F480982

General Info

Members Datasets Scaffolds Average Seq Length
791 451 730 210

Family's Representative Sequence

Representative Sequence 3300014969|Ga0157376_10300847|Ga0157376_103008472
Length 236
Sequence MACSPRARPAVPEERRHADNRAMSTLHHIANRTRRLPPLRVGVGGPVGSGKTTLVEMLCKAMRERYDLVVVTNDIYTKEDQRLLTVAGALEAERIMGVETGGCPHTAIREDASINLEAVDRMLEKFPNADIVFIESGGDNLAATFSPELSDLTIYVIDVAAGEKIPRKGGPGITKSDLFVINKTDLAPYVGANLDVMAADTKRMRGARPFVMSNLKTHDGLADVVKFIETKGMLVS

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2515154122 Paraburkholderia atlantica JPY251 Isolate Nodule
3 2554235231 Pseudomonas putida MTCC 5279 Isolate Unclassified
4 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
5 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
6 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
7 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
8 2602042047 Enterobacter sp. NFIX59 Isolate Rhizoplane
9 2602042066 Enterobacter sp. NFIX45 Isolate Rhizoplane
10 2602042067 Enterobacter sp. NFIX58 Isolate Rhizoplane
11 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
12 2643221585 Pelomonas sp. Root662 Isolate Unclassified
13 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
14 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
15 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
16 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
17 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
18 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
19 2643221656 Pelomonas sp. Root405 Isolate Unclassified
20 2667528172 Enterobacteriaceae bacterium NFIX31 Isolate Rhizoplane
21 2681812866 Enterobacter asburiae NFIX55 Isolate Rhizoplane
22 2681812869 Enterobacter ludwigii NFPP41 Isolate Rhizoplane
23 2721755763 Pandoraea thiooxydans ATSB16 Isolate Rhizosphere
24 2738541296 Paraburkholderia sp. GV073 Isolate Unclassified
25 2738541298 Paraburkholderia sp. GV068 Isolate Unclassified
26 2738541306 Paraburkholderia sp. GV052 Isolate Unclassified
27 2738541337 Pelomonas sp. BT06 Isolate Unclassified
28 2738543002 Paraburkholderia sp. GV072 Isolate Unclassified
29 2738543008 Paraburkholderia sp. GV060 Isolate Unclassified
30 2738543031 Pleomorphomonas sp. CF100 Isolate Unclassified
31 2751185917 Enterobacter sp. HK169 Isolate Unclassified
32 2765235842 Enterobacter ludwigii AA4 Isolate Unclassified
33 2775506706 Enterobacter asburiae 1216 Isolate Unclassified
34 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
35 2821118458 Enterobacter asburiae 609 Isolate Unclassified
36 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
37 2823373977 Enterobacter ludwigii NCR3 Isolate Rhizosphere
38 2834641062 Cupriavidus gilardii JZ4 Isolate Unclassified
39 2835312727 Microvirga calopogonii CCBAU 65841 Isolate Nodule
40 2840878972 Albibacillus kandeliae J95 Isolate Rhizosphere
41 2842775625 Roseomonas sp. R-71825 Isolate Unclassified
42 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
43 2882456835 Microvirga sp. KLBC 81 Isolate Unclassified
44 2894023352 Diaphorobacter ruginosibacter DSM 27467 Isolate Nodule
45 2902682994 Paraburkholderia atlantica CNPSo 3155 Isolate Unclassified
46 2927833300 Enterobacter sp. SLBN-59 Isolate Rhizosphere
47 2932422444 Comamonas sp. 4034 Isolate Rhizosphere
48 2937539931 Pantoea sp. LS15 Isolate Unclassified
49 2939573065 Citrobacter sp. 506 Isolate Rhizosphere
50 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
51 2990703756 Paraburkholderia graminis SLBN-33 Isolate Rhizosphere
52 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
53 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
54 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
55 3300003371 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM Metagenome Rhizosphere
56 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
57 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
58 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
59 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
60 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
61 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
62 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
63 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
64 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
65 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
66 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
67 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
68 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
69 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
70 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
71 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
72 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
73 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
74 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
75 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
76 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
77 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
78 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
79 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
80 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
81 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
82 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
83 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
84 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
85 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
86 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
87 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
88 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
89 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
90 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
91 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
92 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
93 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
94 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
95 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
96 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
97 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
98 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
99 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
100 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
101 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
102 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
103 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
104 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
105 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
106 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
107 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
108 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
109 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
110 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
111 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
112 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
113 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
114 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
115 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
116 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
117 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
118 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
119 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
120 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
121 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
122 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
123 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
124 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
125 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
126 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
127 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
128 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
129 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
130 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
131 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
132 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
133 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
134 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
135 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
136 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
137 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
138 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
139 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
140 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
141 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
142 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
143 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
144 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
145 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
146 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
147 3300009982 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_189 metaG Metagenome Rhizosphere
148 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
149 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
150 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
151 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
152 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
153 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
154 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
155 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
156 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
157 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
158 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
159 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
160 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
161 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
162 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
163 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
164 3300015679 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.4_F08 Metagenome Unclassified
165 3300015680 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.2_H03 Metagenome Rhizosphere
166 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
167 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
168 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
169 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
170 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
171 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
172 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
173 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
174 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
175 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
176 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
177 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
178 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
179 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
180 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
181 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
182 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
183 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
184 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
236 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
237 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
238 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
239 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
241 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
242 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
243 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
244 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
245 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
246 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
247 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
248 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
249 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
250 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
251 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
252 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
253 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
254 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
255 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
256 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
257 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
258 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
259 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
260 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
261 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
262 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
263 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
264 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
265 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
266 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
267 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
268 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
269 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
270 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
271 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
272 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
273 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
274 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
275 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
276 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
277 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
278 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
279 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
280 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
281 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
282 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
283 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
284 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
285 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
286 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
287 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
288 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
289 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
290 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
291 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
292 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
293 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
294 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
295 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
296 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
297 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
298 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
299 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
300 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
301 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
302 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
303 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
304 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
305 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
306 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
307 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
308 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
309 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
310 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
311 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
312 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
313 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
314 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
315 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
316 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
317 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
318 3300044666 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1E Metagenome Unclassified
319 3300044669 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2E Metagenome Unclassified
320 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
321 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
322 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
323 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
324 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
325 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
326 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
327 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
328 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
329 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
330 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
331 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
332 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
333 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
334 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
335 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
336 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
337 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
338 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
339 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
340 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
341 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
342 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
343 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
344 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
345 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
346 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
347 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
348 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
349 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
350 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
351 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
352 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
353 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
354 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
355 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
356 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
357 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
358 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
359 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
360 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
361 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
362 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
363 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
364 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
365 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
366 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
367 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
368 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
369 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
370 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
371 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
372 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
373 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
374 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
375 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
376 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
377 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
378 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
379 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
380 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
381 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
382 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
383 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
384 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
385 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
386 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
387 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
388 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
389 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
390 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
391 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
392 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
393 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
394 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
395 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
396 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
397 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
398 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
399 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
400 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
401 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
402 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
403 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
404 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
405 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
406 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
407 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
408 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
409 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
410 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
411 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
412 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
413 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
414 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
415 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
416 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
417 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
418 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
419 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
420 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
421 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
422 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
423 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
424 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
425 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
426 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
427 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
428 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
429 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
430 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
431 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
432 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
433 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
434 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
435 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
436 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
437 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
438 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
439 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
440 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
441 641736151 Paraburkholderia graminis C4D1M Isolate Rhizoplane
442 8001522603 Methylomicrobium sp. RS1 Isolate Unclassified
443 8003400568 Cupriavidus gilardii USM5 Isolate Rhizosphere
444 8018221730 Enterobacter sp. CM29 Isolate Unclassified
445 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
446 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
447 8052494512 Pseudomonas putida LD6 Isolate Unclassified
448 8054929484 Pseudomonas vlassakiae RW4S1 Isolate Rhizosphere
449 8056120720 Pseudomonas maumuensis COW77 Isolate Rhizosphere
450 8056137416 Pseudomonas fakonensis COW40 Isolate Rhizosphere
451 8057304971 Scandinavium manionii H17S15 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.29
Metatranscriptomes 0
Isolates 7.71

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.73
Nodule 1.64
Rhizoplane 3.03
Rhizosphere 65.87
Stem 0
Stem Tuber 0
Unclassified 19.72

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2783974 2162886007 Bacteria 2010
2 JGI24735J21928_10019472 3300002067 Bacteria 2086
3 JGI25153J46596_10012485 3300003215 Bacteria 3661
4 JGI25160J50197_1001200 3300003354 Bacteria 13170
5 JGI26145J50221_1007868 3300003371 Bacteria 910
6 Ga0055539_1000240 3300003752 Bacteria 36494
7 Ga0055533_1000103 3300003756 Bacteria 107860
8 Ga0055525_1000928 3300003759 Bacteria 8265
9 Ga0055526_1003050 3300003771 Bacteria 10883
10 Ga0055530_10012719 3300003791 Bacteria 2916
11 Ga0055530_10051163 3300003791 Bacteria 959
12 Ga0055531_10000390 3300003794 Bacteria 42387
13 Ga0058692_1002816 3300003856 Bacteria 5707
14 Ga0065165_1000791 3300005262 Bacteria 42372
15 Ga0065165_1001455 3300005262 Bacteria 25574
16 Ga0065704_10002058 3300005289 Bacteria 11509
17 Ga0065704_10077807 3300005289 Bacteria 4614
18 Ga0070658_10224317 3300005327 Bacteria 1590
19 Ga0070658_10271096 3300005327 Bacteria 1443
20 Ga0070676_10008197 3300005328 Bacteria 5623
21 Ga0070683_100022610 3300005329 Bacteria 5622
22 Ga0070690_100166308 3300005330 Bacteria 1515
23 Ga0070670_100024111 3300005331 Bacteria 5234
24 Ga0070670_100090066 3300005331 Bacteria 2637
25 Ga0070677_10025585 3300005333 Bacteria 2204
26 Ga0070677_10060999 3300005333 Bacteria 1556
27 Ga0068869_100656979 3300005334 Bacteria 890
28 Ga0070682_100002901 3300005337 Bacteria 9515
29 Ga0070689_100010287 3300005340 Bacteria 6668
30 Ga0070689_100040016 3300005340 Bacteria 3592
31 Ga0070661_100017322 3300005344 Bacteria 5110
32 Ga0070692_10139728 3300005345 Bacteria 1370
33 Ga0070668_100611455 3300005347 Bacteria 954
34 Ga0070669_100143237 3300005353 Bacteria 1844
35 Ga0070675_100020118 3300005354 Bacteria 5326
36 Ga0070675_100030521 3300005354 Bacteria 4352
37 Ga0070675_100066853 3300005354 Bacteria 2973
38 Ga0070671_100014561 3300005355 Bacteria 6360
39 Ga0070671_100039548 3300005355 Bacteria 3914
40 Ga0070671_100059923 3300005355 Bacteria 3168
41 Ga0070674_100009918 3300005356 Bacteria 5733
42 Ga0070674_100367341 3300005356 Bacteria 1167
43 Ga0070674_100437539 3300005356 Bacteria 1077
44 Ga0070673_100006916 3300005364 Bacteria 7420
45 Ga0070673_100197786 3300005364 Bacteria 1730
46 Ga0070688_100319448 3300005365 Bacteria 1128
47 Ga0070688_100406353 3300005365 Bacteria 1009
48 Ga0070659_100026425 3300005366 Bacteria 4468
49 Ga0070659_100657921 3300005366 Bacteria 904
50 Ga0070667_100005361 3300005367 Bacteria 10710
51 Ga0070667_100343716 3300005367 Bacteria 1350
52 Ga0070667_100923990 3300005367 Bacteria 813
53 Ga0070709_10433646 3300005434 Bacteria 987
54 Ga0070714_100175896 3300005435 Bacteria 1945
55 Ga0070714_100493235 3300005435 Bacteria 1167
56 Ga0070714_100991413 3300005435 Bacteria 817
57 Ga0070711_100062131 3300005439 Bacteria 2603
58 Ga0070708_100161995 3300005445 Bacteria 2085
59 Ga0070663_100006550 3300005455 Bacteria 7017
60 Ga0070663_100206784 3300005455 Bacteria 1535
61 Ga0070678_100591590 3300005456 Bacteria 989
62 Ga0070662_100282844 3300005457 Bacteria 1343
63 Ga0070681_10041779 3300005458 Bacteria 4597
64 Ga0070681_10121927 3300005458 Bacteria 2541
65 Ga0070681_10220109 3300005458 Bacteria 1813
66 Ga0068867_100004166 3300005459 Bacteria 10173
67 Ga0068867_100877485 3300005459 Bacteria 806
68 Ga0070706_100032893 3300005467 Bacteria 4784
69 Ga0070707_100059206 3300005468 Bacteria 3674
70 Ga0070707_100153192 3300005468 Bacteria 2245
71 Ga0070698_100040887 3300005471 Bacteria 4762
72 Ga0070698_100321592 3300005471 Bacteria 1478
73 Ga0070679_100214268 3300005530 Bacteria 1889
74 Ga0070679_100287627 3300005530 Bacteria 1595
75 Ga0070684_100021897 3300005535 Bacteria 5324
76 Ga0070684_100681333 3300005535 Bacteria 958
77 Ga0070697_100188949 3300005536 Bacteria 1748
78 Ga0068853_100095434 3300005539 Bacteria 2622
79 Ga0068853_100216637 3300005539 Bacteria 1747
80 Ga0070672_100001714 3300005543 Bacteria 13688
81 Ga0070672_100222147 3300005543 Bacteria 1585
82 Ga0070672_100248109 3300005543 Bacteria 1499
83 Ga0070672_100323332 3300005543 Bacteria 1311
84 Ga0070665_100001160 3300005548 Bacteria 32371
85 Ga0070665_100116464 3300005548 Bacteria 2675
86 Ga0070665_100547140 3300005548 Bacteria 1170
87 Ga0068855_100355520 3300005563 Bacteria 1613
88 Ga0068855_100395977 3300005563 Bacteria 1514
89 Ga0068857_100000005 3300005577 Bacteria 170248
90 Ga0068857_100076664 3300005577 Bacteria 2982
91 Ga0068854_100093824 3300005578 Bacteria 2238
92 Ga0068854_100219094 3300005578 Bacteria 1505
93 Ga0068856_100008321 3300005614 Bacteria 10107
94 Ga0068852_100742228 3300005616 Bacteria 993
95 Ga0068859_100024837 3300005617 Bacteria 6015
96 Ga0068859_100649608 3300005617 Bacteria 1147
97 Ga0068870_10259450 3300005840 Bacteria 1081
98 Ga0068863_100214953 3300005841 Bacteria 1852
99 Ga0068858_100004350 3300005842 Bacteria 13897
100 Ga0068860_100239700 3300005843 Bacteria 1764
101 Ga0081455_10000723 3300005937 Bacteria 42827
102 Ga0081455_10051537 3300005937 Bacteria 3530
103 Ga0081455_10276508 3300005937 Bacteria 1215
104 Ga0081538_10033312 3300005981 Bacteria 3432
105 Ga0070716_100101169 3300006173 Bacteria 1767
106 Ga0070712_100029765 3300006175 Bacteria 3663
107 Ga0070712_100166724 3300006175 Bacteria 1706
108 Ga0075362_10011088 3300006177 Bacteria 3542
109 Ga0075362_10011491 3300006177 Bacteria 3489
110 Ga0075362_10171481 3300006177 Bacteria 1048
111 Ga0075369_10000532 3300006186 Bacteria 12019
112 Ga0075366_10006382 3300006195 Bacteria 6459
113 Ga0075366_10014006 3300006195 Bacteria 4574
114 Ga0075366_10193263 3300006195 Bacteria 1237
115 Ga0075366_10195147 3300006195 Bacteria 1231
116 Ga0075366_10222599 3300006195 Bacteria 1150
117 Ga0075370_10002042 3300006353 Bacteria 9165
118 Ga0075370_10096345 3300006353 Bacteria 1710
119 Ga0075370_10129531 3300006353 Bacteria 1472
120 Ga0068871_100089638 3300006358 Bacteria 2560
121 Ga0075428_100140266 3300006844 Bacteria 2628
122 Ga0075430_100037022 3300006846 Bacteria 4136
123 Ga0075431_100098152 3300006847 Bacteria 3024
124 Ga0075434_100468682 3300006871 Bacteria 1281
125 Ga0075429_100002479 3300006880 Bacteria 15530
126 Ga0075429_100368044 3300006880 Bacteria 1259
127 Ga0068865_100059814 3300006881 Bacteria 2666
128 Ga0075436_100169485 3300006914 Bacteria 1542
129 Ga0097620_100024837 3300006931 Bacteria 6015
130 Ga0097620_100649518 3300006931 Bacteria 1147
131 Ga0097620_100912251 3300006931 Bacteria 963
132 Ga0079104_1001696 3300006946 Bacteria 14094
133 Ga0079104_1003541 3300006946 Bacteria 7185
134 Ga0079104_1012559 3300006946 Bacteria 2654
135 Ga0075435_100040874 3300007076 Bacteria 3705
136 Ga0099795_10004776 3300007788 Bacteria 3532
137 Ga0105251_10009864 3300009011 Bacteria 5596
138 Ga0105251_10370928 3300009011 Bacteria 655
139 Ga0105244_10041712 3300009036 Bacteria 2377
140 Ga0105244_10044643 3300009036 Bacteria 2282
141 Ga0105250_10000475 3300009092 Bacteria 28364
142 Ga0105240_10105653 3300009093 Bacteria 3418
143 Ga0105240_10153993 3300009093 Bacteria 2736
144 Ga0105240_10175619 3300009093 Bacteria 2532
145 Ga0105240_10450333 3300009093 Bacteria 1441
146 Ga0111539_10246411 3300009094 Bacteria 2080
147 Ga0105247_10180550 3300009101 Bacteria 1408
148 Ga0114129_10452475 3300009147 Bacteria 1684
149 Ga0105243_10127919 3300009148 Bacteria 2151
150 Ga0105243_10165154 3300009148 Bacteria 1912
151 Ga0105243_10590152 3300009148 Bacteria 1068
152 Ga0105241_10561534 3300009174 Bacteria 1026
153 Ga0105242_10455296 3300009176 Bacteria 1207
154 Ga0105248_10000445 3300009177 Bacteria 46980
155 Ga0105248_10076019 3300009177 Bacteria 3775
156 Ga0105248_10144214 3300009177 Bacteria 2687
157 Ga0105248_11203223 3300009177 Bacteria 857
158 Ga0105237_10023936 3300009545 Bacteria 6250
159 Ga0105237_10142234 3300009545 Bacteria 2393
160 Ga0105237_11210506 3300009545 Bacteria 762
161 Ga0105238_10164944 3300009551 Bacteria 2191
162 Ga0105238_10334315 3300009551 Bacteria 1502
163 Ga0105249_10677986 3300009553 Bacteria 1090
164 Ga0105249_10727191 3300009553 Bacteria 1054
165 Ga0105147_100451 3300009982 Bacteria 3415
166 Ga0099796_10004450 3300010159 Bacteria 3390
167 Ga0099796_10028260 3300010159 Bacteria 1799
168 Ga0099796_10075849 3300010159 Bacteria 1223
169 Ga0105239_10010809 3300010375 Bacteria 10197
170 Ga0105239_10242080 3300010375 Bacteria 2025
171 Ga0157373_10258816 3300013100 Bacteria 1231
172 Ga0157371_10032095 3300013102 Bacteria 3780
173 Ga0157371_10083223 3300013102 Bacteria 2266
174 Ga0157371_10202180 3300013102 Bacteria 1424
175 Ga0157370_10008752 3300013104 Bacteria 10884
176 Ga0157370_10011595 3300013104 Bacteria 9202
177 Ga0157370_10079648 3300013104 Bacteria 3085
178 Ga0157370_10636769 3300013104 Bacteria 975
179 Ga0157369_10025847 3300013105 Bacteria 6513
180 Ga0157369_10082380 3300013105 Bacteria 3442
181 Ga0157374_10044716 3300013296 Bacteria 4093
182 Ga0157378_10936206 3300013297 Bacteria 898
183 Ga0163162_10012108 3300013306 Bacteria 8417
184 Ga0163162_10172537 3300013306 Bacteria 2287
185 Ga0157372_11316155 3300013307 Bacteria 834
186 Ga0157375_10016277 3300013308 Bacteria 6673
187 Ga0163163_10469135 3300014325 Bacteria 1319
188 Ga0157379_10003329 3300014968 Bacteria 13618
189 Ga0157376_10300847 3300014969 Bacteria 1518
190 Ga0182007_10019443 3300015262 Bacteria 2441
191 Ga0182005_1144793 3300015265 Bacteria 688
192 Ga0183366_1002 3300015679 Bacteria 791639
193 Ga0183370_1002 3300015680 Bacteria 791639
194 Ga0183369_1002 3300015685 Bacteria 791621
195 Ga0183368_1005 3300015687 Bacteria 791621
196 Ga0163161_10332874 3300017792 Bacteria 1203
197 Ga0213872_10000093 3300021361 Bacteria 83513
198 Ga0213872_10000490 3300021361 Bacteria 31612
199 Ga0213872_10035775 3300021361 Bacteria 2270
200 Ga0213875_10036528 3300021388 Bacteria 2317
201 Ga0228598_1001530 3300024227 Bacteria 5068
202 Ga0209674_100003 3300025226 Bacteria 2196646
203 Ga0209672_104934 3300025228 Bacteria 2371
204 Ga0209563_100141 3300025230 Bacteria 79513
205 Ga0209677_100068 3300025253 Bacteria 146135
206 Ga0209759_1000423 3300025256 Bacteria 51547
207 Ga0209673_1008860 3300025273 Bacteria 4430
208 Ga0209676_1000049 3300025292 Bacteria 403210
209 Ga0209758_1000126 3300025297 Bacteria 189761
210 Ga0209050_1000118 3300025298 Bacteria 202586
211 Ga0209050_1002175 3300025298 Bacteria 17709
212 Ga0209050_1007206 3300025298 Bacteria 6314
213 Ga0207426_1006988 3300025302 Bacteria 4795
214 Ga0209051_1012520 3300025303 Bacteria 4098
215 Ga0209051_1028849 3300025303 Bacteria 2183
216 Ga0209257_1000017 3300025304 Bacteria 866287
217 Ga0209257_1081915 3300025304 Bacteria 826
218 Ga0207696_1000102 3300025711 Bacteria 167962
219 Ga0207655_1000050 3300025728 Bacteria 294923
220 Ga0207713_1003234 3300025735 Bacteria 11245
221 Ga0207713_1007592 3300025735 Bacteria 6363
222 Ga0207713_1010008 3300025735 Bacteria 5289
223 Ga0207713_1034261 3300025735 Bacteria 2208
224 Ga0207713_1037724 3300025735 Bacteria 2058
225 Ga0207713_1062235 3300025735 Bacteria 1416
226 Ga0207682_10046815 3300025893 Bacteria 1778
227 Ga0207682_10059042 3300025893 Bacteria 1602
228 Ga0207692_10025699 3300025898 Bacteria 2754
229 Ga0207688_10037219 3300025901 Bacteria 2698
230 Ga0207688_10076491 3300025901 Bacteria 1906
231 Ga0207647_10000214 3300025904 Bacteria 47271
232 Ga0207699_10169778 3300025906 Bacteria 1459
233 Ga0207699_10417052 3300025906 Bacteria 958
234 Ga0207645_10003842 3300025907 Bacteria 11246
235 Ga0207645_10008045 3300025907 Bacteria 7397
236 Ga0207705_10298720 3300025909 Bacteria 1235
237 Ga0207684_10367423 3300025910 Bacteria 1238
238 Ga0207707_10045648 3300025912 Bacteria 3818
239 Ga0207707_10323779 3300025912 Bacteria 1330
240 Ga0207695_10295074 3300025913 Bacteria 1513
241 Ga0207695_10748603 3300025913 Bacteria 857
242 Ga0207693_10048621 3300025915 Bacteria 3330
243 Ga0207693_10071974 3300025915 Bacteria 2706
244 Ga0207693_10133085 3300025915 Bacteria 1954
245 Ga0207663_10226097 3300025916 Bacteria 1364
246 Ga0207660_10173914 3300025917 Bacteria 1668
247 Ga0207657_10006963 3300025919 Bacteria 11647
248 Ga0207657_10141589 3300025919 Bacteria 1965
249 Ga0207649_10136089 3300025920 Bacteria 1675
250 Ga0207652_10175672 3300025921 Bacteria 1923
251 Ga0207694_10145346 3300025924 Bacteria 1909
252 Ga0207650_10017828 3300025925 Bacteria 4974
253 Ga0207650_10294106 3300025925 Bacteria 1325
254 Ga0207659_10045359 3300025926 Bacteria 3099
255 Ga0207659_10155103 3300025926 Bacteria 1792
256 Ga0207687_10263955 3300025927 Bacteria 1374
257 Ga0207687_10356245 3300025927 Bacteria 1193
258 Ga0207700_10124520 3300025928 Bacteria 2095
259 Ga0207700_10558911 3300025928 Bacteria 1016
260 Ga0207664_10089110 3300025929 Bacteria 2526
261 Ga0207664_10239628 3300025929 Bacteria 1579
262 Ga0207644_10033227 3300025931 Bacteria 3603
263 Ga0207644_10036754 3300025931 Bacteria 3440
264 Ga0207644_10060190 3300025931 Bacteria 2748
265 Ga0207690_10004649 3300025932 Bacteria 8119
266 Ga0207690_10022726 3300025932 Bacteria 3905
267 Ga0207690_10248754 3300025932 Bacteria 1372
268 Ga0207690_10364671 3300025932 Bacteria 1145
269 Ga0207706_10066449 3300025933 Bacteria 3173
270 Ga0207706_10285918 3300025933 Bacteria 1438
271 Ga0207709_10023791 3300025935 Bacteria 3490
272 Ga0207709_10093838 3300025935 Bacteria 1968
273 Ga0207670_10010092 3300025936 Bacteria 5422
274 Ga0207670_10089062 3300025936 Bacteria 2178
275 Ga0207670_10155224 3300025936 Bacteria 1703
276 Ga0207669_10034282 3300025937 Bacteria 2875
277 Ga0207669_10603336 3300025937 Bacteria 892
278 Ga0207669_10695154 3300025937 Bacteria 835
279 Ga0207704_10050758 3300025938 Bacteria 2504
280 Ga0207691_10012265 3300025940 Bacteria 8216
281 Ga0207691_10041907 3300025940 Bacteria 4223
282 Ga0207691_10053770 3300025940 Bacteria 3675
283 Ga0207711_10332058 3300025941 Bacteria 1406
284 Ga0207661_10257693 3300025944 Bacteria 1553
285 Ga0207661_10350052 3300025944 Bacteria 1333
286 Ga0207661_10665332 3300025944 Bacteria 957
287 Ga0207667_10154009 3300025949 Bacteria 2365
288 Ga0207667_10351371 3300025949 Bacteria 1504
289 Ga0207667_10535255 3300025949 Bacteria 1186
290 Ga0207651_10004851 3300025960 Bacteria 6850
291 Ga0207651_10460359 3300025960 Bacteria 1093
292 Ga0207668_10665261 3300025972 Bacteria 913
293 Ga0207640_10140243 3300025981 Bacteria 1761
294 Ga0207658_10001854 3300025986 Bacteria 15830
295 Ga0207658_10293172 3300025986 Bacteria 1399
296 Ga0207677_10026511 3300026023 Bacteria 3637
297 Ga0207703_10004753 3300026035 Bacteria 11078
298 Ga0207703_11125195 3300026035 Bacteria 754
299 Ga0207639_10203980 3300026041 Bacteria 1698
300 Ga0207639_10295485 3300026041 Bacteria 1430
301 Ga0207639_10833009 3300026041 Bacteria 861
302 Ga0207678_10002276 3300026067 Bacteria 17378
303 Ga0207678_10207607 3300026067 Bacteria 1675
304 Ga0207702_10053116 3300026078 Bacteria 3430
305 Ga0207702_10152927 3300026078 Bacteria 2100
306 Ga0207641_10607502 3300026088 Bacteria 1071
307 Ga0207648_10002295 3300026089 Bacteria 20666
308 Ga0207648_10136083 3300026089 Bacteria 2164
309 Ga0207674_10001229 3300026116 Bacteria 33433
310 Ga0207674_10013681 3300026116 Bacteria 8989
311 Ga0207674_10196505 3300026116 Bacteria 1967
312 Ga0207675_100023354 3300026118 Bacteria 5751
313 Ga0207683_10230825 3300026121 Bacteria 1688
314 Ga0207698_10565938 3300026142 Bacteria 1116
315 Ga0209281_1000283 3300027111 Bacteria 95533
316 Ga0209281_1000308 3300027111 Bacteria 87362
317 Ga0209281_1000994 3300027111 Bacteria 22409
318 Ga0209281_1001423 3300027111 Bacteria 14254
319 Ga0209371_1000013 3300027312 Bacteria 691516
320 Ga0209371_1000770 3300027312 Bacteria 26613
321 Ga0209974_10002757 3300027876 Bacteria 6372
322 Ga0207428_10546467 3300027907 Bacteria 838
323 Ga0268266_10001726 3300028379 Bacteria 25029
324 Ga0268266_10044374 3300028379 Bacteria 3801
325 Ga0268266_10235400 3300028379 Bacteria 1688
326 Ga0268266_10516774 3300028379 Bacteria 1141
327 Ga0265334_10009277 3300028573 Bacteria 4163
328 Ga0265318_10007856 3300028577 Bacteria 4793
329 Ga0265336_10000053 3300028666 Bacteria 113034
330 Ga0307517_10000174 3300028786 Bacteria 105578
331 Ga0307517_10108074 3300028786 Bacteria 2138
332 Ga0307515_10001235 3300028794 Bacteria 58313
333 Ga0307515_10004451 3300028794 Bacteria 29009
334 Ga0307515_10132420 3300028794 Bacteria 2735
335 Ga0307515_10162890 3300028794 Bacteria 2264
336 Ga0307515_10246467 3300028794 Bacteria 1547
337 Ga0265324_10000132 3300029957 Bacteria 58866
338 Ga0268256_1000014 3300030500 Bacteria 691435
339 Ga0268256_1000647 3300030500 Bacteria 26522
340 Ga0307511_10094344 3300030521 Bacteria 2006
341 Ga0307512_10046505 3300030522 Bacteria 3538
342 Ga0307512_10184109 3300030522 Bacteria 1167
343 Ga0265328_10020326 3300031239 Bacteria 2542
344 Ga0265325_10030670 3300031241 Bacteria 2882
345 Ga0265325_10035978 3300031241 Bacteria 2626
346 Ga0265340_10001678 3300031247 Bacteria 12726
347 Ga0265339_10011043 3300031249 Bacteria 5581
348 Ga0265331_10006526 3300031250 Bacteria 6884
349 Ga0265327_10000012 3300031251 Bacteria 530403
350 Ga0265327_10003227 3300031251 Bacteria 15859
351 Ga0265327_10228751 3300031251 Bacteria 834
352 Ga0265316_10036333 3300031344 Bacteria 3984
353 Ga0265316_10156124 3300031344 Bacteria 1708
354 Ga0307513_10014799 3300031456 Bacteria 9489
355 Ga0307513_10130230 3300031456 Bacteria 2463
356 Ga0307513_10195449 3300031456 Bacteria 1869
357 Ga0307509_10000225 3300031507 Bacteria 90913
358 Ga0307509_10005996 3300031507 Bacteria 16595
359 Ga0307509_10053865 3300031507 Bacteria 4286
360 Ga0307509_10067974 3300031507 Bacteria 3730
361 Ga0307408_100000010 3300031548 Bacteria 420048
362 Ga0307408_100908838 3300031548 Bacteria 806
363 Ga0265313_10123248 3300031595 Bacteria 1129
364 Ga0307508_10000185 3300031616 Bacteria 75407
365 Ga0307508_10001432 3300031616 Bacteria 26853
366 Ga0307508_10002202 3300031616 Bacteria 20788
367 Ga0307508_10003035 3300031616 Bacteria 17286
368 Ga0307514_10049262 3300031649 Bacteria 3277
369 Ga0307514_10143758 3300031649 Bacteria 1616
370 Ga0316579_10277060 3300031691 Bacteria 811
371 Ga0265314_10001531 3300031711 Bacteria 25492
372 Ga0265314_10035008 3300031711 Bacteria 3663
373 Ga0265314_10138293 3300031711 Bacteria 1510
374 Ga0265342_10042951 3300031712 Bacteria 2729
375 Ga0265342_10165792 3300031712 Bacteria 1219
376 Ga0307516_10001572 3300031730 Bacteria 31438
377 Ga0307516_10009757 3300031730 Bacteria 10650
378 Ga0307516_10259861 3300031730 Bacteria 1427
379 Ga0307405_10021739 3300031731 Bacteria 3612
380 Ga0307405_10185701 3300031731 Bacteria 1497
381 Ga0307413_10339359 3300031824 Bacteria 1155
382 Ga0307407_10026323 3300031903 Bacteria 3078
383 Ga0307409_100286400 3300031995 Bacteria 1526
384 Ga0307416_100851412 3300032002 Bacteria 1010
385 Ga0307507_10065803 3300033179 Bacteria 3329
386 Ga0307510_10002036 3300033180 Bacteria 22846
387 Ga0307510_10034205 3300033180 Bacteria 5694
388 Ga0373948_0005315 3300034817 Bacteria 2081
389 Ga0373926_0077703 3300035083 Bacteria 1225
390 Ga0373928_0010732 3300035084 Bacteria 1803
391 Ga0373940_0037180 3300035088 Bacteria 1324
392 Ga0373923_0076552 3300035111 Bacteria 1445
393 Ga0373932_0025863 3300035112 Bacteria 1593
394 Ga0373936_0024437 3300035113 Bacteria 2359
395 Ga0373939_0000036 3300035114 Bacteria 48825
396 Ga0373954_0011225 3300035118 Bacteria 3966
397 Ga0373956_0019348 3300035119 Bacteria 2886
398 Ga0373943_0034564 3300035170 Bacteria 2412
399 Ga0373943_0401850 3300035170 Bacteria 791
400 Ga0373946_0084338 3300035171 Bacteria 1397
401 Ga0373962_0007469 3300035242 Bacteria 2677
402 Ga0316574_0538732 3300035398 Bacteria 725
403 Ga0373931_0000268 3300035691 Bacteria 21952
404 Ga0373931_0008787 3300035691 Bacteria 4806
405 Ga0373931_0209948 3300035691 Bacteria 1167
406 Ga0373935_0104638 3300035692 Bacteria 1871
407 Ga0373927_0354282 3300035695 Bacteria 967
408 Ga0373927_0477124 3300035695 Bacteria 824
409 Ga0373933_0008201 3300035724 Bacteria 5702
410 Ga0373947_0394835 3300035725 Bacteria 932
411 Ga0373937_0003306 3300036401 Bacteria 13538
412 Ga0373937_0023547 3300036401 Bacteria 5545
413 Ga0373937_0214132 3300036401 Bacteria 1813
414 Ga0373937_0325039 3300036401 Bacteria 1455
415 Ga0373925_0027268 3300037068 Bacteria 4183
416 Ga0373925_0096228 3300037068 Bacteria 2269
417 Ga0373925_0418139 3300037068 Bacteria 1095
418 Ga0395899_0002765 3300037312 Bacteria 14156
419 Ga0395899_0014664 3300037312 Bacteria 5982
420 Ga0395899_0076220 3300037312 Bacteria 2448
421 Ga0395900_0008007 3300037418 Bacteria 10874
422 Ga0395900_0015475 3300037418 Bacteria 7776
423 Ga0395900_0083557 3300037418 Bacteria 3280
424 Ga0395900_0139262 3300037418 Bacteria 2485
425 Ga0395900_0173885 3300037418 Bacteria 2191
426 Ga0395898_0006186 3300037466 Bacteria 12825
427 Ga0395898_0039633 3300037466 Bacteria 4662
428 Ga0395898_0148759 3300037466 Bacteria 2241
429 Ga0395898_0171308 3300037466 Bacteria 2075
430 Ga0395905_0000025 3300037471 Bacteria 317571
431 Ga0395905_0005980 3300037471 Bacteria 12322
432 Ga0395905_0008672 3300037471 Bacteria 10014
433 Ga0395905_0030958 3300037471 Bacteria 5039
434 Ga0395905_0050499 3300037471 Bacteria 3896
435 Ga0395905_0059042 3300037471 Bacteria 3586
436 Ga0395905_0069854 3300037471 Bacteria 3290
437 Ga0395905_0079244 3300037471 Bacteria 3079
438 Ga0395905_0504115 3300037471 Bacteria 1110
439 Ga0395905_0719640 3300037471 Bacteria 900
440 Ga0395905_0755081 3300037471 Bacteria 875
441 Ga0436364_0492175 3300037853 Bacteria 5390
442 Ga0436364_1360306 3300037853 Bacteria 823
443 Ga0395901_0003336 3300038443 Bacteria 16173
444 Ga0395901_0043746 3300038443 Bacteria 4644
445 Ga0395901_0107006 3300038443 Bacteria 2935
446 Ga0395901_0174821 3300038443 Bacteria 2252
447 Ga0395901_0256096 3300038443 Bacteria 1822
448 Ga0395901_0537969 3300038443 Bacteria 1185
449 Ga0400490_19766 3300038726 Bacteria 6232
450 Ga0436365_1030367 3300039437 Bacteria 1100
451 Ga0436360_0103786 3300039438 Bacteria 1165
452 Ga0436360_0283312 3300039438 Bacteria 912
453 Ga0436360_0649612 3300039438 Bacteria 1424
454 Ga0436360_0708127 3300039438 Bacteria 1073
455 Ga0436361_0058641 3300039447 Bacteria 1416
456 Ga0436361_0098550 3300039447 Bacteria 3504
457 Ga0436361_0289802 3300039447 Bacteria 31851
458 Ga0436361_0380155 3300039447 Bacteria 4492
459 Ga0436361_0410668 3300039447 Bacteria 27008
460 Ga0436361_0653184 3300039447 Bacteria 36949
461 Ga0436361_0766328 3300039447 Bacteria 1810
462 Ga0436361_1213797 3300039447 Bacteria 923
463 Ga0436361_1214496 3300039447 Bacteria 9572
464 Ga0436363_0288717 3300039450 Bacteria 839
465 Ga0436362_1051954 3300039453 Bacteria 756
466 Ga0439447_055633 3300041407 Bacteria 938
467 Ga0451789_0173976 3300041443 Bacteria 1107
468 Ga0451789_1258901 3300041443 Bacteria 871
469 Ga0451791_1222017 3300041451 Bacteria 1335
470 Ga0451793_1887844 3300041452 Bacteria 1504
471 Ga0451798_0187906 3300041458 Bacteria 779
472 Ga0451800_0997610 3300041459 Bacteria 1248
473 Ga0451853_0292917 3300041512 Bacteria 3975
474 Ga0439448_0044399 3300042005 Bacteria 1445
475 Ga0439452_000141 3300042010 Bacteria 54325
476 Ga0439452_000604 3300042010 Bacteria 18370
477 Ga0450901_000116 3300042533 Bacteria 8723
478 Ga0451577_0014637 3300042876 Bacteria 7309
479 Ga0451577_0038258 3300042876 Bacteria 4315
480 Ga0466969_0035833 3300044656 Bacteria 2508
481 Ga0466977_0001317 3300044666 Bacteria 10077
482 Ga0466981_0000001 3300044669 Bacteria 367980
483 Ga0466966_0002026 3300044684 Bacteria 13155
484 Ga0466966_0011911 3300044684 Bacteria 5764
485 Ga0466961_0045147 3300044693 Bacteria 2820
486 Ga0453684_0002411 3300044712 Bacteria 45566
487 Ga0453684_0002552 3300044712 Bacteria 43755
488 Ga0453684_0131908 3300044712 Bacteria 2997
489 Ga0466971_0006284 3300044719 Bacteria 5159
490 Ga0466968_0051102 3300044735 Bacteria 1765
491 Ga0466970_0034701 3300044765 Bacteria 2672
492 Ga0466959_0002381 3300045049 Bacteria 11985
493 Ga0466959_0024159 3300045049 Bacteria 4500
494 Ga0466959_0186178 3300045049 Bacteria 1450
495 Ga0451576_0021714 3300045051 Bacteria 6971
496 Ga0451576_0070312 3300045051 Bacteria 3643
497 Ga0466958_0143808 3300045836 Bacteria 1502
498 Ga0495592_0001312 3300046454 Bacteria 17260
499 Ga0495591_010516 3300046458 Bacteria 3580
500 Ga0495629_0062368 3300046459 Bacteria 2604
501 Ga0495629_0429184 3300046459 Bacteria 896
502 Ga0495638_0111379 3300046460 Bacteria 1626
503 Ga0495638_0164268 3300046460 Bacteria 1278
504 Ga0495638_0229829 3300046460 Bacteria 1032
505 Ga0495651_0011915 3300046462 Bacteria 6690
506 Ga0495653_0069116 3300046463 Bacteria 2647
507 Ga0495650_0000040 3300046471 Bacteria 366254
508 Ga0495662_0076309 3300046476 Bacteria 1627
509 Ga0495583_0000159 3300046506 Bacteria 113627
510 Ga0495606_0005971 3300046507 Bacteria 11423
511 Ga0495608_0000180 3300046511 Bacteria 45181
512 Ga0495620_0011609 3300046515 Bacteria 4587
513 Ga0495628_0027713 3300046516 Bacteria 4605
514 Ga0495628_0212603 3300046516 Bacteria 1454
515 Ga0495630_0148899 3300046517 Bacteria 1781
516 Ga0495630_0449750 3300046517 Bacteria 987
517 Ga0495632_0004601 3300046519 Bacteria 9343
518 Ga0495632_0012661 3300046519 Bacteria 4852
519 Ga0495644_0024463 3300046523 Bacteria 2297
520 Ga0495648_0057854 3300046524 Bacteria 2322
521 Ga0495666_0126634 3300046526 Bacteria 1194
522 Ga0495666_0136678 3300046526 Bacteria 1144
523 Ga0495652_0004484 3300046529 Bacteria 13326
524 Ga0495640_0011129 3300046533 Bacteria 6927
525 Ga0495645_0114971 3300046543 Bacteria 1901
526 Ga0495633_0003465 3300046558 Bacteria 10491
527 Ga0495667_0006865 3300046559 Bacteria 7730
528 Ga0495667_0012787 3300046559 Bacteria 5687
529 Ga0495635_0002686 3300046663 Bacteria 12157
530 Ga0495635_0095933 3300046663 Bacteria 2027
531 Ga0495657_0017312 3300046675 Bacteria 5233
532 Ga0495599_0066436 3300046678 Bacteria 2252
533 Ga0495599_0272136 3300046678 Bacteria 1027
534 Ga0495623_0014713 3300046679 Bacteria 5059
535 Ga0495646_0253970 3300046680 Bacteria 941
536 Ga0495658_0032612 3300046683 Bacteria 2846
537 Ga0495624_0095731 3300046690 Bacteria 1830
538 Ga0495671_0016703 3300046692 Bacteria 3915
539 Ga0495671_0084130 3300046692 Bacteria 1559
540 Ga0495649_0000760 3300046694 Bacteria 25925
541 Ga0495649_0001240 3300046694 Bacteria 19630
542 Ga0495649_0005881 3300046694 Bacteria 7705
543 Ga0495589_0003499 3300046794 Bacteria 8497
544 Ga0495600_0005529 3300046809 Bacteria 7625
545 Ga0495604_0000241 3300047317 Bacteria 48922
546 Ga0495674_0017966 3300047319 Bacteria 6583
547 Ga0495674_0032889 3300047319 Bacteria 4701
548 Ga0495674_0149045 3300047319 Bacteria 1962
549 Ga0495672_0159004 3300047320 Bacteria 1164
550 Ga0495676_0213093 3300047321 Bacteria 1335
551 Ga0495680_0000994 3300047322 Bacteria 31554
552 Ga0495679_004962 3300047446 Bacteria 6001
553 Ga0495686_0004435 3300047472 Bacteria 11558
554 Ga0495602_0010667 3300048088 Bacteria 9531
555 Ga0495614_0251148 3300048089 Bacteria 809
556 Ga0496101_0147970 3300048904 Bacteria 1794
557 Ga0496102_0007894 3300048905 Bacteria 9094
558 Ga0496104_0001702 3300048907 Bacteria 18996
559 Ga0496104_0130603 3300048907 Bacteria 2413
560 Ga0496104_0639924 3300048907 Bacteria 972
561 Ga0496105_0054625 3300048908 Bacteria 3297
562 Ga0496105_0226223 3300048908 Bacteria 1521
563 Ga0496105_0379026 3300048908 Bacteria 1126
564 Ga0496109_0460024 3300048912 Bacteria 1202
565 Ga0496112_0031940 3300048915 Bacteria 5110
566 Ga0496112_0037322 3300048915 Bacteria 4743
567 Ga0496116_0001458 3300048919 Bacteria 26519
568 Ga0496116_0009281 3300048919 Bacteria 8408
569 Ga0496116_0026850 3300048919 Bacteria 4200
570 Ga0496116_0045377 3300048919 Bacteria 2975
571 Ga0496117_0008694 3300048920 Bacteria 9598
572 Ga0496117_0016174 3300048920 Bacteria 6305
573 Ga0496117_0112497 3300048920 Bacteria 1692
574 Ga0496117_0128221 3300048920 Bacteria 1543
575 Ga0496118_0002802 3300048921 Bacteria 22834
576 Ga0496118_0022466 3300048921 Bacteria 5512
577 Ga0496118_0035786 3300048921 Bacteria 4024
578 Ga0496118_0038436 3300048921 Bacteria 3835
579 Ga0496118_0040266 3300048921 Bacteria 3717
580 Ga0496118_0073071 3300048921 Bacteria 2459
581 Ga0496118_0153551 3300048921 Bacteria 1436
582 Ga0496118_0215287 3300048921 Bacteria 1123
583 Ga0496119_0000438 3300048922 Bacteria 57088
584 Ga0496119_0006572 3300048922 Bacteria 10717
585 Ga0496119_0009447 3300048922 Bacteria 8365
586 Ga0496119_0009582 3300048922 Bacteria 8275
587 Ga0496119_0020054 3300048922 Bacteria 4891
588 Ga0496119_0093129 3300048922 Bacteria 1707
589 Ga0496119_0185548 3300048922 Bacteria 1087
590 Ga0496119_0196127 3300048922 Bacteria 1048
591 Ga0496119_0205455 3300048922 Bacteria 1017
592 Ga0496120_0006993 3300048923 Bacteria 8487
593 Ga0496120_0015782 3300048923 Bacteria 4964
594 Ga0496120_0017901 3300048923 Bacteria 4578
595 Ga0496120_0035404 3300048923 Bacteria 2982
596 Ga0496120_0076836 3300048923 Bacteria 1818
597 Ga0496120_0107954 3300048923 Bacteria 1459
598 Ga0496120_0109698 3300048923 Bacteria 1443
599 Ga0496120_0286958 3300048923 Bacteria 758
600 Ga0496121_0000729 3300048924 Bacteria 60664
601 Ga0496121_0004852 3300048924 Bacteria 17688
602 Ga0496121_0014724 3300048924 Bacteria 8265
603 Ga0496121_0022172 3300048924 Bacteria 6178
604 Ga0496121_0082677 3300048924 Bacteria 2537
605 Ga0496121_0180201 3300048924 Bacteria 1525
606 Ga0496121_0381877 3300048924 Bacteria 928
607 Ga0496121_0405139 3300048924 Bacteria 892
608 Ga0496121_0424121 3300048924 Bacteria 864
609 Ga0496122_0008944 3300048925 Bacteria 10652
610 Ga0496122_0025170 3300048925 Bacteria 5179
611 Ga0496122_0059803 3300048925 Bacteria 2811
612 Ga0496122_0120875 3300048925 Bacteria 1689
613 Ga0496122_0127356 3300048925 Bacteria 1626
614 Ga0496123_0020285 3300048926 Bacteria 5205
615 Ga0496123_0024494 3300048926 Bacteria 4584
616 Ga0496123_0040172 3300048926 Bacteria 3262
617 Ga0496123_0051988 3300048926 Bacteria 2723
618 Ga0496123_0062130 3300048926 Bacteria 2395
619 Ga0496123_0074150 3300048926 Bacteria 2107
620 Ga0496123_0287337 3300048926 Bacteria 791
621 Ga0496123_0296620 3300048926 Bacteria 773
622 Ga0496124_0000458 3300048927 Bacteria 70719
623 Ga0496124_0000649 3300048927 Bacteria 57400
624 Ga0496124_0004557 3300048927 Bacteria 16105
625 Ga0496124_0043082 3300048927 Bacteria 3881
626 Ga0496124_0109668 3300048927 Bacteria 2223
627 Ga0496124_0115509 3300048927 Bacteria 2153
628 Ga0496124_0122443 3300048927 Bacteria 2076
629 Ga0496124_0157997 3300048927 Bacteria 1770
630 Ga0496124_0178151 3300048927 Bacteria 1638
631 Ga0496124_0524040 3300048927 Bacteria 789
632 Ga0496124_0574994 3300048927 Bacteria 738
633 Ga0496125_0000176 3300048928 Bacteria 140746
634 Ga0496125_0000370 3300048928 Bacteria 84467
635 Ga0496125_0000522 3300048928 Bacteria 66680
636 Ga0496125_0004254 3300048928 Bacteria 16677
637 Ga0496125_0035699 3300048928 Bacteria 4355
638 Ga0496125_0039207 3300048928 Bacteria 4083
639 Ga0496125_0188964 3300048928 Bacteria 1362
640 Ga0496125_0189365 3300048928 Bacteria 1360
641 Ga0496126_0000329 3300048929 Bacteria 101203
642 Ga0496126_0006943 3300048929 Bacteria 12533
643 Ga0496126_0023134 3300048929 Bacteria 6023
644 Ga0496126_0036180 3300048929 Bacteria 4619
645 Ga0496126_0038207 3300048929 Bacteria 4469
646 Ga0496126_0085578 3300048929 Bacteria 2779
647 Ga0496126_0216132 3300048929 Bacteria 1612
648 Ga0496126_0254378 3300048929 Bacteria 1462
649 Ga0496126_0332932 3300048929 Bacteria 1245
650 Ga0496126_0772766 3300048929 Bacteria 739
651 Ga0501031_0438289 3300049568 Bacteria 844
652 Ga0501032_0274596 3300049569 Bacteria 1092
653 Ga0501034_0000891 3300049571 Bacteria 43738
654 Ga0501036_0043205 3300049572 Bacteria 3816
655 Ga0501038_0832475 3300049574 Bacteria 684
656 Ga0501039_0853863 3300049575 Bacteria 709
657 Ga0501042_0167530 3300049578 Bacteria 1585
658 Ga0501070_0458664 3300049586 Bacteria 1027
659 Ga0501070_0717050 3300049586 Bacteria 790
660 Ga0501071_0213511 3300049587 Bacteria 1451
661 Ga0501072_0580051 3300049588 Bacteria 885
662 Ga0501073_0005280 3300049589 Bacteria 9689
663 Ga0501074_0164829 3300049590 Bacteria 1582
664 Ga0501074_0279470 3300049590 Bacteria 1187
665 Ga0501206_005345 3300049653 Bacteria 1652
666 Ga0501080_0277255 3300049742 Bacteria 1525
667 Ga0501081_0080810 3300049743 Bacteria 2276
668 nmdc:mga03683_2170_c2 3300050489 Bacteria 4087
669 nmdc:mga03n38_25584_c1 3300050490 Bacteria 2426
670 nmdc:mga00v17_108561_c1 3300050491 Bacteria 1758
671 nmdc:mga00v17_281313_c1 3300050491 Bacteria 1080
672 nmdc:mga0k408_1297_c2 3300050493 Bacteria 9516
673 nmdc:mga0k408_157438_c1 3300050493 Bacteria 1353
674 nmdc:mga0k408_208903_c2 3300050493 Bacteria 793
675 nmdc:mga0k408_6099_c1 3300050493 Bacteria 6422
676 nmdc:mga07m45_183995_c1 3300050496 Bacteria 1215
677 nmdc:mga07m45_278375_c1 3300050496 Bacteria 973
678 nmdc:mga07m45_748_c1 3300050496 Bacteria 13891
679 nmdc:mga05p37_296340_c1 3300050507 Bacteria 1923
680 nmdc:mga05p37_441880_c1 3300050507 Bacteria 1508
681 nmdc:mga05p37_645950_c1 3300050507 Bacteria 1186
682 nmdc:mga05p37_942100_c1 3300050507 Bacteria 925
683 nmdc:mga09592_2859_c1 3300050508 Bacteria 14008
684 nmdc:mga0qj67_577334_c1 3300050509 Bacteria 900
685 nmdc:mga0qj67_92402_c1 3300050509 Bacteria 2433
686 nmdc:mga06r32_341153_c1 3300050510 Bacteria 1483
687 nmdc:mga08y16_192145_c1 3300050511 Bacteria 2117
688 nmdc:mga08y16_587640_c1 3300050511 Bacteria 1123
689 nmdc:mga08y16_635362_c1 3300050511 Bacteria 1073
690 nmdc:mga0n895_354078_c1 3300050512 Bacteria 1487
691 nmdc:mga08x19_362063_c1 3300050514 Bacteria 1014
692 nmdc:mga0a205_211457_c1 3300050515 Bacteria 1828
693 nmdc:mga0sz30_20944_c1 3300050516 Bacteria 2642
694 nmdc:mga0sz30_2490_c1 3300050516 Bacteria 5323
695 Ga0495601_0001571 3300053077 Bacteria 12632
696 Ga0495601_0002038 3300053077 Bacteria 11335
697 Ga0495612_0000746 3300053078 Bacteria 13248
698 Ga0500635_0000363 3300053080 Bacteria 14460
699 Ga0495595_0000387 3300053084 Bacteria 16728
700 Ga0495595_0057549 3300053084 Bacteria 1813
701 Ga0495595_0430811 3300053084 Bacteria 670
702 Ga0495619_0030742 3300053085 Bacteria 3476
703 Ga0495619_0036207 3300053085 Bacteria 3212
704 Ga0500578_0000079 3300053086 Bacteria 107137
705 Ga0500643_008711 3300053087 Bacteria 3958
706 Ga0500644_0001074 3300053088 Bacteria 8067
707 Ga0500651_0092267 3300053093 Bacteria 1863
708 Ga0500593_041066 3300053117 Bacteria 2067
709 Ga0500594_0001408 3300053118 Bacteria 5221
710 Ga0500594_0004863 3300053118 Bacteria 2970
711 Ga0500595_000029 3300053119 Bacteria 122318
712 Ga0500607_197285 3300053121 Bacteria 870
713 Ga0500652_000624 3300053131 Bacteria 12146
714 Ga0500652_107925 3300053131 Bacteria 1163
715 Ga0500658_0006331 3300053134 Bacteria 4394
716 Ga0500658_0017060 3300053134 Bacteria 2709
717 Ga0500658_0067760 3300053134 Bacteria 1499
718 Ga0500559_0000329 3300053136 Bacteria 35808
719 Ga0500559_0050482 3300053136 Bacteria 1835
720 Ga0500588_0006411 3300053146 Bacteria 2665
721 Ga0500616_0000006 3300053153 Bacteria 944738
722 Ga0500616_0001264 3300053153 Bacteria 25261
723 Ga0500622_0000053 3300053156 Bacteria 145070
724 Ga0500622_0007462 3300053156 Bacteria 6208
725 Ga0500622_0093747 3300053156 Bacteria 1486
726 Ga0500636_0015032 3300053177 Bacteria 4557
727 Ga0500636_0070250 3300053177 Bacteria 2032
728 Ga0500645_000614 3300053730 Bacteria 22818
729 Ga0501082_0071314 3300060353 Bacteria 2992
730 Ga0466962_0005900 3300061719 Bacteria 5884

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 8019555841 8019560230 170
2 3300009176 Ga0105242_10455296 Ga0105242_104552962 190
3 3300049569 Ga0501032_0274596 Ga0501032_0274596_30_605 190
4 3300031731 Ga0307405_10185701 Ga0307405_101857012 194
5 3300050490 nmdc:mga03n38_25584_c1 nmdc:mga03n38_25584_c1_81_677 194
6 3300013104 Ga0157370_10079648 Ga0157370_100796482 196
7 3300042876 Ga0451577_0014637 Ga0451577_0014637_4682_5281 196
8 3300044712 Ga0453684_0002552 Ga0453684_0002552_40722_41321 196
9 3300044765 Ga0466970_0034701 Ga0466970_0034701_275_868 196
10 3300048921 Ga0496118_0215287 Ga0496118_0215287_20_610 196
11 3300048924 Ga0496121_0180201 Ga0496121_0180201_21_611 196
12 3300048927 Ga0496124_0574994 Ga0496124_0574994_128_718 196
13 3300050489 nmdc:mga03683_2170_c2 nmdc:mga03683_2170_c2_2725_3327 196
14 3300050493 nmdc:mga0k408_157438_c1 nmdc:mga0k408_157438_c1_457_1059 196
15 3300050493 nmdc:mga0k408_208903_c2 nmdc:mga0k408_208903_c2_187_783 196
16 3300050516 nmdc:mga0sz30_20944_c1 nmdc:mga0sz30_20944_c1_1357_1959 196
17 3300053153 Ga0500616_0001264 Ga0500616_0001264_1903_2496 196
18 iso_pu_bacteria 8001522603 8001525934 197
19 3300031691 Ga0316579_10277060 Ga0316579_102770601 198
20 3300037471 Ga0395905_0030958 Ga0395905_0030958_37_657 198
21 3300039438 Ga0436360_0103786 Ga0436360_0103786_529_1128 198
22 3300046517 Ga0495630_0449750 Ga0495630_0449750_311_907 198
23 3300046690 Ga0495624_0095731 Ga0495624_0095731_15_611 198
24 3300048088 Ga0495602_0010667 Ga0495602_0010667_183_779 198
25 3300049578 Ga0501042_0167530 Ga0501042_0167530_956_1555 198
26 3300053087 Ga0500643_008711 Ga0500643_008711_1171_1767 198
27 3300053119 Ga0500595_000029 Ga0500595_000029_54398_54994 198
28 iso_pu_bacteria 2585428058 2587731191 198
29 iso_pu_bacteria 2588253510 2588289944 198
30 iso_pu_bacteria 2643221544 2643742396 198
31 iso_pu_bacteria 2643221592 2643972266 198
32 iso_pu_bacteria 2643221625 2644141623 198
33 iso_pu_bacteria 2643221648 2644275606 198
34 3300002067 JGI24735J21928_10019472 JGI24735J21928_100194722 199
35 3300003354 JGI25160J50197_1001200 JGI25160J50197_10012006 199
36 3300005262 Ga0065165_1000791 Ga0065165_100079135 199
37 3300005327 Ga0070658_10224317 Ga0070658_102243172 199
38 3300005334 Ga0068869_100656979 Ga0068869_1006569791 199
39 3300005355 Ga0070671_100014561 Ga0070671_1000145614 199
40 3300005563 Ga0068855_100395977 Ga0068855_1003959772 199
41 3300005616 Ga0068852_100742228 Ga0068852_1007422282 199
42 3300009093 Ga0105240_10450333 Ga0105240_104503332 199
43 3300009177 Ga0105248_10000445 Ga0105248_1000044520 199
44 3300009545 Ga0105237_10142234 Ga0105237_101422342 199
45 3300010375 Ga0105239_10010809 Ga0105239_100108094 199
46 3300013104 Ga0157370_10008752 Ga0157370_1000875210 199
47 3300013105 Ga0157369_10025847 Ga0157369_100258476 199
48 3300021361 Ga0213872_10000093 Ga0213872_1000009371 199
49 3300021361 Ga0213872_10000490 Ga0213872_100004909 199
50 3300021361 Ga0213872_10035775 Ga0213872_100357753 199
51 3300025228 Ga0209672_104934 Ga0209672_1049342 199
52 3300025904 Ga0207647_10000214 Ga0207647_1000021410 199
53 3300025909 Ga0207705_10298720 Ga0207705_102987201 199
54 3300025919 Ga0207657_10006963 Ga0207657_100069638 199
55 3300025941 Ga0207711_10332058 Ga0207711_103320581 199
56 3300025949 Ga0207667_10154009 Ga0207667_101540092 199
57 3300031250 Ga0265331_10006526 Ga0265331_100065263 199
58 3300031251 Ga0265327_10000012 Ga0265327_1000001255 199
59 3300037466 Ga0395898_0148759 Ga0395898_0148759_1187_1807 199
60 3300037471 Ga0395905_0069854 Ga0395905_0069854_1564_2187 199
61 3300037471 Ga0395905_0079244 Ga0395905_0079244_205_846 199
62 3300039447 Ga0436361_0289802 Ga0436361_0289802_23389_24033 199
63 3300039447 Ga0436361_0380155 Ga0436361_0380155_2069_2713 199
64 3300039447 Ga0436361_0410668 Ga0436361_0410668_24192_24833 199
65 3300039447 Ga0436361_1214496 Ga0436361_1214496_417_1058 199
66 3300044656 Ga0466969_0035833 Ga0466969_0035833_1268_1888 199
67 3300044735 Ga0466968_0051102 Ga0466968_0051102_516_1157 199
68 3300045049 Ga0466959_0186178 Ga0466959_0186178_436_1056 199
69 3300048915 Ga0496112_0031940 Ga0496112_0031940_3938_4567 199
70 iso_pu_bacteria 2515154122 2515679265 199
71 iso_pu_bacteria 2585428057 2587728133 199
72 iso_pu_bacteria 2585428062 2587759971 199
73 iso_pu_bacteria 2643221585 2643933639 199
74 iso_pu_bacteria 2643221639 2644222023 199
75 iso_pu_bacteria 2643221646 2644257198 199
76 iso_pu_bacteria 2643221654 2644302863 199
77 iso_pu_bacteria 2643221656 2644315139 199
78 iso_pu_bacteria 2738541296 2738819916 199
79 iso_pu_bacteria 2738541298 2738832396 199
80 iso_pu_bacteria 2738541306 2738873923 199
81 iso_pu_bacteria 2738541337 2739055249 199
82 iso_pu_bacteria 2738543002 2739185553 199
83 iso_pu_bacteria 2738543008 2739220521 199
84 iso_pu_bacteria 2791355137 2792841161 199
85 iso_pu_bacteria 2834641062 2834641739 199
86 iso_pu_bacteria 2840878972 2840883231 199
87 iso_pu_bacteria 2881101125 2881102725 199
88 iso_pu_bacteria 2902682994 2902683277 199
89 iso_pu_bacteria 2932422444 2932424875 199
90 iso_pu_bacteria 2990703756 2990710368 199
91 iso_pu_bacteria 641736151 642422891 199
92 iso_pu_bacteria 8003400568 8003402777 199
93 3300003771 Ga0055526_1003050 Ga0055526_10030503 200
94 3300005439 Ga0070711_100062131 Ga0070711_1000621313 200
95 3300005468 Ga0070707_100059206 Ga0070707_1000592064 200
96 3300005471 Ga0070698_100040887 Ga0070698_1000408878 200
97 3300025910 Ga0207684_10367423 Ga0207684_103674232 200
98 3300025915 Ga0207693_10048621 Ga0207693_100486214 200
99 3300050507 nmdc:mga05p37_296340_c1 nmdc:mga05p37_296340_c1_814_1443 200
100 iso_pu_bacteria 2721755763 2723875890 200
101 3300003215 JGI25153J46596_10012485 JGI25153J46596_100124855 201
102 3300003791 Ga0055530_10012719 Ga0055530_100127193 201
103 3300003794 Ga0055531_10000390 Ga0055531_100003905 201
104 3300005262 Ga0065165_1001455 Ga0065165_100145515 201
105 3300005445 Ga0070708_100161995 Ga0070708_1001619952 201
106 3300005455 Ga0070663_100206784 Ga0070663_1002067842 201
107 3300005456 Ga0070678_100591590 Ga0070678_1005915902 201
108 3300005617 Ga0068859_100649608 Ga0068859_1006496082 201
109 3300006173 Ga0070716_100101169 Ga0070716_1001011692 201
110 3300006353 Ga0075370_10002042 Ga0075370_100020426 201
111 3300006931 Ga0097620_100649518 Ga0097620_1006495182 201
112 3300009177 Ga0105248_10144214 Ga0105248_101442143 201
113 3300013306 Ga0163162_10012108 Ga0163162_100121087 201
114 3300013308 Ga0157375_10016277 Ga0157375_100162775 201
115 3300025273 Ga0209673_1008860 Ga0209673_10088603 201
116 3300025297 Ga0209758_1000126 Ga0209758_1000126169 201
117 3300025298 Ga0209050_1000118 Ga0209050_1000118125 201
118 3300025298 Ga0209050_1002175 Ga0209050_100217516 201
119 3300025303 Ga0209051_1012520 Ga0209051_10125202 201
120 3300025303 Ga0209051_1028849 Ga0209051_10288492 201
121 3300025304 Ga0209257_1000017 Ga0209257_1000017168 201
122 3300025937 Ga0207669_10695154 Ga0207669_106951541 201
123 3300031251 Ga0265327_10228751 Ga0265327_102287511 201
124 3300031456 Ga0307513_10195449 Ga0307513_101954492 201
125 3300037312 Ga0395899_0002765 Ga0395899_0002765_11196_11837 201
126 3300037418 Ga0395900_0083557 Ga0395900_0083557_320_961 201
127 3300037466 Ga0395898_0006186 Ga0395898_0006186_8597_9238 201
128 3300037471 Ga0395905_0059042 Ga0395905_0059042_2347_2988 201
129 3300038443 Ga0395901_0043746 Ga0395901_0043746_471_1112 201
130 3300041443 Ga0451789_1258901 Ga0451789_1258901_121_765 201
131 3300041451 Ga0451791_1222017 Ga0451791_1222017_188_832 201
132 3300041458 Ga0451798_0187906 Ga0451798_0187906_53_697 201
133 3300044666 Ga0466977_0001317 Ga0466977_0001317_6218_6856 201
134 3300044712 Ga0453684_0131908 Ga0453684_0131908_1745_2395 201
135 3300046460 Ga0495638_0229829 Ga0495638_0229829_232_876 201
136 3300046519 Ga0495632_0004601 Ga0495632_0004601_4786_5430 201
137 3300046524 Ga0495648_0057854 Ga0495648_0057854_1184_1807 201
138 3300046692 Ga0495671_0016703 Ga0495671_0016703_2265_2888 201
139 3300048924 Ga0496121_0022172 Ga0496121_0022172_452_1096 201
140 3300048927 Ga0496124_0000458 Ga0496124_0000458_51276_51920 201
141 3300048928 Ga0496125_0039207 Ga0496125_0039207_295_939 201
142 3300050496 nmdc:mga07m45_748_c1 nmdc:mga07m45_748_c1_7413_8057 201
143 3300053086 Ga0500578_0000079 Ga0500578_0000079_7454_8098 201
144 3300053118 Ga0500594_0004863 Ga0500594_0004863_490_1113 201
145 3300053131 Ga0500652_000624 Ga0500652_000624_4212_4856 201
146 3300053134 Ga0500658_0006331 Ga0500658_0006331_3638_4282 201
147 3300053156 Ga0500622_0000053 Ga0500622_0000053_107093_107737 201
148 iso_pu_bacteria 2554235231 2555247152 201
149 iso_pu_bacteria 2602042047 2603644192 201
150 iso_pu_bacteria 2602042066 2603701264 201
151 iso_pu_bacteria 2602042067 2603704784 201
152 iso_pu_bacteria 2667528172 2671104682 201
153 iso_pu_bacteria 2681812866 2681997965 201
154 iso_pu_bacteria 2681812869 2682008076 201
155 iso_pu_bacteria 2751185917 2753857597 201
156 iso_pu_bacteria 2765235842 2765590703 201
157 iso_pu_bacteria 2775506706 2775540265 201
158 iso_pu_bacteria 2821118458 2821120579 201
159 iso_pu_bacteria 2823373977 2823376466 201
160 iso_pu_bacteria 2835312727 2835312758 201
161 iso_pu_bacteria 2882456835 2882461725 201
162 iso_pu_bacteria 2927833300 2927836932 201
163 iso_pu_bacteria 2937539931 2937543970 201
164 iso_pu_bacteria 2939573065 2939576448 201
165 iso_pu_bacteria 8018221730 8018223270 201
166 iso_pu_bacteria 8052494512 8052497667 201
167 iso_pu_bacteria 8054929484 8054931894 201
168 iso_pu_bacteria 8056120720 8056123581 201
169 iso_pu_bacteria 8056137416 8056140736 201
170 iso_pu_bacteria 8057304971 8057308326 201
171 3300003371 JGI26145J50221_1007868 JGI26145J50221_10078682 202
172 3300003752 Ga0055539_1000240 Ga0055539_100024029 202
173 3300003756 Ga0055533_1000103 Ga0055533_100010339 202
174 3300003759 Ga0055525_1000928 Ga0055525_10009283 202
175 3300005327 Ga0070658_10271096 Ga0070658_102710962 202
176 3300005328 Ga0070676_10008197 Ga0070676_100081972 202
177 3300005330 Ga0070690_100166308 Ga0070690_1001663082 202
178 3300005331 Ga0070670_100090066 Ga0070670_1000900663 202
179 3300005333 Ga0070677_10025585 Ga0070677_100255852 202
180 3300005333 Ga0070677_10060999 Ga0070677_100609993 202
181 3300005337 Ga0070682_100002901 Ga0070682_1000029016 202
182 3300005345 Ga0070692_10139728 Ga0070692_101397282 202
183 3300005347 Ga0070668_100611455 Ga0070668_1006114552 202
184 3300005353 Ga0070669_100143237 Ga0070669_1001432372 202
185 3300005354 Ga0070675_100030521 Ga0070675_1000305213 202
186 3300005354 Ga0070675_100066853 Ga0070675_1000668532 202
187 3300005355 Ga0070671_100039548 Ga0070671_1000395483 202
188 3300005355 Ga0070671_100059923 Ga0070671_1000599233 202
189 3300005356 Ga0070674_100009918 Ga0070674_1000099186 202
190 3300005356 Ga0070674_100437539 Ga0070674_1004375391 202
191 3300005364 Ga0070673_100006916 Ga0070673_1000069164 202
192 3300005364 Ga0070673_100197786 Ga0070673_1001977862 202
193 3300005365 Ga0070688_100406353 Ga0070688_1004063532 202
194 3300005367 Ga0070667_100005361 Ga0070667_1000053614 202
195 3300005367 Ga0070667_100343716 Ga0070667_1003437161 202
196 3300005367 Ga0070667_100923990 Ga0070667_1009239901 202
197 3300005455 Ga0070663_100006550 Ga0070663_1000065502 202
198 3300005457 Ga0070662_100282844 Ga0070662_1002828442 202
199 3300005458 Ga0070681_10041779 Ga0070681_100417792 202
200 3300005459 Ga0068867_100004166 Ga0068867_1000041668 202
201 3300005459 Ga0068867_100877485 Ga0068867_1008774851 202
202 3300005535 Ga0070684_100681333 Ga0070684_1006813332 202
203 3300005539 Ga0068853_100095434 Ga0068853_1000954342 202
204 3300005539 Ga0068853_100216637 Ga0068853_1002166372 202
205 3300005543 Ga0070672_100001714 Ga0070672_1000017148 202
206 3300005543 Ga0070672_100222147 Ga0070672_1002221472 202
207 3300005543 Ga0070672_100323332 Ga0070672_1003233321 202
208 3300005548 Ga0070665_100547140 Ga0070665_1005471402 202
209 3300005577 Ga0068857_100076664 Ga0068857_1000766643 202
210 3300005578 Ga0068854_100093824 Ga0068854_1000938243 202
211 3300005578 Ga0068854_100219094 Ga0068854_1002190943 202
212 3300005617 Ga0068859_100024837 Ga0068859_1000248376 202
213 3300005842 Ga0068858_100004350 Ga0068858_1000043506 202
214 3300005843 Ga0068860_100239700 Ga0068860_1002397002 202
215 3300006195 Ga0075366_10006382 Ga0075366_100063822 202
216 3300006195 Ga0075366_10014006 Ga0075366_100140065 202
217 3300006195 Ga0075366_10222599 Ga0075366_102225992 202
218 3300006353 Ga0075370_10129531 Ga0075370_101295312 202
219 3300006358 Ga0068871_100089638 Ga0068871_1000896382 202
220 3300006846 Ga0075430_100037022 Ga0075430_1000370223 202
221 3300006847 Ga0075431_100098152 Ga0075431_1000981522 202
222 3300006880 Ga0075429_100002479 Ga0075429_1000024796 202
223 3300006880 Ga0075429_100368044 Ga0075429_1003680442 202
224 3300006881 Ga0068865_100059814 Ga0068865_1000598143 202
225 3300006931 Ga0097620_100024837 Ga0097620_1000248376 202
226 3300009093 Ga0105240_10175619 Ga0105240_101756194 202
227 3300009101 Ga0105247_10180550 Ga0105247_101805502 202
228 3300009148 Ga0105243_10165154 Ga0105243_101651542 202
229 3300009174 Ga0105241_10561534 Ga0105241_105615341 202
230 3300009177 Ga0105248_10076019 Ga0105248_100760192 202
231 3300009551 Ga0105238_10334315 Ga0105238_103343152 202
232 3300009982 Ga0105147_100451 Ga0105147_1004514 202
233 3300010159 Ga0099796_10028260 Ga0099796_100282603 202
234 3300013102 Ga0157371_10202180 Ga0157371_102021802 202
235 3300013105 Ga0157369_10082380 Ga0157369_100823801 202
236 3300013296 Ga0157374_10044716 Ga0157374_100447165 202
237 3300013297 Ga0157378_10936206 Ga0157378_109362061 202
238 3300013306 Ga0163162_10172537 Ga0163162_101725373 202
239 3300014968 Ga0157379_10003329 Ga0157379_1000332913 202
240 3300014969 Ga0157376_10300847 Ga0157376_103008472 202
241 3300025226 Ga0209674_100003 Ga0209674_100003265 202
242 3300025230 Ga0209563_100141 Ga0209563_1001418 202
243 3300025253 Ga0209677_100068 Ga0209677_100068128 202
244 3300025256 Ga0209759_1000423 Ga0209759_100042328 202
245 3300025304 Ga0209257_1081915 Ga0209257_10819152 202
246 3300025893 Ga0207682_10046815 Ga0207682_100468152 202
247 3300025893 Ga0207682_10059042 Ga0207682_100590422 202
248 3300025901 Ga0207688_10037219 Ga0207688_100372192 202
249 3300025901 Ga0207688_10076491 Ga0207688_100764912 202
250 3300025907 Ga0207645_10003842 Ga0207645_100038422 202
251 3300025907 Ga0207645_10008045 Ga0207645_100080452 202
252 3300025912 Ga0207707_10045648 Ga0207707_100456484 202
253 3300025913 Ga0207695_10748603 Ga0207695_107486031 202
254 3300025919 Ga0207657_10141589 Ga0207657_101415892 202
255 3300025925 Ga0207650_10294106 Ga0207650_102941061 202
256 3300025926 Ga0207659_10045359 Ga0207659_100453593 202
257 3300025927 Ga0207687_10263955 Ga0207687_102639552 202
258 3300025927 Ga0207687_10356245 Ga0207687_103562452 202
259 3300025931 Ga0207644_10036754 Ga0207644_100367542 202
260 3300025931 Ga0207644_10060190 Ga0207644_100601902 202
261 3300025932 Ga0207690_10004649 Ga0207690_100046497 202
262 3300025933 Ga0207706_10285918 Ga0207706_102859181 202
263 3300025935 Ga0207709_10093838 Ga0207709_100938382 202
264 3300025936 Ga0207670_10155224 Ga0207670_101552242 202
265 3300025937 Ga0207669_10034282 Ga0207669_100342822 202
266 3300025937 Ga0207669_10603336 Ga0207669_106033362 202
267 3300025938 Ga0207704_10050758 Ga0207704_100507583 202
268 3300025940 Ga0207691_10012265 Ga0207691_100122653 202
269 3300025940 Ga0207691_10041907 Ga0207691_100419074 202
270 3300025940 Ga0207691_10053770 Ga0207691_100537704 202
271 3300025949 Ga0207667_10535255 Ga0207667_105352552 202
272 3300025960 Ga0207651_10004851 Ga0207651_100048512 202
273 3300025960 Ga0207651_10460359 Ga0207651_104603592 202
274 3300025981 Ga0207640_10140243 Ga0207640_101402431 202
275 3300025986 Ga0207658_10001854 Ga0207658_100018547 202
276 3300025986 Ga0207658_10293172 Ga0207658_102931723 202
277 3300026023 Ga0207677_10026511 Ga0207677_100265112 202
278 3300026035 Ga0207703_10004753 Ga0207703_100047532 202
279 3300026035 Ga0207703_11125195 Ga0207703_111251952 202
280 3300026041 Ga0207639_10203980 Ga0207639_102039802 202
281 3300026041 Ga0207639_10295485 Ga0207639_102954852 202
282 3300026067 Ga0207678_10002276 Ga0207678_100022767 202
283 3300026067 Ga0207678_10207607 Ga0207678_102076072 202
284 3300026089 Ga0207648_10002295 Ga0207648_100022958 202
285 3300026089 Ga0207648_10136083 Ga0207648_101360832 202
286 3300026116 Ga0207674_10013681 Ga0207674_100136816 202
287 3300026118 Ga0207675_100023354 Ga0207675_1000233547 202
288 3300026121 Ga0207683_10230825 Ga0207683_102308252 202
289 3300027876 Ga0209974_10002757 Ga0209974_100027574 202
290 3300028379 Ga0268266_10044374 Ga0268266_100443744 202
291 3300028379 Ga0268266_10516774 Ga0268266_105167742 202
292 3300028666 Ga0265336_10000053 Ga0265336_1000005380 202
293 3300028786 Ga0307517_10000174 Ga0307517_1000017427 202
294 3300028786 Ga0307517_10108074 Ga0307517_101080742 202
295 3300028794 Ga0307515_10001235 Ga0307515_1000123511 202
296 3300028794 Ga0307515_10004451 Ga0307515_1000445122 202
297 3300028794 Ga0307515_10132420 Ga0307515_101324202 202
298 3300028794 Ga0307515_10162890 Ga0307515_101628903 202
299 3300028794 Ga0307515_10246467 Ga0307515_102464672 202
300 3300029957 Ga0265324_10000132 Ga0265324_1000013229 202
301 3300030521 Ga0307511_10094344 Ga0307511_100943442 202
302 3300030522 Ga0307512_10046505 Ga0307512_100465053 202
303 3300030522 Ga0307512_10184109 Ga0307512_101841092 202
304 3300031239 Ga0265328_10020326 Ga0265328_100203262 202
305 3300031251 Ga0265327_10003227 Ga0265327_100032277 202
306 3300031456 Ga0307513_10014799 Ga0307513_100147999 202
307 3300031456 Ga0307513_10130230 Ga0307513_101302302 202
308 3300031507 Ga0307509_10000225 Ga0307509_1000022553 202
309 3300031507 Ga0307509_10005996 Ga0307509_100059967 202
310 3300031507 Ga0307509_10053865 Ga0307509_100538656 202
311 3300031507 Ga0307509_10067974 Ga0307509_100679744 202
312 3300031548 Ga0307408_100000010 Ga0307408_100000010152 202
313 3300031548 Ga0307408_100908838 Ga0307408_1009088381 202
314 3300031616 Ga0307508_10000185 Ga0307508_1000018553 202
315 3300031616 Ga0307508_10002202 Ga0307508_1000220220 202
316 3300031616 Ga0307508_10003035 Ga0307508_100030357 202
317 3300031649 Ga0307514_10049262 Ga0307514_100492623 202
318 3300031649 Ga0307514_10143758 Ga0307514_101437582 202
319 3300031730 Ga0307516_10001572 Ga0307516_1000157223 202
320 3300031730 Ga0307516_10009757 Ga0307516_100097577 202
321 3300031730 Ga0307516_10259861 Ga0307516_102598612 202
322 3300031731 Ga0307405_10021739 Ga0307405_100217394 202
323 3300031903 Ga0307407_10026323 Ga0307407_100263234 202
324 3300031995 Ga0307409_100286400 Ga0307409_1002864002 202
325 3300032002 Ga0307416_100851412 Ga0307416_1008514122 202
326 3300033179 Ga0307507_10065803 Ga0307507_100658033 202
327 3300033180 Ga0307510_10002036 Ga0307510_1000203622 202
328 3300033180 Ga0307510_10034205 Ga0307510_100342054 202
329 3300034817 Ga0373948_0005315 Ga0373948_0005315_615_1262 202
330 3300035088 Ga0373940_0037180 Ga0373940_0037180_11_658 202
331 3300035114 Ga0373939_0000036 Ga0373939_0000036_25083_25730 202
332 3300035170 Ga0373943_0401850 Ga0373943_0401850_40_717 202
333 3300035242 Ga0373962_0007469 Ga0373962_0007469_556_1203 202
334 3300035398 Ga0316574_0538732 Ga0316574_0538732_42_656 202
335 3300035691 Ga0373931_0000268 Ga0373931_0000268_12260_12907 202
336 3300035691 Ga0373931_0008787 Ga0373931_0008787_3445_4101 202
337 3300036401 Ga0373937_0023547 Ga0373937_0023547_3532_4140 202
338 3300036401 Ga0373937_0214132 Ga0373937_0214132_652_1260 202
339 3300037068 Ga0373925_0027268 Ga0373925_0027268_1847_2494 202
340 3300037068 Ga0373925_0096228 Ga0373925_0096228_72_686 202
341 3300037418 Ga0395900_0015475 Ga0395900_0015475_3284_3928 202
342 3300037466 Ga0395898_0039633 Ga0395898_0039633_1632_2276 202
343 3300037471 Ga0395905_0000025 Ga0395905_0000025_43838_44500 202
344 3300037471 Ga0395905_0005980 Ga0395905_0005980_7555_8202 202
345 3300037471 Ga0395905_0050499 Ga0395905_0050499_828_1475 202
346 3300037471 Ga0395905_0504115 Ga0395905_0504115_79_723 202
347 3300037471 Ga0395905_0719640 Ga0395905_0719640_19_666 202
348 3300038443 Ga0395901_0174821 Ga0395901_0174821_102_746 202
349 3300038443 Ga0395901_0537969 Ga0395901_0537969_506_1153 202
350 3300039437 Ga0436365_1030367 Ga0436365_1030367_290_946 202
351 3300039447 Ga0436361_0653184 Ga0436361_0653184_1846_2466 202
352 3300039447 Ga0436361_0766328 Ga0436361_0766328_259_879 202
353 3300039447 Ga0436361_1213797 Ga0436361_1213797_188_796 202
354 3300041443 Ga0451789_0173976 Ga0451789_0173976_165_809 202
355 3300041452 Ga0451793_1887844 Ga0451793_1887844_234_878 202
356 3300041459 Ga0451800_0997610 Ga0451800_0997610_517_1167 202
357 3300042876 Ga0451577_0038258 Ga0451577_0038258_2416_3033 202
358 3300044684 Ga0466966_0002026 Ga0466966_0002026_1957_2628 202
359 3300044684 Ga0466966_0011911 Ga0466966_0011911_2546_3193 202
360 3300044693 Ga0466961_0045147 Ga0466961_0045147_764_1435 202
361 3300044712 Ga0453684_0002411 Ga0453684_0002411_27403_28020 202
362 3300044719 Ga0466971_0006284 Ga0466971_0006284_3654_4325 202
363 3300045049 Ga0466959_0002381 Ga0466959_0002381_5660_6331 202
364 3300045049 Ga0466959_0024159 Ga0466959_0024159_1212_1859 202
365 3300045051 Ga0451576_0070312 Ga0451576_0070312_1744_2361 202
366 3300045836 Ga0466958_0143808 Ga0466958_0143808_78_749 202
367 3300046454 Ga0495592_0001312 Ga0495592_0001312_5030_5677 202
368 3300046460 Ga0495638_0164268 Ga0495638_0164268_69_755 202
369 3300046506 Ga0495583_0000159 Ga0495583_0000159_83180_83860 202
370 3300046507 Ga0495606_0005971 Ga0495606_0005971_10487_11167 202
371 3300046517 Ga0495630_0148899 Ga0495630_0148899_258_902 202
372 3300046519 Ga0495632_0012661 Ga0495632_0012661_715_1365 202
373 3300046523 Ga0495644_0024463 Ga0495644_0024463_1262_1894 202
374 3300046526 Ga0495666_0126634 Ga0495666_0126634_265_912 202
375 3300046558 Ga0495633_0003465 Ga0495633_0003465_7300_7959 202
376 3300046678 Ga0495599_0272136 Ga0495599_0272136_83_736 202
377 3300046680 Ga0495646_0253970 Ga0495646_0253970_69_716 202
378 3300046683 Ga0495658_0032612 Ga0495658_0032612_1596_2243 202
379 3300046692 Ga0495671_0084130 Ga0495671_0084130_314_961 202
380 3300046694 Ga0495649_0005881 Ga0495649_0005881_1115_1795 202
381 3300046794 Ga0495589_0003499 Ga0495589_0003499_5677_6357 202
382 3300047319 Ga0495674_0017966 Ga0495674_0017966_1561_2214 202
383 3300047319 Ga0495674_0032889 Ga0495674_0032889_1933_2583 202
384 3300047320 Ga0495672_0159004 Ga0495672_0159004_395_1027 202
385 3300047472 Ga0495686_0004435 Ga0495686_0004435_10636_11316 202
386 3300048089 Ga0495614_0251148 Ga0495614_0251148_148_792 202
387 3300048904 Ga0496101_0147970 Ga0496101_0147970_204_845 202
388 3300048905 Ga0496102_0007894 Ga0496102_0007894_6041_6685 202
389 3300048907 Ga0496104_0130603 Ga0496104_0130603_1592_2233 202
390 3300048921 Ga0496118_0002802 Ga0496118_0002802_21060_21701 202
391 3300048924 Ga0496121_0000729 Ga0496121_0000729_1631_2287 202
392 3300048924 Ga0496121_0405139 Ga0496121_0405139_193_843 202
393 3300048928 Ga0496125_0000522 Ga0496125_0000522_2962_3627 202
394 3300048929 Ga0496126_0036180 Ga0496126_0036180_1147_1785 202
395 3300049571 Ga0501034_0000891 Ga0501034_0000891_40602_41213 202
396 3300049586 Ga0501070_0717050 Ga0501070_0717050_55_666 202
397 3300049587 Ga0501071_0213511 Ga0501071_0213511_35_673 202
398 3300049653 Ga0501206_005345 Ga0501206_005345_201_851 202
399 3300049742 Ga0501080_0277255 Ga0501080_0277255_691_1302 202
400 3300050491 nmdc:mga00v17_108561_c1 nmdc:mga00v17_108561_c1_685_1371 202
401 3300050493 nmdc:mga0k408_1297_c2 nmdc:mga0k408_1297_c2_6151_6795 202
402 3300050493 nmdc:mga0k408_6099_c1 nmdc:mga0k408_6099_c1_3782_4438 202
403 3300050496 nmdc:mga07m45_183995_c1 nmdc:mga07m45_183995_c1_244_894 202
404 3300050496 nmdc:mga07m45_278375_c1 nmdc:mga07m45_278375_c1_197_898 202
405 3300050508 nmdc:mga09592_2859_c1 nmdc:mga09592_2859_c1_4811_5455 202
406 3300050509 nmdc:mga0qj67_92402_c1 nmdc:mga0qj67_92402_c1_836_1480 202
407 3300050510 nmdc:mga06r32_341153_c1 nmdc:mga06r32_341153_c1_524_1138 202
408 3300050511 nmdc:mga08y16_587640_c1 nmdc:mga08y16_587640_c1_126_734 202
409 3300050512 nmdc:mga0n895_354078_c1 nmdc:mga0n895_354078_c1_25_693 202
410 3300053080 Ga0500635_0000363 Ga0500635_0000363_1273_1953 202
411 3300053084 Ga0495595_0430811 Ga0495595_0430811_19_627 202
412 3300053118 Ga0500594_0001408 Ga0500594_0001408_615_1301 202
413 3300053121 Ga0500607_197285 Ga0500607_197285_210_839 202
414 3300053134 Ga0500658_0067760 Ga0500658_0067760_139_789 202
415 3300053136 Ga0500559_0000329 Ga0500559_0000329_7396_8082 202
416 3300053156 Ga0500622_0007462 Ga0500622_0007462_4673_5317 202
417 3300053156 Ga0500622_0093747 Ga0500622_0093747_559_1209 202
418 3300053177 Ga0500636_0015032 Ga0500636_0015032_3350_4030 202
419 3300053177 Ga0500636_0070250 Ga0500636_0070250_943_1587 202
420 3300061719 Ga0466962_0005900 Ga0466962_0005900_835_1506 202
421 iso_pu_bacteria 2738543031 2739349258 202
422 iso_pu_bacteria 2821443989 2821444350 202
423 iso_pu_bacteria 2894023352 2894027582 202
424 3300005331 Ga0070670_100024111 Ga0070670_1000241112 203
425 3300005340 Ga0070689_100010287 Ga0070689_1000102874 203
426 3300005354 Ga0070675_100020118 Ga0070675_1000201181 203
427 3300005435 Ga0070714_100175896 Ga0070714_1001758961 203
428 3300005435 Ga0070714_100493235 Ga0070714_1004932351 203
429 3300005435 Ga0070714_100991413 Ga0070714_1009914131 203
430 3300005458 Ga0070681_10121927 Ga0070681_101219272 203
431 3300005458 Ga0070681_10220109 Ga0070681_102201093 203
432 3300005471 Ga0070698_100321592 Ga0070698_1003215922 203
433 3300005530 Ga0070679_100287627 Ga0070679_1002876272 203
434 3300005548 Ga0070665_100001160 Ga0070665_10000116010 203
435 3300005548 Ga0070665_100116464 Ga0070665_1001164641 203
436 3300005563 Ga0068855_100355520 Ga0068855_1003555202 203
437 3300005840 Ga0068870_10259450 Ga0068870_102594502 203
438 3300005937 Ga0081455_10276508 Ga0081455_102765081 203
439 3300006175 Ga0070712_100029765 Ga0070712_1000297653 203
440 3300006175 Ga0070712_100166724 Ga0070712_1001667242 203
441 3300006871 Ga0075434_100468682 Ga0075434_1004686821 203
442 3300007076 Ga0075435_100040874 Ga0075435_1000408743 203
443 3300007788 Ga0099795_10004776 Ga0099795_100047762 203
444 3300009093 Ga0105240_10153993 Ga0105240_101539932 203
445 3300009545 Ga0105237_11210506 Ga0105237_112105061 203
446 3300010159 Ga0099796_10004450 Ga0099796_100044502 203
447 3300013100 Ga0157373_10258816 Ga0157373_102588162 203
448 3300013104 Ga0157370_10636769 Ga0157370_106367692 203
449 3300024227 Ga0228598_1001530 Ga0228598_10015302 203
450 3300025906 Ga0207699_10417052 Ga0207699_104170521 203
451 3300025912 Ga0207707_10323779 Ga0207707_103237792 203
452 3300025913 Ga0207695_10295074 Ga0207695_102950742 203
453 3300025915 Ga0207693_10071974 Ga0207693_100719744 203
454 3300025915 Ga0207693_10133085 Ga0207693_101330852 203
455 3300025916 Ga0207663_10226097 Ga0207663_102260971 203
456 3300025917 Ga0207660_10173914 Ga0207660_101739143 203
457 3300025921 Ga0207652_10175672 Ga0207652_101756722 203
458 3300025925 Ga0207650_10017828 Ga0207650_100178283 203
459 3300025926 Ga0207659_10155103 Ga0207659_101551033 203
460 3300025928 Ga0207700_10124520 Ga0207700_101245202 203
461 3300025929 Ga0207664_10089110 Ga0207664_100891102 203
462 3300025929 Ga0207664_10239628 Ga0207664_102396281 203
463 3300025931 Ga0207644_10033227 Ga0207644_100332272 203
464 3300025932 Ga0207690_10364671 Ga0207690_103646711 203
465 3300025933 Ga0207706_10066449 Ga0207706_100664491 203
466 3300025936 Ga0207670_10010092 Ga0207670_100100925 203
467 3300025944 Ga0207661_10257693 Ga0207661_102576931 203
468 3300026078 Ga0207702_10053116 Ga0207702_100531164 203
469 3300028379 Ga0268266_10001726 Ga0268266_1000172610 203
470 3300028379 Ga0268266_10235400 Ga0268266_102354002 203
471 3300028577 Ga0265318_10007856 Ga0265318_100078562 203
472 3300031241 Ga0265325_10035978 Ga0265325_100359782 203
473 3300031249 Ga0265339_10011043 Ga0265339_100110433 203
474 3300031344 Ga0265316_10036333 Ga0265316_100363333 203
475 3300031344 Ga0265316_10156124 Ga0265316_101561242 203
476 3300031595 Ga0265313_10123248 Ga0265313_101232481 203
477 3300031616 Ga0307508_10001432 Ga0307508_1000143215 203
478 3300031711 Ga0265314_10001531 Ga0265314_1000153113 203
479 3300031711 Ga0265314_10035008 Ga0265314_100350082 203
480 3300031711 Ga0265314_10138293 Ga0265314_101382932 203
481 3300031712 Ga0265342_10165792 Ga0265342_101657922 203
482 3300031824 Ga0307413_10339359 Ga0307413_103393592 203
483 3300035083 Ga0373926_0077703 Ga0373926_0077703_32_649 203
484 3300035692 Ga0373935_0104638 Ga0373935_0104638_919_1539 203
485 3300036401 Ga0373937_0325039 Ga0373937_0325039_20_637 203
486 3300037068 Ga0373925_0418139 Ga0373925_0418139_143_763 203
487 3300037312 Ga0395899_0076220 Ga0395899_0076220_1132_1746 203
488 3300037418 Ga0395900_0139262 Ga0395900_0139262_819_1433 203
489 3300037466 Ga0395898_0171308 Ga0395898_0171308_642_1256 203
490 3300037471 Ga0395905_0755081 Ga0395905_0755081_84_698 203
491 3300037853 Ga0436364_1360306 Ga0436364_1360306_32_652 203
492 3300038443 Ga0395901_0256096 Ga0395901_0256096_723_1337 203
493 3300039438 Ga0436360_0649612 Ga0436360_0649612_237_857 203
494 3300039453 Ga0436362_1051954 Ga0436362_1051954_87_704 203
495 3300046459 Ga0495629_0429184 Ga0495629_0429184_50_667 203
496 3300046476 Ga0495662_0076309 Ga0495662_0076309_373_990 203
497 3300046516 Ga0495628_0212603 Ga0495628_0212603_295_912 203
498 3300046559 Ga0495667_0012787 Ga0495667_0012787_1410_2027 203
499 3300046663 Ga0495635_0095933 Ga0495635_0095933_945_1562 203
500 3300048908 Ga0496105_0379026 Ga0496105_0379026_327_947 203
501 3300048912 Ga0496109_0460024 Ga0496109_0460024_289_909 203
502 3300048915 Ga0496112_0037322 Ga0496112_0037322_3021_3638 203
503 3300048928 Ga0496125_0000176 Ga0496125_0000176_135520_136182 203
504 3300048929 Ga0496126_0038207 Ga0496126_0038207_3444_4067 203
505 3300049574 Ga0501038_0832475 Ga0501038_0832475_16_636 203
506 3300049588 Ga0501072_0580051 Ga0501072_0580051_139_759 203
507 3300050507 nmdc:mga05p37_441880_c1 nmdc:mga05p37_441880_c1_503_1120 203
508 3300050507 nmdc:mga05p37_942100_c1 nmdc:mga05p37_942100_c1_287_907 203
509 3300050509 nmdc:mga0qj67_577334_c1 nmdc:mga0qj67_577334_c1_256_879 203
510 3300050514 nmdc:mga08x19_362063_c1 nmdc:mga08x19_362063_c1_56_673 203
511 3300053077 Ga0495601_0002038 Ga0495601_0002038_944_1561 203
512 3300053084 Ga0495595_0057549 Ga0495595_0057549_944_1561 203
513 3300053085 Ga0495619_0036207 Ga0495619_0036207_1651_2268 203
514 3300053088 Ga0500644_0001074 Ga0500644_0001074_1903_2520 203
515 3300053093 Ga0500651_0092267 Ga0500651_0092267_295_912 203
516 3300053131 Ga0500652_107925 Ga0500652_107925_251_868 203
517 3300053153 Ga0500616_0000006 Ga0500616_0000006_167507_168124 203
518 3300053730 Ga0500645_000614 Ga0500645_000614_2774_3391 203
519 3300003791 Ga0055530_10051163 Ga0055530_100511632 204
520 3300005329 Ga0070683_100022610 Ga0070683_1000226103 204
521 3300005340 Ga0070689_100040016 Ga0070689_1000400163 204
522 3300005344 Ga0070661_100017322 Ga0070661_1000173225 204
523 3300005356 Ga0070674_100367341 Ga0070674_1003673411 204
524 3300005365 Ga0070688_100319448 Ga0070688_1003194482 204
525 3300005366 Ga0070659_100657921 Ga0070659_1006579212 204
526 3300005434 Ga0070709_10433646 Ga0070709_104336461 204
527 3300005467 Ga0070706_100032893 Ga0070706_1000328934 204
528 3300005468 Ga0070707_100153192 Ga0070707_1001531923 204
529 3300005530 Ga0070679_100214268 Ga0070679_1002142683 204
530 3300005535 Ga0070684_100021897 Ga0070684_1000218975 204
531 3300005536 Ga0070697_100188949 Ga0070697_1001889492 204
532 3300005543 Ga0070672_100248109 Ga0070672_1002481093 204
533 3300005614 Ga0068856_100008321 Ga0068856_1000083214 204
534 3300005841 Ga0068863_100214953 Ga0068863_1002149532 204
535 3300005937 Ga0081455_10000723 Ga0081455_1000072340 204
536 3300005937 Ga0081455_10051537 Ga0081455_100515373 204
537 3300005981 Ga0081538_10033312 Ga0081538_100333122 204
538 3300006177 Ga0075362_10011088 Ga0075362_100110884 204
539 3300006177 Ga0075362_10011491 Ga0075362_100114915 204
540 3300006177 Ga0075362_10171481 Ga0075362_101714812 204
541 3300006186 Ga0075369_10000532 Ga0075369_100005323 204
542 3300006195 Ga0075366_10195147 Ga0075366_101951472 204
543 3300006353 Ga0075370_10096345 Ga0075370_100963452 204
544 3300006844 Ga0075428_100140266 Ga0075428_1001402662 204
545 3300006914 Ga0075436_100169485 Ga0075436_1001694853 204
546 3300006931 Ga0097620_100912251 Ga0097620_1009122512 204
547 3300009147 Ga0114129_10452475 Ga0114129_104524752 204
548 3300009148 Ga0105243_10590152 Ga0105243_105901522 204
549 3300009177 Ga0105248_11203223 Ga0105248_112032232 204
550 3300009545 Ga0105237_10023936 Ga0105237_100239364 204
551 3300009551 Ga0105238_10164944 Ga0105238_101649443 204
552 3300009553 Ga0105249_10727191 Ga0105249_107271912 204
553 3300010159 Ga0099796_10075849 Ga0099796_100758492 204
554 3300010375 Ga0105239_10242080 Ga0105239_102420802 204
555 3300013307 Ga0157372_11316155 Ga0157372_113161552 204
556 3300015262 Ga0182007_10019443 Ga0182007_100194432 204
557 3300015265 Ga0182005_1144793 Ga0182005_11447931 204
558 3300025292 Ga0209676_1000049 Ga0209676_1000049337 204
559 3300025298 Ga0209050_1007206 Ga0209050_10072068 204
560 3300025302 Ga0207426_1006988 Ga0207426_10069883 204
561 3300025898 Ga0207692_10025699 Ga0207692_100256991 204
562 3300025906 Ga0207699_10169778 Ga0207699_101697782 204
563 3300025920 Ga0207649_10136089 Ga0207649_101360892 204
564 3300025924 Ga0207694_10145346 Ga0207694_101453463 204
565 3300025928 Ga0207700_10558911 Ga0207700_105589112 204
566 3300025932 Ga0207690_10248754 Ga0207690_102487543 204
567 3300025936 Ga0207670_10089062 Ga0207670_100890623 204
568 3300025944 Ga0207661_10665332 Ga0207661_106653321 204
569 3300025949 Ga0207667_10351371 Ga0207667_103513712 204
570 3300025972 Ga0207668_10665261 Ga0207668_106652612 204
571 3300026041 Ga0207639_10833009 Ga0207639_108330092 204
572 3300026078 Ga0207702_10152927 Ga0207702_101529272 204
573 3300026088 Ga0207641_10607502 Ga0207641_106075022 204
574 3300026116 Ga0207674_10196505 Ga0207674_101965052 204
575 3300026142 Ga0207698_10565938 Ga0207698_105659382 204
576 3300027907 Ga0207428_10546467 Ga0207428_105464672 204
577 3300028573 Ga0265334_10009277 Ga0265334_100092775 204
578 3300031241 Ga0265325_10030670 Ga0265325_100306702 204
579 3300031712 Ga0265342_10042951 Ga0265342_100429513 204
580 3300035084 Ga0373928_0010732 Ga0373928_0010732_1007_1624 204
581 3300035111 Ga0373923_0076552 Ga0373923_0076552_122_742 204
582 3300035112 Ga0373932_0025863 Ga0373932_0025863_881_1498 204
583 3300035113 Ga0373936_0024437 Ga0373936_0024437_245_877 204
584 3300035118 Ga0373954_0011225 Ga0373954_0011225_378_998 204
585 3300035119 Ga0373956_0019348 Ga0373956_0019348_732_1352 204
586 3300035170 Ga0373943_0034564 Ga0373943_0034564_203_823 204
587 3300035171 Ga0373946_0084338 Ga0373946_0084338_63_683 204
588 3300035691 Ga0373931_0209948 Ga0373931_0209948_508_1125 204
589 3300035695 Ga0373927_0354282 Ga0373927_0354282_104_721 204
590 3300035695 Ga0373927_0477124 Ga0373927_0477124_100_726 204
591 3300035724 Ga0373933_0008201 Ga0373933_0008201_1702_2322 204
592 3300035725 Ga0373947_0394835 Ga0373947_0394835_58_699 204
593 3300036401 Ga0373937_0003306 Ga0373937_0003306_12326_12946 204
594 3300037312 Ga0395899_0014664 Ga0395899_0014664_3980_4597 204
595 3300037418 Ga0395900_0008007 Ga0395900_0008007_9071_9688 204
596 3300037418 Ga0395900_0173885 Ga0395900_0173885_1563_2180 204
597 3300038443 Ga0395901_0003336 Ga0395901_0003336_3489_4106 204
598 3300038443 Ga0395901_0107006 Ga0395901_0107006_1192_1809 204
599 3300038726 Ga0400490_19766 Ga0400490_19766_3664_4290 204
600 3300039438 Ga0436360_0708127 Ga0436360_0708127_14_631 204
601 3300041407 Ga0439447_055633 Ga0439447_055633_269_886 204
602 3300042005 Ga0439448_0044399 Ga0439448_0044399_400_1017 204
603 3300046459 Ga0495629_0062368 Ga0495629_0062368_1143_1763 204
604 3300046462 Ga0495651_0011915 Ga0495651_0011915_5517_6137 204
605 3300046463 Ga0495653_0069116 Ga0495653_0069116_1535_2155 204
606 3300046511 Ga0495608_0000180 Ga0495608_0000180_15567_16187 204
607 3300046516 Ga0495628_0027713 Ga0495628_0027713_1977_2597 204
608 3300046526 Ga0495666_0136678 Ga0495666_0136678_338_958 204
609 3300046529 Ga0495652_0004484 Ga0495652_0004484_11238_11858 204
610 3300046533 Ga0495640_0011129 Ga0495640_0011129_4735_5355 204
611 3300046543 Ga0495645_0114971 Ga0495645_0114971_112_732 204
612 3300046559 Ga0495667_0006865 Ga0495667_0006865_6109_6729 204
613 3300046663 Ga0495635_0002686 Ga0495635_0002686_5922_6542 204
614 3300046675 Ga0495657_0017312 Ga0495657_0017312_147_767 204
615 3300046678 Ga0495599_0066436 Ga0495599_0066436_1483_2103 204
616 3300046679 Ga0495623_0014713 Ga0495623_0014713_69_689 204
617 3300046809 Ga0495600_0005529 Ga0495600_0005529_6787_7407 204
618 3300047317 Ga0495604_0000241 Ga0495604_0000241_32115_32735 204
619 3300047319 Ga0495674_0149045 Ga0495674_0149045_806_1426 204
620 3300047321 Ga0495676_0213093 Ga0495676_0213093_221_841 204
621 3300047322 Ga0495680_0000994 Ga0495680_0000994_1884_2504 204
622 3300048923 Ga0496120_0107954 Ga0496120_0107954_167_844 204
623 3300048929 Ga0496126_0085578 Ga0496126_0085578_1019_1636 204
624 3300048929 Ga0496126_0216132 Ga0496126_0216132_19_696 204
625 3300049575 Ga0501039_0853863 Ga0501039_0853863_24_650 204
626 3300049589 Ga0501073_0005280 Ga0501073_0005280_1078_1704 204
627 3300049590 Ga0501074_0164829 Ga0501074_0164829_515_1153 204
628 3300050491 nmdc:mga00v17_281313_c1 nmdc:mga00v17_281313_c1_112_738 204
629 3300050507 nmdc:mga05p37_645950_c1 nmdc:mga05p37_645950_c1_19_636 204
630 3300050516 nmdc:mga0sz30_2490_c1 nmdc:mga0sz30_2490_c1_1611_2288 204
631 3300053077 Ga0495601_0001571 Ga0495601_0001571_11595_12215 204
632 3300053078 Ga0495612_0000746 Ga0495612_0000746_9892_10512 204
633 3300053084 Ga0495595_0000387 Ga0495595_0000387_7164_7784 204
634 3300053085 Ga0495619_0030742 Ga0495619_0030742_973_1593 204
635 3300053117 Ga0500593_041066 Ga0500593_041066_1140_1763 204
636 3300053136 Ga0500559_0050482 Ga0500559_0050482_436_1068 204
637 iso_pu_bacteria 2842775625 2842779705 204
638 iso_pu_bacteria 2941531003 2941533317 204
639 iso_pu_bacteria 8019565922 8019570330 204
640 2162886007 SwRhRL2b_contig_2783974 SwRhRL2b_0842.00004660 205
641 3300003856 Ga0058692_1002816 Ga0058692_10028167 205
642 3300005289 Ga0065704_10002058 Ga0065704_1000205811 205
643 3300005289 Ga0065704_10077807 Ga0065704_100778074 205
644 3300005366 Ga0070659_100026425 Ga0070659_1000264253 205
645 3300005577 Ga0068857_100000005 Ga0068857_10000000512 205
646 3300006195 Ga0075366_10193263 Ga0075366_101932632 205
647 3300006946 Ga0079104_1001696 Ga0079104_10016962 205
648 3300006946 Ga0079104_1003541 Ga0079104_10035413 205
649 3300006946 Ga0079104_1012559 Ga0079104_10125592 205
650 3300009011 Ga0105251_10009864 Ga0105251_100098643 205
651 3300009011 Ga0105251_10370928 Ga0105251_103709281 205
652 3300009036 Ga0105244_10041712 Ga0105244_100417123 205
653 3300009036 Ga0105244_10044643 Ga0105244_100446432 205
654 3300009092 Ga0105250_10000475 Ga0105250_100004755 205
655 3300009093 Ga0105240_10105653 Ga0105240_101056532 205
656 3300009094 Ga0111539_10246411 Ga0111539_102464112 205
657 3300009148 Ga0105243_10127919 Ga0105243_101279192 205
658 3300009553 Ga0105249_10677986 Ga0105249_106779861 205
659 3300013102 Ga0157371_10032095 Ga0157371_100320952 205
660 3300013102 Ga0157371_10083223 Ga0157371_100832234 205
661 3300013104 Ga0157370_10011595 Ga0157370_100115959 205
662 3300014325 Ga0163163_10469135 Ga0163163_104691352 205
663 3300015679 Ga0183366_1002 Ga0183366_1002534 205
664 3300015680 Ga0183370_1002 Ga0183370_1002534 205
665 3300015685 Ga0183369_1002 Ga0183369_1002534 205
666 3300015687 Ga0183368_1005 Ga0183368_1005534 205
667 3300017792 Ga0163161_10332874 Ga0163161_103328742 205
668 3300021388 Ga0213875_10036528 Ga0213875_100365281 205
669 3300025711 Ga0207696_1000102 Ga0207696_100010257 205
670 3300025728 Ga0207655_1000050 Ga0207655_100005031 205
671 3300025735 Ga0207713_1003234 Ga0207713_10032342 205
672 3300025735 Ga0207713_1007592 Ga0207713_10075928 205
673 3300025735 Ga0207713_1010008 Ga0207713_10100084 205
674 3300025735 Ga0207713_1034261 Ga0207713_10342612 205
675 3300025735 Ga0207713_1037724 Ga0207713_10377242 205
676 3300025735 Ga0207713_1062235 Ga0207713_10622352 205
677 3300025932 Ga0207690_10022726 Ga0207690_100227263 205
678 3300025935 Ga0207709_10023791 Ga0207709_100237914 205
679 3300025944 Ga0207661_10350052 Ga0207661_103500522 205
680 3300026116 Ga0207674_10001229 Ga0207674_100012298 205
681 3300027111 Ga0209281_1000283 Ga0209281_100028374 205
682 3300027111 Ga0209281_1000308 Ga0209281_100030849 205
683 3300027111 Ga0209281_1000994 Ga0209281_100099421 205
684 3300027111 Ga0209281_1001423 Ga0209281_100142311 205
685 3300027312 Ga0209371_1000013 Ga0209371_1000013445 205
686 3300027312 Ga0209371_1000770 Ga0209371_100077027 205
687 3300030500 Ga0268256_1000014 Ga0268256_1000014233 205
688 3300030500 Ga0268256_1000647 Ga0268256_10006472 205
689 3300031247 Ga0265340_10001678 Ga0265340_100016789 205
690 3300037471 Ga0395905_0008672 Ga0395905_0008672_608_1231 205
691 3300037853 Ga0436364_0492175 Ga0436364_0492175_987_1613 205
692 3300039438 Ga0436360_0283312 Ga0436360_0283312_214_831 205
693 3300039447 Ga0436361_0058641 Ga0436361_0058641_453_1076 205
694 3300039447 Ga0436361_0098550 Ga0436361_0098550_1669_2289 205
695 3300039450 Ga0436363_0288717 Ga0436363_0288717_41_670 205
696 3300041512 Ga0451853_0292917 Ga0451853_0292917_902_1519 205
697 3300042010 Ga0439452_000141 Ga0439452_000141_50980_51597 205
698 3300042010 Ga0439452_000604 Ga0439452_000604_15021_15638 205
699 3300042533 Ga0450901_000116 Ga0450901_000116_6255_6881 205
700 3300044669 Ga0466981_0000001 Ga0466981_0000001_266401_267018 205
701 3300045051 Ga0451576_0021714 Ga0451576_0021714_2393_3016 205
702 3300046458 Ga0495591_010516 Ga0495591_010516_1295_1912 205
703 3300046460 Ga0495638_0111379 Ga0495638_0111379_550_1239 205
704 3300046471 Ga0495650_0000040 Ga0495650_0000040_231465_232082 205
705 3300046515 Ga0495620_0011609 Ga0495620_0011609_1683_2300 205
706 3300046694 Ga0495649_0000760 Ga0495649_0000760_4953_5570 205
707 3300046694 Ga0495649_0001240 Ga0495649_0001240_17966_18583 205
708 3300047446 Ga0495679_004962 Ga0495679_004962_1050_1667 205
709 3300048907 Ga0496104_0001702 Ga0496104_0001702_5266_5883 205
710 3300048907 Ga0496104_0639924 Ga0496104_0639924_46_663 205
711 3300048908 Ga0496105_0054625 Ga0496105_0054625_1051_1668 205
712 3300048908 Ga0496105_0226223 Ga0496105_0226223_554_1171 205
713 3300048919 Ga0496116_0001458 Ga0496116_0001458_23138_23755 205
714 3300048919 Ga0496116_0009281 Ga0496116_0009281_1074_1691 205
715 3300048919 Ga0496116_0026850 Ga0496116_0026850_2510_3127 205
716 3300048919 Ga0496116_0045377 Ga0496116_0045377_947_1564 205
717 3300048920 Ga0496117_0008694 Ga0496117_0008694_722_1339 205
718 3300048920 Ga0496117_0016174 Ga0496117_0016174_423_1040 205
719 3300048920 Ga0496117_0112497 Ga0496117_0112497_986_1603 205
720 3300048920 Ga0496117_0128221 Ga0496117_0128221_93_710 205
721 3300048921 Ga0496118_0022466 Ga0496118_0022466_3303_3920 205
722 3300048921 Ga0496118_0035786 Ga0496118_0035786_2901_3518 205
723 3300048921 Ga0496118_0038436 Ga0496118_0038436_684_1301 205
724 3300048921 Ga0496118_0040266 Ga0496118_0040266_2615_3232 205
725 3300048921 Ga0496118_0073071 Ga0496118_0073071_168_785 205
726 3300048921 Ga0496118_0153551 Ga0496118_0153551_722_1339 205
727 3300048922 Ga0496119_0000438 Ga0496119_0000438_41587_42204 205
728 3300048922 Ga0496119_0006572 Ga0496119_0006572_2764_3381 205
729 3300048922 Ga0496119_0009447 Ga0496119_0009447_6619_7236 205
730 3300048922 Ga0496119_0009582 Ga0496119_0009582_6559_7176 205
731 3300048922 Ga0496119_0020054 Ga0496119_0020054_3540_4157 205
732 3300048922 Ga0496119_0093129 Ga0496119_0093129_99_716 205
733 3300048922 Ga0496119_0185548 Ga0496119_0185548_378_995 205
734 3300048922 Ga0496119_0196127 Ga0496119_0196127_371_988 205
735 3300048922 Ga0496119_0205455 Ga0496119_0205455_30_647 205
736 3300048923 Ga0496120_0006993 Ga0496120_0006993_1130_1747 205
737 3300048923 Ga0496120_0015782 Ga0496120_0015782_2764_3381 205
738 3300048923 Ga0496120_0017901 Ga0496120_0017901_3405_4022 205
739 3300048923 Ga0496120_0035404 Ga0496120_0035404_2017_2634 205
740 3300048923 Ga0496120_0076836 Ga0496120_0076836_99_716 205
741 3300048923 Ga0496120_0109698 Ga0496120_0109698_93_710 205
742 3300048923 Ga0496120_0286958 Ga0496120_0286958_93_710 205
743 3300048924 Ga0496121_0004852 Ga0496121_0004852_2090_2707 205
744 3300048924 Ga0496121_0014724 Ga0496121_0014724_1089_1706 205
745 3300048924 Ga0496121_0082677 Ga0496121_0082677_1037_1654 205
746 3300048924 Ga0496121_0381877 Ga0496121_0381877_222_839 205
747 3300048924 Ga0496121_0424121 Ga0496121_0424121_149_766 205
748 3300048925 Ga0496122_0008944 Ga0496122_0008944_9919_10536 205
749 3300048925 Ga0496122_0025170 Ga0496122_0025170_712_1329 205
750 3300048925 Ga0496122_0059803 Ga0496122_0059803_1671_2288 205
751 3300048925 Ga0496122_0120875 Ga0496122_0120875_1001_1618 205
752 3300048925 Ga0496122_0127356 Ga0496122_0127356_670_1287 205
753 3300048926 Ga0496123_0020285 Ga0496123_0020285_634_1251 205
754 3300048926 Ga0496123_0024494 Ga0496123_0024494_1001_1618 205
755 3300048926 Ga0496123_0040172 Ga0496123_0040172_289_906 205
756 3300048926 Ga0496123_0051988 Ga0496123_0051988_2059_2676 205
757 3300048926 Ga0496123_0062130 Ga0496123_0062130_1168_1785 205
758 3300048926 Ga0496123_0074150 Ga0496123_0074150_1331_1948 205
759 3300048926 Ga0496123_0287337 Ga0496123_0287337_85_702 205
760 3300048926 Ga0496123_0296620 Ga0496123_0296620_85_702 205
761 3300048927 Ga0496124_0000649 Ga0496124_0000649_49391_50014 205
762 3300048927 Ga0496124_0004557 Ga0496124_0004557_161_778 205
763 3300048927 Ga0496124_0043082 Ga0496124_0043082_2576_3193 205
764 3300048927 Ga0496124_0109668 Ga0496124_0109668_486_1103 205
765 3300048927 Ga0496124_0115509 Ga0496124_0115509_515_1132 205
766 3300048927 Ga0496124_0122443 Ga0496124_0122443_974_1591 205
767 3300048927 Ga0496124_0157997 Ga0496124_0157997_354_971 205
768 3300048927 Ga0496124_0178151 Ga0496124_0178151_30_647 205
769 3300048927 Ga0496124_0524040 Ga0496124_0524040_89_706 205
770 3300048928 Ga0496125_0000370 Ga0496125_0000370_15404_16021 205
771 3300048928 Ga0496125_0004254 Ga0496125_0004254_14966_15583 205
772 3300048928 Ga0496125_0035699 Ga0496125_0035699_1130_1747 205
773 3300048928 Ga0496125_0188964 Ga0496125_0188964_653_1270 205
774 3300048928 Ga0496125_0189365 Ga0496125_0189365_648_1265 205
775 3300048929 Ga0496126_0000329 Ga0496126_0000329_99442_100059 205
776 3300048929 Ga0496126_0006943 Ga0496126_0006943_3725_4342 205
777 3300048929 Ga0496126_0023134 Ga0496126_0023134_4298_4915 205
778 3300048929 Ga0496126_0254378 Ga0496126_0254378_687_1304 205
779 3300048929 Ga0496126_0332932 Ga0496126_0332932_300_917 205
780 3300048929 Ga0496126_0772766 Ga0496126_0772766_51_668 205
781 3300049568 Ga0501031_0438289 Ga0501031_0438289_34_654 205
782 3300049572 Ga0501036_0043205 Ga0501036_0043205_1173_1793 205
783 3300049586 Ga0501070_0458664 Ga0501070_0458664_232_852 205
784 3300049590 Ga0501074_0279470 Ga0501074_0279470_76_696 205
785 3300049743 Ga0501081_0080810 Ga0501081_0080810_1487_2107 205
786 3300050511 nmdc:mga08y16_192145_c1 nmdc:mga08y16_192145_c1_1255_1959 205
787 3300050511 nmdc:mga08y16_635362_c1 nmdc:mga08y16_635362_c1_415_1044 205
788 3300050515 nmdc:mga0a205_211457_c1 nmdc:mga0a205_211457_c1_506_1210 205
789 3300053134 Ga0500658_0017060 Ga0500658_0017060_1491_2180 205
790 3300053146 Ga0500588_0006411 Ga0500588_0006411_350_1033 205
791 3300060353 Ga0501082_0071314 Ga0501082_0071314_798_1418 205

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02492

cobW

CobW/HypB/UreG, nucleotide-binding domain

39

212

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
5xkt-assembly1.cif.gz_B klebsiella pneumoniae ureg in complex with gmppnp and nickel 0.9351 6 202
5xkt-assembly1.cif.gz_B klebsiella pneumoniae ureg in complex with gmppnp and nickel 0.9215 6 202
4hi0-assembly1.cif.gz_F crystal structure of helicobacter pylori urease accessory protein uref/h/g complex 0.9155 8 198
4hi0-assembly1.cif.gz_F crystal structure of helicobacter pylori urease accessory protein uref/h/g complex 0.8889 8 198
2hf9-assembly1.cif.gz_A crystal structure of hypb from methanocaldococcus jannaschii in the triphosphate form 0.856 6 200
ID Description Score Start End Superfamily
af_O64700_71_266_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9241 5 200 3.40.50.300
af_O64700_71_266_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9151 5 200 3.40.50.300
2wsmA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.849 6 204 3.40.50.300
af_P0AAN3_68_289_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8397 6 200 3.40.50.300
4lpsB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8211 6 200 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A3C1Z988-F1-model_v4 Urease accessory protein UreG 0.9438 124 202 GO:0003924
GO:0005525
GO:0016151
GO:0043419
AF-A0A830DDA0-F1-model_v4 Urease accessory protein g 0.9427 6 200 GO:0003924
GO:0005525
GO:0016151
GO:0043419
AF-A0A7K4DRQ4-F1-model_v4 Urease accessory protein UreG 0.9408 118 203 GO:0003924
GO:0005525
GO:0016151
GO:0043419
AF-A0A6N6PVF4-F1-model_v4 Urease accessory protein UreG 0.9397 114 200 GO:0003924
GO:0005525
GO:0016151
GO:0043419
AF-A0A6A8FMF7-F1-model_v4 Urease accessory protein UreG 0.9377 123 198 GO:0003924
GO:0005525
GO:0016151
GO:0043419

Feature Viewer

pLDDT pTM Quality
86.56 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map