | Ga0451805_129914_281_580 | 84 |
| 706 | 3300041486 | Ga0451807_0556699 | Ga0451807_0556699_901_1155 | 84 |
| 707 | 3300041496 | Ga0451839_0045583 | Ga0451839_0045583_260_514 | 84 |
| 708 | 3300041512 | Ga0451853_0315177 | Ga0451853_0315177_149_403 | 84 |
| 709 | 3300041512 | Ga0451853_2640337 | Ga0451853_2640337_198_452 | 84 |
| 710 | 3300044683 | Ga0466965_0281656 | Ga0466965_0281656_344_613 | 84 |
| 711 | 3300044694 | Ga0466963_0000301 | Ga0466963_0000301_7192_7446 | 84 |
| 712 | 3300044694 | Ga0466963_0491483 | Ga0466963_0491483_214_483 | 84 |
| 713 | 3300044901 | Ga0466960_0116870 | Ga0466960_0116870_37_306 | 84 |
| 714 | 3300045836 | Ga0466958_0711869 | Ga0466958_0711869_44_313 | 84 |
| 715 | 3300045976 | Ga0466967_0523245 | Ga0466967_0523245_208_477 | 84 |
| 716 | 3300046459 | Ga0495629_0002708 | Ga0495629_0002708_2565_2819 | 84 |
| 717 | 3300046459 | Ga0495629_0074689 | Ga0495629_0074689_1812_2066 | 84 |
| 718 | 3300046472 | Ga0495580_0776350 | Ga0495580_0776350_208_477 | 84 |
| 719 | 3300046499 | Ga0495594_0254464 | Ga0495594_0254464_719_988 | 84 |
| 720 | 3300046514 | Ga0495618_0000144 | Ga0495618_0000144_6436_6690 | 84 |
| 721 | 3300046514 | Ga0495618_0881612 | Ga0495618_0881612_32_301 | 84 |
| 722 | 3300046515 | Ga0495620_0000352 | Ga0495620_0000352_17920_18174 | 84 |
| 723 | 3300046525 | Ga0495663_0329324 | Ga0495663_0329324_87_347 | 84 |
| 724 | 3300046529 | Ga0495652_0000010 | Ga0495652_0000010_16152_16406 | 84 |
| 725 | 3300046533 | Ga0495640_0159172 | Ga0495640_0159172_63_317 | 84 |
| 726 | 3300046536 | Ga0495587_0050595 | Ga0495587_0050595_2109_2363 | 84 |
| 727 | 3300046543 | Ga0495645_0897881 | Ga0495645_0897881_101_355 | 84 |
| 728 | 3300046559 | Ga0495667_0000505 | Ga0495667_0000505_21881_22135 | 84 |
| 729 | 3300046660 | Ga0495625_0000032 | Ga0495625_0000032_60199_60453 | 84 |
| 730 | 3300046681 | Ga0495647_0001468 | Ga0495647_0001468_1698_1952 | 84 |
| 731 | 3300046809 | Ga0495600_0002554 | Ga0495600_0002554_4508_4762 | 84 |
| 732 | 3300047319 | Ga0495674_0000010 | Ga0495674_0000010_193575_193832 | 84 |
| 733 | 3300047320 | Ga0495672_0000281 | Ga0495672_0000281_17762_18031 | 84 |
| 734 | 3300047321 | Ga0495676_0000346 | Ga0495676_0000346_6849_7103 | 84 |
| 735 | 3300047322 | Ga0495680_0023946 | Ga0495680_0023946_58_312 | 84 |
| 736 | 3300047322 | Ga0495680_0068558 | Ga0495680_0068558_1351_1605 | 84 |
| 737 | 3300047472 | Ga0495686_0307544 | Ga0495686_0307544_378_662 | 84 |
| 738 | 3300048903 | Ga0496100_0000001 | Ga0496100_0000001_177446_177700 | 84 |
| 739 | 3300048903 | Ga0496100_0296774 | Ga0496100_0296774_243_503 | 84 |
| 740 | 3300048904 | Ga0496101_0000028 | Ga0496101_0000028_177435_177689 | 84 |
| 741 | 3300048905 | Ga0496102_0000561 | Ga0496102_0000561_17607_17861 | 84 |
| 742 | 3300048905 | Ga0496102_0063392 | Ga0496102_0063392_1574_1831 | 84 |
| 743 | 3300048906 | Ga0496103_0000057 | Ga0496103_0000057_128136_128390 | 84 |
| 744 | 3300048906 | Ga0496103_0348692 | Ga0496103_0348692_267_527 | 84 |
| 745 | 3300048909 | Ga0496106_0000055 | Ga0496106_0000055_70365_70619 | 84 |
| 746 | 3300048910 | Ga0496107_0000002 | Ga0496107_0000002_70788_71042 | 84 |
| 747 | 3300048912 | Ga0496109_0633654 | Ga0496109_0633654_342_602 | 84 |
| 748 | 3300048913 | Ga0496110_0921887 | Ga0496110_0921887_280_549 | 84 |
| 749 | 3300048914 | Ga0496111_0462455 | Ga0496111_0462455_446_706 | 84 |
| 750 | 3300048917 | Ga0496114_0000003 | Ga0496114_0000003_613342_613596 | 84 |
| 751 | 3300048917 | Ga0496114_1412892 | Ga0496114_1412892_47_304 | 84 |
| 752 | 3300048918 | Ga0496115_0000031 | Ga0496115_0000031_37907_38161 | 84 |
| 753 | 3300048918 | Ga0496115_0459754 | Ga0496115_0459754_716_973 | 84 |
| 754 | 3300048921 | Ga0496118_0453632 | Ga0496118_0453632_84_338 | 84 |
| 755 | 3300048929 | Ga0496126_0003365 | Ga0496126_0003365_1850_2107 | 84 |
| 756 | 3300048929 | Ga0496126_0188226 | Ga0496126_0188226_69_326 | 84 |
| 757 | 3300048929 | Ga0496126_1266830 | Ga0496126_1266830_245_499 | 84 |
| 758 | 3300049571 | Ga0501034_0057117 | Ga0501034_0057117_1418_1687 | 84 |
| 759 | 3300049571 | Ga0501034_0362009 | Ga0501034_0362009_724_1002 | 84 |
| 760 | 3300049571 | Ga0501034_0463293 | Ga0501034_0463293_762_1037 | 84 |
| 761 | 3300049571 | Ga0501034_0512890 | Ga0501034_0512890_425_703 | 84 |
| 762 | 3300049572 | Ga0501036_0127828 | Ga0501036_0127828_1489_1767 | 84 |
| 763 | 3300049572 | Ga0501036_0235038 | Ga0501036_0235038_947_1216 | 84 |
| 764 | 3300049573 | Ga0501037_0937940 | Ga0501037_0937940_269_547 | 84 |
| 765 | 3300049574 | Ga0501038_0697984 | Ga0501038_0697984_238_516 | 84 |
| 766 | 3300049575 | Ga0501039_1327507 | Ga0501039_1327507_208_462 | 84 |
| 767 | 3300049579 | Ga0501043_0259435 | Ga0501043_0259435_1010_1288 | 84 |
| 768 | 3300049579 | Ga0501043_0799100 | Ga0501043_0799100_378_647 | 84 |
| 769 | 3300049580 | Ga0501046_0218994 | Ga0501046_0218994_818_1087 | 84 |
| 770 | 3300049581 | Ga0501047_0026314 | Ga0501047_0026314_1217_1495 | 84 |
| 771 | 3300049581 | Ga0501047_0621292 | Ga0501047_0621292_156_431 | 84 |
| 772 | 3300049581 | Ga0501047_0789523 | Ga0501047_0789523_263_532 | 84 |
| 773 | 3300049583 | Ga0501067_0022285 | Ga0501067_0022285_353_631 | 84 |
| 774 | 3300049584 | Ga0501068_0015476 | Ga0501068_0015476_2978_3247 | 84 |
| 775 | 3300049585 | Ga0501069_0095508 | Ga0501069_0095508_935_1204 | 84 |
| 776 | 3300049586 | Ga0501070_0057363 | Ga0501070_0057363_2286_2564 | 84 |
| 777 | 3300049586 | Ga0501070_0125487 | Ga0501070_0125487_978_1250 | 84 |
| 778 | 3300049586 | Ga0501070_0285935 | Ga0501070_0285935_307_594 | 84 |
| 779 | 3300049587 | Ga0501071_1197016 | Ga0501071_1197016_77_346 | 84 |
| 780 | 3300049588 | Ga0501072_0090888 | Ga0501072_0090888_182_451 | 84 |
| 781 | 3300049588 | Ga0501072_0879890 | Ga0501072_0879890_335_616 | 84 |
| 782 | 3300049589 | Ga0501073_0006442 | Ga0501073_0006442_1037_1318 | 84 |
| 783 | 3300049589 | Ga0501073_0201672 | Ga0501073_0201672_1056_1331 | 84 |
| 784 | 3300049590 | Ga0501074_0165974 | Ga0501074_0165974_66_347 | 84 |
| 785 | 3300049590 | Ga0501074_0546987 | Ga0501074_0546987_140_412 | 84 |
| 786 | 3300049590 | Ga0501074_0910440 | Ga0501074_0910440_61_339 | 84 |
| 787 | 3300049592 | Ga0501076_0022848 | Ga0501076_0022848_298_579 | 84 |
| 788 | 3300049592 | Ga0501076_0169944 | Ga0501076_0169944_1454_1723 | 84 |
| 789 | 3300049593 | Ga0501077_0216015 | Ga0501077_0216015_761_1030 | 84 |
| 790 | 3300049593 | Ga0501077_0799913 | Ga0501077_0799913_112_366 | 84 |
| 791 | 3300049741 | Ga0501079_0083902 | Ga0501079_0083902_1907_2176 | 84 |
| 792 | 3300049741 | Ga0501079_0387116 | Ga0501079_0387116_718_999 | 84 |
| 793 | 3300049742 | Ga0501080_0109081 | Ga0501080_0109081_2171_2449 | 84 |
| 794 | 3300049742 | Ga0501080_1075485 | Ga0501080_1075485_193_480 | 84 |
| 795 | 3300049742 | Ga0501080_1196364 | Ga0501080_1196364_103_372 | 84 |
| 796 | 3300049742 | Ga0501080_1227041 | Ga0501080_1227041_158_439 | 84 |
| 797 | 3300049742 | Ga0501080_1731187 | Ga0501080_1731187_225_497 | 84 |
| 798 | 3300049744 | Ga0501083_0004874 | Ga0501083_0004874_4264_4545 | 84 |
| 799 | 3300049744 | Ga0501083_0217935 | Ga0501083_0217935_397_684 | 84 |
| 800 | 3300049744 | Ga0501083_0595252 | Ga0501083_0595252_366_641 | 84 |
| 801 | 3300049822 | Ga0501035_0218688 | Ga0501035_0218688_714_992 | 84 |
| 802 | 3300049822 | Ga0501035_0371544 | Ga0501035_0371544_338_616 | 84 |
| 803 | 3300049823 | Ga0501044_0488677 | Ga0501044_0488677_588_866 | 84 |
| 804 | 3300049823 | Ga0501044_0787155 | Ga0501044_0787155_155_424 | 84 |
| 805 | 3300050509 | nmdc:mga0qj67_57173_c1 | nmdc:mga0qj67_57173_c1_1660_1914 | 84 |
| 806 | 3300050513 | nmdc:mga0rr50_296329_c1 | nmdc:mga0rr50_296329_c1_444_698 | 84 |
| 807 | 3300053094 | Ga0500566_0087398 | Ga0500566_0087398_46_300 | 84 |
| 808 | 3300054114 | Ga0501084_0063259 | Ga0501084_0063259_316_597 | 84 |
| 809 | 3300054114 | Ga0501084_0096036 | Ga0501084_0096036_1169_1444 | 84 |
| 810 | 3300054114 | Ga0501084_1681742 | Ga0501084_1681742_116_391 | 84 |
| 811 | 3300060353 | Ga0501082_0036007 | Ga0501082_0036007_2679_2960 | 84 |
| 812 | 3300060353 | Ga0501082_0042827 | Ga0501082_0042827_2950_3228 | 84 |
| 813 | 3300060353 | Ga0501082_0415509 | Ga0501082_0415509_643_912 | 84 |
| 814 | 3300061734 | Ga0530510_0181357 | Ga0530510_0181357_290_559 | 84 |
| 815 | 3300061734 | Ga0530510_0612711 | Ga0530510_0612711_43_324 | 84 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1v8q-assembly1.cif.gz_A | crystal structure of ribosomal protein l27 from thermus thermophilus hb8 | 0.9673 | 21 | 84 |
| 8c94-assembly1.cif.gz_W | cryo-em captures early ribosome assembly in action | 0.9505 | 21 | 83 |
| 8c95-assembly1.cif.gz_W | cryo-em captures early ribosome assembly in action | 0.9331 | 21 | 83 |
| 8c8z-assembly1.cif.gz_W | cryo-em captures early ribosome assembly in action | 0.9298 | 17 | 83 |
| 6ywv-assembly1.cif.gz_R | the structure of the atp25 bound assembly intermediate of the mitoribosome from neurospora crassa | 0.9283 | 17 | 81 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1v8qA00 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.9673 | 21 | 84 | 2.40.50.100 |
| 1v8qA00 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.9247 | 21 | 84 | 2.40.50.100 |
| af_P0A7L8_6_84_2.40.50.100 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.8651 | 9 | 82 | 2.40.50.100 |
| 5oomW00 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.8612 | 14 | 84 | 2.40.50.100 |
| af_Q9U0I4_44_103_2.40.50.100 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.8545 | 28 | 84 | 2.40.50.100 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A421K8E4-F1-model_v4 | Large ribosomal subunit protein bL27 (50S ribosomal protein L27) | 0.9933 | 21 | 84 |
GO:0003735
GO:0005840 GO:0006412 GO:1990904 |
| AF-I0R0V1-F1-model_v4 | Large ribosomal subunit protein bL27 (50S ribosomal protein L27) | 0.9904 | 23 | 82 |
GO:0003735
GO:0006412 GO:0022625 |
| AF-A0A7Y5TEY2-F1-model_v4 | Large ribosomal subunit protein bL27 (50S ribosomal protein L27) | 0.988 | 21 | 84 |
GO:0003735
GO:0006412 GO:0022625 |
| AF-A0A2D7PMC6-F1-model_v4 | Large ribosomal subunit protein bL27 (50S ribosomal protein L27) | 0.9866 | 23 | 84 |
GO:0003735
GO:0006412 GO:0022625 |
| AF-A0A3D3VUF3-F1-model_v4 | Large ribosomal subunit protein bL27 (50S ribosomal protein L27) | 0.9845 | 23 | 84 |
GO:0003735
GO:0006412 GO:0022625 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar