F481970

General Info

Members Datasets Scaffolds Average Seq Length
814 450 812 103

Family's Representative Sequence

Representative Sequence 3300005339|Ga0070660_101942254|Ga0070660_1019422541
Length 109
Sequence MAKAAKKQAATRVDVSHYDVVLAPHITEKSTLLSEQNAVVFKVARTASKPQIKAAVEALFNVSVTGVNTMNVKGKTKRWKGRPYTRSDVKKAVVTLADGQSIDITTGVA

Samples

Sample ID Description Type Environment
1 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
8 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
9 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
10 3300003308 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
11 3300003559 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_43 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
12 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
13 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
14 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
15 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
16 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
17 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
18 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
19 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
20 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
21 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
22 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
23 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
24 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
25 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
26 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
27 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
28 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
29 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
30 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
31 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
32 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
33 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
34 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
35 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
36 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
37 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
38 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
39 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
40 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
41 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
42 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
43 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
44 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
45 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
46 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
47 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
48 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
49 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
50 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
51 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
52 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
53 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
54 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
55 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
56 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
57 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
58 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
59 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
60 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
61 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
62 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
63 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
64 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
65 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
66 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
67 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
68 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
69 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
70 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
71 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
72 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
73 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
74 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
75 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
76 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
77 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
78 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
79 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
80 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
81 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
82 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
83 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
84 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
85 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
86 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
88 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
89 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
90 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
91 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
92 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
93 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
94 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
95 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
97 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
98 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
99 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
100 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
101 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
102 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
103 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
104 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
105 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
106 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
107 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
108 3300012492 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 Metagenome Rhizosphere
109 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
110 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
111 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
112 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
113 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
114 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
115 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
116 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
117 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
118 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
119 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
120 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
121 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
122 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
123 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
124 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
125 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
126 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
127 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
128 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
129 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
130 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
131 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
135 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
136 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
197 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
198 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
199 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
200 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
201 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
202 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
203 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
204 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
205 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
206 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
207 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
208 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
209 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
210 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
211 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
212 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
213 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
214 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
215 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
216 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
217 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
218 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
219 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
220 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
221 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
222 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
223 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
224 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
225 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
226 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
227 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
228 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
229 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
230 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
231 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
232 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
233 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
234 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
235 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
236 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
237 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
238 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
239 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
240 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
241 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
242 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
243 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
244 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
245 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
246 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
247 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
248 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
249 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
250 3300041444 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaT Metatranscriptome Rhizoplane
251 3300041446 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaT Metatranscriptome Rhizoplane
252 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
253 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
254 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
255 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
256 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
257 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
258 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
259 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
260 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
261 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
262 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
263 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
264 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
265 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
266 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
267 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
268 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
269 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
270 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
271 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
272 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
273 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
274 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
275 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
276 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
277 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
278 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
279 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
280 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
281 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
282 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
283 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
284 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
285 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
286 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
287 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
288 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
289 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
290 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
291 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
292 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
293 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
294 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
295 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
296 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
297 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
298 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
299 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
300 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
301 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
302 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
303 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
304 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
305 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
306 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
307 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
308 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
309 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
310 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
311 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
312 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
313 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
314 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
315 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
316 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
317 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
318 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
319 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
320 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
321 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
322 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
323 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
324 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
325 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
326 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
327 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
328 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
329 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
330 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
331 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
332 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
333 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
334 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
335 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
336 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
337 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
338 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
339 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
340 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
341 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
342 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
343 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
344 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
345 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
346 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
347 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
348 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
349 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
350 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
351 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
352 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
353 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
354 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
355 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
356 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
357 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
358 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
359 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
360 3300049552 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
361 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
362 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
363 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
364 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
365 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
366 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
367 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
368 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
369 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
370 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
371 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
372 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
373 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
374 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
375 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
376 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
377 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
378 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
379 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
380 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
381 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
382 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
383 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
384 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
385 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
386 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
387 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
388 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
389 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
390 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
391 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
392 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
393 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
394 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
395 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
396 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
397 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
398 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
399 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
400 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
401 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
402 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
403 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
404 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
405 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
406 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
407 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
408 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
409 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
410 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
411 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
412 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
413 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
414 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
415 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
416 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
417 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
418 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
419 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
420 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
421 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
422 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
423 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
424 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
425 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
426 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
427 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
428 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
429 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
430 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
431 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
432 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
433 3300059609 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 227R_SD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
434 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
435 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
436 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
437 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
438 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
439 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
440 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
441 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
442 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
443 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
444 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
445 3300059654 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 148R_CW_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
446 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
447 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
448 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
449 8002060224 Methylocystis sp. Sn-Cys Isolate Unclassified
450 8054563764 Acuticoccus kalidii M5D2P5 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 93.86
Metatranscriptomes 5.9
Isolates 0.25

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.99
Nodule 0
Rhizoplane 5.04
Rhizosphere 82.56
Stem 0
Stem Tuber 0
Unclassified 4.42

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1001831 3300001915 Bacteria 5816
2 JGI24740J21852_10047162 3300001979 Bacteria 1260
3 JGI24739J22299_10021603 3300001989 Bacteria 2289
4 JGI24739J22299_10162692 3300001989 Bacteria 658
5 JGI24737J22298_10008367 3300001990 Bacteria 3467
6 JGI24737J22298_10061502 3300001990 Bacteria 1129
7 JGI24737J22298_10257332 3300001990 Bacteria 516
8 JGI24743J22301_10003761 3300001991 Bacteria 2424
9 JGI24743J22301_10051053 3300001991 Bacteria 843
10 JGI24735J21928_10022221 3300002067 Bacteria 1933
11 JGI24735J21928_10024597 3300002067 Bacteria 1820
12 JGI24748J21848_1034612 3300002074 Bacteria 631
13 JGI24738J21930_10011077 3300002075 Bacteria 1992
14 JGI24738J21930_10066840 3300002075 Bacteria 742
15 JGI24744J21845_10000585 3300002077 Bacteria 6547
16 Ga0006777J48905_1085348 3300003308 Bacteria 746
17 Ga0007427J51700_122592 3300003559 Bacteria 892
18 Ga0007429J51699_1030351 3300003579 Bacteria 2885
19 Ga0055542_1007804 3300003762 Bacteria 2138
20 Ga0055542_1010957 3300003762 Bacteria 1632
21 Ga0055529_1015382 3300003763 Bacteria 965
22 Ga0058861_11875447 3300004800 Bacteria 642
23 Ga0065715_10785221 3300005293 Bacteria 616
24 Ga0070658_10056264 3300005327 Bacteria 3196
25 Ga0070658_10119266 3300005327 Bacteria 2191
26 Ga0070658_10167844 3300005327 Bacteria 1843
27 Ga0070658_10284239 3300005327 Bacteria 1408
28 Ga0070676_10007059 3300005328 Bacteria 6013
29 Ga0070676_10497773 3300005328 Bacteria 865
30 Ga0070676_10499120 3300005328 Bacteria 863
31 Ga0070676_10708739 3300005328 Bacteria 736
32 Ga0070683_102337481 3300005329 Bacteria 513
33 Ga0070683_102354244 3300005329 Bacteria 511
34 Ga0070690_100064067 3300005330 Bacteria 2373
35 Ga0070670_100186607 3300005331 Bacteria 1800
36 Ga0070670_100245739 3300005331 Bacteria 1558
37 Ga0070670_100409570 3300005331 Bacteria 1198
38 Ga0070670_100686642 3300005331 Bacteria 920
39 Ga0070677_10000836 3300005333 Bacteria 10111
40 Ga0068869_100000029 3300005334 Bacteria 61111
41 Ga0068869_101021642 3300005334 Bacteria 721
42 Ga0070666_10122703 3300005335 Bacteria 1802
43 Ga0070666_10271576 3300005335 Bacteria 1203
44 Ga0070666_11318960 3300005335 Bacteria 539
45 Ga0070680_100004922 3300005336 Bacteria 10054
46 Ga0070680_100237570 3300005336 Bacteria 1540
47 Ga0070680_101006128 3300005336 Bacteria 720
48 Ga0070682_101205382 3300005337 Bacteria 639
49 Ga0070682_101232756 3300005337 Bacteria 633
50 Ga0068868_100000403 3300005338 Bacteria 29340
51 Ga0068868_100000503 3300005338 Bacteria 26082
52 Ga0068868_101210622 3300005338 Bacteria 699
53 Ga0070660_100059046 3300005339 Bacteria 2974
54 Ga0070660_100071753 3300005339 Bacteria 2704
55 Ga0070660_100124724 3300005339 Bacteria 2057
56 Ga0070660_100128492 3300005339 Bacteria 2026
57 Ga0070660_100254934 3300005339 Bacteria 1431
58 Ga0070660_100649332 3300005339 Bacteria 884
59 Ga0070660_100837217 3300005339 Bacteria 775
60 Ga0070660_101942254 3300005339 Bacteria 502
61 Ga0070689_100912641 3300005340 Bacteria 778
62 Ga0070689_101301101 3300005340 Bacteria 655
63 Ga0070687_100140311 3300005343 Bacteria 1407
64 Ga0070661_100022453 3300005344 Bacteria 4518
65 Ga0070661_100262903 3300005344 Bacteria 1334
66 Ga0070661_100450718 3300005344 Bacteria 1024
67 Ga0070661_100621413 3300005344 Bacteria 875
68 Ga0070661_100899826 3300005344 Bacteria 730
69 Ga0070692_10089416 3300005345 Bacteria 1671
70 Ga0070692_10947100 3300005345 Bacteria 598
71 Ga0070668_100236624 3300005347 Bacteria 1511
72 Ga0070668_101013444 3300005347 Bacteria 747
73 Ga0070668_101698707 3300005347 Bacteria 579
74 Ga0070669_100640431 3300005353 Bacteria 894
75 Ga0070669_101034119 3300005353 Bacteria 706
76 Ga0070669_101746244 3300005353 Bacteria 543
77 Ga0070675_100037136 3300005354 Bacteria 3966
78 Ga0070675_100106783 3300005354 Bacteria 2363
79 Ga0070675_100140583 3300005354 Bacteria 2063
80 Ga0070675_101170349 3300005354 Bacteria 708
81 Ga0070671_100158554 3300005355 Bacteria 1913
82 Ga0070671_100494700 3300005355 Bacteria 1052
83 Ga0070674_100210736 3300005356 Bacteria 1506
84 Ga0070674_100369465 3300005356 Bacteria 1164
85 Ga0070674_100683528 3300005356 Bacteria 876
86 Ga0070673_100000022 3300005364 Bacteria 92156
87 Ga0070673_100115677 3300005364 Bacteria 2230
88 Ga0070673_100297730 3300005364 Bacteria 1419
89 Ga0070688_100155629 3300005365 Bacteria 1566
90 Ga0070688_101777838 3300005365 Bacteria 506
91 Ga0070659_100000159 3300005366 Bacteria 51703
92 Ga0070659_100128898 3300005366 Bacteria 2053
93 Ga0070659_100892304 3300005366 Bacteria 777
94 Ga0070667_100000088 3300005367 Bacteria 113956
95 Ga0070667_100298344 3300005367 Bacteria 1451
96 Ga0070667_100363216 3300005367 Bacteria 1313
97 Ga0070667_100825038 3300005367 Bacteria 861
98 Ga0070667_101089218 3300005367 Bacteria 747
99 Ga0070709_10835980 3300005434 Bacteria 725
100 Ga0070701_10380328 3300005438 Bacteria 890
101 Ga0070701_10602518 3300005438 Bacteria 728
102 Ga0070700_101326393 3300005441 Bacteria 606
103 Ga0070694_101200225 3300005444 Bacteria 636
104 Ga0070663_100033947 3300005455 Bacteria 3529
105 Ga0070663_100239516 3300005455 Bacteria 1431
106 Ga0070663_100644238 3300005455 Bacteria 895
107 Ga0070678_100144850 3300005456 Bacteria 1906
108 Ga0070662_100081689 3300005457 Bacteria 2408
109 Ga0070662_100271769 3300005457 Bacteria 1369
110 Ga0070662_100377979 3300005457 Bacteria 1166
111 Ga0070681_10039142 3300005458 Bacteria 4753
112 Ga0070681_10257591 3300005458 Bacteria 1657
113 Ga0070681_10544016 3300005458 Bacteria 1075
114 Ga0070681_10760507 3300005458 Bacteria 886
115 Ga0068867_100000023 3300005459 Bacteria 92322
116 Ga0068867_100305758 3300005459 Bacteria 1312
117 Ga0068867_100949561 3300005459 Bacteria 777
118 Ga0070685_10323103 3300005466 Bacteria 1047
119 Ga0070685_10752713 3300005466 Bacteria 714
120 Ga0070679_100040114 3300005530 Bacteria 4657
121 Ga0070679_100583247 3300005530 Bacteria 1062
122 Ga0070679_100981786 3300005530 Bacteria 788
123 Ga0070679_101075760 3300005530 Bacteria 749
124 Ga0070684_100313085 3300005535 Bacteria 1441
125 Ga0070684_102339051 3300005535 Bacteria 504
126 Ga0068853_100042530 3300005539 Bacteria 3885
127 Ga0068853_100739625 3300005539 Bacteria 940
128 Ga0070672_100093680 3300005543 Bacteria 2427
129 Ga0070672_100104389 3300005543 Bacteria 2303
130 Ga0070672_100294774 3300005543 Bacteria 1374
131 Ga0070686_100061295 3300005544 Bacteria 2430
132 Ga0070686_100177076 3300005544 Bacteria 1513
133 Ga0070686_100945791 3300005544 Bacteria 704
134 Ga0070686_100951489 3300005544 Bacteria 702
135 Ga0070696_100927593 3300005546 Bacteria 724
136 Ga0070693_100061798 3300005547 Bacteria 2179
137 Ga0070665_100000109 3300005548 Bacteria 155026
138 Ga0070665_100130384 3300005548 Bacteria 2516
139 Ga0070665_100287765 3300005548 Bacteria 1645
140 Ga0070665_100600547 3300005548 Bacteria 1113
141 Ga0070704_101800498 3300005549 Bacteria 567
142 Ga0068855_100119921 3300005563 Bacteria 3011
143 Ga0068855_100553074 3300005563 Bacteria 1245
144 Ga0068855_101312712 3300005563 Bacteria 748
145 Ga0070664_100738428 3300005564 Bacteria 918
146 Ga0070664_100981552 3300005564 Bacteria 794
147 Ga0068857_100057006 3300005577 Bacteria 3467
148 Ga0068857_101362326 3300005577 Bacteria 689
149 Ga0068854_100008814 3300005578 Bacteria 6492
150 Ga0068854_100521673 3300005578 Bacteria 1003
151 Ga0068854_100632751 3300005578 Bacteria 917
152 Ga0068854_100706577 3300005578 Bacteria 871
153 Ga0068856_100233074 3300005614 Bacteria 1856
154 Ga0070702_101650565 3300005615 Bacteria 532
155 Ga0068852_100026154 3300005616 Bacteria 4739
156 Ga0068852_100536878 3300005616 Bacteria 1168
157 Ga0068852_100688555 3300005616 Bacteria 1032
158 Ga0068852_101290518 3300005616 Bacteria 752
159 Ga0068852_102612631 3300005616 Bacteria 524
160 Ga0068859_100742691 3300005617 Bacteria 1070
161 Ga0068864_100016814 3300005618 Bacteria 6095
162 Ga0068864_101619112 3300005618 Bacteria 652
163 Ga0068866_10180122 3300005718 Bacteria 1248
164 Ga0068866_10316151 3300005718 Bacteria 980
165 Ga0068866_10704375 3300005718 Bacteria 693
166 Ga0068861_100388819 3300005719 Bacteria 1235
167 Ga0068861_100573424 3300005719 Bacteria 1032
168 Ga0068861_100637812 3300005719 Bacteria 982
169 Ga0068861_101683616 3300005719 Bacteria 627
170 Ga0068851_10119311 3300005834 Bacteria 1416
171 Ga0068863_100008320 3300005841 Bacteria 10132
172 Ga0068863_100008669 3300005841 Bacteria 9938
173 Ga0068858_100644009 3300005842 Bacteria 1030
174 Ga0068858_101523126 3300005842 Bacteria 660
175 Ga0068860_100000220 3300005843 Bacteria 89460
176 Ga0068860_100024823 3300005843 Bacteria 5789
177 Ga0081540_1080649 3300005983 Bacteria 1466
178 Ga0070717_10235653 3300006028 Bacteria 1612
179 Ga0075365_10543520 3300006038 Bacteria 822
180 Ga0075363_100172626 3300006048 Bacteria 1228
181 Ga0075363_100814191 3300006048 Bacteria 568
182 Ga0070715_10518171 3300006163 Bacteria 685
183 Ga0070716_100688448 3300006173 Bacteria 780
184 Ga0075362_10278047 3300006177 Bacteria 828
185 Ga0075362_10365895 3300006177 Bacteria 724
186 Ga0075367_10081978 3300006178 Bacteria 1952
187 Ga0075367_10116045 3300006178 Bacteria 1646
188 Ga0075369_10109815 3300006186 Bacteria 1242
189 Ga0075366_10007231 3300006195 Bacteria 6117
190 Ga0075366_10013189 3300006195 Bacteria 4700
191 Ga0075366_10035079 3300006195 Bacteria 2957
192 Ga0075366_10038153 3300006195 Bacteria 2837
193 Ga0075366_10070440 3300006195 Bacteria 2082
194 Ga0075366_11030761 3300006195 Bacteria 514
195 Ga0097621_100122566 3300006237 Bacteria 2206
196 Ga0097621_100233974 3300006237 Bacteria 1604
197 Ga0097621_100852498 3300006237 Bacteria 846
198 Ga0097621_101324222 3300006237 Bacteria 681
199 Ga0097621_101986048 3300006237 Bacteria 556
200 Ga0075370_10017297 3300006353 Bacteria 3894
201 Ga0068871_100067789 3300006358 Bacteria 2928
202 Ga0068871_101008421 3300006358 Bacteria 775
203 Ga0075434_100097402 3300006871 Bacteria 2946
204 Ga0075434_101482429 3300006871 Bacteria 688
205 Ga0068865_101196254 3300006881 Bacteria 673
206 Ga0097620_100742697 3300006931 Bacteria 1070
207 Ga0075435_101409965 3300007076 Bacteria 611
208 Ga0099795_10127919 3300007788 Bacteria 1022
209 Ga0105240_10058360 3300009093 Bacteria 4818
210 Ga0111539_10060664 3300009094 Bacteria 4482
211 Ga0111539_12293156 3300009094 Bacteria 626
212 Ga0105245_10075417 3300009098 Bacteria 3071
213 Ga0105245_10076170 3300009098 Bacteria 3056
214 Ga0105245_11800287 3300009098 Bacteria 665
215 Ga0105245_12340185 3300009098 Bacteria 588
216 Ga0105247_10166213 3300009101 Bacteria 1464
217 Ga0105243_10000156 3300009148 Bacteria 78467
218 Ga0105243_10184017 3300009148 Bacteria 1819
219 Ga0105243_10735582 3300009148 Bacteria 965
220 Ga0105243_11981878 3300009148 Bacteria 616
221 Ga0105241_10004308 3300009174 Bacteria 10523
222 Ga0105241_10185999 3300009174 Bacteria 1726
223 Ga0105242_10048043 3300009176 Bacteria 3467
224 Ga0105242_10122649 3300009176 Bacteria 2233
225 Ga0105242_10894592 3300009176 Bacteria 887
226 Ga0105248_10033419 3300009177 Bacteria 5746
227 Ga0105248_10099202 3300009177 Bacteria 3282
228 Ga0105248_11425728 3300009177 Bacteria 784
229 Ga0105237_10246271 3300009545 Bacteria 1789
230 Ga0105237_10398494 3300009545 Bacteria 1381
231 Ga0105237_10482230 3300009545 Bacteria 1246
232 Ga0105237_11062358 3300009545 Bacteria 816
233 Ga0105238_10215885 3300009551 Bacteria 1894
234 Ga0105238_10311541 3300009551 Bacteria 1559
235 Ga0105238_10726602 3300009551 Bacteria 1006
236 Ga0105238_11905866 3300009551 Bacteria 627
237 Ga0105238_12224259 3300009551 Bacteria 583
238 Ga0105238_12495022 3300009551 Bacteria 553
239 Ga0105249_10134716 3300009553 Bacteria 2362
240 Ga0105249_10386652 3300009553 Bacteria 1426
241 Ga0105249_11161671 3300009553 Bacteria 843
242 Ga0105249_12035842 3300009553 Bacteria 647
243 Ga0099796_10476274 3300010159 Bacteria 558
244 Ga0105239_10328506 3300010375 Bacteria 1725
245 Ga0105239_10752756 3300010375 Bacteria 1115
246 Ga0105239_11274454 3300010375 Bacteria 848
247 Ga0105246_10144814 3300011119 Bacteria 1791
248 Ga0105246_10155689 3300011119 Bacteria 1735
249 Ga0105246_10568502 3300011119 Bacteria 974
250 Ga0157335_1041120 3300012492 Bacteria 522
251 Ga0157326_1010864 3300012513 Bacteria 1020
252 Ga0157373_10170122 3300013100 Bacteria 1533
253 Ga0157373_10611096 3300013100 Bacteria 794
254 Ga0157373_11142036 3300013100 Bacteria 585
255 Ga0157371_10059539 3300013102 Bacteria 2707
256 Ga0157370_10378633 3300013104 Bacteria 1304
257 Ga0157370_10758478 3300013104 Bacteria 884
258 Ga0157369_10291945 3300013105 Bacteria 1697
259 Ga0157374_10101300 3300013296 Bacteria 2762
260 Ga0157374_12776130 3300013296 Bacteria 517
261 Ga0157378_10000504 3300013297 Bacteria 37070
262 Ga0157378_10951377 3300013297 Bacteria 892
263 Ga0157378_11681631 3300013297 Bacteria 681
264 Ga0157378_12037748 3300013297 Bacteria 624
265 Ga0163162_10828800 3300013306 Bacteria 1041
266 Ga0163162_13247100 3300013306 Bacteria 521
267 Ga0157372_10606539 3300013307 Bacteria 1276
268 Ga0157372_10694011 3300013307 Bacteria 1185
269 Ga0157372_13318950 3300013307 Bacteria 512
270 Ga0157372_13430144 3300013307 Bacteria 504
271 Ga0157375_10033608 3300013308 Bacteria 4875
272 Ga0157375_10353413 3300013308 Bacteria 1635
273 Ga0157375_10940385 3300013308 Bacteria 1007
274 Ga0157375_11735285 3300013308 Bacteria 739
275 Ga0157375_12635005 3300013308 Bacteria 601
276 Ga0157375_12972468 3300013308 Bacteria 566
277 Ga0182008_10189510 3300014497 Bacteria 1043
278 Ga0157377_10060702 3300014745 Bacteria 2159
279 Ga0157377_10324576 3300014745 Bacteria 1024
280 Ga0157379_10667744 3300014968 Bacteria 974
281 Ga0157379_10959097 3300014968 Bacteria 814
282 Ga0157379_11641516 3300014968 Bacteria 628
283 Ga0157376_10000092 3300014969 Bacteria 68198
284 Ga0157376_11091037 3300014969 Bacteria 824
285 Ga0157376_11798598 3300014969 Bacteria 649
286 Ga0182005_1076003 3300015265 Bacteria 925
287 Ga0182005_1185098 3300015265 Bacteria 620
288 Ga0163161_10040537 3300017792 Bacteria 3345
289 Ga0163161_10097218 3300017792 Bacteria 2187
290 Ga0163161_11522123 3300017792 Bacteria 588
291 Ga0163161_12041913 3300017792 Bacteria 510
292 Ga0206349_1044138 3300020075 Bacteria 866
293 Ga0206351_10035987 3300020077 Bacteria 516
294 Ga0206350_10412050 3300020080 Bacteria 703
295 Ga0206354_10307013 3300020081 Bacteria 713
296 Ga0206354_10821255 3300020081 Bacteria 549
297 Ga0213874_10113685 3300021377 Bacteria 913
298 Ga0213876_10063901 3300021384 Bacteria 1943
299 Ga0213876_10413764 3300021384 Bacteria 717
300 Ga0209677_111507 3300025253 Bacteria 1377
301 Ga0209148_1000059 3300025254 Bacteria 350224
302 Ga0209148_1003717 3300025254 Bacteria 4037
303 Ga0209455_1005324 3300025272 Bacteria 4001
304 Ga0209758_1000548 3300025297 Bacteria 59657
305 Ga0207426_1019059 3300025302 Bacteria 2406
306 Ga0207697_10454228 3300025315 Bacteria 568
307 Ga0207682_10010516 3300025893 Bacteria 3624
308 Ga0207682_10233372 3300025893 Bacteria 853
309 Ga0207642_10015224 3300025899 Bacteria 2860
310 Ga0207642_10150116 3300025899 Bacteria 1239
311 Ga0207710_10061673 3300025900 Bacteria 1702
312 Ga0207710_10241548 3300025900 Bacteria 901
313 Ga0207688_10079487 3300025901 Bacteria 1870
314 Ga0207688_10118686 3300025901 Bacteria 1542
315 Ga0207688_10249972 3300025901 Bacteria 1074
316 Ga0207680_10151589 3300025903 Bacteria 1546
317 Ga0207680_10652026 3300025903 Bacteria 754
318 Ga0207647_10043865 3300025904 Bacteria 2796
319 Ga0207645_10036219 3300025907 Bacteria 3168
320 Ga0207645_11094021 3300025907 Bacteria 538
321 Ga0207643_10425697 3300025908 Bacteria 842
322 Ga0207643_10437555 3300025908 Bacteria 831
323 Ga0207705_10000243 3300025909 Bacteria 53479
324 Ga0207705_10002954 3300025909 Bacteria 12998
325 Ga0207705_10198836 3300025909 Bacteria 1518
326 Ga0207654_10000810 3300025911 Bacteria 17231
327 Ga0207654_10101008 3300025911 Bacteria 1777
328 Ga0207707_10020771 3300025912 Bacteria 5735
329 Ga0207707_11201271 3300025912 Bacteria 614
330 Ga0207695_10075629 3300025913 Bacteria 3426
331 Ga0207671_10253685 3300025914 Bacteria 1383
332 Ga0207671_10268480 3300025914 Bacteria 1344
333 Ga0207660_10059665 3300025917 Bacteria 2740
334 Ga0207660_10202587 3300025917 Bacteria 1551
335 Ga0207660_11558346 3300025917 Bacteria 533
336 Ga0207662_10347525 3300025918 Bacteria 995
337 Ga0207657_10069965 3300025919 Bacteria 2975
338 Ga0207657_10174101 3300025919 Bacteria 1743
339 Ga0207657_10257258 3300025919 Bacteria 1390
340 Ga0207657_11275708 3300025919 Bacteria 556
341 Ga0207649_10300303 3300025920 Bacteria 1174
342 Ga0207649_10307380 3300025920 Bacteria 1161
343 Ga0207649_10709169 3300025920 Bacteria 781
344 Ga0207652_10037461 3300025921 Bacteria 4104
345 Ga0207652_10093381 3300025921 Bacteria 2648
346 Ga0207652_10819732 3300025921 Bacteria 825
347 Ga0207652_11781401 3300025921 Bacteria 521
348 Ga0207681_11378610 3300025923 Bacteria 592
349 Ga0207694_10115742 3300025924 Bacteria 2136
350 Ga0207694_10260982 3300025924 Bacteria 1419
351 Ga0207694_10628194 3300025924 Bacteria 904
352 Ga0207694_10860652 3300025924 Bacteria 766
353 Ga0207650_10196105 3300025925 Bacteria 1615
354 Ga0207650_10657886 3300025925 Bacteria 883
355 Ga0207650_10955711 3300025925 Bacteria 728
356 Ga0207659_10034481 3300025926 Bacteria 3490
357 Ga0207659_10210085 3300025926 Bacteria 1559
358 Ga0207659_10231268 3300025926 Bacteria 1491
359 Ga0207659_10700448 3300025926 Bacteria 867
360 Ga0207659_11866491 3300025926 Bacteria 510
361 Ga0207687_10024648 3300025927 Bacteria 4022
362 Ga0207687_10049506 3300025927 Bacteria 2922
363 Ga0207687_10642981 3300025927 Bacteria 897
364 Ga0207687_11323960 3300025927 Bacteria 619
365 Ga0207644_10085340 3300025931 Bacteria 2342
366 Ga0207644_10374526 3300025931 Bacteria 1160
367 Ga0207644_10597046 3300025931 Bacteria 916
368 Ga0207644_11559031 3300025931 Bacteria 554
369 Ga0207690_10000177 3300025932 Bacteria 49108
370 Ga0207690_10068111 3300025932 Bacteria 2444
371 Ga0207690_10380848 3300025932 Bacteria 1121
372 Ga0207706_10082619 3300025933 Bacteria 2824
373 Ga0207706_10112980 3300025933 Bacteria 2389
374 Ga0207706_10195976 3300025933 Bacteria 1772
375 Ga0207686_10006822 3300025934 Bacteria 6148
376 Ga0207686_10284439 3300025934 Bacteria 1222
377 Ga0207709_10000114 3300025935 Bacteria 124672
378 Ga0207709_11055386 3300025935 Bacteria 666
379 Ga0207709_11566292 3300025935 Bacteria 547
380 Ga0207670_10110814 3300025936 Bacteria 1978
381 Ga0207670_10346826 3300025936 Bacteria 1175
382 Ga0207670_10515265 3300025936 Bacteria 973
383 Ga0207670_10700241 3300025936 Bacteria 838
384 Ga0207669_10011850 3300025937 Bacteria 4261
385 Ga0207669_10233156 3300025937 Bacteria 1359
386 Ga0207669_10283236 3300025937 Bacteria 1251
387 Ga0207704_10000008 3300025938 Bacteria 204682
388 Ga0207704_10388669 3300025938 Bacteria 1097
389 Ga0207665_10569264 3300025939 Bacteria 882
390 Ga0207691_10021000 3300025940 Bacteria 6171
391 Ga0207691_10355035 3300025940 Bacteria 1254
392 Ga0207691_10511865 3300025940 Bacteria 1019
393 Ga0207711_10059567 3300025941 Bacteria 3288
394 Ga0207711_10204371 3300025941 Bacteria 1803
395 Ga0207689_10000701 3300025942 Bacteria 32104
396 Ga0207661_10692144 3300025944 Bacteria 937
397 Ga0207661_11242235 3300025944 Bacteria 685
398 Ga0207661_11257131 3300025944 Bacteria 681
399 Ga0207679_11518547 3300025945 Bacteria 614
400 Ga0207667_10000029 3300025949 Bacteria 329192
401 Ga0207667_10002977 3300025949 Bacteria 21052
402 Ga0207667_10440871 3300025949 Bacteria 1324
403 Ga0207651_10000008 3300025960 Bacteria 204538
404 Ga0207651_11133514 3300025960 Bacteria 701
405 Ga0207651_11176477 3300025960 Bacteria 688
406 Ga0207712_10025347 3300025961 Bacteria 3939
407 Ga0207712_10112962 3300025961 Bacteria 2041
408 Ga0207712_10124942 3300025961 Bacteria 1952
409 Ga0207712_10207690 3300025961 Bacteria 1557
410 Ga0207668_10139283 3300025972 Bacteria 1863
411 Ga0207668_10180641 3300025972 Bacteria 1664
412 Ga0207668_10411378 3300025972 Bacteria 1146
413 Ga0207668_10462857 3300025972 Bacteria 1085
414 Ga0207640_10007440 3300025981 Bacteria 6044
415 Ga0207640_10876091 3300025981 Bacteria 783
416 Ga0207640_11123746 3300025981 Bacteria 696
417 Ga0207658_10000064 3300025986 Bacteria 117779
418 Ga0207658_10151037 3300025986 Bacteria 1892
419 Ga0207658_10795107 3300025986 Bacteria 859
420 Ga0207677_10000091 3300026023 Bacteria 74163
421 Ga0207677_10000280 3300026023 Bacteria 38160
422 Ga0207677_10983091 3300026023 Bacteria 764
423 Ga0207677_11035463 3300026023 Bacteria 746
424 Ga0207703_10309491 3300026035 Bacteria 1443
425 Ga0207639_10046869 3300026041 Bacteria 3264
426 Ga0207678_10063824 3300026067 Bacteria 3165
427 Ga0207678_10375624 3300026067 Bacteria 1228
428 Ga0207678_11549583 3300026067 Bacteria 584
429 Ga0207708_10102376 3300026075 Bacteria 2217
430 Ga0207702_10005062 3300026078 Bacteria 11576
431 Ga0207702_10144576 3300026078 Bacteria 2156
432 Ga0207702_10546079 3300026078 Bacteria 1133
433 Ga0207702_10944196 3300026078 Bacteria 855
434 Ga0207641_10003421 3300026088 Bacteria 14060
435 Ga0207641_10019951 3300026088 Bacteria 5502
436 Ga0207641_10747650 3300026088 Bacteria 965
437 Ga0207648_10000009 3300026089 Bacteria 204229
438 Ga0207648_10562231 3300026089 Bacteria 1049
439 Ga0207648_10750213 3300026089 Bacteria 907
440 Ga0207676_10108953 3300026095 Bacteria 2313
441 Ga0207674_10214218 3300026116 Bacteria 1875
442 Ga0207674_11323738 3300026116 Bacteria 690
443 Ga0207674_11454714 3300026116 Bacteria 654
444 Ga0207675_100402582 3300026118 Bacteria 1349
445 Ga0207675_102632175 3300026118 Bacteria 512
446 Ga0207683_10006500 3300026121 Bacteria 10001
447 Ga0207683_10063505 3300026121 Bacteria 3253
448 Ga0207683_10366205 3300026121 Bacteria 1324
449 Ga0207698_10002773 3300026142 Bacteria 10449
450 Ga0207698_10314913 3300026142 Bacteria 1463
451 Ga0207698_10717229 3300026142 Bacteria 996
452 Ga0207698_10786420 3300026142 Bacteria 953
453 Ga0268266_10000015 3300028379 Bacteria 630629
454 Ga0268266_10000560 3300028379 Bacteria 51866
455 Ga0268266_10421589 3300028379 Bacteria 1265
456 Ga0268266_10530941 3300028379 Bacteria 1126
457 Ga0268266_11006931 3300028379 Bacteria 806
458 Ga0268266_11633475 3300028379 Bacteria 620
459 Ga0268265_12171584 3300028380 Bacteria 562
460 Ga0268264_10000384 3300028381 Bacteria 63602
461 Ga0268264_10049366 3300028381 Bacteria 3501
462 Ga0268264_10310000 3300028381 Bacteria 1489
463 Ga0307517_10068004 3300028786 Bacteria 3252
464 Ga0265330_10283293 3300031235 Bacteria 698
465 Ga0265332_10436973 3300031238 Bacteria 541
466 Ga0265328_10000129 3300031239 Bacteria 36422
467 Ga0265328_10068299 3300031239 Bacteria 1306
468 Ga0265325_10144642 3300031241 Bacteria 1128
469 Ga0265329_10004194 3300031242 Bacteria 6066
470 Ga0265340_10092056 3300031247 Bacteria 1416
471 Ga0265340_10220938 3300031247 Bacteria 849
472 Ga0265340_10408130 3300031247 Bacteria 599
473 Ga0265331_10001125 3300031250 Bacteria 20459
474 Ga0265327_10044157 3300031251 Bacteria 2379
475 Ga0265316_10016003 3300031344 Bacteria 6526
476 Ga0265316_10405158 3300031344 Bacteria 982
477 Ga0307513_10008605 3300031456 Bacteria 13021
478 Ga0307513_10200665 3300031456 Bacteria 1836
479 Ga0307408_100002738 3300031548 Bacteria 12231
480 Ga0307508_10084747 3300031616 Bacteria 2752
481 Ga0265342_10059693 3300031712 Bacteria 2252
482 Ga0265342_10322342 3300031712 Bacteria 810
483 Ga0307405_10503259 3300031731 Bacteria 971
484 Ga0307413_10176896 3300031824 Bacteria 1517
485 Ga0307413_10462880 3300031824 Bacteria 1009
486 Ga0307406_10011946 3300031901 Bacteria 4937
487 Ga0307406_11380337 3300031901 Bacteria 617
488 Ga0307407_10726438 3300031903 Bacteria 750
489 Ga0307412_10138587 3300031911 Bacteria 1778
490 Ga0307412_10730659 3300031911 Bacteria 853
491 Ga0307409_100372070 3300031995 Bacteria 1355
492 Ga0307416_100095222 3300032002 Bacteria 2570
493 Ga0307416_100351348 3300032002 Bacteria 1492
494 Ga0307416_101392196 3300032002 Bacteria 807
495 Ga0307416_101538990 3300032002 Bacteria 771
496 Ga0307416_102386601 3300032002 Bacteria 628
497 Ga0307414_10499576 3300032004 Bacteria 1076
498 Ga0307411_10307164 3300032005 Bacteria 1275
499 Ga0307411_10612816 3300032005 Bacteria 937
500 Ga0307411_11508128 3300032005 Bacteria 618
501 Ga0307411_11550968 3300032005 Bacteria 610
502 Ga0307415_101355857 3300032126 Bacteria 676
503 Ga0307415_101447163 3300032126 Bacteria 656
504 Ga0307510_10131444 3300033180 Bacteria 2175
505 Ga0307510_10281325 3300033180 Bacteria 1134
506 Ga0316596_1101078 3300033541 Bacteria 780
507 Ga0373930_0012668 3300034816 Bacteria 1542
508 Ga0373948_0048488 3300034817 Bacteria 907
509 Ga0373950_0170155 3300034818 Bacteria 508
510 Ga0373929_0009301 3300035085 Bacteria 1820
511 Ga0373949_0020853 3300035090 Bacteria 1503
512 Ga0373949_0081538 3300035090 Bacteria 863
513 Ga0373951_0043729 3300035091 Bacteria 1086
514 Ga0373932_0048633 3300035112 Bacteria 1251
515 Ga0373939_0160427 3300035114 Bacteria 825
516 Ga0373960_0052296 3300035121 Bacteria 1215
517 Ga0373943_0291153 3300035170 Bacteria 925
518 Ga0373955_0190957 3300035172 Bacteria 1218
519 Ga0373942_0087765 3300035207 Bacteria 933
520 Ga0373942_0090162 3300035207 Bacteria 923
521 Ga0373961_0131708 3300035241 Bacteria 838
522 Ga0373931_0046911 3300035691 Bacteria 2285
523 Ga0373935_0225805 3300035692 Bacteria 1302
524 Ga0373933_0473593 3300035724 Bacteria 820
525 Ga0373933_0855821 3300035724 Bacteria 599
526 Ga0373947_0457021 3300035725 Bacteria 865
527 Ga0373947_0503582 3300035725 Bacteria 823
528 Ga0373925_0156062 3300037068 Bacteria 1795
529 Ga0395900_0577370 3300037418 Bacteria 1066
530 Ga0395900_0923344 3300037418 Bacteria 795
531 Ga0395900_1501025 3300037418 Bacteria 586
532 Ga0395905_0118793 3300037471 Bacteria 2485
533 Ga0395905_0413873 3300037471 Bacteria 1243
534 Ga0395905_1716157 3300037471 Bacteria 533
535 Ga0395905_1874582 3300037471 Bacteria 506
536 Ga0395901_0461263 3300038443 Bacteria 1298
537 Ga0395901_0635061 3300038443 Bacteria 1073
538 Ga0395901_1121166 3300038443 Bacteria 756
539 Ga0395901_1180469 3300038443 Bacteria 732
540 Ga0395901_1243918 3300038443 Bacteria 708
541 Ga0436365_0484870 3300039437 Bacteria 2444
542 Ga0436365_0968973 3300039437 Bacteria 967
543 Ga0436365_1200072 3300039437 Bacteria 1660
544 Ga0436365_1660078 3300039437 Bacteria 1040
545 Ga0436360_0611394 3300039438 Bacteria 858
546 Ga0436360_0858015 3300039438 Bacteria 812
547 Ga0436361_0941261 3300039447 Bacteria 551
548 Ga0436363_0240412 3300039450 Bacteria 1739
549 Ga0436363_0285709 3300039450 Bacteria 1350
550 Ga0436363_1187923 3300039450 Bacteria 1470
551 Ga0436363_1389226 3300039450 Bacteria 1549
552 Ga0436362_0367590 3300039453 Bacteria 1182
553 Ga0436362_1207375 3300039453 Bacteria 1146
554 Ga0439447_092817 3300041407 Bacteria 694
555 Ga0451789_0831186 3300041443 Bacteria 645
556 Ga0451790_07228 3300041444 Bacteria 555
557 Ga0451794_28272 3300041446 Bacteria 740
558 Ga0451791_1344492 3300041451 Bacteria 607
559 Ga0451793_0030520 3300041452 Bacteria 601
560 Ga0451795_0403850 3300041456 Bacteria 912
561 Ga0451798_0890559 3300041458 Bacteria 502
562 Ga0451800_0720288 3300041459 Bacteria 693
563 Ga0451802_0399788 3300041460 Bacteria 774
564 Ga0451807_0501283 3300041486 Bacteria 518
565 Ga0451841_1431138 3300041498 Bacteria 547
566 Ga0451855_0958600 3300041511 Bacteria 531
567 Ga0451853_0270632 3300041512 Bacteria 535
568 Ga0451853_3598434 3300041512 Bacteria 625
569 Ga0439437_039413 3300042000 Bacteria 610
570 Ga0439441_113155 3300042001 Bacteria 617
571 Ga0439448_0262567 3300042005 Bacteria 610
572 Ga0439455_0132446 3300042012 Bacteria 703
573 Ga0450894_073624 3300042131 Bacteria 525
574 Ga0439458_0050761 3300042157 Bacteria 1023
575 Ga0439435_0080051 3300042436 Bacteria 979
576 Ga0439459_0041698 3300042438 Bacteria 978
577 Ga0466969_0073651 3300044656 Bacteria 1639
578 Ga0466966_0432360 3300044684 Bacteria 791
579 Ga0466961_0067895 3300044693 Bacteria 2264
580 Ga0466961_0924790 3300044693 Bacteria 519
581 Ga0466963_0552115 3300044694 Bacteria 813
582 Ga0466968_0010999 3300044735 Bacteria 3517
583 Ga0466970_0183319 3300044765 Bacteria 1162
584 Ga0466970_0454594 3300044765 Bacteria 734
585 Ga0466957_0920067 3300044842 Bacteria 625
586 Ga0466959_0097616 3300045049 Bacteria 2105
587 Ga0466958_0155298 3300045836 Bacteria 1444
588 Ga0466967_0405609 3300045976 Bacteria 1327
589 Ga0466967_0416898 3300045976 Bacteria 1308
590 Ga0495617_072304 3300046452 Bacteria 1134
591 Ga0495629_0572716 3300046459 Bacteria 757
592 Ga0495638_0175804 3300046460 Bacteria 1225
593 Ga0495650_0001317 3300046471 Bacteria 25056
594 Ga0495584_0733574 3300046491 Bacteria 504
595 Ga0495596_0039835 3300046500 Bacteria 1855
596 Ga0495607_0075376 3300046501 Bacteria 1870
597 Ga0495583_0055775 3300046506 Bacteria 1784
598 Ga0495606_0026341 3300046507 Bacteria 4145
599 Ga0495616_0043729 3300046513 Bacteria 2274
600 Ga0495616_0080148 3300046513 Bacteria 1564
601 Ga0495620_0212922 3300046515 Bacteria 741
602 Ga0495631_0272042 3300046518 Bacteria 721
603 Ga0495632_0111724 3300046519 Bacteria 1283
604 Ga0495637_0017513 3300046520 Bacteria 3336
605 Ga0495643_0423485 3300046522 Bacteria 583
606 Ga0495648_0007227 3300046524 Bacteria 8919
607 Ga0495663_0006927 3300046525 Bacteria 3127
608 Ga0495663_0398762 3300046525 Bacteria 506
609 Ga0495654_0212746 3300046530 Bacteria 821
610 Ga0495587_0028999 3300046536 Bacteria 3362
611 Ga0495609_0162383 3300046538 Bacteria 946
612 Ga0495597_0032717 3300046542 Bacteria 2358
613 Ga0495597_0337585 3300046542 Bacteria 580
614 Ga0495645_0950428 3300046543 Bacteria 508
615 Ga0495622_0017900 3300046557 Bacteria 3300
616 Ga0495633_0052492 3300046558 Bacteria 1920
617 Ga0495668_0000016 3300046616 Bacteria 438197
618 Ga0495611_0189735 3300046648 Bacteria 959
619 Ga0495625_0018235 3300046660 Bacteria 5484
620 Ga0495659_0089938 3300046664 Bacteria 1177
621 Ga0495661_0299532 3300046665 Bacteria 805
622 Ga0495669_0001189 3300046684 Bacteria 10830
623 Ga0495670_0090056 3300046691 Bacteria 1569
624 Ga0495671_0615362 3300046692 Bacteria 516
625 Ga0495649_0128062 3300046694 Bacteria 1340
626 Ga0495589_0256713 3300046794 Bacteria 816
627 Ga0495600_0009263 3300046809 Bacteria 6075
628 Ga0495660_0071205 3300046810 Bacteria 1844
629 Ga0495604_0267655 3300047317 Bacteria 1159
630 Ga0495636_0137389 3300047318 Bacteria 1090
631 Ga0495674_0400752 3300047319 Bacteria 1108
632 Ga0495672_0053242 3300047320 Bacteria 2373
633 Ga0495672_0415684 3300047320 Bacteria 612
634 Ga0495680_0705488 3300047322 Bacteria 666
635 Ga0495683_0123059 3300047323 Bacteria 1229
636 Ga0495687_037411 3300047443 Bacteria 2162
637 Ga0495687_037412 3300047443 Bacteria 2162
638 Ga0495679_051402 3300047446 Bacteria 1236
639 Ga0495673_0358210 3300047469 Bacteria 514
640 Ga0495681_0032741 3300047470 Bacteria 2613
641 Ga0495686_0144866 3300047472 Bacteria 1399
642 Ga0495615_0096358 3300048090 Bacteria 831
643 Ga0495615_0096878 3300048090 Bacteria 829
644 Ga0496100_0177022 3300048903 Bacteria 1540
645 Ga0496101_0014870 3300048904 Bacteria 5237
646 Ga0496101_0833573 3300048904 Bacteria 727
647 Ga0496102_0003155 3300048905 Bacteria 13978
648 Ga0496102_0067172 3300048905 Bacteria 3288
649 Ga0496102_0664938 3300048905 Bacteria 965
650 Ga0496103_0000903 3300048906 Bacteria 21301
651 Ga0496103_0061364 3300048906 Bacteria 2338
652 Ga0496104_0101217 3300048907 Bacteria 2758
653 Ga0496105_0014636 3300048908 Bacteria 6247
654 Ga0496105_0035470 3300048908 Bacteria 4104
655 Ga0496106_0233931 3300048909 Bacteria 1467
656 Ga0496107_0092306 3300048910 Bacteria 2213
657 Ga0496107_0099103 3300048910 Bacteria 2135
658 Ga0496108_0071844 3300048911 Bacteria 2920
659 Ga0496108_0539287 3300048911 Bacteria 1018
660 Ga0496109_0054198 3300048912 Bacteria 3658
661 Ga0496109_0367857 3300048912 Bacteria 1358
662 Ga0496110_0121916 3300048913 Bacteria 2349
663 Ga0496111_0137029 3300048914 Bacteria 1813
664 Ga0496111_0177046 3300048914 Bacteria 1585
665 Ga0496111_0494249 3300048914 Bacteria 901
666 Ga0496112_0118329 3300048915 Bacteria 2619
667 Ga0496112_0308603 3300048915 Bacteria 1527
668 Ga0496112_0363032 3300048915 Bacteria 1390
669 Ga0496113_0444654 3300048916 Bacteria 1041
670 Ga0496113_0579968 3300048916 Bacteria 899
671 Ga0496114_0060604 3300048917 Bacteria 3163
672 Ga0496115_0002506 3300048918 Bacteria 13194
673 Ga0496115_0024784 3300048918 Bacteria 4665
674 Ga0496115_0049337 3300048918 Bacteria 3369
675 Ga0496116_0009806 3300048919 Bacteria 8117
676 Ga0496117_0000324 3300048920 Bacteria 83876
677 Ga0496118_0002151 3300048921 Bacteria 27486
678 Ga0496118_0523507 3300048921 Bacteria 584
679 Ga0496119_0019706 3300048922 Bacteria 4952
680 Ga0496120_0013189 3300048923 Bacteria 5578
681 Ga0496121_0002794 3300048924 Bacteria 25864
682 Ga0496122_0020856 3300048925 Bacteria 5894
683 Ga0496122_0535551 3300048925 Bacteria 561
684 Ga0496123_0017188 3300048926 Bacteria 5835
685 Ga0496124_0000351 3300048927 Bacteria 84021
686 Ga0496125_0011965 3300048928 Bacteria 8640
687 Ga0496126_0002155 3300048929 Bacteria 27384
688 Ga0501308_007330 3300049128 Bacteria 1152
689 Ga0501305_055965 3300049161 Bacteria 671
690 Ga0501307_017543 3300049162 Bacteria 903
691 Ga0495682_0228037 3300049460 Bacteria 660
692 Ga0501300_039689 3300049523 Bacteria 707
693 Ga0501336_018314 3300049552 Bacteria 620
694 Ga0501032_0037596 3300049569 Bacteria 3300
695 Ga0501033_0059370 3300049570 Bacteria 2824
696 Ga0501034_1455194 3300049571 Bacteria 559
697 Ga0501036_0273418 3300049572 Bacteria 1414
698 Ga0501036_0984885 3300049572 Bacteria 690
699 Ga0501037_0000191 3300049573 Bacteria 56839
700 Ga0501043_0000080 3300049579 Bacteria 85372
701 Ga0501047_0560620 3300049581 Bacteria 966
702 Ga0501048_0940235 3300049582 Bacteria 622
703 Ga0501068_0626878 3300049584 Bacteria 701
704 Ga0501069_0000091 3300049585 Bacteria 43550
705 Ga0501069_0088669 3300049585 Bacteria 1748
706 Ga0501070_0014064 3300049586 Bacteria 6737
707 Ga0501070_0014243 3300049586 Bacteria 6692
708 Ga0501071_0045783 3300049587 Bacteria 3140
709 Ga0501073_0040996 3300049589 Bacteria 3273
710 Ga0501073_0484052 3300049589 Bacteria 856
711 Ga0501073_0834745 3300049589 Bacteria 635
712 Ga0501074_0002583 3300049590 Bacteria 12638
713 Ga0501075_1525655 3300049591 Bacteria 506
714 Ga0501257_001130 3300049686 Bacteria 5433
715 Ga0501079_0578838 3300049741 Bacteria 883
716 Ga0501079_0667145 3300049741 Bacteria 819
717 Ga0501080_0075363 3300049742 Bacteria 3138
718 Ga0501080_0511307 3300049742 Bacteria 1072
719 Ga0501083_0001214 3300049744 Bacteria 17447
720 Ga0501280_006929 3300049776 Bacteria 1592
721 Ga0501035_0072152 3300049822 Bacteria 3056
722 Ga0501035_1146408 3300049822 Bacteria 605
723 Ga0501044_0092128 3300049823 Bacteria 3056
724 nmdc:mga03683_278950_c1 3300050489 Bacteria 781
725 nmdc:mga03n38_607148_c1 3300050490 Bacteria 624
726 nmdc:mga0yw44_302857_c1 3300050492 Bacteria 1071
727 nmdc:mga0k408_114332_c1 3300050493 Bacteria 1596
728 nmdc:mga0k408_25101_c1 3300050493 Bacteria 3373
729 nmdc:mga0k408_4095_c1 3300050493 Bacteria 7742
730 nmdc:mga0k408_780026_c1 3300050493 Bacteria 557
731 nmdc:mga0k408_98907_c1 3300050493 Bacteria 1719
732 nmdc:mga06z11_131797_c1 3300050494 Bacteria 1404
733 nmdc:mga06z11_172734_c1 3300050494 Bacteria 1242
734 nmdc:mga06z11_372392_c1 3300050494 Bacteria 857
735 nmdc:mga04h51_513537_c1 3300050495 Bacteria 513
736 nmdc:mga08y16_1096076_c1 3300050511 Bacteria 771
737 nmdc:mga0n895_592416_c1 3300050512 Bacteria 1112
738 nmdc:mga0n895_761735_c1 3300050512 Bacteria 960
739 nmdc:mga0rr50_756197_c1 3300050513 Bacteria 829
740 nmdc:mga08x19_1033595_c1 3300050514 Bacteria 583
741 nmdc:mga0sz30_192635_c1 3300050516 Bacteria 905
742 nmdc:mga0sz30_74009_c1 3300050516 Bacteria 1469
743 Ga0495601_0050869 3300053077 Bacteria 2614
744 Ga0500610_0000216 3300053079 Bacteria 17601
745 Ga0495655_0010736 3300053083 Bacteria 1818
746 Ga0495655_0101522 3300053083 Bacteria 852
747 Ga0495655_0180561 3300053083 Bacteria 680
748 Ga0495595_0069895 3300053084 Bacteria 1658
749 Ga0495619_1125224 3300053085 Bacteria 522
750 Ga0500578_0400604 3300053086 Bacteria 791
751 Ga0500643_109253 3300053087 Bacteria 747
752 Ga0500646_0004531 3300053090 Bacteria 3517
753 Ga0500646_0040773 3300053090 Bacteria 1307
754 Ga0500583_0399269 3300053092 Bacteria 660
755 Ga0500641_0169432 3300053096 Bacteria 940
756 Ga0500556_0200021 3300053104 Bacteria 790
757 Ga0500562_083776 3300053108 Bacteria 864
758 Ga0500593_181685 3300053117 Bacteria 780
759 Ga0500594_0173443 3300053118 Bacteria 701
760 Ga0500595_018979 3300053119 Bacteria 2502
761 Ga0500642_0001933 3300053130 Bacteria 6005
762 Ga0500642_0009901 3300053130 Bacteria 3335
763 Ga0500652_145430 3300053131 Bacteria 985
764 Ga0500568_0035867 3300053139 Bacteria 2021
765 Ga0500573_0000559 3300053140 Bacteria 16226
766 Ga0500573_0293206 3300053140 Bacteria 817
767 Ga0500604_0000014 3300053151 Bacteria 92128
768 Ga0500604_0206745 3300053151 Bacteria 676
769 Ga0500616_0006579 3300053153 Bacteria 7577
770 Ga0500616_0073152 3300053153 Bacteria 1741
771 Ga0500622_0002771 3300053156 Bacteria 12332
772 Ga0500636_0152791 3300053177 Bacteria 1266
773 Ga0500645_000002 3300053730 Bacteria 388892
774 Ga0500645_088783 3300053730 Bacteria 878
775 Ga0500587_034778 3300053739 Bacteria 704
776 Ga0501084_0151360 3300054114 Bacteria 1956
777 Ga0587084_007588 3300059477 Bacteria 1350
778 Ga0587066_007807 3300059490 Bacteria 1465
779 Ga0587070_008024 3300059491 Bacteria 1484
780 Ga0587070_065000 3300059491 Bacteria 764
781 Ga0587073_0021745 3300059492 Bacteria 1237
782 Ga0587077_003076 3300059493 Bacteria 2064
783 Ga0587080_008678 3300059503 Bacteria 1462
784 Ga0587082_014514 3300059504 Bacteria 1203
785 Ga0587083_0020431 3300059505 Bacteria 1220
786 Ga0587088_010422 3300059508 Bacteria 1361
787 Ga0587090_017496 3300059510 Bacteria 1084
788 Ga0587090_084782 3300059510 Bacteria 640
789 Ga0587091_001650 3300059511 Bacteria 2475
790 Ga0587094_012259 3300059513 Bacteria 1142
791 Ga0587106_020463 3300059605 Bacteria 976
792 Ga0587131_020051 3300059609 Bacteria 545
793 Ga0587101_004327 3300059623 Bacteria 1511
794 Ga0587115_001498 3300059626 Bacteria 2157
795 Ga0587067_006007 3300059640 Bacteria 1672
796 Ga0587067_017691 3300059640 Bacteria 1186
797 Ga0587068_010651 3300059641 Bacteria 1376
798 Ga0587069_012706 3300059642 Bacteria 1146
799 Ga0587072_016814 3300059643 Bacteria 1256
800 Ga0587072_112905 3300059643 Bacteria 622
801 Ga0587075_012510 3300059644 Bacteria 1154
802 Ga0587076_013991 3300059645 Bacteria 1227
803 Ga0587078_006230 3300059646 Bacteria 1292
804 Ga0587079_008799 3300059647 Bacteria 1554
805 Ga0587107_051730 3300059652 Bacteria 699
806 Ga0587110_018389 3300059654 Bacteria 772
807 Ga0587071_013079 3300060344 Bacteria 1424
808 Ga0587071_055585 3300060344 Bacteria 829
809 Ga0501082_0113976 3300060353 Bacteria 2341
810 Ga0501082_0282717 3300060353 Bacteria 1444
811 Ga0501082_0486754 3300060353 Bacteria 1078
812 Ga0466962_0424806 3300061719 Bacteria 667

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049460 Ga0495682_0228037 Ga0495682_0228037_14_289 89
2 3300041511 Ga0451855_0958600 Ga0451855_0958600_35_316 92
3 3300025949 Ga0207667_10440871 Ga0207667_104408713 94
4 iso_pu_bacteria 8002060224 8002061399 94
5 iso_pu_bacteria 8054563764 8054566754 94
6 3300006881 Ga0068865_101196254 Ga0068865_1011962542 95
7 3300025900 Ga0207710_10241548 Ga0207710_102415482 95
8 3300025936 Ga0207670_10700241 Ga0207670_107002412 97
9 3300033541 Ga0316596_1101078 Ga0316596_11010782 97
10 3300041451 Ga0451791_1344492 Ga0451791_1344492_245_538 97
11 3300049569 Ga0501032_0037596 Ga0501032_0037596_1961_2254 97
12 3300049570 Ga0501033_0059370 Ga0501033_0059370_860_1153 97
13 3300049572 Ga0501036_0273418 Ga0501036_0273418_919_1212 97
14 3300049573 Ga0501037_0000191 Ga0501037_0000191_54650_54943 97
15 3300049579 Ga0501043_0000080 Ga0501043_0000080_1897_2190 97
16 3300049581 Ga0501047_0560620 Ga0501047_0560620_330_623 97
17 3300049582 Ga0501048_0940235 Ga0501048_0940235_306_599 97
18 3300049585 Ga0501069_0000091 Ga0501069_0000091_1111_1404 97
19 3300049586 Ga0501070_0014064 Ga0501070_0014064_4548_4841 97
20 3300049587 Ga0501071_0045783 Ga0501071_0045783_1122_1415 97
21 3300049589 Ga0501073_0040996 Ga0501073_0040996_1117_1410 97
22 3300049590 Ga0501074_0002583 Ga0501074_0002583_1876_2169 97
23 3300049741 Ga0501079_0578838 Ga0501079_0578838_132_425 97
24 3300049742 Ga0501080_0075363 Ga0501080_0075363_949_1242 97
25 3300049744 Ga0501083_0001214 Ga0501083_0001214_15262_15555 97
26 3300049822 Ga0501035_0072152 Ga0501035_0072152_1897_2190 97
27 3300049823 Ga0501044_0092128 Ga0501044_0092128_1897_2190 97
28 3300060353 Ga0501082_0113976 Ga0501082_0113976_743_1036 97
29 3300031235 Ga0265330_10283293 Ga0265330_102832932 98
30 3300031239 Ga0265328_10000129 Ga0265328_100001295 98
31 3300031239 Ga0265328_10068299 Ga0265328_100682992 98
32 3300031242 Ga0265329_10004194 Ga0265329_1000419411 98
33 3300031247 Ga0265340_10220938 Ga0265340_102209382 98
34 3300031250 Ga0265331_10001125 Ga0265331_1000112521 98
35 3300031251 Ga0265327_10044157 Ga0265327_100441573 98
36 3300031344 Ga0265316_10016003 Ga0265316_100160033 98
37 3300031344 Ga0265316_10405158 Ga0265316_104051581 98
38 3300031712 Ga0265342_10059693 Ga0265342_100596931 98
39 3300037418 Ga0395900_0923344 Ga0395900_0923344_150_446 98
40 3300038443 Ga0395901_1121166 Ga0395901_1121166_420_716 98
41 3300039437 Ga0436365_1660078 Ga0436365_1660078_601_897 98
42 3300039450 Ga0436363_0240412 Ga0436363_0240412_225_521 98
43 3300047320 Ga0495672_0053242 Ga0495672_0053242_238_534 98
44 3300047320 Ga0495672_0415684 Ga0495672_0415684_92_388 98
45 3300049591 Ga0501075_1525655 Ga0501075_1525655_37_333 98
46 3300005328 Ga0070676_10497773 Ga0070676_104977732 99
47 3300005329 Ga0070683_102337481 Ga0070683_1023374811 99
48 3300005330 Ga0070690_100064067 Ga0070690_1000640675 99
49 3300005331 Ga0070670_100409570 Ga0070670_1004095702 99
50 3300005331 Ga0070670_100686642 Ga0070670_1006866422 99
51 3300005334 Ga0068869_101021642 Ga0068869_1010216422 99
52 3300005335 Ga0070666_11318960 Ga0070666_113189601 99
53 3300005336 Ga0070680_100004922 Ga0070680_1000049224 99
54 3300005337 Ga0070682_101232756 Ga0070682_1012327562 99
55 3300005340 Ga0070689_100912641 Ga0070689_1009126411 99
56 3300005340 Ga0070689_101301101 Ga0070689_1013011012 99
57 3300005343 Ga0070687_100140311 Ga0070687_1001403112 99
58 3300005347 Ga0070668_101698707 Ga0070668_1016987072 99
59 3300005353 Ga0070669_101034119 Ga0070669_1010341192 99
60 3300005354 Ga0070675_100140583 Ga0070675_1001405832 99
61 3300005355 Ga0070671_100494700 Ga0070671_1004947002 99
62 3300005356 Ga0070674_100369465 Ga0070674_1003694652 99
63 3300005365 Ga0070688_100155629 Ga0070688_1001556292 99
64 3300005365 Ga0070688_101777838 Ga0070688_1017778382 99
65 3300005366 Ga0070659_100892304 Ga0070659_1008923042 99
66 3300005367 Ga0070667_100298344 Ga0070667_1002983443 99
67 3300005367 Ga0070667_101089218 Ga0070667_1010892182 99
68 3300005434 Ga0070709_10835980 Ga0070709_108359802 99
69 3300005438 Ga0070701_10380328 Ga0070701_103803282 99
70 3300005441 Ga0070700_101326393 Ga0070700_1013263932 99
71 3300005444 Ga0070694_101200225 Ga0070694_1012002252 99
72 3300005457 Ga0070662_100271769 Ga0070662_1002717692 99
73 3300005458 Ga0070681_10039142 Ga0070681_100391425 99
74 3300005458 Ga0070681_10257591 Ga0070681_102575912 99
75 3300005458 Ga0070681_10544016 Ga0070681_105440162 99
76 3300005459 Ga0068867_100305758 Ga0068867_1003057583 99
77 3300005466 Ga0070685_10323103 Ga0070685_103231032 99
78 3300005530 Ga0070679_100040114 Ga0070679_1000401145 99
79 3300005530 Ga0070679_101075760 Ga0070679_1010757602 99
80 3300005543 Ga0070672_100294774 Ga0070672_1002947742 99
81 3300005544 Ga0070686_100177076 Ga0070686_1001770762 99
82 3300005544 Ga0070686_100945791 Ga0070686_1009457912 99
83 3300005544 Ga0070686_100951489 Ga0070686_1009514892 99
84 3300005547 Ga0070693_100061798 Ga0070693_1000617983 99
85 3300005548 Ga0070665_100287765 Ga0070665_1002877653 99
86 3300005549 Ga0070704_101800498 Ga0070704_1018004982 99
87 3300005616 Ga0068852_100688555 Ga0068852_1006885552 99
88 3300005618 Ga0068864_100016814 Ga0068864_1000168143 99
89 3300005618 Ga0068864_101619112 Ga0068864_1016191121 99
90 3300005718 Ga0068866_10316151 Ga0068866_103161512 99
91 3300005719 Ga0068861_100573424 Ga0068861_1005734242 99
92 3300005719 Ga0068861_100637812 Ga0068861_1006378122 99
93 3300005719 Ga0068861_101683616 Ga0068861_1016836162 99
94 3300005842 Ga0068858_100644009 Ga0068858_1006440093 99
95 3300005983 Ga0081540_1080649 Ga0081540_10806492 99
96 3300006028 Ga0070717_10235653 Ga0070717_102356533 99
97 3300006038 Ga0075365_10543520 Ga0075365_105435202 99
98 3300006048 Ga0075363_100172626 Ga0075363_1001726262 99
99 3300006048 Ga0075363_100814191 Ga0075363_1008141912 99
100 3300006163 Ga0070715_10518171 Ga0070715_105181711 99
101 3300006173 Ga0070716_100688448 Ga0070716_1006884482 99
102 3300006177 Ga0075362_10278047 Ga0075362_102780472 99
103 3300006177 Ga0075362_10365895 Ga0075362_103658952 99
104 3300006178 Ga0075367_10081978 Ga0075367_100819783 99
105 3300006178 Ga0075367_10116045 Ga0075367_101160452 99
106 3300006195 Ga0075366_10007231 Ga0075366_1000723111 99
107 3300006195 Ga0075366_10013189 Ga0075366_100131895 99
108 3300006195 Ga0075366_10038153 Ga0075366_100381532 99
109 3300006195 Ga0075366_11030761 Ga0075366_110307611 99
110 3300006237 Ga0097621_100122566 Ga0097621_1001225662 99
111 3300006237 Ga0097621_100852498 Ga0097621_1008524982 99
112 3300006237 Ga0097621_101986048 Ga0097621_1019860481 99
113 3300006358 Ga0068871_101008421 Ga0068871_1010084212 99
114 3300006871 Ga0075434_101482429 Ga0075434_1014824292 99
115 3300007076 Ga0075435_101409965 Ga0075435_1014099652 99
116 3300007788 Ga0099795_10127919 Ga0099795_101279192 99
117 3300009094 Ga0111539_10060664 Ga0111539_100606649 99
118 3300009094 Ga0111539_12293156 Ga0111539_122931562 99
119 3300009098 Ga0105245_11800287 Ga0105245_118002872 99
120 3300009101 Ga0105247_10166213 Ga0105247_101662132 99
121 3300009176 Ga0105242_10122649 Ga0105242_101226493 99
122 3300009177 Ga0105248_10099202 Ga0105248_100992023 99
123 3300009545 Ga0105237_10246271 Ga0105237_102462712 99
124 3300009545 Ga0105237_11062358 Ga0105237_110623581 99
125 3300009551 Ga0105238_10311541 Ga0105238_103115412 99
126 3300009551 Ga0105238_12495022 Ga0105238_124950222 99
127 3300009553 Ga0105249_10386652 Ga0105249_103866522 99
128 3300010159 Ga0099796_10476274 Ga0099796_104762742 99
129 3300010375 Ga0105239_11274454 Ga0105239_112744542 99
130 3300013297 Ga0157378_12037748 Ga0157378_120377482 99
131 3300013306 Ga0163162_10828800 Ga0163162_108288002 99
132 3300013308 Ga0157375_10353413 Ga0157375_103534132 99
133 3300014497 Ga0182008_10189510 Ga0182008_101895101 99
134 3300014745 Ga0157377_10324576 Ga0157377_103245762 99
135 3300014968 Ga0157379_10667744 Ga0157379_106677442 99
136 3300014968 Ga0157379_10959097 Ga0157379_109590972 99
137 3300015265 Ga0182005_1076003 Ga0182005_10760031 99
138 3300015265 Ga0182005_1185098 Ga0182005_11850982 99
139 3300017792 Ga0163161_10097218 Ga0163161_100972185 99
140 3300017792 Ga0163161_12041913 Ga0163161_120419132 99
141 3300021384 Ga0213876_10413764 Ga0213876_104137642 99
142 3300025297 Ga0209758_1000548 Ga0209758_100054856 99
143 3300025302 Ga0207426_1019059 Ga0207426_10190595 99
144 3300025899 Ga0207642_10150116 Ga0207642_101501161 99
145 3300025900 Ga0207710_10061673 Ga0207710_100616732 99
146 3300025903 Ga0207680_10652026 Ga0207680_106520262 99
147 3300025908 Ga0207643_10437555 Ga0207643_104375552 99
148 3300025909 Ga0207705_10198836 Ga0207705_101988362 99
149 3300025912 Ga0207707_10020771 Ga0207707_1002077112 99
150 3300025914 Ga0207671_10268480 Ga0207671_102684802 99
151 3300025917 Ga0207660_10059665 Ga0207660_100596655 99
152 3300025918 Ga0207662_10347525 Ga0207662_103475252 99
153 3300025921 Ga0207652_10037461 Ga0207652_100374614 99
154 3300025921 Ga0207652_10093381 Ga0207652_100933812 99
155 3300025921 Ga0207652_11781401 Ga0207652_117814011 99
156 3300025923 Ga0207681_11378610 Ga0207681_113786101 99
157 3300025924 Ga0207694_10260982 Ga0207694_102609822 99
158 3300025924 Ga0207694_10860652 Ga0207694_108606522 99
159 3300025925 Ga0207650_10196105 Ga0207650_101961051 99
160 3300025925 Ga0207650_10955711 Ga0207650_109557112 99
161 3300025926 Ga0207659_10700448 Ga0207659_107004482 99
162 3300025926 Ga0207659_11866491 Ga0207659_118664912 99
163 3300025931 Ga0207644_10085340 Ga0207644_100853403 99
164 3300025931 Ga0207644_11559031 Ga0207644_115590312 99
165 3300025936 Ga0207670_10110814 Ga0207670_101108144 99
166 3300025936 Ga0207670_10515265 Ga0207670_105152652 99
167 3300025937 Ga0207669_10233156 Ga0207669_102331562 99
168 3300025937 Ga0207669_10283236 Ga0207669_102832362 99
169 3300025938 Ga0207704_10388669 Ga0207704_103886692 99
170 3300025939 Ga0207665_10569264 Ga0207665_105692642 99
171 3300025940 Ga0207691_10511865 Ga0207691_105118652 99
172 3300025941 Ga0207711_10204371 Ga0207711_102043712 99
173 3300025960 Ga0207651_11176477 Ga0207651_111764771 99
174 3300025961 Ga0207712_10207690 Ga0207712_102076903 99
175 3300025972 Ga0207668_10180641 Ga0207668_101806413 99
176 3300025972 Ga0207668_10411378 Ga0207668_104113781 99
177 3300025986 Ga0207658_10795107 Ga0207658_107951072 99
178 3300026023 Ga0207677_11035463 Ga0207677_110354632 99
179 3300026035 Ga0207703_10309491 Ga0207703_103094913 99
180 3300026067 Ga0207678_10375624 Ga0207678_103756242 99
181 3300026075 Ga0207708_10102376 Ga0207708_101023765 99
182 3300026088 Ga0207641_10747650 Ga0207641_107476501 99
183 3300026089 Ga0207648_10750213 Ga0207648_107502131 99
184 3300026095 Ga0207676_10108953 Ga0207676_101089534 99
185 3300026121 Ga0207683_10063505 Ga0207683_100635054 99
186 3300026142 Ga0207698_10786420 Ga0207698_107864202 99
187 3300028379 Ga0268266_10421589 Ga0268266_104215892 99
188 3300028379 Ga0268266_11006931 Ga0268266_110069311 99
189 3300028380 Ga0268265_12171584 Ga0268265_121715842 99
190 3300028381 Ga0268264_10310000 Ga0268264_103100003 99
191 3300031238 Ga0265332_10436973 Ga0265332_104369732 99
192 3300031241 Ga0265325_10144642 Ga0265325_101446423 99
193 3300031247 Ga0265340_10092056 Ga0265340_100920562 99
194 3300031247 Ga0265340_10408130 Ga0265340_104081302 99
195 3300031456 Ga0307513_10200665 Ga0307513_102006652 99
196 3300031712 Ga0265342_10322342 Ga0265342_103223421 99
197 3300031824 Ga0307413_10462880 Ga0307413_104628802 99
198 3300032002 Ga0307416_101538990 Ga0307416_1015389902 99
199 3300032005 Ga0307411_11550968 Ga0307411_115509682 99
200 3300032126 Ga0307415_101355857 Ga0307415_1013558572 99
201 3300033180 Ga0307510_10281325 Ga0307510_102813252 99
202 3300034816 Ga0373930_0012668 Ga0373930_0012668_779_1078 99
203 3300034817 Ga0373948_0048488 Ga0373948_0048488_166_465 99
204 3300034818 Ga0373950_0170155 Ga0373950_0170155_24_323 99
205 3300035085 Ga0373929_0009301 Ga0373929_0009301_1091_1390 99
206 3300035090 Ga0373949_0020853 Ga0373949_0020853_738_1037 99
207 3300035091 Ga0373951_0043729 Ga0373951_0043729_62_361 99
208 3300035112 Ga0373932_0048633 Ga0373932_0048633_435_734 99
209 3300035114 Ga0373939_0160427 Ga0373939_0160427_481_780 99
210 3300035121 Ga0373960_0052296 Ga0373960_0052296_487_786 99
211 3300035170 Ga0373943_0291153 Ga0373943_0291153_256_555 99
212 3300035172 Ga0373955_0190957 Ga0373955_0190957_851_1150 99
213 3300035207 Ga0373942_0087765 Ga0373942_0087765_505_804 99
214 3300035207 Ga0373942_0090162 Ga0373942_0090162_484_783 99
215 3300035241 Ga0373961_0131708 Ga0373961_0131708_235_534 99
216 3300035691 Ga0373931_0046911 Ga0373931_0046911_1193_1492 99
217 3300035692 Ga0373935_0225805 Ga0373935_0225805_87_386 99
218 3300035724 Ga0373933_0473593 Ga0373933_0473593_362_661 99
219 3300035724 Ga0373933_0855821 Ga0373933_0855821_232_531 99
220 3300035725 Ga0373947_0457021 Ga0373947_0457021_98_397 99
221 3300037068 Ga0373925_0156062 Ga0373925_0156062_28_327 99
222 3300037471 Ga0395905_1874582 Ga0395905_1874582_186_485 99
223 3300039437 Ga0436365_1200072 Ga0436365_1200072_1129_1428 99
224 3300039438 Ga0436360_0611394 Ga0436360_0611394_234_533 99
225 3300039438 Ga0436360_0858015 Ga0436360_0858015_313_612 99
226 3300039447 Ga0436361_0941261 Ga0436361_0941261_81_380 99
227 3300039450 Ga0436363_0285709 Ga0436363_0285709_83_382 99
228 3300039450 Ga0436363_1187923 Ga0436363_1187923_242_541 99
229 3300039453 Ga0436362_0367590 Ga0436362_0367590_418_717 99
230 3300039453 Ga0436362_1207375 Ga0436362_1207375_451_750 99
231 3300041407 Ga0439447_092817 Ga0439447_092817_214_513 99
232 3300042131 Ga0450894_073624 Ga0450894_073624_139_438 99
233 3300042436 Ga0439435_0080051 Ga0439435_0080051_455_754 99
234 3300042438 Ga0439459_0041698 Ga0439459_0041698_498_797 99
235 3300044693 Ga0466961_0924790 Ga0466961_0924790_121_420 99
236 3300045976 Ga0466967_0405609 Ga0466967_0405609_878_1177 99
237 3300046459 Ga0495629_0572716 Ga0495629_0572716_173_472 99
238 3300046543 Ga0495645_0950428 Ga0495645_0950428_187_486 99
239 3300046664 Ga0495659_0089938 Ga0495659_0089938_798_1097 99
240 3300046794 Ga0495589_0256713 Ga0495589_0256713_185_484 99
241 3300047317 Ga0495604_0267655 Ga0495604_0267655_76_375 99
242 3300047319 Ga0495674_0400752 Ga0495674_0400752_568_867 99
243 3300047322 Ga0495680_0705488 Ga0495680_0705488_352_651 99
244 3300047469 Ga0495673_0358210 Ga0495673_0358210_72_371 99
245 3300048903 Ga0496100_0177022 Ga0496100_0177022_400_699 99
246 3300048904 Ga0496101_0014870 Ga0496101_0014870_765_1064 99
247 3300048905 Ga0496102_0067172 Ga0496102_0067172_884_1183 99
248 3300048906 Ga0496103_0061364 Ga0496103_0061364_40_339 99
249 3300048907 Ga0496104_0101217 Ga0496104_0101217_569_868 99
250 3300048908 Ga0496105_0035470 Ga0496105_0035470_1758_2057 99
251 3300048909 Ga0496106_0233931 Ga0496106_0233931_1009_1308 99
252 3300048910 Ga0496107_0092306 Ga0496107_0092306_61_360 99
253 3300048911 Ga0496108_0071844 Ga0496108_0071844_1048_1347 99
254 3300048911 Ga0496108_0539287 Ga0496108_0539287_47_346 99
255 3300048912 Ga0496109_0054198 Ga0496109_0054198_2077_2376 99
256 3300048913 Ga0496110_0121916 Ga0496110_0121916_1891_2190 99
257 3300048914 Ga0496111_0177046 Ga0496111_0177046_732_1031 99
258 3300048915 Ga0496112_0118329 Ga0496112_0118329_998_1297 99
259 3300048915 Ga0496112_0308603 Ga0496112_0308603_398_697 99
260 3300048916 Ga0496113_0444654 Ga0496113_0444654_304_603 99
261 3300048918 Ga0496115_0024784 Ga0496115_0024784_2400_2699 99
262 3300048918 Ga0496115_0049337 Ga0496115_0049337_28_327 99
263 3300049584 Ga0501068_0626878 Ga0501068_0626878_207_506 99
264 3300049589 Ga0501073_0834745 Ga0501073_0834745_242_541 99
265 3300049741 Ga0501079_0667145 Ga0501079_0667145_420_719 99
266 3300049742 Ga0501080_0511307 Ga0501080_0511307_108_407 99
267 3300050489 nmdc:mga03683_278950_c1 nmdc:mga03683_278950_c1_249_548 99
268 3300050490 nmdc:mga03n38_607148_c1 nmdc:mga03n38_607148_c1_223_522 99
269 3300050492 nmdc:mga0yw44_302857_c1 nmdc:mga0yw44_302857_c1_95_394 99
270 3300050493 nmdc:mga0k408_25101_c1 nmdc:mga0k408_25101_c1_563_862 99
271 3300050493 nmdc:mga0k408_4095_c1 nmdc:mga0k408_4095_c1_286_585 99
272 3300050493 nmdc:mga0k408_780026_c1 nmdc:mga0k408_780026_c1_109_408 99
273 3300050493 nmdc:mga0k408_98907_c1 nmdc:mga0k408_98907_c1_793_1092 99
274 3300050494 nmdc:mga06z11_131797_c1 nmdc:mga06z11_131797_c1_1021_1320 99
275 3300050494 nmdc:mga06z11_172734_c1 nmdc:mga06z11_172734_c1_444_743 99
276 3300050494 nmdc:mga06z11_372392_c1 nmdc:mga06z11_372392_c1_264_563 99
277 3300050495 nmdc:mga04h51_513537_c1 nmdc:mga04h51_513537_c1_49_348 99
278 3300050511 nmdc:mga08y16_1096076_c1 nmdc:mga08y16_1096076_c1_153_452 99
279 3300050512 nmdc:mga0n895_761735_c1 nmdc:mga0n895_761735_c1_603_902 99
280 3300050513 nmdc:mga0rr50_756197_c1 nmdc:mga0rr50_756197_c1_515_814 99
281 3300050516 nmdc:mga0sz30_192635_c1 nmdc:mga0sz30_192635_c1_407_706 99
282 3300053077 Ga0495601_0050869 Ga0495601_0050869_680_979 99
283 3300053083 Ga0495655_0010736 Ga0495655_0010736_299_598 99
284 3300053083 Ga0495655_0180561 Ga0495655_0180561_91_390 99
285 3300053084 Ga0495595_0069895 Ga0495595_0069895_350_649 99
286 3300053085 Ga0495619_1125224 Ga0495619_1125224_211_510 99
287 3300053086 Ga0500578_0400604 Ga0500578_0400604_171_470 99
288 3300053090 Ga0500646_0040773 Ga0500646_0040773_567_866 99
289 3300053104 Ga0500556_0200021 Ga0500556_0200021_211_510 99
290 3300053108 Ga0500562_083776 Ga0500562_083776_29_328 99
291 3300053117 Ga0500593_181685 Ga0500593_181685_235_534 99
292 3300053118 Ga0500594_0173443 Ga0500594_0173443_277_576 99
293 3300053130 Ga0500642_0009901 Ga0500642_0009901_1738_2037 99
294 3300053131 Ga0500652_145430 Ga0500652_145430_303_602 99
295 3300053151 Ga0500604_0206745 Ga0500604_0206745_75_374 99
296 3300053153 Ga0500616_0073152 Ga0500616_0073152_960_1259 99
297 3300053156 Ga0500622_0002771 Ga0500622_0002771_5458_5757 99
298 3300053730 Ga0500645_088783 Ga0500645_088783_83_382 99
299 3300054114 Ga0501084_0151360 Ga0501084_0151360_1051_1350 99
300 3300060353 Ga0501082_0282717 Ga0501082_0282717_232_531 99
301 3300060353 Ga0501082_0486754 Ga0501082_0486754_639_938 99
302 3300009553 Ga0105249_10134716 Ga0105249_101347165 101
303 3300025961 Ga0207712_10124942 Ga0207712_101249425 101
304 3300041443 Ga0451789_0831186 Ga0451789_0831186_30_338 102
305 3300005367 Ga0070667_100000088 Ga0070667_10000008858 103
306 3300005841 Ga0068863_100008669 Ga0068863_1000086693 103
307 3300005843 Ga0068860_100000220 Ga0068860_10000022036 103
308 3300006353 Ga0075370_10017297 Ga0075370_100172975 103
309 3300009553 Ga0105249_12035842 Ga0105249_120358421 103
310 3300012492 Ga0157335_1041120 Ga0157335_10411201 103
311 3300025903 Ga0207680_10151589 Ga0207680_101515893 103
312 3300025986 Ga0207658_10000064 Ga0207658_1000006459 103
313 3300026088 Ga0207641_10003421 Ga0207641_100034211 103
314 3300028381 Ga0268264_10000384 Ga0268264_100003842 103
315 3300041512 Ga0451853_0270632 Ga0451853_0270632_56_370 103
316 3300005333 Ga0070677_10000836 Ga0070677_100008365 104
317 3300005335 Ga0070666_10122703 Ga0070666_101227034 104
318 3300005335 Ga0070666_10271576 Ga0070666_102715761 104
319 3300005578 Ga0068854_100521673 Ga0068854_1005216732 104
320 3300013100 Ga0157373_10611096 Ga0157373_106110962 104
321 3300021377 Ga0213874_10113685 Ga0213874_101136852 104
322 3300025893 Ga0207682_10010516 Ga0207682_100105161 104
323 3300025981 Ga0207640_11123746 Ga0207640_111237462 104
324 3300026067 Ga0207678_11549583 Ga0207678_115495831 104
325 3300031548 Ga0307408_100002738 Ga0307408_10000273822 104
326 3300031731 Ga0307405_10503259 Ga0307405_105032592 104
327 3300031824 Ga0307413_10176896 Ga0307413_101768962 104
328 3300031901 Ga0307406_10011946 Ga0307406_100119466 104
329 3300031901 Ga0307406_11380337 Ga0307406_113803372 104
330 3300031903 Ga0307407_10726438 Ga0307407_107264382 104
331 3300031911 Ga0307412_10138587 Ga0307412_101385872 104
332 3300031995 Ga0307409_100372070 Ga0307409_1003720702 104
333 3300032002 Ga0307416_100095222 Ga0307416_1000952222 104
334 3300032002 Ga0307416_100351348 Ga0307416_1003513482 104
335 3300032002 Ga0307416_102386601 Ga0307416_1023866012 104
336 3300032004 Ga0307414_10499576 Ga0307414_104995762 104
337 3300032005 Ga0307411_10307164 Ga0307411_103071642 104
338 3300032005 Ga0307411_10612816 Ga0307411_106128162 104
339 3300032126 Ga0307415_101447163 Ga0307415_1014471631 104
340 3300035090 Ga0373949_0081538 Ga0373949_0081538_223_543 104
341 3300035725 Ga0373947_0503582 Ga0373947_0503582_58_384 104
342 3300039450 Ga0436363_1389226 Ga0436363_1389226_874_1200 104
343 3300041444 Ga0451790_07228 Ga0451790_07228_93_416 104
344 3300042000 Ga0439437_039413 Ga0439437_039413_108_422 104
345 3300042001 Ga0439441_113155 Ga0439441_113155_229_543 104
346 3300048914 Ga0496111_0494249 Ga0496111_0494249_74_394 104
347 3300048915 Ga0496112_0363032 Ga0496112_0363032_206_526 104
348 3300049523 Ga0501300_039689 Ga0501300_039689_76_390 104
349 3300049686 Ga0501257_001130 Ga0501257_001130_1612_1926 104
350 3300049776 Ga0501280_006929 Ga0501280_006929_321_635 104
351 3300053090 Ga0500646_0004531 Ga0500646_0004531_1663_1986 104
352 3300053139 Ga0500568_0035867 Ga0500568_0035867_733_1056 104
353 3300053140 Ga0500573_0000559 Ga0500573_0000559_12893_13207 104
354 3300053140 Ga0500573_0293206 Ga0500573_0293206_252_572 104
355 3300053151 Ga0500604_0000014 Ga0500604_0000014_5063_5386 104
356 3300053153 Ga0500616_0006579 Ga0500616_0006579_2063_2386 104
357 3300001915 JGI24741J21665_1001831 JGI24741J21665_10018313 105
358 3300001979 JGI24740J21852_10047162 JGI24740J21852_100471622 105
359 3300001989 JGI24739J22299_10021603 JGI24739J22299_100216034 105
360 3300001989 JGI24739J22299_10162692 JGI24739J22299_101626922 105
361 3300001990 JGI24737J22298_10008367 JGI24737J22298_100083673 105
362 3300001990 JGI24737J22298_10061502 JGI24737J22298_100615021 105
363 3300001990 JGI24737J22298_10257332 JGI24737J22298_102573322 105
364 3300001991 JGI24743J22301_10003761 JGI24743J22301_100037614 105
365 3300001991 JGI24743J22301_10051053 JGI24743J22301_100510532 105
366 3300002067 JGI24735J21928_10022221 JGI24735J21928_100222213 105
367 3300002067 JGI24735J21928_10024597 JGI24735J21928_100245972 105
368 3300002074 JGI24748J21848_1034612 JGI24748J21848_10346122 105
369 3300002075 JGI24738J21930_10011077 JGI24738J21930_100110772 105
370 3300002075 JGI24738J21930_10066840 JGI24738J21930_100668402 105
371 3300002077 JGI24744J21845_10000585 JGI24744J21845_1000058516 105
372 3300003308 Ga0006777J48905_1085348 Ga0006777J48905_10853482 105
373 3300003559 Ga0007427J51700_122592 Ga0007427J51700_1225922 105
374 3300003579 Ga0007429J51699_1030351 Ga0007429J51699_10303513 105
375 3300003762 Ga0055542_1007804 Ga0055542_10078043 105
376 3300003762 Ga0055542_1010957 Ga0055542_10109571 105
377 3300003763 Ga0055529_1015382 Ga0055529_10153822 105
378 3300004800 Ga0058861_11875447 Ga0058861_118754472 105
379 3300005293 Ga0065715_10785221 Ga0065715_107852212 105
380 3300005327 Ga0070658_10056264 Ga0070658_100562642 105
381 3300005327 Ga0070658_10119266 Ga0070658_101192663 105
382 3300005327 Ga0070658_10167844 Ga0070658_101678442 105
383 3300005327 Ga0070658_10284239 Ga0070658_102842391 105
384 3300005328 Ga0070676_10007059 Ga0070676_100070592 105
385 3300005328 Ga0070676_10499120 Ga0070676_104991201 105
386 3300005328 Ga0070676_10708739 Ga0070676_107087392 105
387 3300005329 Ga0070683_102354244 Ga0070683_1023542441 105
388 3300005331 Ga0070670_100186607 Ga0070670_1001866072 105
389 3300005331 Ga0070670_100245739 Ga0070670_1002457392 105
390 3300005334 Ga0068869_100000029 Ga0068869_10000002926 105
391 3300005336 Ga0070680_100237570 Ga0070680_1002375703 105
392 3300005336 Ga0070680_101006128 Ga0070680_1010061282 105
393 3300005337 Ga0070682_101205382 Ga0070682_1012053821 105
394 3300005338 Ga0068868_100000403 Ga0068868_1000004034 105
395 3300005338 Ga0068868_100000503 Ga0068868_10000050334 105
396 3300005338 Ga0068868_101210622 Ga0068868_1012106222 105
397 3300005339 Ga0070660_100059046 Ga0070660_1000590464 105
398 3300005339 Ga0070660_100071753 Ga0070660_1000717531 105
399 3300005339 Ga0070660_100124724 Ga0070660_1001247243 105
400 3300005339 Ga0070660_100128492 Ga0070660_1001284923 105
401 3300005339 Ga0070660_100254934 Ga0070660_1002549343 105
402 3300005339 Ga0070660_100649332 Ga0070660_1006493322 105
403 3300005339 Ga0070660_100837217 Ga0070660_1008372172 105
404 3300005339 Ga0070660_101942254 Ga0070660_1019422541 105
405 3300005344 Ga0070661_100022453 Ga0070661_1000224535 105
406 3300005344 Ga0070661_100262903 Ga0070661_1002629032 105
407 3300005344 Ga0070661_100450718 Ga0070661_1004507182 105
408 3300005344 Ga0070661_100621413 Ga0070661_1006214132 105
409 3300005344 Ga0070661_100899826 Ga0070661_1008998261 105
410 3300005345 Ga0070692_10089416 Ga0070692_100894162 105
411 3300005345 Ga0070692_10947100 Ga0070692_109471002 105
412 3300005347 Ga0070668_100236624 Ga0070668_1002366242 105
413 3300005347 Ga0070668_101013444 Ga0070668_1010134441 105
414 3300005353 Ga0070669_100640431 Ga0070669_1006404312 105
415 3300005353 Ga0070669_101746244 Ga0070669_1017462441 105
416 3300005354 Ga0070675_100037136 Ga0070675_1000371367 105
417 3300005354 Ga0070675_100106783 Ga0070675_1001067833 105
418 3300005354 Ga0070675_101170349 Ga0070675_1011703492 105
419 3300005355 Ga0070671_100158554 Ga0070671_1001585543 105
420 3300005356 Ga0070674_100210736 Ga0070674_1002107363 105
421 3300005356 Ga0070674_100683528 Ga0070674_1006835281 105
422 3300005364 Ga0070673_100000022 Ga0070673_10000002295 105
423 3300005364 Ga0070673_100115677 Ga0070673_1001156772 105
424 3300005364 Ga0070673_100297730 Ga0070673_1002977301 105
425 3300005366 Ga0070659_100000159 Ga0070659_10000015937 105
426 3300005366 Ga0070659_100128898 Ga0070659_1001288982 105
427 3300005367 Ga0070667_100363216 Ga0070667_1003632162 105
428 3300005367 Ga0070667_100825038 Ga0070667_1008250382 105
429 3300005438 Ga0070701_10602518 Ga0070701_106025181 105
430 3300005455 Ga0070663_100033947 Ga0070663_1000339475 105
431 3300005455 Ga0070663_100239516 Ga0070663_1002395162 105
432 3300005455 Ga0070663_100644238 Ga0070663_1006442382 105
433 3300005456 Ga0070678_100144850 Ga0070678_1001448502 105
434 3300005457 Ga0070662_100081689 Ga0070662_1000816893 105
435 3300005457 Ga0070662_100377979 Ga0070662_1003779792 105
436 3300005458 Ga0070681_10760507 Ga0070681_107605072 105
437 3300005459 Ga0068867_100000023 Ga0068867_1000000233 105
438 3300005459 Ga0068867_100949561 Ga0068867_1009495612 105
439 3300005466 Ga0070685_10752713 Ga0070685_107527132 105
440 3300005530 Ga0070679_100583247 Ga0070679_1005832472 105
441 3300005530 Ga0070679_100981786 Ga0070679_1009817862 105
442 3300005535 Ga0070684_100313085 Ga0070684_1003130852 105
443 3300005535 Ga0070684_102339051 Ga0070684_1023390511 105
444 3300005539 Ga0068853_100042530 Ga0068853_1000425303 105
445 3300005539 Ga0068853_100739625 Ga0068853_1007396252 105
446 3300005543 Ga0070672_100093680 Ga0070672_1000936803 105
447 3300005543 Ga0070672_100104389 Ga0070672_1001043892 105
448 3300005544 Ga0070686_100061295 Ga0070686_1000612952 105
449 3300005546 Ga0070696_100927593 Ga0070696_1009275932 105
450 3300005548 Ga0070665_100000109 Ga0070665_1000001093 105
451 3300005548 Ga0070665_100130384 Ga0070665_1001303844 105
452 3300005548 Ga0070665_100600547 Ga0070665_1006005471 105
453 3300005563 Ga0068855_100119921 Ga0068855_1001199215 105
454 3300005563 Ga0068855_100553074 Ga0068855_1005530742 105
455 3300005563 Ga0068855_101312712 Ga0068855_1013127122 105
456 3300005564 Ga0070664_100738428 Ga0070664_1007384282 105
457 3300005564 Ga0070664_100981552 Ga0070664_1009815522 105
458 3300005577 Ga0068857_100057006 Ga0068857_1000570065 105
459 3300005577 Ga0068857_101362326 Ga0068857_1013623262 105
460 3300005578 Ga0068854_100008814 Ga0068854_1000088141 105
461 3300005578 Ga0068854_100632751 Ga0068854_1006327512 105
462 3300005578 Ga0068854_100706577 Ga0068854_1007065772 105
463 3300005614 Ga0068856_100233074 Ga0068856_1002330742 105
464 3300005615 Ga0070702_101650565 Ga0070702_1016505651 105
465 3300005616 Ga0068852_100026154 Ga0068852_1000261546 105
466 3300005616 Ga0068852_100536878 Ga0068852_1005368782 105
467 3300005616 Ga0068852_101290518 Ga0068852_1012905182 105
468 3300005616 Ga0068852_102612631 Ga0068852_1026126312 105
469 3300005617 Ga0068859_100742691 Ga0068859_1007426912 105
470 3300005718 Ga0068866_10180122 Ga0068866_101801222 105
471 3300005718 Ga0068866_10704375 Ga0068866_107043752 105
472 3300005719 Ga0068861_100388819 Ga0068861_1003888192 105
473 3300005834 Ga0068851_10119311 Ga0068851_101193112 105
474 3300005841 Ga0068863_100008320 Ga0068863_1000083204 105
475 3300005842 Ga0068858_101523126 Ga0068858_1015231262 105
476 3300005843 Ga0068860_100024823 Ga0068860_10002482312 105
477 3300006186 Ga0075369_10109815 Ga0075369_101098153 105
478 3300006195 Ga0075366_10035079 Ga0075366_100350792 105
479 3300006195 Ga0075366_10070440 Ga0075366_100704403 105
480 3300006237 Ga0097621_100233974 Ga0097621_1002339743 105
481 3300006237 Ga0097621_101324222 Ga0097621_1013242222 105
482 3300006358 Ga0068871_100067789 Ga0068871_1000677894 105
483 3300006871 Ga0075434_100097402 Ga0075434_1000974025 105
484 3300006931 Ga0097620_100742697 Ga0097620_1007426972 105
485 3300009093 Ga0105240_10058360 Ga0105240_100583606 105
486 3300009098 Ga0105245_10075417 Ga0105245_100754171 105
487 3300009098 Ga0105245_10076170 Ga0105245_100761702 105
488 3300009098 Ga0105245_12340185 Ga0105245_123401852 105
489 3300009148 Ga0105243_10000156 Ga0105243_100001566 105
490 3300009148 Ga0105243_10184017 Ga0105243_101840172 105
491 3300009148 Ga0105243_10735582 Ga0105243_107355822 105
492 3300009148 Ga0105243_11981878 Ga0105243_119818782 105
493 3300009174 Ga0105241_10004308 Ga0105241_100043082 105
494 3300009174 Ga0105241_10185999 Ga0105241_101859992 105
495 3300009176 Ga0105242_10048043 Ga0105242_100480432 105
496 3300009176 Ga0105242_10894592 Ga0105242_108945922 105
497 3300009177 Ga0105248_10033419 Ga0105248_100334196 105
498 3300009177 Ga0105248_11425728 Ga0105248_114257281 105
499 3300009545 Ga0105237_10398494 Ga0105237_103984942 105
500 3300009545 Ga0105237_10482230 Ga0105237_104822302 105
501 3300009551 Ga0105238_10215885 Ga0105238_102158852 105
502 3300009551 Ga0105238_10726602 Ga0105238_107266022 105
503 3300009551 Ga0105238_11905866 Ga0105238_119058662 105
504 3300009551 Ga0105238_12224259 Ga0105238_122242592 105
505 3300009553 Ga0105249_11161671 Ga0105249_111616712 105
506 3300010375 Ga0105239_10328506 Ga0105239_103285063 105
507 3300010375 Ga0105239_10752756 Ga0105239_107527562 105
508 3300011119 Ga0105246_10144814 Ga0105246_101448144 105
509 3300011119 Ga0105246_10155689 Ga0105246_101556893 105
510 3300011119 Ga0105246_10568502 Ga0105246_105685022 105
511 3300012513 Ga0157326_1010864 Ga0157326_10108642 105
512 3300013100 Ga0157373_10170122 Ga0157373_101701222 105
513 3300013100 Ga0157373_11142036 Ga0157373_111420362 105
514 3300013102 Ga0157371_10059539 Ga0157371_100595392 105
515 3300013104 Ga0157370_10378633 Ga0157370_103786332 105
516 3300013104 Ga0157370_10758478 Ga0157370_107584781 105
517 3300013105 Ga0157369_10291945 Ga0157369_102919452 105
518 3300013296 Ga0157374_10101300 Ga0157374_101013004 105
519 3300013296 Ga0157374_12776130 Ga0157374_127761301 105
520 3300013297 Ga0157378_10000504 Ga0157378_1000050429 105
521 3300013297 Ga0157378_10951377 Ga0157378_109513772 105
522 3300013297 Ga0157378_11681631 Ga0157378_116816311 105
523 3300013306 Ga0163162_13247100 Ga0163162_132471001 105
524 3300013307 Ga0157372_10606539 Ga0157372_106065392 105
525 3300013307 Ga0157372_10694011 Ga0157372_106940112 105
526 3300013307 Ga0157372_13318950 Ga0157372_133189502 105
527 3300013307 Ga0157372_13430144 Ga0157372_134301442 105
528 3300013308 Ga0157375_10033608 Ga0157375_100336085 105
529 3300013308 Ga0157375_10940385 Ga0157375_109403852 105
530 3300013308 Ga0157375_11735285 Ga0157375_117352852 105
531 3300013308 Ga0157375_12635005 Ga0157375_126350052 105
532 3300013308 Ga0157375_12972468 Ga0157375_129724681 105
533 3300014745 Ga0157377_10060702 Ga0157377_100607023 105
534 3300014968 Ga0157379_11641516 Ga0157379_116415162 105
535 3300014969 Ga0157376_10000092 Ga0157376_1000009260 105
536 3300014969 Ga0157376_11091037 Ga0157376_110910372 105
537 3300014969 Ga0157376_11798598 Ga0157376_117985982 105
538 3300017792 Ga0163161_10040537 Ga0163161_100405372 105
539 3300017792 Ga0163161_11522123 Ga0163161_115221231 105
540 3300020075 Ga0206349_1044138 Ga0206349_10441382 105
541 3300020077 Ga0206351_10035987 Ga0206351_100359872 105
542 3300020080 Ga0206350_10412050 Ga0206350_104120502 105
543 3300020081 Ga0206354_10307013 Ga0206354_103070132 105
544 3300020081 Ga0206354_10821255 Ga0206354_108212551 105
545 3300021384 Ga0213876_10063901 Ga0213876_100639012 105
546 3300025253 Ga0209677_111507 Ga0209677_1115072 105
547 3300025254 Ga0209148_1000059 Ga0209148_1000059346 105
548 3300025254 Ga0209148_1003717 Ga0209148_10037175 105
549 3300025272 Ga0209455_1005324 Ga0209455_10053244 105
550 3300025315 Ga0207697_10454228 Ga0207697_104542282 105
551 3300025893 Ga0207682_10233372 Ga0207682_102333722 105
552 3300025899 Ga0207642_10015224 Ga0207642_100152245 105
553 3300025901 Ga0207688_10079487 Ga0207688_100794872 105
554 3300025901 Ga0207688_10118686 Ga0207688_101186862 105
555 3300025901 Ga0207688_10249972 Ga0207688_102499721 105
556 3300025904 Ga0207647_10043865 Ga0207647_100438653 105
557 3300025907 Ga0207645_10036219 Ga0207645_100362194 105
558 3300025907 Ga0207645_11094021 Ga0207645_110940212 105
559 3300025908 Ga0207643_10425697 Ga0207643_104256972 105
560 3300025909 Ga0207705_10000243 Ga0207705_1000024333 105
561 3300025909 Ga0207705_10002954 Ga0207705_100029546 105
562 3300025911 Ga0207654_10000810 Ga0207654_1000081020 105
563 3300025911 Ga0207654_10101008 Ga0207654_101010082 105
564 3300025912 Ga0207707_11201271 Ga0207707_112012712 105
565 3300025913 Ga0207695_10075629 Ga0207695_100756293 105
566 3300025914 Ga0207671_10253685 Ga0207671_102536852 105
567 3300025917 Ga0207660_10202587 Ga0207660_102025872 105
568 3300025917 Ga0207660_11558346 Ga0207660_115583462 105
569 3300025919 Ga0207657_10069965 Ga0207657_100699654 105
570 3300025919 Ga0207657_10174101 Ga0207657_101741012 105
571 3300025919 Ga0207657_10257258 Ga0207657_102572583 105
572 3300025919 Ga0207657_11275708 Ga0207657_112757081 105
573 3300025920 Ga0207649_10300303 Ga0207649_103003032 105
574 3300025920 Ga0207649_10307380 Ga0207649_103073802 105
575 3300025920 Ga0207649_10709169 Ga0207649_107091692 105
576 3300025921 Ga0207652_10819732 Ga0207652_108197322 105
577 3300025924 Ga0207694_10115742 Ga0207694_101157423 105
578 3300025924 Ga0207694_10628194 Ga0207694_106281942 105
579 3300025925 Ga0207650_10657886 Ga0207650_106578862 105
580 3300025926 Ga0207659_10034481 Ga0207659_100344813 105
581 3300025926 Ga0207659_10210085 Ga0207659_102100852 105
582 3300025926 Ga0207659_10231268 Ga0207659_102312683 105
583 3300025927 Ga0207687_10024648 Ga0207687_100246482 105
584 3300025927 Ga0207687_10049506 Ga0207687_100495066 105
585 3300025927 Ga0207687_10642981 Ga0207687_106429812 105
586 3300025927 Ga0207687_11323960 Ga0207687_113239601 105
587 3300025931 Ga0207644_10374526 Ga0207644_103745262 105
588 3300025931 Ga0207644_10597046 Ga0207644_105970462 105
589 3300025932 Ga0207690_10000177 Ga0207690_1000017734 105
590 3300025932 Ga0207690_10068111 Ga0207690_100681113 105
591 3300025932 Ga0207690_10380848 Ga0207690_103808482 105
592 3300025933 Ga0207706_10082619 Ga0207706_100826192 105
593 3300025933 Ga0207706_10112980 Ga0207706_101129803 105
594 3300025933 Ga0207706_10195976 Ga0207706_101959762 105
595 3300025934 Ga0207686_10006822 Ga0207686_100068226 105
596 3300025934 Ga0207686_10284439 Ga0207686_102844392 105
597 3300025935 Ga0207709_10000114 Ga0207709_1000011413 105
598 3300025935 Ga0207709_11055386 Ga0207709_110553862 105
599 3300025935 Ga0207709_11566292 Ga0207709_115662922 105
600 3300025936 Ga0207670_10346826 Ga0207670_103468262 105
601 3300025937 Ga0207669_10011850 Ga0207669_100118505 105
602 3300025938 Ga0207704_10000008 Ga0207704_10000008129 105
603 3300025940 Ga0207691_10021000 Ga0207691_100210005 105
604 3300025940 Ga0207691_10355035 Ga0207691_103550352 105
605 3300025941 Ga0207711_10059567 Ga0207711_100595673 105
606 3300025942 Ga0207689_10000701 Ga0207689_1000070128 105
607 3300025944 Ga0207661_10692144 Ga0207661_106921442 105
608 3300025944 Ga0207661_11242235 Ga0207661_112422352 105
609 3300025944 Ga0207661_11257131 Ga0207661_112571312 105
610 3300025945 Ga0207679_11518547 Ga0207679_115185472 105
611 3300025949 Ga0207667_10000029 Ga0207667_10000029336 105
612 3300025949 Ga0207667_10002977 Ga0207667_1000297718 105
613 3300025960 Ga0207651_10000008 Ga0207651_1000000895 105
614 3300025960 Ga0207651_11133514 Ga0207651_111335142 105
615 3300025961 Ga0207712_10025347 Ga0207712_100253476 105
616 3300025961 Ga0207712_10112962 Ga0207712_101129625 105
617 3300025972 Ga0207668_10139283 Ga0207668_101392833 105
618 3300025972 Ga0207668_10462857 Ga0207668_104628572 105
619 3300025981 Ga0207640_10007440 Ga0207640_100074409 105
620 3300025981 Ga0207640_10876091 Ga0207640_108760912 105
621 3300025986 Ga0207658_10151037 Ga0207658_101510372 105
622 3300026023 Ga0207677_10000091 Ga0207677_1000009176 105
623 3300026023 Ga0207677_10000280 Ga0207677_1000028020 105
624 3300026023 Ga0207677_10983091 Ga0207677_109830912 105
625 3300026041 Ga0207639_10046869 Ga0207639_100468693 105
626 3300026067 Ga0207678_10063824 Ga0207678_100638242 105
627 3300026078 Ga0207702_10005062 Ga0207702_100050622 105
628 3300026078 Ga0207702_10144576 Ga0207702_101445762 105
629 3300026078 Ga0207702_10546079 Ga0207702_105460792 105
630 3300026078 Ga0207702_10944196 Ga0207702_109441962 105
631 3300026088 Ga0207641_10019951 Ga0207641_100199514 105
632 3300026089 Ga0207648_10000009 Ga0207648_1000000995 105
633 3300026089 Ga0207648_10562231 Ga0207648_105622312 105
634 3300026116 Ga0207674_10214218 Ga0207674_102142183 105
635 3300026116 Ga0207674_11323738 Ga0207674_113237382 105
636 3300026116 Ga0207674_11454714 Ga0207674_114547141 105
637 3300026118 Ga0207675_100402582 Ga0207675_1004025822 105
638 3300026118 Ga0207675_102632175 Ga0207675_1026321752 105
639 3300026121 Ga0207683_10006500 Ga0207683_100065003 105
640 3300026121 Ga0207683_10366205 Ga0207683_103662052 105
641 3300026142 Ga0207698_10002773 Ga0207698_1000277310 105
642 3300026142 Ga0207698_10314913 Ga0207698_103149132 105
643 3300026142 Ga0207698_10717229 Ga0207698_107172292 105
644 3300028379 Ga0268266_10000015 Ga0268266_10000015617 105
645 3300028379 Ga0268266_10000560 Ga0268266_100005606 105
646 3300028379 Ga0268266_10530941 Ga0268266_105309412 105
647 3300028379 Ga0268266_11633475 Ga0268266_116334752 105
648 3300028381 Ga0268264_10049366 Ga0268264_100493665 105
649 3300028786 Ga0307517_10068004 Ga0307517_100680044 105
650 3300031456 Ga0307513_10008605 Ga0307513_100086058 105
651 3300031616 Ga0307508_10084747 Ga0307508_100847475 105
652 3300031911 Ga0307412_10730659 Ga0307412_107306592 105
653 3300032002 Ga0307416_101392196 Ga0307416_1013921962 105
654 3300032005 Ga0307411_11508128 Ga0307411_115081281 105
655 3300033180 Ga0307510_10131444 Ga0307510_101314442 105
656 3300037418 Ga0395900_0577370 Ga0395900_0577370_124_441 105
657 3300037418 Ga0395900_1501025 Ga0395900_1501025_237_560 105
658 3300037471 Ga0395905_0118793 Ga0395905_0118793_243_560 105
659 3300037471 Ga0395905_0413873 Ga0395905_0413873_285_602 105
660 3300037471 Ga0395905_1716157 Ga0395905_1716157_122_439 105
661 3300038443 Ga0395901_0461263 Ga0395901_0461263_301_618 105
662 3300038443 Ga0395901_0635061 Ga0395901_0635061_704_1021 105
663 3300038443 Ga0395901_1180469 Ga0395901_1180469_353_670 105
664 3300038443 Ga0395901_1243918 Ga0395901_1243918_68_385 105
665 3300039437 Ga0436365_0484870 Ga0436365_0484870_210_539 105
666 3300039437 Ga0436365_0968973 Ga0436365_0968973_60_383 105
667 3300041446 Ga0451794_28272 Ga0451794_28272_122_445 105
668 3300041452 Ga0451793_0030520 Ga0451793_0030520_200_526 105
669 3300041456 Ga0451795_0403850 Ga0451795_0403850_113_436 105
670 3300041458 Ga0451798_0890559 Ga0451798_0890559_131_457 105
671 3300041459 Ga0451800_0720288 Ga0451800_0720288_102_428 105
672 3300041460 Ga0451802_0399788 Ga0451802_0399788_153_479 105
673 3300041486 Ga0451807_0501283 Ga0451807_0501283_54_371 105
674 3300041498 Ga0451841_1431138 Ga0451841_1431138_92_415 105
675 3300041512 Ga0451853_3598434 Ga0451853_3598434_147_473 105
676 3300042005 Ga0439448_0262567 Ga0439448_0262567_215_532 105
677 3300042012 Ga0439455_0132446 Ga0439455_0132446_52_369 105
678 3300042157 Ga0439458_0050761 Ga0439458_0050761_244_561 105
679 3300044656 Ga0466969_0073651 Ga0466969_0073651_1187_1504 105
680 3300044684 Ga0466966_0432360 Ga0466966_0432360_242_559 105
681 3300044693 Ga0466961_0067895 Ga0466961_0067895_1081_1398 105
682 3300044694 Ga0466963_0552115 Ga0466963_0552115_178_495 105
683 3300044735 Ga0466968_0010999 Ga0466968_0010999_2887_3204 105
684 3300044765 Ga0466970_0183319 Ga0466970_0183319_267_584 105
685 3300044765 Ga0466970_0454594 Ga0466970_0454594_405_722 105
686 3300044842 Ga0466957_0920067 Ga0466957_0920067_258_575 105
687 3300045049 Ga0466959_0097616 Ga0466959_0097616_1715_2032 105
688 3300045836 Ga0466958_0155298 Ga0466958_0155298_1102_1419 105
689 3300045976 Ga0466967_0416898 Ga0466967_0416898_845_1162 105
690 3300046452 Ga0495617_072304 Ga0495617_072304_507_830 105
691 3300046460 Ga0495638_0175804 Ga0495638_0175804_117_440 105
692 3300046471 Ga0495650_0001317 Ga0495650_0001317_21100_21423 105
693 3300046491 Ga0495584_0733574 Ga0495584_0733574_65_388 105
694 3300046500 Ga0495596_0039835 Ga0495596_0039835_477_800 105
695 3300046501 Ga0495607_0075376 Ga0495607_0075376_1372_1695 105
696 3300046506 Ga0495583_0055775 Ga0495583_0055775_579_902 105
697 3300046507 Ga0495606_0026341 Ga0495606_0026341_1434_1757 105
698 3300046513 Ga0495616_0043729 Ga0495616_0043729_1145_1468 105
699 3300046513 Ga0495616_0080148 Ga0495616_0080148_366_692 105
700 3300046515 Ga0495620_0212922 Ga0495620_0212922_285_611 105
701 3300046518 Ga0495631_0272042 Ga0495631_0272042_388_711 105
702 3300046519 Ga0495632_0111724 Ga0495632_0111724_648_971 105
703 3300046520 Ga0495637_0017513 Ga0495637_0017513_2001_2324 105
704 3300046522 Ga0495643_0423485 Ga0495643_0423485_139_462 105
705 3300046524 Ga0495648_0007227 Ga0495648_0007227_4910_5233 105
706 3300046525 Ga0495663_0006927 Ga0495663_0006927_675_998 105
707 3300046525 Ga0495663_0398762 Ga0495663_0398762_116_439 105
708 3300046530 Ga0495654_0212746 Ga0495654_0212746_478_801 105
709 3300046536 Ga0495587_0028999 Ga0495587_0028999_1251_1574 105
710 3300046538 Ga0495609_0162383 Ga0495609_0162383_579_902 105
711 3300046542 Ga0495597_0032717 Ga0495597_0032717_534_857 105
712 3300046542 Ga0495597_0337585 Ga0495597_0337585_200_523 105
713 3300046557 Ga0495622_0017900 Ga0495622_0017900_700_1023 105
714 3300046558 Ga0495633_0052492 Ga0495633_0052492_1152_1475 105
715 3300046616 Ga0495668_0000016 Ga0495668_0000016_140177_140500 105
716 3300046648 Ga0495611_0189735 Ga0495611_0189735_499_822 105
717 3300046660 Ga0495625_0018235 Ga0495625_0018235_3600_3923 105
718 3300046665 Ga0495661_0299532 Ga0495661_0299532_143_466 105
719 3300046684 Ga0495669_0001189 Ga0495669_0001189_5744_6067 105
720 3300046691 Ga0495670_0090056 Ga0495670_0090056_1011_1334 105
721 3300046692 Ga0495671_0615362 Ga0495671_0615362_33_356 105
722 3300046694 Ga0495649_0128062 Ga0495649_0128062_768_1091 105
723 3300046809 Ga0495600_0009263 Ga0495600_0009263_2103_2426 105
724 3300046810 Ga0495660_0071205 Ga0495660_0071205_459_782 105
725 3300047318 Ga0495636_0137389 Ga0495636_0137389_258_581 105
726 3300047323 Ga0495683_0123059 Ga0495683_0123059_594_917 105
727 3300047443 Ga0495687_037411 Ga0495687_037411_1209_1532 105
728 3300047443 Ga0495687_037412 Ga0495687_037412_631_954 105
729 3300047446 Ga0495679_051402 Ga0495679_051402_239_562 105
730 3300047470 Ga0495681_0032741 Ga0495681_0032741_1523_1846 105
731 3300047472 Ga0495686_0144866 Ga0495686_0144866_773_1096 105
732 3300048090 Ga0495615_0096358 Ga0495615_0096358_22_351 105
733 3300048090 Ga0495615_0096878 Ga0495615_0096878_214_537 105
734 3300048904 Ga0496101_0833573 Ga0496101_0833573_256_579 105
735 3300048905 Ga0496102_0003155 Ga0496102_0003155_3945_4268 105
736 3300048905 Ga0496102_0664938 Ga0496102_0664938_182_499 105
737 3300048906 Ga0496103_0000903 Ga0496103_0000903_3758_4081 105
738 3300048908 Ga0496105_0014636 Ga0496105_0014636_5025_5348 105
739 3300048910 Ga0496107_0099103 Ga0496107_0099103_130_453 105
740 3300048912 Ga0496109_0367857 Ga0496109_0367857_454_777 105
741 3300048914 Ga0496111_0137029 Ga0496111_0137029_321_644 105
742 3300048916 Ga0496113_0579968 Ga0496113_0579968_238_561 105
743 3300048917 Ga0496114_0060604 Ga0496114_0060604_2060_2383 105
744 3300048918 Ga0496115_0002506 Ga0496115_0002506_3903_4226 105
745 3300048919 Ga0496116_0009806 Ga0496116_0009806_3895_4218 105
746 3300048920 Ga0496117_0000324 Ga0496117_0000324_79632_79955 105
747 3300048921 Ga0496118_0002151 Ga0496118_0002151_23317_23640 105
748 3300048921 Ga0496118_0523507 Ga0496118_0523507_39_356 105
749 3300048922 Ga0496119_0019706 Ga0496119_0019706_781_1104 105
750 3300048923 Ga0496120_0013189 Ga0496120_0013189_5039_5362 105
751 3300048924 Ga0496121_0002794 Ga0496121_0002794_21616_21939 105
752 3300048925 Ga0496122_0020856 Ga0496122_0020856_2455_2778 105
753 3300048925 Ga0496122_0535551 Ga0496122_0535551_34_360 105
754 3300048926 Ga0496123_0017188 Ga0496123_0017188_3598_3921 105
755 3300048927 Ga0496124_0000351 Ga0496124_0000351_79722_80045 105
756 3300048928 Ga0496125_0011965 Ga0496125_0011965_4502_4825 105
757 3300048929 Ga0496126_0002155 Ga0496126_0002155_23149_23472 105
758 3300049128 Ga0501308_007330 Ga0501308_007330_657_974 105
759 3300049161 Ga0501305_055965 Ga0501305_055965_214_531 105
760 3300049162 Ga0501307_017543 Ga0501307_017543_442_765 105
761 3300049552 Ga0501336_018314 Ga0501336_018314_48_365 105
762 3300049571 Ga0501034_1455194 Ga0501034_1455194_115_438 105
763 3300049572 Ga0501036_0984885 Ga0501036_0984885_284_607 105
764 3300049585 Ga0501069_0088669 Ga0501069_0088669_986_1309 105
765 3300049586 Ga0501070_0014243 Ga0501070_0014243_2225_2548 105
766 3300049589 Ga0501073_0484052 Ga0501073_0484052_226_546 105
767 3300049822 Ga0501035_1146408 Ga0501035_1146408_94_411 105
768 3300050493 nmdc:mga0k408_114332_c1 nmdc:mga0k408_114332_c1_326_649 105
769 3300050512 nmdc:mga0n895_592416_c1 nmdc:mga0n895_592416_c1_285_611 105
770 3300050514 nmdc:mga08x19_1033595_c1 nmdc:mga08x19_1033595_c1_49_378 105
771 3300050516 nmdc:mga0sz30_74009_c1 nmdc:mga0sz30_74009_c1_477_800 105
772 3300053079 Ga0500610_0000216 Ga0500610_0000216_15688_16011 105
773 3300053083 Ga0495655_0101522 Ga0495655_0101522_171_494 105
774 3300053087 Ga0500643_109253 Ga0500643_109253_170_493 105
775 3300053092 Ga0500583_0399269 Ga0500583_0399269_287_610 105
776 3300053096 Ga0500641_0169432 Ga0500641_0169432_48_374 105
777 3300053119 Ga0500595_018979 Ga0500595_018979_1850_2173 105
778 3300053130 Ga0500642_0001933 Ga0500642_0001933_3806_4129 105
779 3300053177 Ga0500636_0152791 Ga0500636_0152791_124_447 105
780 3300053730 Ga0500645_000002 Ga0500645_000002_205206_205529 105
781 3300053739 Ga0500587_034778 Ga0500587_034778_304_633 105
782 3300059477 Ga0587084_007588 Ga0587084_007588_810_1127 105
783 3300059490 Ga0587066_007807 Ga0587066_007807_336_653 105
784 3300059491 Ga0587070_008024 Ga0587070_008024_808_1125 105
785 3300059491 Ga0587070_065000 Ga0587070_065000_169_492 105
786 3300059492 Ga0587073_0021745 Ga0587073_0021745_213_530 105
787 3300059493 Ga0587077_003076 Ga0587077_003076_829_1146 105
788 3300059503 Ga0587080_008678 Ga0587080_008678_258_575 105
789 3300059504 Ga0587082_014514 Ga0587082_014514_270_587 105
790 3300059505 Ga0587083_0020431 Ga0587083_0020431_217_534 105
791 3300059508 Ga0587088_010422 Ga0587088_010422_602_919 105
792 3300059510 Ga0587090_017496 Ga0587090_017496_451_768 105
793 3300059510 Ga0587090_084782 Ga0587090_084782_166_495 105
794 3300059511 Ga0587091_001650 Ga0587091_001650_933_1250 105
795 3300059513 Ga0587094_012259 Ga0587094_012259_209_526 105
796 3300059605 Ga0587106_020463 Ga0587106_020463_467_784 105
797 3300059609 Ga0587131_020051 Ga0587131_020051_82_405 105
798 3300059623 Ga0587101_004327 Ga0587101_004327_937_1254 105
799 3300059626 Ga0587115_001498 Ga0587115_001498_340_663 105
800 3300059640 Ga0587067_006007 Ga0587067_006007_855_1172 105
801 3300059640 Ga0587067_017691 Ga0587067_017691_293_616 105
802 3300059641 Ga0587068_010651 Ga0587068_010651_827_1144 105
803 3300059642 Ga0587069_012706 Ga0587069_012706_264_581 105
804 3300059643 Ga0587072_016814 Ga0587072_016814_253_570 105
805 3300059643 Ga0587072_112905 Ga0587072_112905_263_586 105
806 3300059644 Ga0587075_012510 Ga0587075_012510_549_866 105
807 3300059645 Ga0587076_013991 Ga0587076_013991_224_541 105
808 3300059646 Ga0587078_006230 Ga0587078_006230_416_733 105
809 3300059647 Ga0587079_008799 Ga0587079_008799_551_868 105
810 3300059652 Ga0587107_051730 Ga0587107_051730_350_667 105
811 3300059654 Ga0587110_018389 Ga0587110_018389_96_419 105
812 3300060344 Ga0587071_013079 Ga0587071_013079_827_1144 105
813 3300060344 Ga0587071_055585 Ga0587071_055585_36_359 105
814 3300061719 Ga0466962_0424806 Ga0466962_0424806_113_430 105

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00276

Ribosomal_L23

Ribosomal protein L23

19

104

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
8cgd-assembly1.cif.gz_s clindamycin bound to the 50s subunit 0.9322 13 93
8cvm-assembly1.cif.gz_s cutibacterium acnes 50s ribosomal subunit with p-site trna and sarecycline bound in the local refined map 0.9229 14 101
6spb-assembly1.cif.gz_T pseudomonas aeruginosa 50s ribosome from a clinical isolate with a mutation in ul6 0.9181 12 100
6enj-assembly1.cif.gz_T polyproline-stalled ribosome in the presence of a+p site trna and elongation-factor p (ef-p) 0.9128 10 99
7m4z-assembly1.cif.gz_S a. baumannii ribosome-eravacycline complex: hpf-bound 70s 0.9069 13 98
ID Description Score Start End Superfamily
6hmaR00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.8941 14 100 3.30.70.330
6fu8C00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.877 13 99 3.30.70.330
4garT00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.8704 11 99 3.30.70.330
6hmaR00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.8572 14 100 3.30.70.330
af_P61845_1_86_3.30.70.330 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.8517 16 100 3.30.70.330
ID Description Score Start End GO Terms
AF-A0A356KYD9-F1-model_v4 Large ribosomal subunit protein uL23 0.953 14 100 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-Q3A6P5-F1-model_v4 Large ribosomal subunit protein uL23 (50S ribosomal protein L23) 0.9529 14 101 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A2E1VV25-F1-model_v4 Large ribosomal subunit protein uL23 0.9528 14 100 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A1F9D7K7-F1-model_v4 Large ribosomal subunit protein uL23 0.9511 14 101 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A0S7X6A9-F1-model_v4 Large ribosomal subunit protein uL23 0.9503 14 101 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904

Feature Viewer

pLDDT pTM Quality
79.35 0.67 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map