F481970
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 814 | 450 | 812 | 103 |
Family's Representative Sequence
| Representative Sequence | 3300005339|Ga0070660_101942254|Ga0070660_1019422541 |
| Length | 109 |
| Sequence | MAKAAKKQAATRVDVSHYDVVLAPHITEKSTLLSEQNAVVFKVARTASKPQIKAAVEALFNVSVTGVNTMNVKGKTKRWKGRPYTRSDVKKAVVTLADGQSIDITTGVA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 2 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 3 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 4 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 5 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 6 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 7 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 8 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 9 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 10 | 3300003308 | Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 11 | 3300003559 | Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_43 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 12 | 3300003579 | Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 13 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 14 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 15 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 16 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 17 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 24 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 26 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 28 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 30 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 40 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 50 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 51 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 53 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 55 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 57 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 62 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 64 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 65 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 66 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 68 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 69 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 70 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 71 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 72 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 73 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 74 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 75 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 76 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 77 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 79 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 80 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 81 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 82 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 83 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 84 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 85 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 86 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 88 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 89 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 90 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 91 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 93 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 94 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 106 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300012492 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 | Metagenome | Rhizosphere |
| 109 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 110 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 120 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 124 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 126 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 127 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 128 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 129 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 130 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 131 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 132 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 135 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 197 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 198 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 199 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 200 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 201 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 202 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 203 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 204 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 205 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 206 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 207 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 208 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 209 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 210 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 211 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 212 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 213 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 214 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 215 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 216 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 217 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 218 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 219 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 220 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 221 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 222 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 223 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 224 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 225 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 226 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 227 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 228 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 229 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 230 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 231 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 232 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 233 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 234 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 235 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 236 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 237 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 238 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 239 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 240 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 241 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 242 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 243 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 244 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 245 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 246 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 247 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 248 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 249 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 250 | 3300041444 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaT | Metatranscriptome | Rhizoplane |
| 251 | 3300041446 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaT | Metatranscriptome | Rhizoplane |
| 252 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 253 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 254 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 255 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 256 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 257 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 258 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 259 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 260 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 261 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 262 | 3300042000 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 | Metagenome | Rhizosphere |
| 263 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 264 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 265 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 266 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 267 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 268 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 269 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 270 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 271 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 272 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 273 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 274 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 275 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 276 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 277 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 278 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 279 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 280 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 329 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 330 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 331 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 332 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 333 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 334 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 335 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 336 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 337 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 338 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 339 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 340 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 341 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 342 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 343 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 344 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 345 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 346 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 347 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 348 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 349 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 350 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 351 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 352 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 353 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 354 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 355 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 356 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 357 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 358 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 360 | 3300049552 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 361 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 362 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 363 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 364 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 365 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 366 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 367 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 368 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 369 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 370 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 371 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 372 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 373 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 374 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 375 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 376 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 377 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 378 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 379 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 380 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 381 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 382 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 383 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 384 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 385 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 386 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 387 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 388 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 389 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 390 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 391 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 392 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 393 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 394 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 396 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 400 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 401 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 402 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 403 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 404 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 405 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 406 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 407 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 408 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 409 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 410 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 411 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 412 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 413 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 414 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 415 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 416 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 417 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 418 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 419 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 420 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 421 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 422 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 423 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 424 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 425 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 426 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 427 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 428 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 429 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 430 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 431 | 3300059513 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 432 | 3300059605 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 433 | 3300059609 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 227R_SD_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 434 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 435 | 3300059626 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 436 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 437 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 438 | 3300059642 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 439 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 440 | 3300059644 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 441 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 442 | 3300059646 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 443 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 444 | 3300059652 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 445 | 3300059654 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 148R_CW_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 446 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 447 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 448 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 449 | 8002060224 | Methylocystis sp. Sn-Cys | Isolate | Unclassified |
| 450 | 8054563764 | Acuticoccus kalidii M5D2P5 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.86 |
| Metatranscriptomes | 5.9 |
| Isolates | 0.25 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7.99 |
| Nodule | 0 |
| Rhizoplane | 5.04 |
| Rhizosphere | 82.56 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.42 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24741J21665_1001831 | 3300001915 | Bacteria | 5816 |
| 2 | JGI24740J21852_10047162 | 3300001979 | Bacteria | 1260 |
| 3 | JGI24739J22299_10021603 | 3300001989 | Bacteria | 2289 |
| 4 | JGI24739J22299_10162692 | 3300001989 | Bacteria | 658 |
| 5 | JGI24737J22298_10008367 | 3300001990 | Bacteria | 3467 |
| 6 | JGI24737J22298_10061502 | 3300001990 | Bacteria | 1129 |
| 7 | JGI24737J22298_10257332 | 3300001990 | Bacteria | 516 |
| 8 | JGI24743J22301_10003761 | 3300001991 | Bacteria | 2424 |
| 9 | JGI24743J22301_10051053 | 3300001991 | Bacteria | 843 |
| 10 | JGI24735J21928_10022221 | 3300002067 | Bacteria | 1933 |
| 11 | JGI24735J21928_10024597 | 3300002067 | Bacteria | 1820 |
| 12 | JGI24748J21848_1034612 | 3300002074 | Bacteria | 631 |
| 13 | JGI24738J21930_10011077 | 3300002075 | Bacteria | 1992 |
| 14 | JGI24738J21930_10066840 | 3300002075 | Bacteria | 742 |
| 15 | JGI24744J21845_10000585 | 3300002077 | Bacteria | 6547 |
| 16 | Ga0006777J48905_1085348 | 3300003308 | Bacteria | 746 |
| 17 | Ga0007427J51700_122592 | 3300003559 | Bacteria | 892 |
| 18 | Ga0007429J51699_1030351 | 3300003579 | Bacteria | 2885 |
| 19 | Ga0055542_1007804 | 3300003762 | Bacteria | 2138 |
| 20 | Ga0055542_1010957 | 3300003762 | Bacteria | 1632 |
| 21 | Ga0055529_1015382 | 3300003763 | Bacteria | 965 |
| 22 | Ga0058861_11875447 | 3300004800 | Bacteria | 642 |
| 23 | Ga0065715_10785221 | 3300005293 | Bacteria | 616 |
| 24 | Ga0070658_10056264 | 3300005327 | Bacteria | 3196 |
| 25 | Ga0070658_10119266 | 3300005327 | Bacteria | 2191 |
| 26 | Ga0070658_10167844 | 3300005327 | Bacteria | 1843 |
| 27 | Ga0070658_10284239 | 3300005327 | Bacteria | 1408 |
| 28 | Ga0070676_10007059 | 3300005328 | Bacteria | 6013 |
| 29 | Ga0070676_10497773 | 3300005328 | Bacteria | 865 |
| 30 | Ga0070676_10499120 | 3300005328 | Bacteria | 863 |
| 31 | Ga0070676_10708739 | 3300005328 | Bacteria | 736 |
| 32 | Ga0070683_102337481 | 3300005329 | Bacteria | 513 |
| 33 | Ga0070683_102354244 | 3300005329 | Bacteria | 511 |
| 34 | Ga0070690_100064067 | 3300005330 | Bacteria | 2373 |
| 35 | Ga0070670_100186607 | 3300005331 | Bacteria | 1800 |
| 36 | Ga0070670_100245739 | 3300005331 | Bacteria | 1558 |
| 37 | Ga0070670_100409570 | 3300005331 | Bacteria | 1198 |
| 38 | Ga0070670_100686642 | 3300005331 | Bacteria | 920 |
| 39 | Ga0070677_10000836 | 3300005333 | Bacteria | 10111 |
| 40 | Ga0068869_100000029 | 3300005334 | Bacteria | 61111 |
| 41 | Ga0068869_101021642 | 3300005334 | Bacteria | 721 |
| 42 | Ga0070666_10122703 | 3300005335 | Bacteria | 1802 |
| 43 | Ga0070666_10271576 | 3300005335 | Bacteria | 1203 |
| 44 | Ga0070666_11318960 | 3300005335 | Bacteria | 539 |
| 45 | Ga0070680_100004922 | 3300005336 | Bacteria | 10054 |
| 46 | Ga0070680_100237570 | 3300005336 | Bacteria | 1540 |
| 47 | Ga0070680_101006128 | 3300005336 | Bacteria | 720 |
| 48 | Ga0070682_101205382 | 3300005337 | Bacteria | 639 |
| 49 | Ga0070682_101232756 | 3300005337 | Bacteria | 633 |
| 50 | Ga0068868_100000403 | 3300005338 | Bacteria | 29340 |
| 51 | Ga0068868_100000503 | 3300005338 | Bacteria | 26082 |
| 52 | Ga0068868_101210622 | 3300005338 | Bacteria | 699 |
| 53 | Ga0070660_100059046 | 3300005339 | Bacteria | 2974 |
| 54 | Ga0070660_100071753 | 3300005339 | Bacteria | 2704 |
| 55 | Ga0070660_100124724 | 3300005339 | Bacteria | 2057 |
| 56 | Ga0070660_100128492 | 3300005339 | Bacteria | 2026 |
| 57 | Ga0070660_100254934 | 3300005339 | Bacteria | 1431 |
| 58 | Ga0070660_100649332 | 3300005339 | Bacteria | 884 |
| 59 | Ga0070660_100837217 | 3300005339 | Bacteria | 775 |
| 60 | Ga0070660_101942254 | 3300005339 | Bacteria | 502 |
| 61 | Ga0070689_100912641 | 3300005340 | Bacteria | 778 |
| 62 | Ga0070689_101301101 | 3300005340 | Bacteria | 655 |
| 63 | Ga0070687_100140311 | 3300005343 | Bacteria | 1407 |
| 64 | Ga0070661_100022453 | 3300005344 | Bacteria | 4518 |
| 65 | Ga0070661_100262903 | 3300005344 | Bacteria | 1334 |
| 66 | Ga0070661_100450718 | 3300005344 | Bacteria | 1024 |
| 67 | Ga0070661_100621413 | 3300005344 | Bacteria | 875 |
| 68 | Ga0070661_100899826 | 3300005344 | Bacteria | 730 |
| 69 | Ga0070692_10089416 | 3300005345 | Bacteria | 1671 |
| 70 | Ga0070692_10947100 | 3300005345 | Bacteria | 598 |
| 71 | Ga0070668_100236624 | 3300005347 | Bacteria | 1511 |
| 72 | Ga0070668_101013444 | 3300005347 | Bacteria | 747 |
| 73 | Ga0070668_101698707 | 3300005347 | Bacteria | 579 |
| 74 | Ga0070669_100640431 | 3300005353 | Bacteria | 894 |
| 75 | Ga0070669_101034119 | 3300005353 | Bacteria | 706 |
| 76 | Ga0070669_101746244 | 3300005353 | Bacteria | 543 |
| 77 | Ga0070675_100037136 | 3300005354 | Bacteria | 3966 |
| 78 | Ga0070675_100106783 | 3300005354 | Bacteria | 2363 |
| 79 | Ga0070675_100140583 | 3300005354 | Bacteria | 2063 |
| 80 | Ga0070675_101170349 | 3300005354 | Bacteria | 708 |
| 81 | Ga0070671_100158554 | 3300005355 | Bacteria | 1913 |
| 82 | Ga0070671_100494700 | 3300005355 | Bacteria | 1052 |
| 83 | Ga0070674_100210736 | 3300005356 | Bacteria | 1506 |
| 84 | Ga0070674_100369465 | 3300005356 | Bacteria | 1164 |
| 85 | Ga0070674_100683528 | 3300005356 | Bacteria | 876 |
| 86 | Ga0070673_100000022 | 3300005364 | Bacteria | 92156 |
| 87 | Ga0070673_100115677 | 3300005364 | Bacteria | 2230 |
| 88 | Ga0070673_100297730 | 3300005364 | Bacteria | 1419 |
| 89 | Ga0070688_100155629 | 3300005365 | Bacteria | 1566 |
| 90 | Ga0070688_101777838 | 3300005365 | Bacteria | 506 |
| 91 | Ga0070659_100000159 | 3300005366 | Bacteria | 51703 |
| 92 | Ga0070659_100128898 | 3300005366 | Bacteria | 2053 |
| 93 | Ga0070659_100892304 | 3300005366 | Bacteria | 777 |
| 94 | Ga0070667_100000088 | 3300005367 | Bacteria | 113956 |
| 95 | Ga0070667_100298344 | 3300005367 | Bacteria | 1451 |
| 96 | Ga0070667_100363216 | 3300005367 | Bacteria | 1313 |
| 97 | Ga0070667_100825038 | 3300005367 | Bacteria | 861 |
| 98 | Ga0070667_101089218 | 3300005367 | Bacteria | 747 |
| 99 | Ga0070709_10835980 | 3300005434 | Bacteria | 725 |
| 100 | Ga0070701_10380328 | 3300005438 | Bacteria | 890 |
| 101 | Ga0070701_10602518 | 3300005438 | Bacteria | 728 |
| 102 | Ga0070700_101326393 | 3300005441 | Bacteria | 606 |
| 103 | Ga0070694_101200225 | 3300005444 | Bacteria | 636 |
| 104 | Ga0070663_100033947 | 3300005455 | Bacteria | 3529 |
| 105 | Ga0070663_100239516 | 3300005455 | Bacteria | 1431 |
| 106 | Ga0070663_100644238 | 3300005455 | Bacteria | 895 |
| 107 | Ga0070678_100144850 | 3300005456 | Bacteria | 1906 |
| 108 | Ga0070662_100081689 | 3300005457 | Bacteria | 2408 |
| 109 | Ga0070662_100271769 | 3300005457 | Bacteria | 1369 |
| 110 | Ga0070662_100377979 | 3300005457 | Bacteria | 1166 |
| 111 | Ga0070681_10039142 | 3300005458 | Bacteria | 4753 |
| 112 | Ga0070681_10257591 | 3300005458 | Bacteria | 1657 |
| 113 | Ga0070681_10544016 | 3300005458 | Bacteria | 1075 |
| 114 | Ga0070681_10760507 | 3300005458 | Bacteria | 886 |
| 115 | Ga0068867_100000023 | 3300005459 | Bacteria | 92322 |
| 116 | Ga0068867_100305758 | 3300005459 | Bacteria | 1312 |
| 117 | Ga0068867_100949561 | 3300005459 | Bacteria | 777 |
| 118 | Ga0070685_10323103 | 3300005466 | Bacteria | 1047 |
| 119 | Ga0070685_10752713 | 3300005466 | Bacteria | 714 |
| 120 | Ga0070679_100040114 | 3300005530 | Bacteria | 4657 |
| 121 | Ga0070679_100583247 | 3300005530 | Bacteria | 1062 |
| 122 | Ga0070679_100981786 | 3300005530 | Bacteria | 788 |
| 123 | Ga0070679_101075760 | 3300005530 | Bacteria | 749 |
| 124 | Ga0070684_100313085 | 3300005535 | Bacteria | 1441 |
| 125 | Ga0070684_102339051 | 3300005535 | Bacteria | 504 |
| 126 | Ga0068853_100042530 | 3300005539 | Bacteria | 3885 |
| 127 | Ga0068853_100739625 | 3300005539 | Bacteria | 940 |
| 128 | Ga0070672_100093680 | 3300005543 | Bacteria | 2427 |
| 129 | Ga0070672_100104389 | 3300005543 | Bacteria | 2303 |
| 130 | Ga0070672_100294774 | 3300005543 | Bacteria | 1374 |
| 131 | Ga0070686_100061295 | 3300005544 | Bacteria | 2430 |
| 132 | Ga0070686_100177076 | 3300005544 | Bacteria | 1513 |
| 133 | Ga0070686_100945791 | 3300005544 | Bacteria | 704 |
| 134 | Ga0070686_100951489 | 3300005544 | Bacteria | 702 |
| 135 | Ga0070696_100927593 | 3300005546 | Bacteria | 724 |
| 136 | Ga0070693_100061798 | 3300005547 | Bacteria | 2179 |
| 137 | Ga0070665_100000109 | 3300005548 | Bacteria | 155026 |
| 138 | Ga0070665_100130384 | 3300005548 | Bacteria | 2516 |
| 139 | Ga0070665_100287765 | 3300005548 | Bacteria | 1645 |
| 140 | Ga0070665_100600547 | 3300005548 | Bacteria | 1113 |
| 141 | Ga0070704_101800498 | 3300005549 | Bacteria | 567 |
| 142 | Ga0068855_100119921 | 3300005563 | Bacteria | 3011 |
| 143 | Ga0068855_100553074 | 3300005563 | Bacteria | 1245 |
| 144 | Ga0068855_101312712 | 3300005563 | Bacteria | 748 |
| 145 | Ga0070664_100738428 | 3300005564 | Bacteria | 918 |
| 146 | Ga0070664_100981552 | 3300005564 | Bacteria | 794 |
| 147 | Ga0068857_100057006 | 3300005577 | Bacteria | 3467 |
| 148 | Ga0068857_101362326 | 3300005577 | Bacteria | 689 |
| 149 | Ga0068854_100008814 | 3300005578 | Bacteria | 6492 |
| 150 | Ga0068854_100521673 | 3300005578 | Bacteria | 1003 |
| 151 | Ga0068854_100632751 | 3300005578 | Bacteria | 917 |
| 152 | Ga0068854_100706577 | 3300005578 | Bacteria | 871 |
| 153 | Ga0068856_100233074 | 3300005614 | Bacteria | 1856 |
| 154 | Ga0070702_101650565 | 3300005615 | Bacteria | 532 |
| 155 | Ga0068852_100026154 | 3300005616 | Bacteria | 4739 |
| 156 | Ga0068852_100536878 | 3300005616 | Bacteria | 1168 |
| 157 | Ga0068852_100688555 | 3300005616 | Bacteria | 1032 |
| 158 | Ga0068852_101290518 | 3300005616 | Bacteria | 752 |
| 159 | Ga0068852_102612631 | 3300005616 | Bacteria | 524 |
| 160 | Ga0068859_100742691 | 3300005617 | Bacteria | 1070 |
| 161 | Ga0068864_100016814 | 3300005618 | Bacteria | 6095 |
| 162 | Ga0068864_101619112 | 3300005618 | Bacteria | 652 |
| 163 | Ga0068866_10180122 | 3300005718 | Bacteria | 1248 |
| 164 | Ga0068866_10316151 | 3300005718 | Bacteria | 980 |
| 165 | Ga0068866_10704375 | 3300005718 | Bacteria | 693 |
| 166 | Ga0068861_100388819 | 3300005719 | Bacteria | 1235 |
| 167 | Ga0068861_100573424 | 3300005719 | Bacteria | 1032 |
| 168 | Ga0068861_100637812 | 3300005719 | Bacteria | 982 |
| 169 | Ga0068861_101683616 | 3300005719 | Bacteria | 627 |
| 170 | Ga0068851_10119311 | 3300005834 | Bacteria | 1416 |
| 171 | Ga0068863_100008320 | 3300005841 | Bacteria | 10132 |
| 172 | Ga0068863_100008669 | 3300005841 | Bacteria | 9938 |
| 173 | Ga0068858_100644009 | 3300005842 | Bacteria | 1030 |
| 174 | Ga0068858_101523126 | 3300005842 | Bacteria | 660 |
| 175 | Ga0068860_100000220 | 3300005843 | Bacteria | 89460 |
| 176 | Ga0068860_100024823 | 3300005843 | Bacteria | 5789 |
| 177 | Ga0081540_1080649 | 3300005983 | Bacteria | 1466 |
| 178 | Ga0070717_10235653 | 3300006028 | Bacteria | 1612 |
| 179 | Ga0075365_10543520 | 3300006038 | Bacteria | 822 |
| 180 | Ga0075363_100172626 | 3300006048 | Bacteria | 1228 |
| 181 | Ga0075363_100814191 | 3300006048 | Bacteria | 568 |
| 182 | Ga0070715_10518171 | 3300006163 | Bacteria | 685 |
| 183 | Ga0070716_100688448 | 3300006173 | Bacteria | 780 |
| 184 | Ga0075362_10278047 | 3300006177 | Bacteria | 828 |
| 185 | Ga0075362_10365895 | 3300006177 | Bacteria | 724 |
| 186 | Ga0075367_10081978 | 3300006178 | Bacteria | 1952 |
| 187 | Ga0075367_10116045 | 3300006178 | Bacteria | 1646 |
| 188 | Ga0075369_10109815 | 3300006186 | Bacteria | 1242 |
| 189 | Ga0075366_10007231 | 3300006195 | Bacteria | 6117 |
| 190 | Ga0075366_10013189 | 3300006195 | Bacteria | 4700 |
| 191 | Ga0075366_10035079 | 3300006195 | Bacteria | 2957 |
| 192 | Ga0075366_10038153 | 3300006195 | Bacteria | 2837 |
| 193 | Ga0075366_10070440 | 3300006195 | Bacteria | 2082 |
| 194 | Ga0075366_11030761 | 3300006195 | Bacteria | 514 |
| 195 | Ga0097621_100122566 | 3300006237 | Bacteria | 2206 |
| 196 | Ga0097621_100233974 | 3300006237 | Bacteria | 1604 |
| 197 | Ga0097621_100852498 | 3300006237 | Bacteria | 846 |
| 198 | Ga0097621_101324222 | 3300006237 | Bacteria | 681 |
| 199 | Ga0097621_101986048 | 3300006237 | Bacteria | 556 |
| 200 | Ga0075370_10017297 | 3300006353 | Bacteria | 3894 |
| 201 | Ga0068871_100067789 | 3300006358 | Bacteria | 2928 |
| 202 | Ga0068871_101008421 | 3300006358 | Bacteria | 775 |
| 203 | Ga0075434_100097402 | 3300006871 | Bacteria | 2946 |
| 204 | Ga0075434_101482429 | 3300006871 | Bacteria | 688 |
| 205 | Ga0068865_101196254 | 3300006881 | Bacteria | 673 |
| 206 | Ga0097620_100742697 | 3300006931 | Bacteria | 1070 |
| 207 | Ga0075435_101409965 | 3300007076 | Bacteria | 611 |
| 208 | Ga0099795_10127919 | 3300007788 | Bacteria | 1022 |
| 209 | Ga0105240_10058360 | 3300009093 | Bacteria | 4818 |
| 210 | Ga0111539_10060664 | 3300009094 | Bacteria | 4482 |
| 211 | Ga0111539_12293156 | 3300009094 | Bacteria | 626 |
| 212 | Ga0105245_10075417 | 3300009098 | Bacteria | 3071 |
| 213 | Ga0105245_10076170 | 3300009098 | Bacteria | 3056 |
| 214 | Ga0105245_11800287 | 3300009098 | Bacteria | 665 |
| 215 | Ga0105245_12340185 | 3300009098 | Bacteria | 588 |
| 216 | Ga0105247_10166213 | 3300009101 | Bacteria | 1464 |
| 217 | Ga0105243_10000156 | 3300009148 | Bacteria | 78467 |
| 218 | Ga0105243_10184017 | 3300009148 | Bacteria | 1819 |
| 219 | Ga0105243_10735582 | 3300009148 | Bacteria | 965 |
| 220 | Ga0105243_11981878 | 3300009148 | Bacteria | 616 |
| 221 | Ga0105241_10004308 | 3300009174 | Bacteria | 10523 |
| 222 | Ga0105241_10185999 | 3300009174 | Bacteria | 1726 |
| 223 | Ga0105242_10048043 | 3300009176 | Bacteria | 3467 |
| 224 | Ga0105242_10122649 | 3300009176 | Bacteria | 2233 |
| 225 | Ga0105242_10894592 | 3300009176 | Bacteria | 887 |
| 226 | Ga0105248_10033419 | 3300009177 | Bacteria | 5746 |
| 227 | Ga0105248_10099202 | 3300009177 | Bacteria | 3282 |
| 228 | Ga0105248_11425728 | 3300009177 | Bacteria | 784 |
| 229 | Ga0105237_10246271 | 3300009545 | Bacteria | 1789 |
| 230 | Ga0105237_10398494 | 3300009545 | Bacteria | 1381 |
| 231 | Ga0105237_10482230 | 3300009545 | Bacteria | 1246 |
| 232 | Ga0105237_11062358 | 3300009545 | Bacteria | 816 |
| 233 | Ga0105238_10215885 | 3300009551 | Bacteria | 1894 |
| 234 | Ga0105238_10311541 | 3300009551 | Bacteria | 1559 |
| 235 | Ga0105238_10726602 | 3300009551 | Bacteria | 1006 |
| 236 | Ga0105238_11905866 | 3300009551 | Bacteria | 627 |
| 237 | Ga0105238_12224259 | 3300009551 | Bacteria | 583 |
| 238 | Ga0105238_12495022 | 3300009551 | Bacteria | 553 |
| 239 | Ga0105249_10134716 | 3300009553 | Bacteria | 2362 |
| 240 | Ga0105249_10386652 | 3300009553 | Bacteria | 1426 |
| 241 | Ga0105249_11161671 | 3300009553 | Bacteria | 843 |
| 242 | Ga0105249_12035842 | 3300009553 | Bacteria | 647 |
| 243 | Ga0099796_10476274 | 3300010159 | Bacteria | 558 |
| 244 | Ga0105239_10328506 | 3300010375 | Bacteria | 1725 |
| 245 | Ga0105239_10752756 | 3300010375 | Bacteria | 1115 |
| 246 | Ga0105239_11274454 | 3300010375 | Bacteria | 848 |
| 247 | Ga0105246_10144814 | 3300011119 | Bacteria | 1791 |
| 248 | Ga0105246_10155689 | 3300011119 | Bacteria | 1735 |
| 249 | Ga0105246_10568502 | 3300011119 | Bacteria | 974 |
| 250 | Ga0157335_1041120 | 3300012492 | Bacteria | 522 |
| 251 | Ga0157326_1010864 | 3300012513 | Bacteria | 1020 |
| 252 | Ga0157373_10170122 | 3300013100 | Bacteria | 1533 |
| 253 | Ga0157373_10611096 | 3300013100 | Bacteria | 794 |
| 254 | Ga0157373_11142036 | 3300013100 | Bacteria | 585 |
| 255 | Ga0157371_10059539 | 3300013102 | Bacteria | 2707 |
| 256 | Ga0157370_10378633 | 3300013104 | Bacteria | 1304 |
| 257 | Ga0157370_10758478 | 3300013104 | Bacteria | 884 |
| 258 | Ga0157369_10291945 | 3300013105 | Bacteria | 1697 |
| 259 | Ga0157374_10101300 | 3300013296 | Bacteria | 2762 |
| 260 | Ga0157374_12776130 | 3300013296 | Bacteria | 517 |
| 261 | Ga0157378_10000504 | 3300013297 | Bacteria | 37070 |
| 262 | Ga0157378_10951377 | 3300013297 | Bacteria | 892 |
| 263 | Ga0157378_11681631 | 3300013297 | Bacteria | 681 |
| 264 | Ga0157378_12037748 | 3300013297 | Bacteria | 624 |
| 265 | Ga0163162_10828800 | 3300013306 | Bacteria | 1041 |
| 266 | Ga0163162_13247100 | 3300013306 | Bacteria | 521 |
| 267 | Ga0157372_10606539 | 3300013307 | Bacteria | 1276 |
| 268 | Ga0157372_10694011 | 3300013307 | Bacteria | 1185 |
| 269 | Ga0157372_13318950 | 3300013307 | Bacteria | 512 |
| 270 | Ga0157372_13430144 | 3300013307 | Bacteria | 504 |
| 271 | Ga0157375_10033608 | 3300013308 | Bacteria | 4875 |
| 272 | Ga0157375_10353413 | 3300013308 | Bacteria | 1635 |
| 273 | Ga0157375_10940385 | 3300013308 | Bacteria | 1007 |
| 274 | Ga0157375_11735285 | 3300013308 | Bacteria | 739 |
| 275 | Ga0157375_12635005 | 3300013308 | Bacteria | 601 |
| 276 | Ga0157375_12972468 | 3300013308 | Bacteria | 566 |
| 277 | Ga0182008_10189510 | 3300014497 | Bacteria | 1043 |
| 278 | Ga0157377_10060702 | 3300014745 | Bacteria | 2159 |
| 279 | Ga0157377_10324576 | 3300014745 | Bacteria | 1024 |
| 280 | Ga0157379_10667744 | 3300014968 | Bacteria | 974 |
| 281 | Ga0157379_10959097 | 3300014968 | Bacteria | 814 |
| 282 | Ga0157379_11641516 | 3300014968 | Bacteria | 628 |
| 283 | Ga0157376_10000092 | 3300014969 | Bacteria | 68198 |
| 284 | Ga0157376_11091037 | 3300014969 | Bacteria | 824 |
| 285 | Ga0157376_11798598 | 3300014969 | Bacteria | 649 |
| 286 | Ga0182005_1076003 | 3300015265 | Bacteria | 925 |
| 287 | Ga0182005_1185098 | 3300015265 | Bacteria | 620 |
| 288 | Ga0163161_10040537 | 3300017792 | Bacteria | 3345 |
| 289 | Ga0163161_10097218 | 3300017792 | Bacteria | 2187 |
| 290 | Ga0163161_11522123 | 3300017792 | Bacteria | 588 |
| 291 | Ga0163161_12041913 | 3300017792 | Bacteria | 510 |
| 292 | Ga0206349_1044138 | 3300020075 | Bacteria | 866 |
| 293 | Ga0206351_10035987 | 3300020077 | Bacteria | 516 |
| 294 | Ga0206350_10412050 | 3300020080 | Bacteria | 703 |
| 295 | Ga0206354_10307013 | 3300020081 | Bacteria | 713 |
| 296 | Ga0206354_10821255 | 3300020081 | Bacteria | 549 |
| 297 | Ga0213874_10113685 | 3300021377 | Bacteria | 913 |
| 298 | Ga0213876_10063901 | 3300021384 | Bacteria | 1943 |
| 299 | Ga0213876_10413764 | 3300021384 | Bacteria | 717 |
| 300 | Ga0209677_111507 | 3300025253 | Bacteria | 1377 |
| 301 | Ga0209148_1000059 | 3300025254 | Bacteria | 350224 |
| 302 | Ga0209148_1003717 | 3300025254 | Bacteria | 4037 |
| 303 | Ga0209455_1005324 | 3300025272 | Bacteria | 4001 |
| 304 | Ga0209758_1000548 | 3300025297 | Bacteria | 59657 |
| 305 | Ga0207426_1019059 | 3300025302 | Bacteria | 2406 |
| 306 | Ga0207697_10454228 | 3300025315 | Bacteria | 568 |
| 307 | Ga0207682_10010516 | 3300025893 | Bacteria | 3624 |
| 308 | Ga0207682_10233372 | 3300025893 | Bacteria | 853 |
| 309 | Ga0207642_10015224 | 3300025899 | Bacteria | 2860 |
| 310 | Ga0207642_10150116 | 3300025899 | Bacteria | 1239 |
| 311 | Ga0207710_10061673 | 3300025900 | Bacteria | 1702 |
| 312 | Ga0207710_10241548 | 3300025900 | Bacteria | 901 |
| 313 | Ga0207688_10079487 | 3300025901 | Bacteria | 1870 |
| 314 | Ga0207688_10118686 | 3300025901 | Bacteria | 1542 |
| 315 | Ga0207688_10249972 | 3300025901 | Bacteria | 1074 |
| 316 | Ga0207680_10151589 | 3300025903 | Bacteria | 1546 |
| 317 | Ga0207680_10652026 | 3300025903 | Bacteria | 754 |
| 318 | Ga0207647_10043865 | 3300025904 | Bacteria | 2796 |
| 319 | Ga0207645_10036219 | 3300025907 | Bacteria | 3168 |
| 320 | Ga0207645_11094021 | 3300025907 | Bacteria | 538 |
| 321 | Ga0207643_10425697 | 3300025908 | Bacteria | 842 |
| 322 | Ga0207643_10437555 | 3300025908 | Bacteria | 831 |
| 323 | Ga0207705_10000243 | 3300025909 | Bacteria | 53479 |
| 324 | Ga0207705_10002954 | 3300025909 | Bacteria | 12998 |
| 325 | Ga0207705_10198836 | 3300025909 | Bacteria | 1518 |
| 326 | Ga0207654_10000810 | 3300025911 | Bacteria | 17231 |
| 327 | Ga0207654_10101008 | 3300025911 | Bacteria | 1777 |
| 328 | Ga0207707_10020771 | 3300025912 | Bacteria | 5735 |
| 329 | Ga0207707_11201271 | 3300025912 | Bacteria | 614 |
| 330 | Ga0207695_10075629 | 3300025913 | Bacteria | 3426 |
| 331 | Ga0207671_10253685 | 3300025914 | Bacteria | 1383 |
| 332 | Ga0207671_10268480 | 3300025914 | Bacteria | 1344 |
| 333 | Ga0207660_10059665 | 3300025917 | Bacteria | 2740 |
| 334 | Ga0207660_10202587 | 3300025917 | Bacteria | 1551 |
| 335 | Ga0207660_11558346 | 3300025917 | Bacteria | 533 |
| 336 | Ga0207662_10347525 | 3300025918 | Bacteria | 995 |
| 337 | Ga0207657_10069965 | 3300025919 | Bacteria | 2975 |
| 338 | Ga0207657_10174101 | 3300025919 | Bacteria | 1743 |
| 339 | Ga0207657_10257258 | 3300025919 | Bacteria | 1390 |
| 340 | Ga0207657_11275708 | 3300025919 | Bacteria | 556 |
| 341 | Ga0207649_10300303 | 3300025920 | Bacteria | 1174 |
| 342 | Ga0207649_10307380 | 3300025920 | Bacteria | 1161 |
| 343 | Ga0207649_10709169 | 3300025920 | Bacteria | 781 |
| 344 | Ga0207652_10037461 | 3300025921 | Bacteria | 4104 |
| 345 | Ga0207652_10093381 | 3300025921 | Bacteria | 2648 |
| 346 | Ga0207652_10819732 | 3300025921 | Bacteria | 825 |
| 347 | Ga0207652_11781401 | 3300025921 | Bacteria | 521 |
| 348 | Ga0207681_11378610 | 3300025923 | Bacteria | 592 |
| 349 | Ga0207694_10115742 | 3300025924 | Bacteria | 2136 |
| 350 | Ga0207694_10260982 | 3300025924 | Bacteria | 1419 |
| 351 | Ga0207694_10628194 | 3300025924 | Bacteria | 904 |
| 352 | Ga0207694_10860652 | 3300025924 | Bacteria | 766 |
| 353 | Ga0207650_10196105 | 3300025925 | Bacteria | 1615 |
| 354 | Ga0207650_10657886 | 3300025925 | Bacteria | 883 |
| 355 | Ga0207650_10955711 | 3300025925 | Bacteria | 728 |
| 356 | Ga0207659_10034481 | 3300025926 | Bacteria | 3490 |
| 357 | Ga0207659_10210085 | 3300025926 | Bacteria | 1559 |
| 358 | Ga0207659_10231268 | 3300025926 | Bacteria | 1491 |
| 359 | Ga0207659_10700448 | 3300025926 | Bacteria | 867 |
| 360 | Ga0207659_11866491 | 3300025926 | Bacteria | 510 |
| 361 | Ga0207687_10024648 | 3300025927 | Bacteria | 4022 |
| 362 | Ga0207687_10049506 | 3300025927 | Bacteria | 2922 |
| 363 | Ga0207687_10642981 | 3300025927 | Bacteria | 897 |
| 364 | Ga0207687_11323960 | 3300025927 | Bacteria | 619 |
| 365 | Ga0207644_10085340 | 3300025931 | Bacteria | 2342 |
| 366 | Ga0207644_10374526 | 3300025931 | Bacteria | 1160 |
| 367 | Ga0207644_10597046 | 3300025931 | Bacteria | 916 |
| 368 | Ga0207644_11559031 | 3300025931 | Bacteria | 554 |
| 369 | Ga0207690_10000177 | 3300025932 | Bacteria | 49108 |
| 370 | Ga0207690_10068111 | 3300025932 | Bacteria | 2444 |
| 371 | Ga0207690_10380848 | 3300025932 | Bacteria | 1121 |
| 372 | Ga0207706_10082619 | 3300025933 | Bacteria | 2824 |
| 373 | Ga0207706_10112980 | 3300025933 | Bacteria | 2389 |
| 374 | Ga0207706_10195976 | 3300025933 | Bacteria | 1772 |
| 375 | Ga0207686_10006822 | 3300025934 | Bacteria | 6148 |
| 376 | Ga0207686_10284439 | 3300025934 | Bacteria | 1222 |
| 377 | Ga0207709_10000114 | 3300025935 | Bacteria | 124672 |
| 378 | Ga0207709_11055386 | 3300025935 | Bacteria | 666 |
| 379 | Ga0207709_11566292 | 3300025935 | Bacteria | 547 |
| 380 | Ga0207670_10110814 | 3300025936 | Bacteria | 1978 |
| 381 | Ga0207670_10346826 | 3300025936 | Bacteria | 1175 |
| 382 | Ga0207670_10515265 | 3300025936 | Bacteria | 973 |
| 383 | Ga0207670_10700241 | 3300025936 | Bacteria | 838 |
| 384 | Ga0207669_10011850 | 3300025937 | Bacteria | 4261 |
| 385 | Ga0207669_10233156 | 3300025937 | Bacteria | 1359 |
| 386 | Ga0207669_10283236 | 3300025937 | Bacteria | 1251 |
| 387 | Ga0207704_10000008 | 3300025938 | Bacteria | 204682 |
| 388 | Ga0207704_10388669 | 3300025938 | Bacteria | 1097 |
| 389 | Ga0207665_10569264 | 3300025939 | Bacteria | 882 |
| 390 | Ga0207691_10021000 | 3300025940 | Bacteria | 6171 |
| 391 | Ga0207691_10355035 | 3300025940 | Bacteria | 1254 |
| 392 | Ga0207691_10511865 | 3300025940 | Bacteria | 1019 |
| 393 | Ga0207711_10059567 | 3300025941 | Bacteria | 3288 |
| 394 | Ga0207711_10204371 | 3300025941 | Bacteria | 1803 |
| 395 | Ga0207689_10000701 | 3300025942 | Bacteria | 32104 |
| 396 | Ga0207661_10692144 | 3300025944 | Bacteria | 937 |
| 397 | Ga0207661_11242235 | 3300025944 | Bacteria | 685 |
| 398 | Ga0207661_11257131 | 3300025944 | Bacteria | 681 |
| 399 | Ga0207679_11518547 | 3300025945 | Bacteria | 614 |
| 400 | Ga0207667_10000029 | 3300025949 | Bacteria | 329192 |
| 401 | Ga0207667_10002977 | 3300025949 | Bacteria | 21052 |
| 402 | Ga0207667_10440871 | 3300025949 | Bacteria | 1324 |
| 403 | Ga0207651_10000008 | 3300025960 | Bacteria | 204538 |
| 404 | Ga0207651_11133514 | 3300025960 | Bacteria | 701 |
| 405 | Ga0207651_11176477 | 3300025960 | Bacteria | 688 |
| 406 | Ga0207712_10025347 | 3300025961 | Bacteria | 3939 |
| 407 | Ga0207712_10112962 | 3300025961 | Bacteria | 2041 |
| 408 | Ga0207712_10124942 | 3300025961 | Bacteria | 1952 |
| 409 | Ga0207712_10207690 | 3300025961 | Bacteria | 1557 |
| 410 | Ga0207668_10139283 | 3300025972 | Bacteria | 1863 |
| 411 | Ga0207668_10180641 | 3300025972 | Bacteria | 1664 |
| 412 | Ga0207668_10411378 | 3300025972 | Bacteria | 1146 |
| 413 | Ga0207668_10462857 | 3300025972 | Bacteria | 1085 |
| 414 | Ga0207640_10007440 | 3300025981 | Bacteria | 6044 |
| 415 | Ga0207640_10876091 | 3300025981 | Bacteria | 783 |
| 416 | Ga0207640_11123746 | 3300025981 | Bacteria | 696 |
| 417 | Ga0207658_10000064 | 3300025986 | Bacteria | 117779 |
| 418 | Ga0207658_10151037 | 3300025986 | Bacteria | 1892 |
| 419 | Ga0207658_10795107 | 3300025986 | Bacteria | 859 |
| 420 | Ga0207677_10000091 | 3300026023 | Bacteria | 74163 |
| 421 | Ga0207677_10000280 | 3300026023 | Bacteria | 38160 |
| 422 | Ga0207677_10983091 | 3300026023 | Bacteria | 764 |
| 423 | Ga0207677_11035463 | 3300026023 | Bacteria | 746 |
| 424 | Ga0207703_10309491 | 3300026035 | Bacteria | 1443 |
| 425 | Ga0207639_10046869 | 3300026041 | Bacteria | 3264 |
| 426 | Ga0207678_10063824 | 3300026067 | Bacteria | 3165 |
| 427 | Ga0207678_10375624 | 3300026067 | Bacteria | 1228 |
| 428 | Ga0207678_11549583 | 3300026067 | Bacteria | 584 |
| 429 | Ga0207708_10102376 | 3300026075 | Bacteria | 2217 |
| 430 | Ga0207702_10005062 | 3300026078 | Bacteria | 11576 |
| 431 | Ga0207702_10144576 | 3300026078 | Bacteria | 2156 |
| 432 | Ga0207702_10546079 | 3300026078 | Bacteria | 1133 |
| 433 | Ga0207702_10944196 | 3300026078 | Bacteria | 855 |
| 434 | Ga0207641_10003421 | 3300026088 | Bacteria | 14060 |
| 435 | Ga0207641_10019951 | 3300026088 | Bacteria | 5502 |
| 436 | Ga0207641_10747650 | 3300026088 | Bacteria | 965 |
| 437 | Ga0207648_10000009 | 3300026089 | Bacteria | 204229 |
| 438 | Ga0207648_10562231 | 3300026089 | Bacteria | 1049 |
| 439 | Ga0207648_10750213 | 3300026089 | Bacteria | 907 |
| 440 | Ga0207676_10108953 | 3300026095 | Bacteria | 2313 |
| 441 | Ga0207674_10214218 | 3300026116 | Bacteria | 1875 |
| 442 | Ga0207674_11323738 | 3300026116 | Bacteria | 690 |
| 443 | Ga0207674_11454714 | 3300026116 | Bacteria | 654 |
| 444 | Ga0207675_100402582 | 3300026118 | Bacteria | 1349 |
| 445 | Ga0207675_102632175 | 3300026118 | Bacteria | 512 |
| 446 | Ga0207683_10006500 | 3300026121 | Bacteria | 10001 |
| 447 | Ga0207683_10063505 | 3300026121 | Bacteria | 3253 |
| 448 | Ga0207683_10366205 | 3300026121 | Bacteria | 1324 |
| 449 | Ga0207698_10002773 | 3300026142 | Bacteria | 10449 |
| 450 | Ga0207698_10314913 | 3300026142 | Bacteria | 1463 |
| 451 | Ga0207698_10717229 | 3300026142 | Bacteria | 996 |
| 452 | Ga0207698_10786420 | 3300026142 | Bacteria | 953 |
| 453 | Ga0268266_10000015 | 3300028379 | Bacteria | 630629 |
| 454 | Ga0268266_10000560 | 3300028379 | Bacteria | 51866 |
| 455 | Ga0268266_10421589 | 3300028379 | Bacteria | 1265 |
| 456 | Ga0268266_10530941 | 3300028379 | Bacteria | 1126 |
| 457 | Ga0268266_11006931 | 3300028379 | Bacteria | 806 |
| 458 | Ga0268266_11633475 | 3300028379 | Bacteria | 620 |
| 459 | Ga0268265_12171584 | 3300028380 | Bacteria | 562 |
| 460 | Ga0268264_10000384 | 3300028381 | Bacteria | 63602 |
| 461 | Ga0268264_10049366 | 3300028381 | Bacteria | 3501 |
| 462 | Ga0268264_10310000 | 3300028381 | Bacteria | 1489 |
| 463 | Ga0307517_10068004 | 3300028786 | Bacteria | 3252 |
| 464 | Ga0265330_10283293 | 3300031235 | Bacteria | 698 |
| 465 | Ga0265332_10436973 | 3300031238 | Bacteria | 541 |
| 466 | Ga0265328_10000129 | 3300031239 | Bacteria | 36422 |
| 467 | Ga0265328_10068299 | 3300031239 | Bacteria | 1306 |
| 468 | Ga0265325_10144642 | 3300031241 | Bacteria | 1128 |
| 469 | Ga0265329_10004194 | 3300031242 | Bacteria | 6066 |
| 470 | Ga0265340_10092056 | 3300031247 | Bacteria | 1416 |
| 471 | Ga0265340_10220938 | 3300031247 | Bacteria | 849 |
| 472 | Ga0265340_10408130 | 3300031247 | Bacteria | 599 |
| 473 | Ga0265331_10001125 | 3300031250 | Bacteria | 20459 |
| 474 | Ga0265327_10044157 | 3300031251 | Bacteria | 2379 |
| 475 | Ga0265316_10016003 | 3300031344 | Bacteria | 6526 |
| 476 | Ga0265316_10405158 | 3300031344 | Bacteria | 982 |
| 477 | Ga0307513_10008605 | 3300031456 | Bacteria | 13021 |
| 478 | Ga0307513_10200665 | 3300031456 | Bacteria | 1836 |
| 479 | Ga0307408_100002738 | 3300031548 | Bacteria | 12231 |
| 480 | Ga0307508_10084747 | 3300031616 | Bacteria | 2752 |
| 481 | Ga0265342_10059693 | 3300031712 | Bacteria | 2252 |
| 482 | Ga0265342_10322342 | 3300031712 | Bacteria | 810 |
| 483 | Ga0307405_10503259 | 3300031731 | Bacteria | 971 |
| 484 | Ga0307413_10176896 | 3300031824 | Bacteria | 1517 |
| 485 | Ga0307413_10462880 | 3300031824 | Bacteria | 1009 |
| 486 | Ga0307406_10011946 | 3300031901 | Bacteria | 4937 |
| 487 | Ga0307406_11380337 | 3300031901 | Bacteria | 617 |
| 488 | Ga0307407_10726438 | 3300031903 | Bacteria | 750 |
| 489 | Ga0307412_10138587 | 3300031911 | Bacteria | 1778 |
| 490 | Ga0307412_10730659 | 3300031911 | Bacteria | 853 |
| 491 | Ga0307409_100372070 | 3300031995 | Bacteria | 1355 |
| 492 | Ga0307416_100095222 | 3300032002 | Bacteria | 2570 |
| 493 | Ga0307416_100351348 | 3300032002 | Bacteria | 1492 |
| 494 | Ga0307416_101392196 | 3300032002 | Bacteria | 807 |
| 495 | Ga0307416_101538990 | 3300032002 | Bacteria | 771 |
| 496 | Ga0307416_102386601 | 3300032002 | Bacteria | 628 |
| 497 | Ga0307414_10499576 | 3300032004 | Bacteria | 1076 |
| 498 | Ga0307411_10307164 | 3300032005 | Bacteria | 1275 |
| 499 | Ga0307411_10612816 | 3300032005 | Bacteria | 937 |
| 500 | Ga0307411_11508128 | 3300032005 | Bacteria | 618 |
| 501 | Ga0307411_11550968 | 3300032005 | Bacteria | 610 |
| 502 | Ga0307415_101355857 | 3300032126 | Bacteria | 676 |
| 503 | Ga0307415_101447163 | 3300032126 | Bacteria | 656 |
| 504 | Ga0307510_10131444 | 3300033180 | Bacteria | 2175 |
| 505 | Ga0307510_10281325 | 3300033180 | Bacteria | 1134 |
| 506 | Ga0316596_1101078 | 3300033541 | Bacteria | 780 |
| 507 | Ga0373930_0012668 | 3300034816 | Bacteria | 1542 |
| 508 | Ga0373948_0048488 | 3300034817 | Bacteria | 907 |
| 509 | Ga0373950_0170155 | 3300034818 | Bacteria | 508 |
| 510 | Ga0373929_0009301 | 3300035085 | Bacteria | 1820 |
| 511 | Ga0373949_0020853 | 3300035090 | Bacteria | 1503 |
| 512 | Ga0373949_0081538 | 3300035090 | Bacteria | 863 |
| 513 | Ga0373951_0043729 | 3300035091 | Bacteria | 1086 |
| 514 | Ga0373932_0048633 | 3300035112 | Bacteria | 1251 |
| 515 | Ga0373939_0160427 | 3300035114 | Bacteria | 825 |
| 516 | Ga0373960_0052296 | 3300035121 | Bacteria | 1215 |
| 517 | Ga0373943_0291153 | 3300035170 | Bacteria | 925 |
| 518 | Ga0373955_0190957 | 3300035172 | Bacteria | 1218 |
| 519 | Ga0373942_0087765 | 3300035207 | Bacteria | 933 |
| 520 | Ga0373942_0090162 | 3300035207 | Bacteria | 923 |
| 521 | Ga0373961_0131708 | 3300035241 | Bacteria | 838 |
| 522 | Ga0373931_0046911 | 3300035691 | Bacteria | 2285 |
| 523 | Ga0373935_0225805 | 3300035692 | Bacteria | 1302 |
| 524 | Ga0373933_0473593 | 3300035724 | Bacteria | 820 |
| 525 | Ga0373933_0855821 | 3300035724 | Bacteria | 599 |
| 526 | Ga0373947_0457021 | 3300035725 | Bacteria | 865 |
| 527 | Ga0373947_0503582 | 3300035725 | Bacteria | 823 |
| 528 | Ga0373925_0156062 | 3300037068 | Bacteria | 1795 |
| 529 | Ga0395900_0577370 | 3300037418 | Bacteria | 1066 |
| 530 | Ga0395900_0923344 | 3300037418 | Bacteria | 795 |
| 531 | Ga0395900_1501025 | 3300037418 | Bacteria | 586 |
| 532 | Ga0395905_0118793 | 3300037471 | Bacteria | 2485 |
| 533 | Ga0395905_0413873 | 3300037471 | Bacteria | 1243 |
| 534 | Ga0395905_1716157 | 3300037471 | Bacteria | 533 |
| 535 | Ga0395905_1874582 | 3300037471 | Bacteria | 506 |
| 536 | Ga0395901_0461263 | 3300038443 | Bacteria | 1298 |
| 537 | Ga0395901_0635061 | 3300038443 | Bacteria | 1073 |
| 538 | Ga0395901_1121166 | 3300038443 | Bacteria | 756 |
| 539 | Ga0395901_1180469 | 3300038443 | Bacteria | 732 |
| 540 | Ga0395901_1243918 | 3300038443 | Bacteria | 708 |
| 541 | Ga0436365_0484870 | 3300039437 | Bacteria | 2444 |
| 542 | Ga0436365_0968973 | 3300039437 | Bacteria | 967 |
| 543 | Ga0436365_1200072 | 3300039437 | Bacteria | 1660 |
| 544 | Ga0436365_1660078 | 3300039437 | Bacteria | 1040 |
| 545 | Ga0436360_0611394 | 3300039438 | Bacteria | 858 |
| 546 | Ga0436360_0858015 | 3300039438 | Bacteria | 812 |
| 547 | Ga0436361_0941261 | 3300039447 | Bacteria | 551 |
| 548 | Ga0436363_0240412 | 3300039450 | Bacteria | 1739 |
| 549 | Ga0436363_0285709 | 3300039450 | Bacteria | 1350 |
| 550 | Ga0436363_1187923 | 3300039450 | Bacteria | 1470 |
| 551 | Ga0436363_1389226 | 3300039450 | Bacteria | 1549 |
| 552 | Ga0436362_0367590 | 3300039453 | Bacteria | 1182 |
| 553 | Ga0436362_1207375 | 3300039453 | Bacteria | 1146 |
| 554 | Ga0439447_092817 | 3300041407 | Bacteria | 694 |
| 555 | Ga0451789_0831186 | 3300041443 | Bacteria | 645 |
| 556 | Ga0451790_07228 | 3300041444 | Bacteria | 555 |
| 557 | Ga0451794_28272 | 3300041446 | Bacteria | 740 |
| 558 | Ga0451791_1344492 | 3300041451 | Bacteria | 607 |
| 559 | Ga0451793_0030520 | 3300041452 | Bacteria | 601 |
| 560 | Ga0451795_0403850 | 3300041456 | Bacteria | 912 |
| 561 | Ga0451798_0890559 | 3300041458 | Bacteria | 502 |
| 562 | Ga0451800_0720288 | 3300041459 | Bacteria | 693 |
| 563 | Ga0451802_0399788 | 3300041460 | Bacteria | 774 |
| 564 | Ga0451807_0501283 | 3300041486 | Bacteria | 518 |
| 565 | Ga0451841_1431138 | 3300041498 | Bacteria | 547 |
| 566 | Ga0451855_0958600 | 3300041511 | Bacteria | 531 |
| 567 | Ga0451853_0270632 | 3300041512 | Bacteria | 535 |
| 568 | Ga0451853_3598434 | 3300041512 | Bacteria | 625 |
| 569 | Ga0439437_039413 | 3300042000 | Bacteria | 610 |
| 570 | Ga0439441_113155 | 3300042001 | Bacteria | 617 |
| 571 | Ga0439448_0262567 | 3300042005 | Bacteria | 610 |
| 572 | Ga0439455_0132446 | 3300042012 | Bacteria | 703 |
| 573 | Ga0450894_073624 | 3300042131 | Bacteria | 525 |
| 574 | Ga0439458_0050761 | 3300042157 | Bacteria | 1023 |
| 575 | Ga0439435_0080051 | 3300042436 | Bacteria | 979 |
| 576 | Ga0439459_0041698 | 3300042438 | Bacteria | 978 |
| 577 | Ga0466969_0073651 | 3300044656 | Bacteria | 1639 |
| 578 | Ga0466966_0432360 | 3300044684 | Bacteria | 791 |
| 579 | Ga0466961_0067895 | 3300044693 | Bacteria | 2264 |
| 580 | Ga0466961_0924790 | 3300044693 | Bacteria | 519 |
| 581 | Ga0466963_0552115 | 3300044694 | Bacteria | 813 |
| 582 | Ga0466968_0010999 | 3300044735 | Bacteria | 3517 |
| 583 | Ga0466970_0183319 | 3300044765 | Bacteria | 1162 |
| 584 | Ga0466970_0454594 | 3300044765 | Bacteria | 734 |
| 585 | Ga0466957_0920067 | 3300044842 | Bacteria | 625 |
| 586 | Ga0466959_0097616 | 3300045049 | Bacteria | 2105 |
| 587 | Ga0466958_0155298 | 3300045836 | Bacteria | 1444 |
| 588 | Ga0466967_0405609 | 3300045976 | Bacteria | 1327 |
| 589 | Ga0466967_0416898 | 3300045976 | Bacteria | 1308 |
| 590 | Ga0495617_072304 | 3300046452 | Bacteria | 1134 |
| 591 | Ga0495629_0572716 | 3300046459 | Bacteria | 757 |
| 592 | Ga0495638_0175804 | 3300046460 | Bacteria | 1225 |
| 593 | Ga0495650_0001317 | 3300046471 | Bacteria | 25056 |
| 594 | Ga0495584_0733574 | 3300046491 | Bacteria | 504 |
| 595 | Ga0495596_0039835 | 3300046500 | Bacteria | 1855 |
| 596 | Ga0495607_0075376 | 3300046501 | Bacteria | 1870 |
| 597 | Ga0495583_0055775 | 3300046506 | Bacteria | 1784 |
| 598 | Ga0495606_0026341 | 3300046507 | Bacteria | 4145 |
| 599 | Ga0495616_0043729 | 3300046513 | Bacteria | 2274 |
| 600 | Ga0495616_0080148 | 3300046513 | Bacteria | 1564 |
| 601 | Ga0495620_0212922 | 3300046515 | Bacteria | 741 |
| 602 | Ga0495631_0272042 | 3300046518 | Bacteria | 721 |
| 603 | Ga0495632_0111724 | 3300046519 | Bacteria | 1283 |
| 604 | Ga0495637_0017513 | 3300046520 | Bacteria | 3336 |
| 605 | Ga0495643_0423485 | 3300046522 | Bacteria | 583 |
| 606 | Ga0495648_0007227 | 3300046524 | Bacteria | 8919 |
| 607 | Ga0495663_0006927 | 3300046525 | Bacteria | 3127 |
| 608 | Ga0495663_0398762 | 3300046525 | Bacteria | 506 |
| 609 | Ga0495654_0212746 | 3300046530 | Bacteria | 821 |
| 610 | Ga0495587_0028999 | 3300046536 | Bacteria | 3362 |
| 611 | Ga0495609_0162383 | 3300046538 | Bacteria | 946 |
| 612 | Ga0495597_0032717 | 3300046542 | Bacteria | 2358 |
| 613 | Ga0495597_0337585 | 3300046542 | Bacteria | 580 |
| 614 | Ga0495645_0950428 | 3300046543 | Bacteria | 508 |
| 615 | Ga0495622_0017900 | 3300046557 | Bacteria | 3300 |
| 616 | Ga0495633_0052492 | 3300046558 | Bacteria | 1920 |
| 617 | Ga0495668_0000016 | 3300046616 | Bacteria | 438197 |
| 618 | Ga0495611_0189735 | 3300046648 | Bacteria | 959 |
| 619 | Ga0495625_0018235 | 3300046660 | Bacteria | 5484 |
| 620 | Ga0495659_0089938 | 3300046664 | Bacteria | 1177 |
| 621 | Ga0495661_0299532 | 3300046665 | Bacteria | 805 |
| 622 | Ga0495669_0001189 | 3300046684 | Bacteria | 10830 |
| 623 | Ga0495670_0090056 | 3300046691 | Bacteria | 1569 |
| 624 | Ga0495671_0615362 | 3300046692 | Bacteria | 516 |
| 625 | Ga0495649_0128062 | 3300046694 | Bacteria | 1340 |
| 626 | Ga0495589_0256713 | 3300046794 | Bacteria | 816 |
| 627 | Ga0495600_0009263 | 3300046809 | Bacteria | 6075 |
| 628 | Ga0495660_0071205 | 3300046810 | Bacteria | 1844 |
| 629 | Ga0495604_0267655 | 3300047317 | Bacteria | 1159 |
| 630 | Ga0495636_0137389 | 3300047318 | Bacteria | 1090 |
| 631 | Ga0495674_0400752 | 3300047319 | Bacteria | 1108 |
| 632 | Ga0495672_0053242 | 3300047320 | Bacteria | 2373 |
| 633 | Ga0495672_0415684 | 3300047320 | Bacteria | 612 |
| 634 | Ga0495680_0705488 | 3300047322 | Bacteria | 666 |
| 635 | Ga0495683_0123059 | 3300047323 | Bacteria | 1229 |
| 636 | Ga0495687_037411 | 3300047443 | Bacteria | 2162 |
| 637 | Ga0495687_037412 | 3300047443 | Bacteria | 2162 |
| 638 | Ga0495679_051402 | 3300047446 | Bacteria | 1236 |
| 639 | Ga0495673_0358210 | 3300047469 | Bacteria | 514 |
| 640 | Ga0495681_0032741 | 3300047470 | Bacteria | 2613 |
| 641 | Ga0495686_0144866 | 3300047472 | Bacteria | 1399 |
| 642 | Ga0495615_0096358 | 3300048090 | Bacteria | 831 |
| 643 | Ga0495615_0096878 | 3300048090 | Bacteria | 829 |
| 644 | Ga0496100_0177022 | 3300048903 | Bacteria | 1540 |
| 645 | Ga0496101_0014870 | 3300048904 | Bacteria | 5237 |
| 646 | Ga0496101_0833573 | 3300048904 | Bacteria | 727 |
| 647 | Ga0496102_0003155 | 3300048905 | Bacteria | 13978 |
| 648 | Ga0496102_0067172 | 3300048905 | Bacteria | 3288 |
| 649 | Ga0496102_0664938 | 3300048905 | Bacteria | 965 |
| 650 | Ga0496103_0000903 | 3300048906 | Bacteria | 21301 |
| 651 | Ga0496103_0061364 | 3300048906 | Bacteria | 2338 |
| 652 | Ga0496104_0101217 | 3300048907 | Bacteria | 2758 |
| 653 | Ga0496105_0014636 | 3300048908 | Bacteria | 6247 |
| 654 | Ga0496105_0035470 | 3300048908 | Bacteria | 4104 |
| 655 | Ga0496106_0233931 | 3300048909 | Bacteria | 1467 |
| 656 | Ga0496107_0092306 | 3300048910 | Bacteria | 2213 |
| 657 | Ga0496107_0099103 | 3300048910 | Bacteria | 2135 |
| 658 | Ga0496108_0071844 | 3300048911 | Bacteria | 2920 |
| 659 | Ga0496108_0539287 | 3300048911 | Bacteria | 1018 |
| 660 | Ga0496109_0054198 | 3300048912 | Bacteria | 3658 |
| 661 | Ga0496109_0367857 | 3300048912 | Bacteria | 1358 |
| 662 | Ga0496110_0121916 | 3300048913 | Bacteria | 2349 |
| 663 | Ga0496111_0137029 | 3300048914 | Bacteria | 1813 |
| 664 | Ga0496111_0177046 | 3300048914 | Bacteria | 1585 |
| 665 | Ga0496111_0494249 | 3300048914 | Bacteria | 901 |
| 666 | Ga0496112_0118329 | 3300048915 | Bacteria | 2619 |
| 667 | Ga0496112_0308603 | 3300048915 | Bacteria | 1527 |
| 668 | Ga0496112_0363032 | 3300048915 | Bacteria | 1390 |
| 669 | Ga0496113_0444654 | 3300048916 | Bacteria | 1041 |
| 670 | Ga0496113_0579968 | 3300048916 | Bacteria | 899 |
| 671 | Ga0496114_0060604 | 3300048917 | Bacteria | 3163 |
| 672 | Ga0496115_0002506 | 3300048918 | Bacteria | 13194 |
| 673 | Ga0496115_0024784 | 3300048918 | Bacteria | 4665 |
| 674 | Ga0496115_0049337 | 3300048918 | Bacteria | 3369 |
| 675 | Ga0496116_0009806 | 3300048919 | Bacteria | 8117 |
| 676 | Ga0496117_0000324 | 3300048920 | Bacteria | 83876 |
| 677 | Ga0496118_0002151 | 3300048921 | Bacteria | 27486 |
| 678 | Ga0496118_0523507 | 3300048921 | Bacteria | 584 |
| 679 | Ga0496119_0019706 | 3300048922 | Bacteria | 4952 |
| 680 | Ga0496120_0013189 | 3300048923 | Bacteria | 5578 |
| 681 | Ga0496121_0002794 | 3300048924 | Bacteria | 25864 |
| 682 | Ga0496122_0020856 | 3300048925 | Bacteria | 5894 |
| 683 | Ga0496122_0535551 | 3300048925 | Bacteria | 561 |
| 684 | Ga0496123_0017188 | 3300048926 | Bacteria | 5835 |
| 685 | Ga0496124_0000351 | 3300048927 | Bacteria | 84021 |
| 686 | Ga0496125_0011965 | 3300048928 | Bacteria | 8640 |
| 687 | Ga0496126_0002155 | 3300048929 | Bacteria | 27384 |
| 688 | Ga0501308_007330 | 3300049128 | Bacteria | 1152 |
| 689 | Ga0501305_055965 | 3300049161 | Bacteria | 671 |
| 690 | Ga0501307_017543 | 3300049162 | Bacteria | 903 |
| 691 | Ga0495682_0228037 | 3300049460 | Bacteria | 660 |
| 692 | Ga0501300_039689 | 3300049523 | Bacteria | 707 |
| 693 | Ga0501336_018314 | 3300049552 | Bacteria | 620 |
| 694 | Ga0501032_0037596 | 3300049569 | Bacteria | 3300 |
| 695 | Ga0501033_0059370 | 3300049570 | Bacteria | 2824 |
| 696 | Ga0501034_1455194 | 3300049571 | Bacteria | 559 |
| 697 | Ga0501036_0273418 | 3300049572 | Bacteria | 1414 |
| 698 | Ga0501036_0984885 | 3300049572 | Bacteria | 690 |
| 699 | Ga0501037_0000191 | 3300049573 | Bacteria | 56839 |
| 700 | Ga0501043_0000080 | 3300049579 | Bacteria | 85372 |
| 701 | Ga0501047_0560620 | 3300049581 | Bacteria | 966 |
| 702 | Ga0501048_0940235 | 3300049582 | Bacteria | 622 |
| 703 | Ga0501068_0626878 | 3300049584 | Bacteria | 701 |
| 704 | Ga0501069_0000091 | 3300049585 | Bacteria | 43550 |
| 705 | Ga0501069_0088669 | 3300049585 | Bacteria | 1748 |
| 706 | Ga0501070_0014064 | 3300049586 | Bacteria | 6737 |
| 707 | Ga0501070_0014243 | 3300049586 | Bacteria | 6692 |
| 708 | Ga0501071_0045783 | 3300049587 | Bacteria | 3140 |
| 709 | Ga0501073_0040996 | 3300049589 | Bacteria | 3273 |
| 710 | Ga0501073_0484052 | 3300049589 | Bacteria | 856 |
| 711 | Ga0501073_0834745 | 3300049589 | Bacteria | 635 |
| 712 | Ga0501074_0002583 | 3300049590 | Bacteria | 12638 |
| 713 | Ga0501075_1525655 | 3300049591 | Bacteria | 506 |
| 714 | Ga0501257_001130 | 3300049686 | Bacteria | 5433 |
| 715 | Ga0501079_0578838 | 3300049741 | Bacteria | 883 |
| 716 | Ga0501079_0667145 | 3300049741 | Bacteria | 819 |
| 717 | Ga0501080_0075363 | 3300049742 | Bacteria | 3138 |
| 718 | Ga0501080_0511307 | 3300049742 | Bacteria | 1072 |
| 719 | Ga0501083_0001214 | 3300049744 | Bacteria | 17447 |
| 720 | Ga0501280_006929 | 3300049776 | Bacteria | 1592 |
| 721 | Ga0501035_0072152 | 3300049822 | Bacteria | 3056 |
| 722 | Ga0501035_1146408 | 3300049822 | Bacteria | 605 |
| 723 | Ga0501044_0092128 | 3300049823 | Bacteria | 3056 |
| 724 | nmdc:mga03683_278950_c1 | 3300050489 | Bacteria | 781 |
| 725 | nmdc:mga03n38_607148_c1 | 3300050490 | Bacteria | 624 |
| 726 | nmdc:mga0yw44_302857_c1 | 3300050492 | Bacteria | 1071 |
| 727 | nmdc:mga0k408_114332_c1 | 3300050493 | Bacteria | 1596 |
| 728 | nmdc:mga0k408_25101_c1 | 3300050493 | Bacteria | 3373 |
| 729 | nmdc:mga0k408_4095_c1 | 3300050493 | Bacteria | 7742 |
| 730 | nmdc:mga0k408_780026_c1 | 3300050493 | Bacteria | 557 |
| 731 | nmdc:mga0k408_98907_c1 | 3300050493 | Bacteria | 1719 |
| 732 | nmdc:mga06z11_131797_c1 | 3300050494 | Bacteria | 1404 |
| 733 | nmdc:mga06z11_172734_c1 | 3300050494 | Bacteria | 1242 |
| 734 | nmdc:mga06z11_372392_c1 | 3300050494 | Bacteria | 857 |
| 735 | nmdc:mga04h51_513537_c1 | 3300050495 | Bacteria | 513 |
| 736 | nmdc:mga08y16_1096076_c1 | 3300050511 | Bacteria | 771 |
| 737 | nmdc:mga0n895_592416_c1 | 3300050512 | Bacteria | 1112 |
| 738 | nmdc:mga0n895_761735_c1 | 3300050512 | Bacteria | 960 |
| 739 | nmdc:mga0rr50_756197_c1 | 3300050513 | Bacteria | 829 |
| 740 | nmdc:mga08x19_1033595_c1 | 3300050514 | Bacteria | 583 |
| 741 | nmdc:mga0sz30_192635_c1 | 3300050516 | Bacteria | 905 |
| 742 | nmdc:mga0sz30_74009_c1 | 3300050516 | Bacteria | 1469 |
| 743 | Ga0495601_0050869 | 3300053077 | Bacteria | 2614 |
| 744 | Ga0500610_0000216 | 3300053079 | Bacteria | 17601 |
| 745 | Ga0495655_0010736 | 3300053083 | Bacteria | 1818 |
| 746 | Ga0495655_0101522 | 3300053083 | Bacteria | 852 |
| 747 | Ga0495655_0180561 | 3300053083 | Bacteria | 680 |
| 748 | Ga0495595_0069895 | 3300053084 | Bacteria | 1658 |
| 749 | Ga0495619_1125224 | 3300053085 | Bacteria | 522 |
| 750 | Ga0500578_0400604 | 3300053086 | Bacteria | 791 |
| 751 | Ga0500643_109253 | 3300053087 | Bacteria | 747 |
| 752 | Ga0500646_0004531 | 3300053090 | Bacteria | 3517 |
| 753 | Ga0500646_0040773 | 3300053090 | Bacteria | 1307 |
| 754 | Ga0500583_0399269 | 3300053092 | Bacteria | 660 |
| 755 | Ga0500641_0169432 | 3300053096 | Bacteria | 940 |
| 756 | Ga0500556_0200021 | 3300053104 | Bacteria | 790 |
| 757 | Ga0500562_083776 | 3300053108 | Bacteria | 864 |
| 758 | Ga0500593_181685 | 3300053117 | Bacteria | 780 |
| 759 | Ga0500594_0173443 | 3300053118 | Bacteria | 701 |
| 760 | Ga0500595_018979 | 3300053119 | Bacteria | 2502 |
| 761 | Ga0500642_0001933 | 3300053130 | Bacteria | 6005 |
| 762 | Ga0500642_0009901 | 3300053130 | Bacteria | 3335 |
| 763 | Ga0500652_145430 | 3300053131 | Bacteria | 985 |
| 764 | Ga0500568_0035867 | 3300053139 | Bacteria | 2021 |
| 765 | Ga0500573_0000559 | 3300053140 | Bacteria | 16226 |
| 766 | Ga0500573_0293206 | 3300053140 | Bacteria | 817 |
| 767 | Ga0500604_0000014 | 3300053151 | Bacteria | 92128 |
| 768 | Ga0500604_0206745 | 3300053151 | Bacteria | 676 |
| 769 | Ga0500616_0006579 | 3300053153 | Bacteria | 7577 |
| 770 | Ga0500616_0073152 | 3300053153 | Bacteria | 1741 |
| 771 | Ga0500622_0002771 | 3300053156 | Bacteria | 12332 |
| 772 | Ga0500636_0152791 | 3300053177 | Bacteria | 1266 |
| 773 | Ga0500645_000002 | 3300053730 | Bacteria | 388892 |
| 774 | Ga0500645_088783 | 3300053730 | Bacteria | 878 |
| 775 | Ga0500587_034778 | 3300053739 | Bacteria | 704 |
| 776 | Ga0501084_0151360 | 3300054114 | Bacteria | 1956 |
| 777 | Ga0587084_007588 | 3300059477 | Bacteria | 1350 |
| 778 | Ga0587066_007807 | 3300059490 | Bacteria | 1465 |
| 779 | Ga0587070_008024 | 3300059491 | Bacteria | 1484 |
| 780 | Ga0587070_065000 | 3300059491 | Bacteria | 764 |
| 781 | Ga0587073_0021745 | 3300059492 | Bacteria | 1237 |
| 782 | Ga0587077_003076 | 3300059493 | Bacteria | 2064 |
| 783 | Ga0587080_008678 | 3300059503 | Bacteria | 1462 |
| 784 | Ga0587082_014514 | 3300059504 | Bacteria | 1203 |
| 785 | Ga0587083_0020431 | 3300059505 | Bacteria | 1220 |
| 786 | Ga0587088_010422 | 3300059508 | Bacteria | 1361 |
| 787 | Ga0587090_017496 | 3300059510 | Bacteria | 1084 |
| 788 | Ga0587090_084782 | 3300059510 | Bacteria | 640 |
| 789 | Ga0587091_001650 | 3300059511 | Bacteria | 2475 |
| 790 | Ga0587094_012259 | 3300059513 | Bacteria | 1142 |
| 791 | Ga0587106_020463 | 3300059605 | Bacteria | 976 |
| 792 | Ga0587131_020051 | 3300059609 | Bacteria | 545 |
| 793 | Ga0587101_004327 | 3300059623 | Bacteria | 1511 |
| 794 | Ga0587115_001498 | 3300059626 | Bacteria | 2157 |
| 795 | Ga0587067_006007 | 3300059640 | Bacteria | 1672 |
| 796 | Ga0587067_017691 | 3300059640 | Bacteria | 1186 |
| 797 | Ga0587068_010651 | 3300059641 | Bacteria | 1376 |
| 798 | Ga0587069_012706 | 3300059642 | Bacteria | 1146 |
| 799 | Ga0587072_016814 | 3300059643 | Bacteria | 1256 |
| 800 | Ga0587072_112905 | 3300059643 | Bacteria | 622 |
| 801 | Ga0587075_012510 | 3300059644 | Bacteria | 1154 |
| 802 | Ga0587076_013991 | 3300059645 | Bacteria | 1227 |
| 803 | Ga0587078_006230 | 3300059646 | Bacteria | 1292 |
| 804 | Ga0587079_008799 | 3300059647 | Bacteria | 1554 |
| 805 | Ga0587107_051730 | 3300059652 | Bacteria | 699 |
| 806 | Ga0587110_018389 | 3300059654 | Bacteria | 772 |
| 807 | Ga0587071_013079 | 3300060344 | Bacteria | 1424 |
| 808 | Ga0587071_055585 | 3300060344 | Bacteria | 829 |
| 809 | Ga0501082_0113976 | 3300060353 | Bacteria | 2341 |
| 810 | Ga0501082_0282717 | 3300060353 | Bacteria | 1444 |
| 811 | Ga0501082_0486754 | 3300060353 | Bacteria | 1078 |
| 812 | Ga0466962_0424806 | 3300061719 | Bacteria | 667 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049460 | Ga0495682_0228037 | Ga0495682_0228037_14_289 | 89 |
| 2 | 3300041511 | Ga0451855_0958600 | Ga0451855_0958600_35_316 | 92 |
| 3 | 3300025949 | Ga0207667_10440871 | Ga0207667_104408713 | 94 |
| 4 | iso_pu_bacteria | 8002060224 | 8002061399 | 94 |
| 5 | iso_pu_bacteria | 8054563764 | 8054566754 | 94 |
| 6 | 3300006881 | Ga0068865_101196254 | Ga0068865_1011962542 | 95 |
| 7 | 3300025900 | Ga0207710_10241548 | Ga0207710_102415482 | 95 |
| 8 | 3300025936 | Ga0207670_10700241 | Ga0207670_107002412 | 97 |
| 9 | 3300033541 | Ga0316596_1101078 | Ga0316596_11010782 | 97 |
| 10 | 3300041451 | Ga0451791_1344492 | Ga0451791_1344492_245_538 | 97 |
| 11 | 3300049569 | Ga0501032_0037596 | Ga0501032_0037596_1961_2254 | 97 |
| 12 | 3300049570 | Ga0501033_0059370 | Ga0501033_0059370_860_1153 | 97 |
| 13 | 3300049572 | Ga0501036_0273418 | Ga0501036_0273418_919_1212 | 97 |
| 14 | 3300049573 | Ga0501037_0000191 | Ga0501037_0000191_54650_54943 | 97 |
| 15 | 3300049579 | Ga0501043_0000080 | Ga0501043_0000080_1897_2190 | 97 |
| 16 | 3300049581 | Ga0501047_0560620 | Ga0501047_0560620_330_623 | 97 |
| 17 | 3300049582 | Ga0501048_0940235 | Ga0501048_0940235_306_599 | 97 |
| 18 | 3300049585 | Ga0501069_0000091 | Ga0501069_0000091_1111_1404 | 97 |
| 19 | 3300049586 | Ga0501070_0014064 | Ga0501070_0014064_4548_4841 | 97 |
| 20 | 3300049587 | Ga0501071_0045783 | Ga0501071_0045783_1122_1415 | 97 |
| 21 | 3300049589 | Ga0501073_0040996 | Ga0501073_0040996_1117_1410 | 97 |
| 22 | 3300049590 | Ga0501074_0002583 | Ga0501074_0002583_1876_2169 | 97 |
| 23 | 3300049741 | Ga0501079_0578838 | Ga0501079_0578838_132_425 | 97 |
| 24 | 3300049742 | Ga0501080_0075363 | Ga0501080_0075363_949_1242 | 97 |
| 25 | 3300049744 | Ga0501083_0001214 | Ga0501083_0001214_15262_15555 | 97 |
| 26 | 3300049822 | Ga0501035_0072152 | Ga0501035_0072152_1897_2190 | 97 |
| 27 | 3300049823 | Ga0501044_0092128 | Ga0501044_0092128_1897_2190 | 97 |
| 28 | 3300060353 | Ga0501082_0113976 | Ga0501082_0113976_743_1036 | 97 |
| 29 | 3300031235 | Ga0265330_10283293 | Ga0265330_102832932 | 98 |
| 30 | 3300031239 | Ga0265328_10000129 | Ga0265328_100001295 | 98 |
| 31 | 3300031239 | Ga0265328_10068299 | Ga0265328_100682992 | 98 |
| 32 | 3300031242 | Ga0265329_10004194 | Ga0265329_1000419411 | 98 |
| 33 | 3300031247 | Ga0265340_10220938 | Ga0265340_102209382 | 98 |
| 34 | 3300031250 | Ga0265331_10001125 | Ga0265331_1000112521 | 98 |
| 35 | 3300031251 | Ga0265327_10044157 | Ga0265327_100441573 | 98 |
| 36 | 3300031344 | Ga0265316_10016003 | Ga0265316_100160033 | 98 |
| 37 | 3300031344 | Ga0265316_10405158 | Ga0265316_104051581 | 98 |
| 38 | 3300031712 | Ga0265342_10059693 | Ga0265342_100596931 | 98 |
| 39 | 3300037418 | Ga0395900_0923344 | Ga0395900_0923344_150_446 | 98 |
| 40 | 3300038443 | Ga0395901_1121166 | Ga0395901_1121166_420_716 | 98 |
| 41 | 3300039437 | Ga0436365_1660078 | Ga0436365_1660078_601_897 | 98 |
| 42 | 3300039450 | Ga0436363_0240412 | Ga0436363_0240412_225_521 | 98 |
| 43 | 3300047320 | Ga0495672_0053242 | Ga0495672_0053242_238_534 | 98 |
| 44 | 3300047320 | Ga0495672_0415684 | Ga0495672_0415684_92_388 | 98 |
| 45 | 3300049591 | Ga0501075_1525655 | Ga0501075_1525655_37_333 | 98 |
| 46 | 3300005328 | Ga0070676_10497773 | Ga0070676_104977732 | 99 |
| 47 | 3300005329 | Ga0070683_102337481 | Ga0070683_1023374811 | 99 |
| 48 | 3300005330 | Ga0070690_100064067 | Ga0070690_1000640675 | 99 |
| 49 | 3300005331 | Ga0070670_100409570 | Ga0070670_1004095702 | 99 |
| 50 | 3300005331 | Ga0070670_100686642 | Ga0070670_1006866422 | 99 |
| 51 | 3300005334 | Ga0068869_101021642 | Ga0068869_1010216422 | 99 |
| 52 | 3300005335 | Ga0070666_11318960 | Ga0070666_113189601 | 99 |
| 53 | 3300005336 | Ga0070680_100004922 | Ga0070680_1000049224 | 99 |
| 54 | 3300005337 | Ga0070682_101232756 | Ga0070682_1012327562 | 99 |
| 55 | 3300005340 | Ga0070689_100912641 | Ga0070689_1009126411 | 99 |
| 56 | 3300005340 | Ga0070689_101301101 | Ga0070689_1013011012 | 99 |
| 57 | 3300005343 | Ga0070687_100140311 | Ga0070687_1001403112 | 99 |
| 58 | 3300005347 | Ga0070668_101698707 | Ga0070668_1016987072 | 99 |
| 59 | 3300005353 | Ga0070669_101034119 | Ga0070669_1010341192 | 99 |
| 60 | 3300005354 | Ga0070675_100140583 | Ga0070675_1001405832 | 99 |
| 61 | 3300005355 | Ga0070671_100494700 | Ga0070671_1004947002 | 99 |
| 62 | 3300005356 | Ga0070674_100369465 | Ga0070674_1003694652 | 99 |
| 63 | 3300005365 | Ga0070688_100155629 | Ga0070688_1001556292 | 99 |
| 64 | 3300005365 | Ga0070688_101777838 | Ga0070688_1017778382 | 99 |
| 65 | 3300005366 | Ga0070659_100892304 | Ga0070659_1008923042 | 99 |
| 66 | 3300005367 | Ga0070667_100298344 | Ga0070667_1002983443 | 99 |
| 67 | 3300005367 | Ga0070667_101089218 | Ga0070667_1010892182 | 99 |
| 68 | 3300005434 | Ga0070709_10835980 | Ga0070709_108359802 | 99 |
| 69 | 3300005438 | Ga0070701_10380328 | Ga0070701_103803282 | 99 |
| 70 | 3300005441 | Ga0070700_101326393 | Ga0070700_1013263932 | 99 |
| 71 | 3300005444 | Ga0070694_101200225 | Ga0070694_1012002252 | 99 |
| 72 | 3300005457 | Ga0070662_100271769 | Ga0070662_1002717692 | 99 |
| 73 | 3300005458 | Ga0070681_10039142 | Ga0070681_100391425 | 99 |
| 74 | 3300005458 | Ga0070681_10257591 | Ga0070681_102575912 | 99 |
| 75 | 3300005458 | Ga0070681_10544016 | Ga0070681_105440162 | 99 |
| 76 | 3300005459 | Ga0068867_100305758 | Ga0068867_1003057583 | 99 |
| 77 | 3300005466 | Ga0070685_10323103 | Ga0070685_103231032 | 99 |
| 78 | 3300005530 | Ga0070679_100040114 | Ga0070679_1000401145 | 99 |
| 79 | 3300005530 | Ga0070679_101075760 | Ga0070679_1010757602 | 99 |
| 80 | 3300005543 | Ga0070672_100294774 | Ga0070672_1002947742 | 99 |
| 81 | 3300005544 | Ga0070686_100177076 | Ga0070686_1001770762 | 99 |
| 82 | 3300005544 | Ga0070686_100945791 | Ga0070686_1009457912 | 99 |
| 83 | 3300005544 | Ga0070686_100951489 | Ga0070686_1009514892 | 99 |
| 84 | 3300005547 | Ga0070693_100061798 | Ga0070693_1000617983 | 99 |
| 85 | 3300005548 | Ga0070665_100287765 | Ga0070665_1002877653 | 99 |
| 86 | 3300005549 | Ga0070704_101800498 | Ga0070704_1018004982 | 99 |
| 87 | 3300005616 | Ga0068852_100688555 | Ga0068852_1006885552 | 99 |
| 88 | 3300005618 | Ga0068864_100016814 | Ga0068864_1000168143 | 99 |
| 89 | 3300005618 | Ga0068864_101619112 | Ga0068864_1016191121 | 99 |
| 90 | 3300005718 | Ga0068866_10316151 | Ga0068866_103161512 | 99 |
| 91 | 3300005719 | Ga0068861_100573424 | Ga0068861_1005734242 | 99 |
| 92 | 3300005719 | Ga0068861_100637812 | Ga0068861_1006378122 | 99 |
| 93 | 3300005719 | Ga0068861_101683616 | Ga0068861_1016836162 | 99 |
| 94 | 3300005842 | Ga0068858_100644009 | Ga0068858_1006440093 | 99 |
| 95 | 3300005983 | Ga0081540_1080649 | Ga0081540_10806492 | 99 |
| 96 | 3300006028 | Ga0070717_10235653 | Ga0070717_102356533 | 99 |
| 97 | 3300006038 | Ga0075365_10543520 | Ga0075365_105435202 | 99 |
| 98 | 3300006048 | Ga0075363_100172626 | Ga0075363_1001726262 | 99 |
| 99 | 3300006048 | Ga0075363_100814191 | Ga0075363_1008141912 | 99 |
| 100 | 3300006163 | Ga0070715_10518171 | Ga0070715_105181711 | 99 |
| 101 | 3300006173 | Ga0070716_100688448 | Ga0070716_1006884482 | 99 |
| 102 | 3300006177 | Ga0075362_10278047 | Ga0075362_102780472 | 99 |
| 103 | 3300006177 | Ga0075362_10365895 | Ga0075362_103658952 | 99 |
| 104 | 3300006178 | Ga0075367_10081978 | Ga0075367_100819783 | 99 |
| 105 | 3300006178 | Ga0075367_10116045 | Ga0075367_101160452 | 99 |
| 106 | 3300006195 | Ga0075366_10007231 | Ga0075366_1000723111 | 99 |
| 107 | 3300006195 | Ga0075366_10013189 | Ga0075366_100131895 | 99 |
| 108 | 3300006195 | Ga0075366_10038153 | Ga0075366_100381532 | 99 |
| 109 | 3300006195 | Ga0075366_11030761 | Ga0075366_110307611 | 99 |
| 110 | 3300006237 | Ga0097621_100122566 | Ga0097621_1001225662 | 99 |
| 111 | 3300006237 | Ga0097621_100852498 | Ga0097621_1008524982 | 99 |
| 112 | 3300006237 | Ga0097621_101986048 | Ga0097621_1019860481 | 99 |
| 113 | 3300006358 | Ga0068871_101008421 | Ga0068871_1010084212 | 99 |
| 114 | 3300006871 | Ga0075434_101482429 | Ga0075434_1014824292 | 99 |
| 115 | 3300007076 | Ga0075435_101409965 | Ga0075435_1014099652 | 99 |
| 116 | 3300007788 | Ga0099795_10127919 | Ga0099795_101279192 | 99 |
| 117 | 3300009094 | Ga0111539_10060664 | Ga0111539_100606649 | 99 |
| 118 | 3300009094 | Ga0111539_12293156 | Ga0111539_122931562 | 99 |
| 119 | 3300009098 | Ga0105245_11800287 | Ga0105245_118002872 | 99 |
| 120 | 3300009101 | Ga0105247_10166213 | Ga0105247_101662132 | 99 |
| 121 | 3300009176 | Ga0105242_10122649 | Ga0105242_101226493 | 99 |
| 122 | 3300009177 | Ga0105248_10099202 | Ga0105248_100992023 | 99 |
| 123 | 3300009545 | Ga0105237_10246271 | Ga0105237_102462712 | 99 |
| 124 | 3300009545 | Ga0105237_11062358 | Ga0105237_110623581 | 99 |
| 125 | 3300009551 | Ga0105238_10311541 | Ga0105238_103115412 | 99 |
| 126 | 3300009551 | Ga0105238_12495022 | Ga0105238_124950222 | 99 |
| 127 | 3300009553 | Ga0105249_10386652 | Ga0105249_103866522 | 99 |
| 128 | 3300010159 | Ga0099796_10476274 | Ga0099796_104762742 | 99 |
| 129 | 3300010375 | Ga0105239_11274454 | Ga0105239_112744542 | 99 |
| 130 | 3300013297 | Ga0157378_12037748 | Ga0157378_120377482 | 99 |
| 131 | 3300013306 | Ga0163162_10828800 | Ga0163162_108288002 | 99 |
| 132 | 3300013308 | Ga0157375_10353413 | Ga0157375_103534132 | 99 |
| 133 | 3300014497 | Ga0182008_10189510 | Ga0182008_101895101 | 99 |
| 134 | 3300014745 | Ga0157377_10324576 | Ga0157377_103245762 | 99 |
| 135 | 3300014968 | Ga0157379_10667744 | Ga0157379_106677442 | 99 |
| 136 | 3300014968 | Ga0157379_10959097 | Ga0157379_109590972 | 99 |
| 137 | 3300015265 | Ga0182005_1076003 | Ga0182005_10760031 | 99 |
| 138 | 3300015265 | Ga0182005_1185098 | Ga0182005_11850982 | 99 |
| 139 | 3300017792 | Ga0163161_10097218 | Ga0163161_100972185 | 99 |
| 140 | 3300017792 | Ga0163161_12041913 | Ga0163161_120419132 | 99 |
| 141 | 3300021384 | Ga0213876_10413764 | Ga0213876_104137642 | 99 |
| 142 | 3300025297 | Ga0209758_1000548 | Ga0209758_100054856 | 99 |
| 143 | 3300025302 | Ga0207426_1019059 | Ga0207426_10190595 | 99 |
| 144 | 3300025899 | Ga0207642_10150116 | Ga0207642_101501161 | 99 |
| 145 | 3300025900 | Ga0207710_10061673 | Ga0207710_100616732 | 99 |
| 146 | 3300025903 | Ga0207680_10652026 | Ga0207680_106520262 | 99 |
| 147 | 3300025908 | Ga0207643_10437555 | Ga0207643_104375552 | 99 |
| 148 | 3300025909 | Ga0207705_10198836 | Ga0207705_101988362 | 99 |
| 149 | 3300025912 | Ga0207707_10020771 | Ga0207707_1002077112 | 99 |
| 150 | 3300025914 | Ga0207671_10268480 | Ga0207671_102684802 | 99 |
| 151 | 3300025917 | Ga0207660_10059665 | Ga0207660_100596655 | 99 |
| 152 | 3300025918 | Ga0207662_10347525 | Ga0207662_103475252 | 99 |
| 153 | 3300025921 | Ga0207652_10037461 | Ga0207652_100374614 | 99 |
| 154 | 3300025921 | Ga0207652_10093381 | Ga0207652_100933812 | 99 |
| 155 | 3300025921 | Ga0207652_11781401 | Ga0207652_117814011 | 99 |
| 156 | 3300025923 | Ga0207681_11378610 | Ga0207681_113786101 | 99 |
| 157 | 3300025924 | Ga0207694_10260982 | Ga0207694_102609822 | 99 |
| 158 | 3300025924 | Ga0207694_10860652 | Ga0207694_108606522 | 99 |
| 159 | 3300025925 | Ga0207650_10196105 | Ga0207650_101961051 | 99 |
| 160 | 3300025925 | Ga0207650_10955711 | Ga0207650_109557112 | 99 |
| 161 | 3300025926 | Ga0207659_10700448 | Ga0207659_107004482 | 99 |
| 162 | 3300025926 | Ga0207659_11866491 | Ga0207659_118664912 | 99 |
| 163 | 3300025931 | Ga0207644_10085340 | Ga0207644_100853403 | 99 |
| 164 | 3300025931 | Ga0207644_11559031 | Ga0207644_115590312 | 99 |
| 165 | 3300025936 | Ga0207670_10110814 | Ga0207670_101108144 | 99 |
| 166 | 3300025936 | Ga0207670_10515265 | Ga0207670_105152652 | 99 |
| 167 | 3300025937 | Ga0207669_10233156 | Ga0207669_102331562 | 99 |
| 168 | 3300025937 | Ga0207669_10283236 | Ga0207669_102832362 | 99 |
| 169 | 3300025938 | Ga0207704_10388669 | Ga0207704_103886692 | 99 |
| 170 | 3300025939 | Ga0207665_10569264 | Ga0207665_105692642 | 99 |
| 171 | 3300025940 | Ga0207691_10511865 | Ga0207691_105118652 | 99 |
| 172 | 3300025941 | Ga0207711_10204371 | Ga0207711_102043712 | 99 |
| 173 | 3300025960 | Ga0207651_11176477 | Ga0207651_111764771 | 99 |
| 174 | 3300025961 | Ga0207712_10207690 | Ga0207712_102076903 | 99 |
| 175 | 3300025972 | Ga0207668_10180641 | Ga0207668_101806413 | 99 |
| 176 | 3300025972 | Ga0207668_10411378 | Ga0207668_104113781 | 99 |
| 177 | 3300025986 | Ga0207658_10795107 | Ga0207658_107951072 | 99 |
| 178 | 3300026023 | Ga0207677_11035463 | Ga0207677_110354632 | 99 |
| 179 | 3300026035 | Ga0207703_10309491 | Ga0207703_103094913 | 99 |
| 180 | 3300026067 | Ga0207678_10375624 | Ga0207678_103756242 | 99 |
| 181 | 3300026075 | Ga0207708_10102376 | Ga0207708_101023765 | 99 |
| 182 | 3300026088 | Ga0207641_10747650 | Ga0207641_107476501 | 99 |
| 183 | 3300026089 | Ga0207648_10750213 | Ga0207648_107502131 | 99 |
| 184 | 3300026095 | Ga0207676_10108953 | Ga0207676_101089534 | 99 |
| 185 | 3300026121 | Ga0207683_10063505 | Ga0207683_100635054 | 99 |
| 186 | 3300026142 | Ga0207698_10786420 | Ga0207698_107864202 | 99 |
| 187 | 3300028379 | Ga0268266_10421589 | Ga0268266_104215892 | 99 |
| 188 | 3300028379 | Ga0268266_11006931 | Ga0268266_110069311 | 99 |
| 189 | 3300028380 | Ga0268265_12171584 | Ga0268265_121715842 | 99 |
| 190 | 3300028381 | Ga0268264_10310000 | Ga0268264_103100003 | 99 |
| 191 | 3300031238 | Ga0265332_10436973 | Ga0265332_104369732 | 99 |
| 192 | 3300031241 | Ga0265325_10144642 | Ga0265325_101446423 | 99 |
| 193 | 3300031247 | Ga0265340_10092056 | Ga0265340_100920562 | 99 |
| 194 | 3300031247 | Ga0265340_10408130 | Ga0265340_104081302 | 99 |
| 195 | 3300031456 | Ga0307513_10200665 | Ga0307513_102006652 | 99 |
| 196 | 3300031712 | Ga0265342_10322342 | Ga0265342_103223421 | 99 |
| 197 | 3300031824 | Ga0307413_10462880 | Ga0307413_104628802 | 99 |
| 198 | 3300032002 | Ga0307416_101538990 | Ga0307416_1015389902 | 99 |
| 199 | 3300032005 | Ga0307411_11550968 | Ga0307411_115509682 | 99 |
| 200 | 3300032126 | Ga0307415_101355857 | Ga0307415_1013558572 | 99 |
| 201 | 3300033180 | Ga0307510_10281325 | Ga0307510_102813252 | 99 |
| 202 | 3300034816 | Ga0373930_0012668 | Ga0373930_0012668_779_1078 | 99 |
| 203 | 3300034817 | Ga0373948_0048488 | Ga0373948_0048488_166_465 | 99 |
| 204 | 3300034818 | Ga0373950_0170155 | Ga0373950_0170155_24_323 | 99 |
| 205 | 3300035085 | Ga0373929_0009301 | Ga0373929_0009301_1091_1390 | 99 |
| 206 | 3300035090 | Ga0373949_0020853 | Ga0373949_0020853_738_1037 | 99 |
| 207 | 3300035091 | Ga0373951_0043729 | Ga0373951_0043729_62_361 | 99 |
| 208 | 3300035112 | Ga0373932_0048633 | Ga0373932_0048633_435_734 | 99 |
| 209 | 3300035114 | Ga0373939_0160427 | Ga0373939_0160427_481_780 | 99 |
| 210 | 3300035121 | Ga0373960_0052296 | Ga0373960_0052296_487_786 | 99 |
| 211 | 3300035170 | Ga0373943_0291153 | Ga0373943_0291153_256_555 | 99 |
| 212 | 3300035172 | Ga0373955_0190957 | Ga0373955_0190957_851_1150 | 99 |
| 213 | 3300035207 | Ga0373942_0087765 | Ga0373942_0087765_505_804 | 99 |
| 214 | 3300035207 | Ga0373942_0090162 | Ga0373942_0090162_484_783 | 99 |
| 215 | 3300035241 | Ga0373961_0131708 | Ga0373961_0131708_235_534 | 99 |
| 216 | 3300035691 | Ga0373931_0046911 | Ga0373931_0046911_1193_1492 | 99 |
| 217 | 3300035692 | Ga0373935_0225805 | Ga0373935_0225805_87_386 | 99 |
| 218 | 3300035724 | Ga0373933_0473593 | Ga0373933_0473593_362_661 | 99 |
| 219 | 3300035724 | Ga0373933_0855821 | Ga0373933_0855821_232_531 | 99 |
| 220 | 3300035725 | Ga0373947_0457021 | Ga0373947_0457021_98_397 | 99 |
| 221 | 3300037068 | Ga0373925_0156062 | Ga0373925_0156062_28_327 | 99 |
| 222 | 3300037471 | Ga0395905_1874582 | Ga0395905_1874582_186_485 | 99 |
| 223 | 3300039437 | Ga0436365_1200072 | Ga0436365_1200072_1129_1428 | 99 |
| 224 | 3300039438 | Ga0436360_0611394 | Ga0436360_0611394_234_533 | 99 |
| 225 | 3300039438 | Ga0436360_0858015 | Ga0436360_0858015_313_612 | 99 |
| 226 | 3300039447 | Ga0436361_0941261 | Ga0436361_0941261_81_380 | 99 |
| 227 | 3300039450 | Ga0436363_0285709 | Ga0436363_0285709_83_382 | 99 |
| 228 | 3300039450 | Ga0436363_1187923 | Ga0436363_1187923_242_541 | 99 |
| 229 | 3300039453 | Ga0436362_0367590 | Ga0436362_0367590_418_717 | 99 |
| 230 | 3300039453 | Ga0436362_1207375 | Ga0436362_1207375_451_750 | 99 |
| 231 | 3300041407 | Ga0439447_092817 | Ga0439447_092817_214_513 | 99 |
| 232 | 3300042131 | Ga0450894_073624 | Ga0450894_073624_139_438 | 99 |
| 233 | 3300042436 | Ga0439435_0080051 | Ga0439435_0080051_455_754 | 99 |
| 234 | 3300042438 | Ga0439459_0041698 | Ga0439459_0041698_498_797 | 99 |
| 235 | 3300044693 | Ga0466961_0924790 | Ga0466961_0924790_121_420 | 99 |
| 236 | 3300045976 | Ga0466967_0405609 | Ga0466967_0405609_878_1177 | 99 |
| 237 | 3300046459 | Ga0495629_0572716 | Ga0495629_0572716_173_472 | 99 |
| 238 | 3300046543 | Ga0495645_0950428 | Ga0495645_0950428_187_486 | 99 |
| 239 | 3300046664 | Ga0495659_0089938 | Ga0495659_0089938_798_1097 | 99 |
| 240 | 3300046794 | Ga0495589_0256713 | Ga0495589_0256713_185_484 | 99 |
| 241 | 3300047317 | Ga0495604_0267655 | Ga0495604_0267655_76_375 | 99 |
| 242 | 3300047319 | Ga0495674_0400752 | Ga0495674_0400752_568_867 | 99 |
| 243 | 3300047322 | Ga0495680_0705488 | Ga0495680_0705488_352_651 | 99 |
| 244 | 3300047469 | Ga0495673_0358210 | Ga0495673_0358210_72_371 | 99 |
| 245 | 3300048903 | Ga0496100_0177022 | Ga0496100_0177022_400_699 | 99 |
| 246 | 3300048904 | Ga0496101_0014870 | Ga0496101_0014870_765_1064 | 99 |
| 247 | 3300048905 | Ga0496102_0067172 | Ga0496102_0067172_884_1183 | 99 |
| 248 | 3300048906 | Ga0496103_0061364 | Ga0496103_0061364_40_339 | 99 |
| 249 | 3300048907 | Ga0496104_0101217 | Ga0496104_0101217_569_868 | 99 |
| 250 | 3300048908 | Ga0496105_0035470 | Ga0496105_0035470_1758_2057 | 99 |
| 251 | 3300048909 | Ga0496106_0233931 | Ga0496106_0233931_1009_1308 | 99 |
| 252 | 3300048910 | Ga0496107_0092306 | Ga0496107_0092306_61_360 | 99 |
| 253 | 3300048911 | Ga0496108_0071844 | Ga0496108_0071844_1048_1347 | 99 |
| 254 | 3300048911 | Ga0496108_0539287 | Ga0496108_0539287_47_346 | 99 |
| 255 | 3300048912 | Ga0496109_0054198 | Ga0496109_0054198_2077_2376 | 99 |
| 256 | 3300048913 | Ga0496110_0121916 | Ga0496110_0121916_1891_2190 | 99 |
| 257 | 3300048914 | Ga0496111_0177046 | Ga0496111_0177046_732_1031 | 99 |
| 258 | 3300048915 | Ga0496112_0118329 | Ga0496112_0118329_998_1297 | 99 |
| 259 | 3300048915 | Ga0496112_0308603 | Ga0496112_0308603_398_697 | 99 |
| 260 | 3300048916 | Ga0496113_0444654 | Ga0496113_0444654_304_603 | 99 |
| 261 | 3300048918 | Ga0496115_0024784 | Ga0496115_0024784_2400_2699 | 99 |
| 262 | 3300048918 | Ga0496115_0049337 | Ga0496115_0049337_28_327 | 99 |
| 263 | 3300049584 | Ga0501068_0626878 | Ga0501068_0626878_207_506 | 99 |
| 264 | 3300049589 | Ga0501073_0834745 | Ga0501073_0834745_242_541 | 99 |
| 265 | 3300049741 | Ga0501079_0667145 | Ga0501079_0667145_420_719 | 99 |
| 266 | 3300049742 | Ga0501080_0511307 | Ga0501080_0511307_108_407 | 99 |
| 267 | 3300050489 | nmdc:mga03683_278950_c1 | nmdc:mga03683_278950_c1_249_548 | 99 |
| 268 | 3300050490 | nmdc:mga03n38_607148_c1 | nmdc:mga03n38_607148_c1_223_522 | 99 |
| 269 | 3300050492 | nmdc:mga0yw44_302857_c1 | nmdc:mga0yw44_302857_c1_95_394 | 99 |
| 270 | 3300050493 | nmdc:mga0k408_25101_c1 | nmdc:mga0k408_25101_c1_563_862 | 99 |
| 271 | 3300050493 | nmdc:mga0k408_4095_c1 | nmdc:mga0k408_4095_c1_286_585 | 99 |
| 272 | 3300050493 | nmdc:mga0k408_780026_c1 | nmdc:mga0k408_780026_c1_109_408 | 99 |
| 273 | 3300050493 | nmdc:mga0k408_98907_c1 | nmdc:mga0k408_98907_c1_793_1092 | 99 |
| 274 | 3300050494 | nmdc:mga06z11_131797_c1 | nmdc:mga06z11_131797_c1_1021_1320 | 99 |
| 275 | 3300050494 | nmdc:mga06z11_172734_c1 | nmdc:mga06z11_172734_c1_444_743 | 99 |
| 276 | 3300050494 | nmdc:mga06z11_372392_c1 | nmdc:mga06z11_372392_c1_264_563 | 99 |
| 277 | 3300050495 | nmdc:mga04h51_513537_c1 | nmdc:mga04h51_513537_c1_49_348 | 99 |
| 278 | 3300050511 | nmdc:mga08y16_1096076_c1 | nmdc:mga08y16_1096076_c1_153_452 | 99 |
| 279 | 3300050512 | nmdc:mga0n895_761735_c1 | nmdc:mga0n895_761735_c1_603_902 | 99 |
| 280 | 3300050513 | nmdc:mga0rr50_756197_c1 | nmdc:mga0rr50_756197_c1_515_814 | 99 |
| 281 | 3300050516 | nmdc:mga0sz30_192635_c1 | nmdc:mga0sz30_192635_c1_407_706 | 99 |
| 282 | 3300053077 | Ga0495601_0050869 | Ga0495601_0050869_680_979 | 99 |
| 283 | 3300053083 | Ga0495655_0010736 | Ga0495655_0010736_299_598 | 99 |
| 284 | 3300053083 | Ga0495655_0180561 | Ga0495655_0180561_91_390 | 99 |
| 285 | 3300053084 | Ga0495595_0069895 | Ga0495595_0069895_350_649 | 99 |
| 286 | 3300053085 | Ga0495619_1125224 | Ga0495619_1125224_211_510 | 99 |
| 287 | 3300053086 | Ga0500578_0400604 | Ga0500578_0400604_171_470 | 99 |
| 288 | 3300053090 | Ga0500646_0040773 | Ga0500646_0040773_567_866 | 99 |
| 289 | 3300053104 | Ga0500556_0200021 | Ga0500556_0200021_211_510 | 99 |
| 290 | 3300053108 | Ga0500562_083776 | Ga0500562_083776_29_328 | 99 |
| 291 | 3300053117 | Ga0500593_181685 | Ga0500593_181685_235_534 | 99 |
| 292 | 3300053118 | Ga0500594_0173443 | Ga0500594_0173443_277_576 | 99 |
| 293 | 3300053130 | Ga0500642_0009901 | Ga0500642_0009901_1738_2037 | 99 |
| 294 | 3300053131 | Ga0500652_145430 | Ga0500652_145430_303_602 | 99 |
| 295 | 3300053151 | Ga0500604_0206745 | Ga0500604_0206745_75_374 | 99 |
| 296 | 3300053153 | Ga0500616_0073152 | Ga0500616_0073152_960_1259 | 99 |
| 297 | 3300053156 | Ga0500622_0002771 | Ga0500622_0002771_5458_5757 | 99 |
| 298 | 3300053730 | Ga0500645_088783 | Ga0500645_088783_83_382 | 99 |
| 299 | 3300054114 | Ga0501084_0151360 | Ga0501084_0151360_1051_1350 | 99 |
| 300 | 3300060353 | Ga0501082_0282717 | Ga0501082_0282717_232_531 | 99 |
| 301 | 3300060353 | Ga0501082_0486754 | Ga0501082_0486754_639_938 | 99 |
| 302 | 3300009553 | Ga0105249_10134716 | Ga0105249_101347165 | 101 |
| 303 | 3300025961 | Ga0207712_10124942 | Ga0207712_101249425 | 101 |
| 304 | 3300041443 | Ga0451789_0831186 | Ga0451789_0831186_30_338 | 102 |
| 305 | 3300005367 | Ga0070667_100000088 | Ga0070667_10000008858 | 103 |
| 306 | 3300005841 | Ga0068863_100008669 | Ga0068863_1000086693 | 103 |
| 307 | 3300005843 | Ga0068860_100000220 | Ga0068860_10000022036 | 103 |
| 308 | 3300006353 | Ga0075370_10017297 | Ga0075370_100172975 | 103 |
| 309 | 3300009553 | Ga0105249_12035842 | Ga0105249_120358421 | 103 |
| 310 | 3300012492 | Ga0157335_1041120 | Ga0157335_10411201 | 103 |
| 311 | 3300025903 | Ga0207680_10151589 | Ga0207680_101515893 | 103 |
| 312 | 3300025986 | Ga0207658_10000064 | Ga0207658_1000006459 | 103 |
| 313 | 3300026088 | Ga0207641_10003421 | Ga0207641_100034211 | 103 |
| 314 | 3300028381 | Ga0268264_10000384 | Ga0268264_100003842 | 103 |
| 315 | 3300041512 | Ga0451853_0270632 | Ga0451853_0270632_56_370 | 103 |
| 316 | 3300005333 | Ga0070677_10000836 | Ga0070677_100008365 | 104 |
| 317 | 3300005335 | Ga0070666_10122703 | Ga0070666_101227034 | 104 |
| 318 | 3300005335 | Ga0070666_10271576 | Ga0070666_102715761 | 104 |
| 319 | 3300005578 | Ga0068854_100521673 | Ga0068854_1005216732 | 104 |
| 320 | 3300013100 | Ga0157373_10611096 | Ga0157373_106110962 | 104 |
| 321 | 3300021377 | Ga0213874_10113685 | Ga0213874_101136852 | 104 |
| 322 | 3300025893 | Ga0207682_10010516 | Ga0207682_100105161 | 104 |
| 323 | 3300025981 | Ga0207640_11123746 | Ga0207640_111237462 | 104 |
| 324 | 3300026067 | Ga0207678_11549583 | Ga0207678_115495831 | 104 |
| 325 | 3300031548 | Ga0307408_100002738 | Ga0307408_10000273822 | 104 |
| 326 | 3300031731 | Ga0307405_10503259 | Ga0307405_105032592 | 104 |
| 327 | 3300031824 | Ga0307413_10176896 | Ga0307413_101768962 | 104 |
| 328 | 3300031901 | Ga0307406_10011946 | Ga0307406_100119466 | 104 |
| 329 | 3300031901 | Ga0307406_11380337 | Ga0307406_113803372 | 104 |
| 330 | 3300031903 | Ga0307407_10726438 | Ga0307407_107264382 | 104 |
| 331 | 3300031911 | Ga0307412_10138587 | Ga0307412_101385872 | 104 |
| 332 | 3300031995 | Ga0307409_100372070 | Ga0307409_1003720702 | 104 |
| 333 | 3300032002 | Ga0307416_100095222 | Ga0307416_1000952222 | 104 |
| 334 | 3300032002 | Ga0307416_100351348 | Ga0307416_1003513482 | 104 |
| 335 | 3300032002 | Ga0307416_102386601 | Ga0307416_1023866012 | 104 |
| 336 | 3300032004 | Ga0307414_10499576 | Ga0307414_104995762 | 104 |
| 337 | 3300032005 | Ga0307411_10307164 | Ga0307411_103071642 | 104 |
| 338 | 3300032005 | Ga0307411_10612816 | Ga0307411_106128162 | 104 |
| 339 | 3300032126 | Ga0307415_101447163 | Ga0307415_1014471631 | 104 |
| 340 | 3300035090 | Ga0373949_0081538 | Ga0373949_0081538_223_543 | 104 |
| 341 | 3300035725 | Ga0373947_0503582 | Ga0373947_0503582_58_384 | 104 |
| 342 | 3300039450 | Ga0436363_1389226 | Ga0436363_1389226_874_1200 | 104 |
| 343 | 3300041444 | Ga0451790_07228 | Ga0451790_07228_93_416 | 104 |
| 344 | 3300042000 | Ga0439437_039413 | Ga0439437_039413_108_422 | 104 |
| 345 | 3300042001 | Ga0439441_113155 | Ga0439441_113155_229_543 | 104 |
| 346 | 3300048914 | Ga0496111_0494249 | Ga0496111_0494249_74_394 | 104 |
| 347 | 3300048915 | Ga0496112_0363032 | Ga0496112_0363032_206_526 | 104 |
| 348 | 3300049523 | Ga0501300_039689 | Ga0501300_039689_76_390 | 104 |
| 349 | 3300049686 | Ga0501257_001130 | Ga0501257_001130_1612_1926 | 104 |
| 350 | 3300049776 | Ga0501280_006929 | Ga0501280_006929_321_635 | 104 |
| 351 | 3300053090 | Ga0500646_0004531 | Ga0500646_0004531_1663_1986 | 104 |
| 352 | 3300053139 | Ga0500568_0035867 | Ga0500568_0035867_733_1056 | 104 |
| 353 | 3300053140 | Ga0500573_0000559 | Ga0500573_0000559_12893_13207 | 104 |
| 354 | 3300053140 | Ga0500573_0293206 | Ga0500573_0293206_252_572 | 104 |
| 355 | 3300053151 | Ga0500604_0000014 | Ga0500604_0000014_5063_5386 | 104 |
| 356 | 3300053153 | Ga0500616_0006579 | Ga0500616_0006579_2063_2386 | 104 |
| 357 | 3300001915 | JGI24741J21665_1001831 | JGI24741J21665_10018313 | 105 |
| 358 | 3300001979 | JGI24740J21852_10047162 | JGI24740J21852_100471622 | 105 |
| 359 | 3300001989 | JGI24739J22299_10021603 | JGI24739J22299_100216034 | 105 |
| 360 | 3300001989 | JGI24739J22299_10162692 | JGI24739J22299_101626922 | 105 |
| 361 | 3300001990 | JGI24737J22298_10008367 | JGI24737J22298_100083673 | 105 |
| 362 | 3300001990 | JGI24737J22298_10061502 | JGI24737J22298_100615021 | 105 |
| 363 | 3300001990 | JGI24737J22298_10257332 | JGI24737J22298_102573322 | 105 |
| 364 | 3300001991 | JGI24743J22301_10003761 | JGI24743J22301_100037614 | 105 |
| 365 | 3300001991 | JGI24743J22301_10051053 | JGI24743J22301_100510532 | 105 |
| 366 | 3300002067 | JGI24735J21928_10022221 | JGI24735J21928_100222213 | 105 |
| 367 | 3300002067 | JGI24735J21928_10024597 | JGI24735J21928_100245972 | 105 |
| 368 | 3300002074 | JGI24748J21848_1034612 | JGI24748J21848_10346122 | 105 |
| 369 | 3300002075 | JGI24738J21930_10011077 | JGI24738J21930_100110772 | 105 |
| 370 | 3300002075 | JGI24738J21930_10066840 | JGI24738J21930_100668402 | 105 |
| 371 | 3300002077 | JGI24744J21845_10000585 | JGI24744J21845_1000058516 | 105 |
| 372 | 3300003308 | Ga0006777J48905_1085348 | Ga0006777J48905_10853482 | 105 |
| 373 | 3300003559 | Ga0007427J51700_122592 | Ga0007427J51700_1225922 | 105 |
| 374 | 3300003579 | Ga0007429J51699_1030351 | Ga0007429J51699_10303513 | 105 |
| 375 | 3300003762 | Ga0055542_1007804 | Ga0055542_10078043 | 105 |
| 376 | 3300003762 | Ga0055542_1010957 | Ga0055542_10109571 | 105 |
| 377 | 3300003763 | Ga0055529_1015382 | Ga0055529_10153822 | 105 |
| 378 | 3300004800 | Ga0058861_11875447 | Ga0058861_118754472 | 105 |
| 379 | 3300005293 | Ga0065715_10785221 | Ga0065715_107852212 | 105 |
| 380 | 3300005327 | Ga0070658_10056264 | Ga0070658_100562642 | 105 |
| 381 | 3300005327 | Ga0070658_10119266 | Ga0070658_101192663 | 105 |
| 382 | 3300005327 | Ga0070658_10167844 | Ga0070658_101678442 | 105 |
| 383 | 3300005327 | Ga0070658_10284239 | Ga0070658_102842391 | 105 |
| 384 | 3300005328 | Ga0070676_10007059 | Ga0070676_100070592 | 105 |
| 385 | 3300005328 | Ga0070676_10499120 | Ga0070676_104991201 | 105 |
| 386 | 3300005328 | Ga0070676_10708739 | Ga0070676_107087392 | 105 |
| 387 | 3300005329 | Ga0070683_102354244 | Ga0070683_1023542441 | 105 |
| 388 | 3300005331 | Ga0070670_100186607 | Ga0070670_1001866072 | 105 |
| 389 | 3300005331 | Ga0070670_100245739 | Ga0070670_1002457392 | 105 |
| 390 | 3300005334 | Ga0068869_100000029 | Ga0068869_10000002926 | 105 |
| 391 | 3300005336 | Ga0070680_100237570 | Ga0070680_1002375703 | 105 |
| 392 | 3300005336 | Ga0070680_101006128 | Ga0070680_1010061282 | 105 |
| 393 | 3300005337 | Ga0070682_101205382 | Ga0070682_1012053821 | 105 |
| 394 | 3300005338 | Ga0068868_100000403 | Ga0068868_1000004034 | 105 |
| 395 | 3300005338 | Ga0068868_100000503 | Ga0068868_10000050334 | 105 |
| 396 | 3300005338 | Ga0068868_101210622 | Ga0068868_1012106222 | 105 |
| 397 | 3300005339 | Ga0070660_100059046 | Ga0070660_1000590464 | 105 |
| 398 | 3300005339 | Ga0070660_100071753 | Ga0070660_1000717531 | 105 |
| 399 | 3300005339 | Ga0070660_100124724 | Ga0070660_1001247243 | 105 |
| 400 | 3300005339 | Ga0070660_100128492 | Ga0070660_1001284923 | 105 |
| 401 | 3300005339 | Ga0070660_100254934 | Ga0070660_1002549343 | 105 |
| 402 | 3300005339 | Ga0070660_100649332 | Ga0070660_1006493322 | 105 |
| 403 | 3300005339 | Ga0070660_100837217 | Ga0070660_1008372172 | 105 |
| 404 | 3300005339 | Ga0070660_101942254 | Ga0070660_1019422541 | 105 |
| 405 | 3300005344 | Ga0070661_100022453 | Ga0070661_1000224535 | 105 |
| 406 | 3300005344 | Ga0070661_100262903 | Ga0070661_1002629032 | 105 |
| 407 | 3300005344 | Ga0070661_100450718 | Ga0070661_1004507182 | 105 |
| 408 | 3300005344 | Ga0070661_100621413 | Ga0070661_1006214132 | 105 |
| 409 | 3300005344 | Ga0070661_100899826 | Ga0070661_1008998261 | 105 |
| 410 | 3300005345 | Ga0070692_10089416 | Ga0070692_100894162 | 105 |
| 411 | 3300005345 | Ga0070692_10947100 | Ga0070692_109471002 | 105 |
| 412 | 3300005347 | Ga0070668_100236624 | Ga0070668_1002366242 | 105 |
| 413 | 3300005347 | Ga0070668_101013444 | Ga0070668_1010134441 | 105 |
| 414 | 3300005353 | Ga0070669_100640431 | Ga0070669_1006404312 | 105 |
| 415 | 3300005353 | Ga0070669_101746244 | Ga0070669_1017462441 | 105 |
| 416 | 3300005354 | Ga0070675_100037136 | Ga0070675_1000371367 | 105 |
| 417 | 3300005354 | Ga0070675_100106783 | Ga0070675_1001067833 | 105 |
| 418 | 3300005354 | Ga0070675_101170349 | Ga0070675_1011703492 | 105 |
| 419 | 3300005355 | Ga0070671_100158554 | Ga0070671_1001585543 | 105 |
| 420 | 3300005356 | Ga0070674_100210736 | Ga0070674_1002107363 | 105 |
| 421 | 3300005356 | Ga0070674_100683528 | Ga0070674_1006835281 | 105 |
| 422 | 3300005364 | Ga0070673_100000022 | Ga0070673_10000002295 | 105 |
| 423 | 3300005364 | Ga0070673_100115677 | Ga0070673_1001156772 | 105 |
| 424 | 3300005364 | Ga0070673_100297730 | Ga0070673_1002977301 | 105 |
| 425 | 3300005366 | Ga0070659_100000159 | Ga0070659_10000015937 | 105 |
| 426 | 3300005366 | Ga0070659_100128898 | Ga0070659_1001288982 | 105 |
| 427 | 3300005367 | Ga0070667_100363216 | Ga0070667_1003632162 | 105 |
| 428 | 3300005367 | Ga0070667_100825038 | Ga0070667_1008250382 | 105 |
| 429 | 3300005438 | Ga0070701_10602518 | Ga0070701_106025181 | 105 |
| 430 | 3300005455 | Ga0070663_100033947 | Ga0070663_1000339475 | 105 |
| 431 | 3300005455 | Ga0070663_100239516 | Ga0070663_1002395162 | 105 |
| 432 | 3300005455 | Ga0070663_100644238 | Ga0070663_1006442382 | 105 |
| 433 | 3300005456 | Ga0070678_100144850 | Ga0070678_1001448502 | 105 |
| 434 | 3300005457 | Ga0070662_100081689 | Ga0070662_1000816893 | 105 |
| 435 | 3300005457 | Ga0070662_100377979 | Ga0070662_1003779792 | 105 |
| 436 | 3300005458 | Ga0070681_10760507 | Ga0070681_107605072 | 105 |
| 437 | 3300005459 | Ga0068867_100000023 | Ga0068867_1000000233 | 105 |
| 438 | 3300005459 | Ga0068867_100949561 | Ga0068867_1009495612 | 105 |
| 439 | 3300005466 | Ga0070685_10752713 | Ga0070685_107527132 | 105 |
| 440 | 3300005530 | Ga0070679_100583247 | Ga0070679_1005832472 | 105 |
| 441 | 3300005530 | Ga0070679_100981786 | Ga0070679_1009817862 | 105 |
| 442 | 3300005535 | Ga0070684_100313085 | Ga0070684_1003130852 | 105 |
| 443 | 3300005535 | Ga0070684_102339051 | Ga0070684_1023390511 | 105 |
| 444 | 3300005539 | Ga0068853_100042530 | Ga0068853_1000425303 | 105 |
| 445 | 3300005539 | Ga0068853_100739625 | Ga0068853_1007396252 | 105 |
| 446 | 3300005543 | Ga0070672_100093680 | Ga0070672_1000936803 | 105 |
| 447 | 3300005543 | Ga0070672_100104389 | Ga0070672_1001043892 | 105 |
| 448 | 3300005544 | Ga0070686_100061295 | Ga0070686_1000612952 | 105 |
| 449 | 3300005546 | Ga0070696_100927593 | Ga0070696_1009275932 | 105 |
| 450 | 3300005548 | Ga0070665_100000109 | Ga0070665_1000001093 | 105 |
| 451 | 3300005548 | Ga0070665_100130384 | Ga0070665_1001303844 | 105 |
| 452 | 3300005548 | Ga0070665_100600547 | Ga0070665_1006005471 | 105 |
| 453 | 3300005563 | Ga0068855_100119921 | Ga0068855_1001199215 | 105 |
| 454 | 3300005563 | Ga0068855_100553074 | Ga0068855_1005530742 | 105 |
| 455 | 3300005563 | Ga0068855_101312712 | Ga0068855_1013127122 | 105 |
| 456 | 3300005564 | Ga0070664_100738428 | Ga0070664_1007384282 | 105 |
| 457 | 3300005564 | Ga0070664_100981552 | Ga0070664_1009815522 | 105 |
| 458 | 3300005577 | Ga0068857_100057006 | Ga0068857_1000570065 | 105 |
| 459 | 3300005577 | Ga0068857_101362326 | Ga0068857_1013623262 | 105 |
| 460 | 3300005578 | Ga0068854_100008814 | Ga0068854_1000088141 | 105 |
| 461 | 3300005578 | Ga0068854_100632751 | Ga0068854_1006327512 | 105 |
| 462 | 3300005578 | Ga0068854_100706577 | Ga0068854_1007065772 | 105 |
| 463 | 3300005614 | Ga0068856_100233074 | Ga0068856_1002330742 | 105 |
| 464 | 3300005615 | Ga0070702_101650565 | Ga0070702_1016505651 | 105 |
| 465 | 3300005616 | Ga0068852_100026154 | Ga0068852_1000261546 | 105 |
| 466 | 3300005616 | Ga0068852_100536878 | Ga0068852_1005368782 | 105 |
| 467 | 3300005616 | Ga0068852_101290518 | Ga0068852_1012905182 | 105 |
| 468 | 3300005616 | Ga0068852_102612631 | Ga0068852_1026126312 | 105 |
| 469 | 3300005617 | Ga0068859_100742691 | Ga0068859_1007426912 | 105 |
| 470 | 3300005718 | Ga0068866_10180122 | Ga0068866_101801222 | 105 |
| 471 | 3300005718 | Ga0068866_10704375 | Ga0068866_107043752 | 105 |
| 472 | 3300005719 | Ga0068861_100388819 | Ga0068861_1003888192 | 105 |
| 473 | 3300005834 | Ga0068851_10119311 | Ga0068851_101193112 | 105 |
| 474 | 3300005841 | Ga0068863_100008320 | Ga0068863_1000083204 | 105 |
| 475 | 3300005842 | Ga0068858_101523126 | Ga0068858_1015231262 | 105 |
| 476 | 3300005843 | Ga0068860_100024823 | Ga0068860_10002482312 | 105 |
| 477 | 3300006186 | Ga0075369_10109815 | Ga0075369_101098153 | 105 |
| 478 | 3300006195 | Ga0075366_10035079 | Ga0075366_100350792 | 105 |
| 479 | 3300006195 | Ga0075366_10070440 | Ga0075366_100704403 | 105 |
| 480 | 3300006237 | Ga0097621_100233974 | Ga0097621_1002339743 | 105 |
| 481 | 3300006237 | Ga0097621_101324222 | Ga0097621_1013242222 | 105 |
| 482 | 3300006358 | Ga0068871_100067789 | Ga0068871_1000677894 | 105 |
| 483 | 3300006871 | Ga0075434_100097402 | Ga0075434_1000974025 | 105 |
| 484 | 3300006931 | Ga0097620_100742697 | Ga0097620_1007426972 | 105 |
| 485 | 3300009093 | Ga0105240_10058360 | Ga0105240_100583606 | 105 |
| 486 | 3300009098 | Ga0105245_10075417 | Ga0105245_100754171 | 105 |
| 487 | 3300009098 | Ga0105245_10076170 | Ga0105245_100761702 | 105 |
| 488 | 3300009098 | Ga0105245_12340185 | Ga0105245_123401852 | 105 |
| 489 | 3300009148 | Ga0105243_10000156 | Ga0105243_100001566 | 105 |
| 490 | 3300009148 | Ga0105243_10184017 | Ga0105243_101840172 | 105 |
| 491 | 3300009148 | Ga0105243_10735582 | Ga0105243_107355822 | 105 |
| 492 | 3300009148 | Ga0105243_11981878 | Ga0105243_119818782 | 105 |
| 493 | 3300009174 | Ga0105241_10004308 | Ga0105241_100043082 | 105 |
| 494 | 3300009174 | Ga0105241_10185999 | Ga0105241_101859992 | 105 |
| 495 | 3300009176 | Ga0105242_10048043 | Ga0105242_100480432 | 105 |
| 496 | 3300009176 | Ga0105242_10894592 | Ga0105242_108945922 | 105 |
| 497 | 3300009177 | Ga0105248_10033419 | Ga0105248_100334196 | 105 |
| 498 | 3300009177 | Ga0105248_11425728 | Ga0105248_114257281 | 105 |
| 499 | 3300009545 | Ga0105237_10398494 | Ga0105237_103984942 | 105 |
| 500 | 3300009545 | Ga0105237_10482230 | Ga0105237_104822302 | 105 |
| 501 | 3300009551 | Ga0105238_10215885 | Ga0105238_102158852 | 105 |
| 502 | 3300009551 | Ga0105238_10726602 | Ga0105238_107266022 | 105 |
| 503 | 3300009551 | Ga0105238_11905866 | Ga0105238_119058662 | 105 |
| 504 | 3300009551 | Ga0105238_12224259 | Ga0105238_122242592 | 105 |
| 505 | 3300009553 | Ga0105249_11161671 | Ga0105249_111616712 | 105 |
| 506 | 3300010375 | Ga0105239_10328506 | Ga0105239_103285063 | 105 |
| 507 | 3300010375 | Ga0105239_10752756 | Ga0105239_107527562 | 105 |
| 508 | 3300011119 | Ga0105246_10144814 | Ga0105246_101448144 | 105 |
| 509 | 3300011119 | Ga0105246_10155689 | Ga0105246_101556893 | 105 |
| 510 | 3300011119 | Ga0105246_10568502 | Ga0105246_105685022 | 105 |
| 511 | 3300012513 | Ga0157326_1010864 | Ga0157326_10108642 | 105 |
| 512 | 3300013100 | Ga0157373_10170122 | Ga0157373_101701222 | 105 |
| 513 | 3300013100 | Ga0157373_11142036 | Ga0157373_111420362 | 105 |
| 514 | 3300013102 | Ga0157371_10059539 | Ga0157371_100595392 | 105 |
| 515 | 3300013104 | Ga0157370_10378633 | Ga0157370_103786332 | 105 |
| 516 | 3300013104 | Ga0157370_10758478 | Ga0157370_107584781 | 105 |
| 517 | 3300013105 | Ga0157369_10291945 | Ga0157369_102919452 | 105 |
| 518 | 3300013296 | Ga0157374_10101300 | Ga0157374_101013004 | 105 |
| 519 | 3300013296 | Ga0157374_12776130 | Ga0157374_127761301 | 105 |
| 520 | 3300013297 | Ga0157378_10000504 | Ga0157378_1000050429 | 105 |
| 521 | 3300013297 | Ga0157378_10951377 | Ga0157378_109513772 | 105 |
| 522 | 3300013297 | Ga0157378_11681631 | Ga0157378_116816311 | 105 |
| 523 | 3300013306 | Ga0163162_13247100 | Ga0163162_132471001 | 105 |
| 524 | 3300013307 | Ga0157372_10606539 | Ga0157372_106065392 | 105 |
| 525 | 3300013307 | Ga0157372_10694011 | Ga0157372_106940112 | 105 |
| 526 | 3300013307 | Ga0157372_13318950 | Ga0157372_133189502 | 105 |
| 527 | 3300013307 | Ga0157372_13430144 | Ga0157372_134301442 | 105 |
| 528 | 3300013308 | Ga0157375_10033608 | Ga0157375_100336085 | 105 |
| 529 | 3300013308 | Ga0157375_10940385 | Ga0157375_109403852 | 105 |
| 530 | 3300013308 | Ga0157375_11735285 | Ga0157375_117352852 | 105 |
| 531 | 3300013308 | Ga0157375_12635005 | Ga0157375_126350052 | 105 |
| 532 | 3300013308 | Ga0157375_12972468 | Ga0157375_129724681 | 105 |
| 533 | 3300014745 | Ga0157377_10060702 | Ga0157377_100607023 | 105 |
| 534 | 3300014968 | Ga0157379_11641516 | Ga0157379_116415162 | 105 |
| 535 | 3300014969 | Ga0157376_10000092 | Ga0157376_1000009260 | 105 |
| 536 | 3300014969 | Ga0157376_11091037 | Ga0157376_110910372 | 105 |
| 537 | 3300014969 | Ga0157376_11798598 | Ga0157376_117985982 | 105 |
| 538 | 3300017792 | Ga0163161_10040537 | Ga0163161_100405372 | 105 |
| 539 | 3300017792 | Ga0163161_11522123 | Ga0163161_115221231 | 105 |
| 540 | 3300020075 | Ga0206349_1044138 | Ga0206349_10441382 | 105 |
| 541 | 3300020077 | Ga0206351_10035987 | Ga0206351_100359872 | 105 |
| 542 | 3300020080 | Ga0206350_10412050 | Ga0206350_104120502 | 105 |
| 543 | 3300020081 | Ga0206354_10307013 | Ga0206354_103070132 | 105 |
| 544 | 3300020081 | Ga0206354_10821255 | Ga0206354_108212551 | 105 |
| 545 | 3300021384 | Ga0213876_10063901 | Ga0213876_100639012 | 105 |
| 546 | 3300025253 | Ga0209677_111507 | Ga0209677_1115072 | 105 |
| 547 | 3300025254 | Ga0209148_1000059 | Ga0209148_1000059346 | 105 |
| 548 | 3300025254 | Ga0209148_1003717 | Ga0209148_10037175 | 105 |
| 549 | 3300025272 | Ga0209455_1005324 | Ga0209455_10053244 | 105 |
| 550 | 3300025315 | Ga0207697_10454228 | Ga0207697_104542282 | 105 |
| 551 | 3300025893 | Ga0207682_10233372 | Ga0207682_102333722 | 105 |
| 552 | 3300025899 | Ga0207642_10015224 | Ga0207642_100152245 | 105 |
| 553 | 3300025901 | Ga0207688_10079487 | Ga0207688_100794872 | 105 |
| 554 | 3300025901 | Ga0207688_10118686 | Ga0207688_101186862 | 105 |
| 555 | 3300025901 | Ga0207688_10249972 | Ga0207688_102499721 | 105 |
| 556 | 3300025904 | Ga0207647_10043865 | Ga0207647_100438653 | 105 |
| 557 | 3300025907 | Ga0207645_10036219 | Ga0207645_100362194 | 105 |
| 558 | 3300025907 | Ga0207645_11094021 | Ga0207645_110940212 | 105 |
| 559 | 3300025908 | Ga0207643_10425697 | Ga0207643_104256972 | 105 |
| 560 | 3300025909 | Ga0207705_10000243 | Ga0207705_1000024333 | 105 |
| 561 | 3300025909 | Ga0207705_10002954 | Ga0207705_100029546 | 105 |
| 562 | 3300025911 | Ga0207654_10000810 | Ga0207654_1000081020 | 105 |
| 563 | 3300025911 | Ga0207654_10101008 | Ga0207654_101010082 | 105 |
| 564 | 3300025912 | Ga0207707_11201271 | Ga0207707_112012712 | 105 |
| 565 | 3300025913 | Ga0207695_10075629 | Ga0207695_100756293 | 105 |
| 566 | 3300025914 | Ga0207671_10253685 | Ga0207671_102536852 | 105 |
| 567 | 3300025917 | Ga0207660_10202587 | Ga0207660_102025872 | 105 |
| 568 | 3300025917 | Ga0207660_11558346 | Ga0207660_115583462 | 105 |
| 569 | 3300025919 | Ga0207657_10069965 | Ga0207657_100699654 | 105 |
| 570 | 3300025919 | Ga0207657_10174101 | Ga0207657_101741012 | 105 |
| 571 | 3300025919 | Ga0207657_10257258 | Ga0207657_102572583 | 105 |
| 572 | 3300025919 | Ga0207657_11275708 | Ga0207657_112757081 | 105 |
| 573 | 3300025920 | Ga0207649_10300303 | Ga0207649_103003032 | 105 |
| 574 | 3300025920 | Ga0207649_10307380 | Ga0207649_103073802 | 105 |
| 575 | 3300025920 | Ga0207649_10709169 | Ga0207649_107091692 | 105 |
| 576 | 3300025921 | Ga0207652_10819732 | Ga0207652_108197322 | 105 |
| 577 | 3300025924 | Ga0207694_10115742 | Ga0207694_101157423 | 105 |
| 578 | 3300025924 | Ga0207694_10628194 | Ga0207694_106281942 | 105 |
| 579 | 3300025925 | Ga0207650_10657886 | Ga0207650_106578862 | 105 |
| 580 | 3300025926 | Ga0207659_10034481 | Ga0207659_100344813 | 105 |
| 581 | 3300025926 | Ga0207659_10210085 | Ga0207659_102100852 | 105 |
| 582 | 3300025926 | Ga0207659_10231268 | Ga0207659_102312683 | 105 |
| 583 | 3300025927 | Ga0207687_10024648 | Ga0207687_100246482 | 105 |
| 584 | 3300025927 | Ga0207687_10049506 | Ga0207687_100495066 | 105 |
| 585 | 3300025927 | Ga0207687_10642981 | Ga0207687_106429812 | 105 |
| 586 | 3300025927 | Ga0207687_11323960 | Ga0207687_113239601 | 105 |
| 587 | 3300025931 | Ga0207644_10374526 | Ga0207644_103745262 | 105 |
| 588 | 3300025931 | Ga0207644_10597046 | Ga0207644_105970462 | 105 |
| 589 | 3300025932 | Ga0207690_10000177 | Ga0207690_1000017734 | 105 |
| 590 | 3300025932 | Ga0207690_10068111 | Ga0207690_100681113 | 105 |
| 591 | 3300025932 | Ga0207690_10380848 | Ga0207690_103808482 | 105 |
| 592 | 3300025933 | Ga0207706_10082619 | Ga0207706_100826192 | 105 |
| 593 | 3300025933 | Ga0207706_10112980 | Ga0207706_101129803 | 105 |
| 594 | 3300025933 | Ga0207706_10195976 | Ga0207706_101959762 | 105 |
| 595 | 3300025934 | Ga0207686_10006822 | Ga0207686_100068226 | 105 |
| 596 | 3300025934 | Ga0207686_10284439 | Ga0207686_102844392 | 105 |
| 597 | 3300025935 | Ga0207709_10000114 | Ga0207709_1000011413 | 105 |
| 598 | 3300025935 | Ga0207709_11055386 | Ga0207709_110553862 | 105 |
| 599 | 3300025935 | Ga0207709_11566292 | Ga0207709_115662922 | 105 |
| 600 | 3300025936 | Ga0207670_10346826 | Ga0207670_103468262 | 105 |
| 601 | 3300025937 | Ga0207669_10011850 | Ga0207669_100118505 | 105 |
| 602 | 3300025938 | Ga0207704_10000008 | Ga0207704_10000008129 | 105 |
| 603 | 3300025940 | Ga0207691_10021000 | Ga0207691_100210005 | 105 |
| 604 | 3300025940 | Ga0207691_10355035 | Ga0207691_103550352 | 105 |
| 605 | 3300025941 | Ga0207711_10059567 | Ga0207711_100595673 | 105 |
| 606 | 3300025942 | Ga0207689_10000701 | Ga0207689_1000070128 | 105 |
| 607 | 3300025944 | Ga0207661_10692144 | Ga0207661_106921442 | 105 |
| 608 | 3300025944 | Ga0207661_11242235 | Ga0207661_112422352 | 105 |
| 609 | 3300025944 | Ga0207661_11257131 | Ga0207661_112571312 | 105 |
| 610 | 3300025945 | Ga0207679_11518547 | Ga0207679_115185472 | 105 |
| 611 | 3300025949 | Ga0207667_10000029 | Ga0207667_10000029336 | 105 |
| 612 | 3300025949 | Ga0207667_10002977 | Ga0207667_1000297718 | 105 |
| 613 | 3300025960 | Ga0207651_10000008 | Ga0207651_1000000895 | 105 |
| 614 | 3300025960 | Ga0207651_11133514 | Ga0207651_111335142 | 105 |
| 615 | 3300025961 | Ga0207712_10025347 | Ga0207712_100253476 | 105 |
| 616 | 3300025961 | Ga0207712_10112962 | Ga0207712_101129625 | 105 |
| 617 | 3300025972 | Ga0207668_10139283 | Ga0207668_101392833 | 105 |
| 618 | 3300025972 | Ga0207668_10462857 | Ga0207668_104628572 | 105 |
| 619 | 3300025981 | Ga0207640_10007440 | Ga0207640_100074409 | 105 |
| 620 | 3300025981 | Ga0207640_10876091 | Ga0207640_108760912 | 105 |
| 621 | 3300025986 | Ga0207658_10151037 | Ga0207658_101510372 | 105 |
| 622 | 3300026023 | Ga0207677_10000091 | Ga0207677_1000009176 | 105 |
| 623 | 3300026023 | Ga0207677_10000280 | Ga0207677_1000028020 | 105 |
| 624 | 3300026023 | Ga0207677_10983091 | Ga0207677_109830912 | 105 |
| 625 | 3300026041 | Ga0207639_10046869 | Ga0207639_100468693 | 105 |
| 626 | 3300026067 | Ga0207678_10063824 | Ga0207678_100638242 | 105 |
| 627 | 3300026078 | Ga0207702_10005062 | Ga0207702_100050622 | 105 |
| 628 | 3300026078 | Ga0207702_10144576 | Ga0207702_101445762 | 105 |
| 629 | 3300026078 | Ga0207702_10546079 | Ga0207702_105460792 | 105 |
| 630 | 3300026078 | Ga0207702_10944196 | Ga0207702_109441962 | 105 |
| 631 | 3300026088 | Ga0207641_10019951 | Ga0207641_100199514 | 105 |
| 632 | 3300026089 | Ga0207648_10000009 | Ga0207648_1000000995 | 105 |
| 633 | 3300026089 | Ga0207648_10562231 | Ga0207648_105622312 | 105 |
| 634 | 3300026116 | Ga0207674_10214218 | Ga0207674_102142183 | 105 |
| 635 | 3300026116 | Ga0207674_11323738 | Ga0207674_113237382 | 105 |
| 636 | 3300026116 | Ga0207674_11454714 | Ga0207674_114547141 | 105 |
| 637 | 3300026118 | Ga0207675_100402582 | Ga0207675_1004025822 | 105 |
| 638 | 3300026118 | Ga0207675_102632175 | Ga0207675_1026321752 | 105 |
| 639 | 3300026121 | Ga0207683_10006500 | Ga0207683_100065003 | 105 |
| 640 | 3300026121 | Ga0207683_10366205 | Ga0207683_103662052 | 105 |
| 641 | 3300026142 | Ga0207698_10002773 | Ga0207698_1000277310 | 105 |
| 642 | 3300026142 | Ga0207698_10314913 | Ga0207698_103149132 | 105 |
| 643 | 3300026142 | Ga0207698_10717229 | Ga0207698_107172292 | 105 |
| 644 | 3300028379 | Ga0268266_10000015 | Ga0268266_10000015617 | 105 |
| 645 | 3300028379 | Ga0268266_10000560 | Ga0268266_100005606 | 105 |
| 646 | 3300028379 | Ga0268266_10530941 | Ga0268266_105309412 | 105 |
| 647 | 3300028379 | Ga0268266_11633475 | Ga0268266_116334752 | 105 |
| 648 | 3300028381 | Ga0268264_10049366 | Ga0268264_100493665 | 105 |
| 649 | 3300028786 | Ga0307517_10068004 | Ga0307517_100680044 | 105 |
| 650 | 3300031456 | Ga0307513_10008605 | Ga0307513_100086058 | 105 |
| 651 | 3300031616 | Ga0307508_10084747 | Ga0307508_100847475 | 105 |
| 652 | 3300031911 | Ga0307412_10730659 | Ga0307412_107306592 | 105 |
| 653 | 3300032002 | Ga0307416_101392196 | Ga0307416_1013921962 | 105 |
| 654 | 3300032005 | Ga0307411_11508128 | Ga0307411_115081281 | 105 |
| 655 | 3300033180 | Ga0307510_10131444 | Ga0307510_101314442 | 105 |
| 656 | 3300037418 | Ga0395900_0577370 | Ga0395900_0577370_124_441 | 105 |
| 657 | 3300037418 | Ga0395900_1501025 | Ga0395900_1501025_237_560 | 105 |
| 658 | 3300037471 | Ga0395905_0118793 | Ga0395905_0118793_243_560 | 105 |
| 659 | 3300037471 | Ga0395905_0413873 | Ga0395905_0413873_285_602 | 105 |
| 660 | 3300037471 | Ga0395905_1716157 | Ga0395905_1716157_122_439 | 105 |
| 661 | 3300038443 | Ga0395901_0461263 | Ga0395901_0461263_301_618 | 105 |
| 662 | 3300038443 | Ga0395901_0635061 | Ga0395901_0635061_704_1021 | 105 |
| 663 | 3300038443 | Ga0395901_1180469 | Ga0395901_1180469_353_670 | 105 |
| 664 | 3300038443 | Ga0395901_1243918 | Ga0395901_1243918_68_385 | 105 |
| 665 | 3300039437 | Ga0436365_0484870 | Ga0436365_0484870_210_539 | 105 |
| 666 | 3300039437 | Ga0436365_0968973 | Ga0436365_0968973_60_383 | 105 |
| 667 | 3300041446 | Ga0451794_28272 | Ga0451794_28272_122_445 | 105 |
| 668 | 3300041452 | Ga0451793_0030520 | Ga0451793_0030520_200_526 | 105 |
| 669 | 3300041456 | Ga0451795_0403850 | Ga0451795_0403850_113_436 | 105 |
| 670 | 3300041458 | Ga0451798_0890559 | Ga0451798_0890559_131_457 | 105 |
| 671 | 3300041459 | Ga0451800_0720288 | Ga0451800_0720288_102_428 | 105 |
| 672 | 3300041460 | Ga0451802_0399788 | Ga0451802_0399788_153_479 | 105 |
| 673 | 3300041486 | Ga0451807_0501283 | Ga0451807_0501283_54_371 | 105 |
| 674 | 3300041498 | Ga0451841_1431138 | Ga0451841_1431138_92_415 | 105 |
| 675 | 3300041512 | Ga0451853_3598434 | Ga0451853_3598434_147_473 | 105 |
| 676 | 3300042005 | Ga0439448_0262567 | Ga0439448_0262567_215_532 | 105 |
| 677 | 3300042012 | Ga0439455_0132446 | Ga0439455_0132446_52_369 | 105 |
| 678 | 3300042157 | Ga0439458_0050761 | Ga0439458_0050761_244_561 | 105 |
| 679 | 3300044656 | Ga0466969_0073651 | Ga0466969_0073651_1187_1504 | 105 |
| 680 | 3300044684 | Ga0466966_0432360 | Ga0466966_0432360_242_559 | 105 |
| 681 | 3300044693 | Ga0466961_0067895 | Ga0466961_0067895_1081_1398 | 105 |
| 682 | 3300044694 | Ga0466963_0552115 | Ga0466963_0552115_178_495 | 105 |
| 683 | 3300044735 | Ga0466968_0010999 | Ga0466968_0010999_2887_3204 | 105 |
| 684 | 3300044765 | Ga0466970_0183319 | Ga0466970_0183319_267_584 | 105 |
| 685 | 3300044765 | Ga0466970_0454594 | Ga0466970_0454594_405_722 | 105 |
| 686 | 3300044842 | Ga0466957_0920067 | Ga0466957_0920067_258_575 | 105 |
| 687 | 3300045049 | Ga0466959_0097616 | Ga0466959_0097616_1715_2032 | 105 |
| 688 | 3300045836 | Ga0466958_0155298 | Ga0466958_0155298_1102_1419 | 105 |
| 689 | 3300045976 | Ga0466967_0416898 | Ga0466967_0416898_845_1162 | 105 |
| 690 | 3300046452 | Ga0495617_072304 | Ga0495617_072304_507_830 | 105 |
| 691 | 3300046460 | Ga0495638_0175804 | Ga0495638_0175804_117_440 | 105 |
| 692 | 3300046471 | Ga0495650_0001317 | Ga0495650_0001317_21100_21423 | 105 |
| 693 | 3300046491 | Ga0495584_0733574 | Ga0495584_0733574_65_388 | 105 |
| 694 | 3300046500 | Ga0495596_0039835 | Ga0495596_0039835_477_800 | 105 |
| 695 | 3300046501 | Ga0495607_0075376 | Ga0495607_0075376_1372_1695 | 105 |
| 696 | 3300046506 | Ga0495583_0055775 | Ga0495583_0055775_579_902 | 105 |
| 697 | 3300046507 | Ga0495606_0026341 | Ga0495606_0026341_1434_1757 | 105 |
| 698 | 3300046513 | Ga0495616_0043729 | Ga0495616_0043729_1145_1468 | 105 |
| 699 | 3300046513 | Ga0495616_0080148 | Ga0495616_0080148_366_692 | 105 |
| 700 | 3300046515 | Ga0495620_0212922 | Ga0495620_0212922_285_611 | 105 |
| 701 | 3300046518 | Ga0495631_0272042 | Ga0495631_0272042_388_711 | 105 |
| 702 | 3300046519 | Ga0495632_0111724 | Ga0495632_0111724_648_971 | 105 |
| 703 | 3300046520 | Ga0495637_0017513 | Ga0495637_0017513_2001_2324 | 105 |
| 704 | 3300046522 | Ga0495643_0423485 | Ga0495643_0423485_139_462 | 105 |
| 705 | 3300046524 | Ga0495648_0007227 | Ga0495648_0007227_4910_5233 | 105 |
| 706 | 3300046525 | Ga0495663_0006927 | Ga0495663_0006927_675_998 | 105 |
| 707 | 3300046525 | Ga0495663_0398762 | Ga0495663_0398762_116_439 | 105 |
| 708 | 3300046530 | Ga0495654_0212746 | Ga0495654_0212746_478_801 | 105 |
| 709 | 3300046536 | Ga0495587_0028999 | Ga0495587_0028999_1251_1574 | 105 |
| 710 | 3300046538 | Ga0495609_0162383 | Ga0495609_0162383_579_902 | 105 |
| 711 | 3300046542 | Ga0495597_0032717 | Ga0495597_0032717_534_857 | 105 |
| 712 | 3300046542 | Ga0495597_0337585 | Ga0495597_0337585_200_523 | 105 |
| 713 | 3300046557 | Ga0495622_0017900 | Ga0495622_0017900_700_1023 | 105 |
| 714 | 3300046558 | Ga0495633_0052492 | Ga0495633_0052492_1152_1475 | 105 |
| 715 | 3300046616 | Ga0495668_0000016 | Ga0495668_0000016_140177_140500 | 105 |
| 716 | 3300046648 | Ga0495611_0189735 | Ga0495611_0189735_499_822 | 105 |
| 717 | 3300046660 | Ga0495625_0018235 | Ga0495625_0018235_3600_3923 | 105 |
| 718 | 3300046665 | Ga0495661_0299532 | Ga0495661_0299532_143_466 | 105 |
| 719 | 3300046684 | Ga0495669_0001189 | Ga0495669_0001189_5744_6067 | 105 |
| 720 | 3300046691 | Ga0495670_0090056 | Ga0495670_0090056_1011_1334 | 105 |
| 721 | 3300046692 | Ga0495671_0615362 | Ga0495671_0615362_33_356 | 105 |
| 722 | 3300046694 | Ga0495649_0128062 | Ga0495649_0128062_768_1091 | 105 |
| 723 | 3300046809 | Ga0495600_0009263 | Ga0495600_0009263_2103_2426 | 105 |
| 724 | 3300046810 | Ga0495660_0071205 | Ga0495660_0071205_459_782 | 105 |
| 725 | 3300047318 | Ga0495636_0137389 | Ga0495636_0137389_258_581 | 105 |
| 726 | 3300047323 | Ga0495683_0123059 | Ga0495683_0123059_594_917 | 105 |
| 727 | 3300047443 | Ga0495687_037411 | Ga0495687_037411_1209_1532 | 105 |
| 728 | 3300047443 | Ga0495687_037412 | Ga0495687_037412_631_954 | 105 |
| 729 | 3300047446 | Ga0495679_051402 | Ga0495679_051402_239_562 | 105 |
| 730 | 3300047470 | Ga0495681_0032741 | Ga0495681_0032741_1523_1846 | 105 |
| 731 | 3300047472 | Ga0495686_0144866 | Ga0495686_0144866_773_1096 | 105 |
| 732 | 3300048090 | Ga0495615_0096358 | Ga0495615_0096358_22_351 | 105 |
| 733 | 3300048090 | Ga0495615_0096878 | Ga0495615_0096878_214_537 | 105 |
| 734 | 3300048904 | Ga0496101_0833573 | Ga0496101_0833573_256_579 | 105 |
| 735 | 3300048905 | Ga0496102_0003155 | Ga0496102_0003155_3945_4268 | 105 |
| 736 | 3300048905 | Ga0496102_0664938 | Ga0496102_0664938_182_499 | 105 |
| 737 | 3300048906 | Ga0496103_0000903 | Ga0496103_0000903_3758_4081 | 105 |
| 738 | 3300048908 | Ga0496105_0014636 | Ga0496105_0014636_5025_5348 | 105 |
| 739 | 3300048910 | Ga0496107_0099103 | Ga0496107_0099103_130_453 | 105 |
| 740 | 3300048912 | Ga0496109_0367857 | Ga0496109_0367857_454_777 | 105 |
| 741 | 3300048914 | Ga0496111_0137029 | Ga0496111_0137029_321_644 | 105 |
| 742 | 3300048916 | Ga0496113_0579968 | Ga0496113_0579968_238_561 | 105 |
| 743 | 3300048917 | Ga0496114_0060604 | Ga0496114_0060604_2060_2383 | 105 |
| 744 | 3300048918 | Ga0496115_0002506 | Ga0496115_0002506_3903_4226 | 105 |
| 745 | 3300048919 | Ga0496116_0009806 | Ga0496116_0009806_3895_4218 | 105 |
| 746 | 3300048920 | Ga0496117_0000324 | Ga0496117_0000324_79632_79955 | 105 |
| 747 | 3300048921 | Ga0496118_0002151 | Ga0496118_0002151_23317_23640 | 105 |
| 748 | 3300048921 | Ga0496118_0523507 | Ga0496118_0523507_39_356 | 105 |
| 749 | 3300048922 | Ga0496119_0019706 | Ga0496119_0019706_781_1104 | 105 |
| 750 | 3300048923 | Ga0496120_0013189 | Ga0496120_0013189_5039_5362 | 105 |
| 751 | 3300048924 | Ga0496121_0002794 | Ga0496121_0002794_21616_21939 | 105 |
| 752 | 3300048925 | Ga0496122_0020856 | Ga0496122_0020856_2455_2778 | 105 |
| 753 | 3300048925 | Ga0496122_0535551 | Ga0496122_0535551_34_360 | 105 |
| 754 | 3300048926 | Ga0496123_0017188 | Ga0496123_0017188_3598_3921 | 105 |
| 755 | 3300048927 | Ga0496124_0000351 | Ga0496124_0000351_79722_80045 | 105 |
| 756 | 3300048928 | Ga0496125_0011965 | Ga0496125_0011965_4502_4825 | 105 |
| 757 | 3300048929 | Ga0496126_0002155 | Ga0496126_0002155_23149_23472 | 105 |
| 758 | 3300049128 | Ga0501308_007330 | Ga0501308_007330_657_974 | 105 |
| 759 | 3300049161 | Ga0501305_055965 | Ga0501305_055965_214_531 | 105 |
| 760 | 3300049162 | Ga0501307_017543 | Ga0501307_017543_442_765 | 105 |
| 761 | 3300049552 | Ga0501336_018314 | Ga0501336_018314_48_365 | 105 |
| 762 | 3300049571 | Ga0501034_1455194 | Ga0501034_1455194_115_438 | 105 |
| 763 | 3300049572 | Ga0501036_0984885 | Ga0501036_0984885_284_607 | 105 |
| 764 | 3300049585 | Ga0501069_0088669 | Ga0501069_0088669_986_1309 | 105 |
| 765 | 3300049586 | Ga0501070_0014243 | Ga0501070_0014243_2225_2548 | 105 |
| 766 | 3300049589 | Ga0501073_0484052 | Ga0501073_0484052_226_546 | 105 |
| 767 | 3300049822 | Ga0501035_1146408 | Ga0501035_1146408_94_411 | 105 |
| 768 | 3300050493 | nmdc:mga0k408_114332_c1 | nmdc:mga0k408_114332_c1_326_649 | 105 |
| 769 | 3300050512 | nmdc:mga0n895_592416_c1 | nmdc:mga0n895_592416_c1_285_611 | 105 |
| 770 | 3300050514 | nmdc:mga08x19_1033595_c1 | nmdc:mga08x19_1033595_c1_49_378 | 105 |
| 771 | 3300050516 | nmdc:mga0sz30_74009_c1 | nmdc:mga0sz30_74009_c1_477_800 | 105 |
| 772 | 3300053079 | Ga0500610_0000216 | Ga0500610_0000216_15688_16011 | 105 |
| 773 | 3300053083 | Ga0495655_0101522 | Ga0495655_0101522_171_494 | 105 |
| 774 | 3300053087 | Ga0500643_109253 | Ga0500643_109253_170_493 | 105 |
| 775 | 3300053092 | Ga0500583_0399269 | Ga0500583_0399269_287_610 | 105 |
| 776 | 3300053096 | Ga0500641_0169432 | Ga0500641_0169432_48_374 | 105 |
| 777 | 3300053119 | Ga0500595_018979 | Ga0500595_018979_1850_2173 | 105 |
| 778 | 3300053130 | Ga0500642_0001933 | Ga0500642_0001933_3806_4129 | 105 |
| 779 | 3300053177 | Ga0500636_0152791 | Ga0500636_0152791_124_447 | 105 |
| 780 | 3300053730 | Ga0500645_000002 | Ga0500645_000002_205206_205529 | 105 |
| 781 | 3300053739 | Ga0500587_034778 | Ga0500587_034778_304_633 | 105 |
| 782 | 3300059477 | Ga0587084_007588 | Ga0587084_007588_810_1127 | 105 |
| 783 | 3300059490 | Ga0587066_007807 | Ga0587066_007807_336_653 | 105 |
| 784 | 3300059491 | Ga0587070_008024 | Ga0587070_008024_808_1125 | 105 |
| 785 | 3300059491 | Ga0587070_065000 | Ga0587070_065000_169_492 | 105 |
| 786 | 3300059492 | Ga0587073_0021745 | Ga0587073_0021745_213_530 | 105 |
| 787 | 3300059493 | Ga0587077_003076 | Ga0587077_003076_829_1146 | 105 |
| 788 | 3300059503 | Ga0587080_008678 | Ga0587080_008678_258_575 | 105 |
| 789 | 3300059504 | Ga0587082_014514 | Ga0587082_014514_270_587 | 105 |
| 790 | 3300059505 | Ga0587083_0020431 | Ga0587083_0020431_217_534 | 105 |
| 791 | 3300059508 | Ga0587088_010422 | Ga0587088_010422_602_919 | 105 |
| 792 | 3300059510 | Ga0587090_017496 | Ga0587090_017496_451_768 | 105 |
| 793 | 3300059510 | Ga0587090_084782 | Ga0587090_084782_166_495 | 105 |
| 794 | 3300059511 | Ga0587091_001650 | Ga0587091_001650_933_1250 | 105 |
| 795 | 3300059513 | Ga0587094_012259 | Ga0587094_012259_209_526 | 105 |
| 796 | 3300059605 | Ga0587106_020463 | Ga0587106_020463_467_784 | 105 |
| 797 | 3300059609 | Ga0587131_020051 | Ga0587131_020051_82_405 | 105 |
| 798 | 3300059623 | Ga0587101_004327 | Ga0587101_004327_937_1254 | 105 |
| 799 | 3300059626 | Ga0587115_001498 | Ga0587115_001498_340_663 | 105 |
| 800 | 3300059640 | Ga0587067_006007 | Ga0587067_006007_855_1172 | 105 |
| 801 | 3300059640 | Ga0587067_017691 | Ga0587067_017691_293_616 | 105 |
| 802 | 3300059641 | Ga0587068_010651 | Ga0587068_010651_827_1144 | 105 |
| 803 | 3300059642 | Ga0587069_012706 | Ga0587069_012706_264_581 | 105 |
| 804 | 3300059643 | Ga0587072_016814 | Ga0587072_016814_253_570 | 105 |
| 805 | 3300059643 | Ga0587072_112905 | Ga0587072_112905_263_586 | 105 |
| 806 | 3300059644 | Ga0587075_012510 | Ga0587075_012510_549_866 | 105 |
| 807 | 3300059645 | Ga0587076_013991 | Ga0587076_013991_224_541 | 105 |
| 808 | 3300059646 | Ga0587078_006230 | Ga0587078_006230_416_733 | 105 |
| 809 | 3300059647 | Ga0587079_008799 | Ga0587079_008799_551_868 | 105 |
| 810 | 3300059652 | Ga0587107_051730 | Ga0587107_051730_350_667 | 105 |
| 811 | 3300059654 | Ga0587110_018389 | Ga0587110_018389_96_419 | 105 |
| 812 | 3300060344 | Ga0587071_013079 | Ga0587071_013079_827_1144 | 105 |
| 813 | 3300060344 | Ga0587071_055585 | Ga0587071_055585_36_359 | 105 |
| 814 | 3300061719 | Ga0466962_0424806 | Ga0466962_0424806_113_430 | 105 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8cgd-assembly1.cif.gz_s | clindamycin bound to the 50s subunit | 0.9322 | 13 | 93 |
| 8cvm-assembly1.cif.gz_s | cutibacterium acnes 50s ribosomal subunit with p-site trna and sarecycline bound in the local refined map | 0.9229 | 14 | 101 |
| 6spb-assembly1.cif.gz_T | pseudomonas aeruginosa 50s ribosome from a clinical isolate with a mutation in ul6 | 0.9181 | 12 | 100 |
| 6enj-assembly1.cif.gz_T | polyproline-stalled ribosome in the presence of a+p site trna and elongation-factor p (ef-p) | 0.9128 | 10 | 99 |
| 7m4z-assembly1.cif.gz_S | a. baumannii ribosome-eravacycline complex: hpf-bound 70s | 0.9069 | 13 | 98 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 6hmaR00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain | 0.8941 | 14 | 100 | 3.30.70.330 |
| 6fu8C00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain | 0.877 | 13 | 99 | 3.30.70.330 |
| 4garT00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain | 0.8704 | 11 | 99 | 3.30.70.330 |
| 6hmaR00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain | 0.8572 | 14 | 100 | 3.30.70.330 |
| af_P61845_1_86_3.30.70.330 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain | 0.8517 | 16 | 100 | 3.30.70.330 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A356KYD9-F1-model_v4 | Large ribosomal subunit protein uL23 | 0.953 | 14 | 100 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-Q3A6P5-F1-model_v4 | Large ribosomal subunit protein uL23 (50S ribosomal protein L23) | 0.9529 | 14 | 101 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-A0A2E1VV25-F1-model_v4 | Large ribosomal subunit protein uL23 | 0.9528 | 14 | 100 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-A0A1F9D7K7-F1-model_v4 | Large ribosomal subunit protein uL23 | 0.9511 | 14 | 101 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-A0A0S7X6A9-F1-model_v4 | Large ribosomal subunit protein uL23 | 0.9503 | 14 | 101 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar