F479850
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 766 | 375 | 766 | 72 |
Family's Representative Sequence
| Representative Sequence | 3300013104|Ga0157370_10372969|Ga0157370_103729693 |
| Length | 85 |
| Sequence | MLRIESFGTTNWLKEICMLILTRRVGETLMIGESVSVTVLGVKGNQVRIGINAPKDVAVHREEIFQRIKREHSDQGDNHSPPPTS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300000546 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled | Metagenome | Rhizosphere |
| 2 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 3 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 4 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 5 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 6 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 7 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 8 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 9 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 10 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 11 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 12 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 13 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 14 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 15 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 16 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 17 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 18 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 19 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 20 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 21 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 22 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 23 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 24 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 25 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 28 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 31 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 35 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 37 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 46 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 62 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 63 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 64 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 67 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 68 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 69 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 71 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 72 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 76 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 77 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 79 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 80 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 81 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 83 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 84 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 85 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 86 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 87 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 88 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 89 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 90 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 91 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 92 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 93 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 94 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 95 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 96 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 97 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 99 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 100 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 101 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 102 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 103 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 104 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 105 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 107 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 108 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009982 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_189 metaG | Metagenome | Rhizosphere |
| 121 | 3300009993 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG | Metagenome | Rhizosphere |
| 122 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 123 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Metagenome | Rhizosphere |
| 126 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 137 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 140 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 141 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 142 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 143 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 144 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 145 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 146 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 147 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300027424 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300028017 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 | Metagenome | Rhizosphere |
| 217 | 3300028023 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 | Metagenome | Rhizosphere |
| 218 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 222 | 3300030836 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 223 | 3300030879 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 224 | 3300030886 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 225 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 226 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 227 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 228 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 229 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 230 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 231 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 232 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 233 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 234 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 235 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 236 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 237 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 238 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 239 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 240 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 241 | 3300032120 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 242 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 243 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 244 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 245 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 246 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 247 | 3300033527 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 248 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 249 | 3300033529 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 250 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 251 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 252 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 253 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 254 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 255 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 256 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 257 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 258 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 259 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 260 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 261 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 262 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 263 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 264 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 265 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 266 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 267 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 268 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 269 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 270 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 271 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 272 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 273 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 274 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 275 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 276 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 277 | 3300041497 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaT | Metatranscriptome | Unclassified |
| 278 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 279 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 280 | 3300041502 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaT | Metatranscriptome | Unclassified |
| 281 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 282 | 3300041506 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaT | Metatranscriptome | Unclassified |
| 283 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 284 | 3300041916 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaT_extra_run | Metatranscriptome | Unclassified |
| 285 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 286 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 287 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 288 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 289 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 290 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 291 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 292 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 306 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 307 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 308 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 309 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 310 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 311 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 312 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 313 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 314 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 315 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 316 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 317 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 318 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 319 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 320 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 322 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 323 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 324 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 325 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 326 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 327 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 328 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 329 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 330 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 331 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 332 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 333 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 334 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 335 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 336 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 337 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 338 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 339 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 340 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 341 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 342 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 343 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 344 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 345 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 346 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 347 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 348 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 349 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 350 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 352 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 353 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 356 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 357 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 358 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 359 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 360 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 361 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 362 | 3300053124 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere | Metagenome | Endosphere |
| 363 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 364 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 365 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 366 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 367 | 3300053149 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere | Metagenome | Endosphere |
| 368 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 369 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 370 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 371 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 372 | 3300059513 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 373 | 3300059652 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 374 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 375 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.86 |
| Metatranscriptomes | 6.14 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.79 |
| Nodule | 0 |
| Rhizoplane | 2.87 |
| Rhizosphere | 87.08 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.26 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | LJNas_1034716 | 3300000546 | Bacteria | 544 |
| 2 | JGI24736J21556_1036419 | 3300001904 | Bacteria | 758 |
| 3 | JGI24735J21928_10125450 | 3300002067 | Bacteria | 739 |
| 4 | JGI25156J39149_1004445 | 3300002705 | Bacteria | 4269 |
| 5 | JGI25162J39368_1004805 | 3300002737 | Bacteria | 2945 |
| 6 | JGI25154J39366_1012161 | 3300002738 | Bacteria | 959 |
| 7 | JGI25154J39366_1028219 | 3300002738 | Bacteria | 501 |
| 8 | JGI25157J39369_1000172 | 3300002741 | Bacteria | 54469 |
| 9 | JGI25157J39369_1000651 | 3300002741 | Bacteria | 19348 |
| 10 | JGI25157J39369_1003545 | 3300002741 | Bacteria | 3142 |
| 11 | JGI25163J39215_1000867 | 3300002771 | Bacteria | 7109 |
| 12 | JGI25164J39214_1000263 | 3300002772 | Bacteria | 39612 |
| 13 | JGI25164J39214_1001469 | 3300002772 | Bacteria | 5409 |
| 14 | JGI25165J46597_1000473 | 3300003214 | Bacteria | 39640 |
| 15 | JGI25165J46597_1002594 | 3300003214 | Bacteria | 5511 |
| 16 | Ga0055538_1003671 | 3300003751 | Bacteria | 1892 |
| 17 | Ga0055539_1001567 | 3300003752 | Bacteria | 4141 |
| 18 | Ga0055533_1002616 | 3300003756 | Bacteria | 4006 |
| 19 | Ga0055527_1000466 | 3300003760 | Bacteria | 15580 |
| 20 | Ga0055527_1004919 | 3300003760 | Bacteria | 1789 |
| 21 | Ga0055535_1001065 | 3300003761 | Bacteria | 16907 |
| 22 | Ga0055535_1001154 | 3300003761 | Bacteria | 15575 |
| 23 | Ga0055535_1001333 | 3300003761 | Bacteria | 13057 |
| 24 | Ga0055535_1002782 | 3300003761 | Bacteria | 5583 |
| 25 | Ga0055542_1000183 | 3300003762 | Bacteria | 77794 |
| 26 | Ga0055542_1000423 | 3300003762 | Bacteria | 40916 |
| 27 | Ga0055542_1001148 | 3300003762 | Bacteria | 15575 |
| 28 | Ga0055529_1000116 | 3300003763 | Bacteria | 117929 |
| 29 | Ga0055529_1000189 | 3300003763 | Bacteria | 84123 |
| 30 | Ga0055529_1000934 | 3300003763 | Bacteria | 15580 |
| 31 | Ga0055529_1008658 | 3300003763 | Bacteria | 1350 |
| 32 | Ga0055541_1026526 | 3300003841 | Bacteria | 614 |
| 33 | Ga0058863_11947076 | 3300004799 | Bacteria | 521 |
| 34 | Ga0058861_11990870 | 3300004800 | Bacteria | 1211 |
| 35 | Ga0058862_12551623 | 3300004803 | Bacteria | 725 |
| 36 | Ga0058862_12768923 | 3300004803 | Bacteria | 809 |
| 37 | Ga0058862_12834623 | 3300004803 | Bacteria | 711 |
| 38 | Ga0058862_12892832 | 3300004803 | Bacteria | 673 |
| 39 | Ga0065712_10790436 | 3300005290 | Bacteria | 513 |
| 40 | Ga0065715_10368505 | 3300005293 | Bacteria | 924 |
| 41 | Ga0065715_10717176 | 3300005293 | Bacteria | 645 |
| 42 | Ga0065707_10230286 | 3300005295 | Bacteria | 1191 |
| 43 | Ga0070658_10233400 | 3300005327 | Bacteria | 1558 |
| 44 | Ga0070658_10371490 | 3300005327 | Bacteria | 1226 |
| 45 | Ga0070683_100038381 | 3300005329 | Bacteria | 4390 |
| 46 | Ga0070683_100071576 | 3300005329 | Bacteria | 3235 |
| 47 | Ga0070683_100278724 | 3300005329 | Bacteria | 1590 |
| 48 | Ga0070683_102061891 | 3300005329 | Bacteria | 548 |
| 49 | Ga0070690_100523436 | 3300005330 | Bacteria | 890 |
| 50 | Ga0070690_100912466 | 3300005330 | Bacteria | 688 |
| 51 | Ga0070670_100006835 | 3300005331 | Bacteria | 9667 |
| 52 | Ga0070670_100815699 | 3300005331 | Bacteria | 843 |
| 53 | Ga0070677_10014576 | 3300005333 | Bacteria | 2769 |
| 54 | Ga0068869_100773220 | 3300005334 | Bacteria | 824 |
| 55 | Ga0068869_101096866 | 3300005334 | Bacteria | 696 |
| 56 | Ga0070666_10048447 | 3300005335 | Bacteria | 2855 |
| 57 | Ga0070666_10799671 | 3300005335 | Bacteria | 694 |
| 58 | Ga0070666_10866891 | 3300005335 | Bacteria | 667 |
| 59 | Ga0070680_100033389 | 3300005336 | Bacteria | 4147 |
| 60 | Ga0070680_100848346 | 3300005336 | Bacteria | 788 |
| 61 | Ga0070680_100906673 | 3300005336 | Bacteria | 760 |
| 62 | Ga0070682_100082465 | 3300005337 | Bacteria | 2084 |
| 63 | Ga0070682_100406135 | 3300005337 | Bacteria | 1031 |
| 64 | Ga0070682_100599573 | 3300005337 | Bacteria | 869 |
| 65 | Ga0068868_100082626 | 3300005338 | Bacteria | 2576 |
| 66 | Ga0068868_101101065 | 3300005338 | Bacteria | 731 |
| 67 | Ga0068868_101964569 | 3300005338 | Unclassified | 555 |
| 68 | Ga0070660_100100092 | 3300005339 | Bacteria | 2295 |
| 69 | Ga0070660_101177686 | 3300005339 | Bacteria | 649 |
| 70 | Ga0070689_100041539 | 3300005340 | Bacteria | 3531 |
| 71 | Ga0070689_100563746 | 3300005340 | Bacteria | 983 |
| 72 | Ga0070691_10438235 | 3300005341 | Bacteria | 744 |
| 73 | Ga0070691_10736879 | 3300005341 | Bacteria | 595 |
| 74 | Ga0070661_100023087 | 3300005344 | Bacteria | 4457 |
| 75 | Ga0070661_100041870 | 3300005344 | Bacteria | 3342 |
| 76 | Ga0070661_100079174 | 3300005344 | Bacteria | 2424 |
| 77 | Ga0070661_101074462 | 3300005344 | Bacteria | 670 |
| 78 | Ga0070692_10057912 | 3300005345 | Bacteria | 2033 |
| 79 | Ga0070668_100679357 | 3300005347 | Bacteria | 907 |
| 80 | Ga0070668_101466779 | 3300005347 | Bacteria | 623 |
| 81 | Ga0070669_100048736 | 3300005353 | Bacteria | 3092 |
| 82 | Ga0070669_100134768 | 3300005353 | Bacteria | 1899 |
| 83 | Ga0070669_101329635 | 3300005353 | Bacteria | 623 |
| 84 | Ga0070675_100463179 | 3300005354 | Bacteria | 1138 |
| 85 | Ga0070675_100893280 | 3300005354 | Bacteria | 814 |
| 86 | Ga0070671_100003573 | 3300005355 | Bacteria | 12159 |
| 87 | Ga0070671_100046776 | 3300005355 | Bacteria | 3598 |
| 88 | Ga0070674_100613382 | 3300005356 | Unclassified | 921 |
| 89 | Ga0070688_100107312 | 3300005365 | Bacteria | 1851 |
| 90 | Ga0070659_100492215 | 3300005366 | Bacteria | 1044 |
| 91 | Ga0070659_100953547 | 3300005366 | Bacteria | 751 |
| 92 | Ga0070667_100018316 | 3300005367 | Bacteria | 5805 |
| 93 | Ga0070667_100059421 | 3300005367 | Bacteria | 3234 |
| 94 | Ga0070667_100566795 | 3300005367 | Bacteria | 1045 |
| 95 | Ga0070709_10857423 | 3300005434 | Bacteria | 716 |
| 96 | Ga0070714_100000280 | 3300005435 | Bacteria | 39190 |
| 97 | Ga0070714_101245989 | 3300005435 | Bacteria | 726 |
| 98 | Ga0070714_101306806 | 3300005435 | Bacteria | 708 |
| 99 | Ga0070713_100017354 | 3300005436 | Bacteria | 5441 |
| 100 | Ga0070710_10094052 | 3300005437 | Bacteria | 1773 |
| 101 | Ga0070701_11308421 | 3300005438 | Bacteria | 518 |
| 102 | Ga0070711_100026241 | 3300005439 | Bacteria | 3817 |
| 103 | Ga0070711_100847153 | 3300005439 | Bacteria | 778 |
| 104 | Ga0070705_101558335 | 3300005440 | Bacteria | 555 |
| 105 | Ga0070700_100014142 | 3300005441 | Bacteria | 4503 |
| 106 | Ga0070700_100148850 | 3300005441 | Bacteria | 1599 |
| 107 | Ga0070694_100384741 | 3300005444 | Bacteria | 1095 |
| 108 | Ga0070708_101612759 | 3300005445 | Bacteria | 604 |
| 109 | Ga0070663_100019820 | 3300005455 | Bacteria | 4441 |
| 110 | Ga0070663_100457914 | 3300005455 | Bacteria | 1052 |
| 111 | Ga0070663_102096731 | 3300005455 | Bacteria | 509 |
| 112 | Ga0070678_101004605 | 3300005456 | Bacteria | 767 |
| 113 | Ga0070662_100147198 | 3300005457 | Bacteria | 1830 |
| 114 | Ga0070662_100686337 | 3300005457 | Bacteria | 865 |
| 115 | Ga0070681_10012205 | 3300005458 | Bacteria | 8519 |
| 116 | Ga0070681_10013793 | 3300005458 | Bacteria | 8044 |
| 117 | Ga0070681_10017187 | 3300005458 | Bacteria | 7232 |
| 118 | Ga0070681_10027498 | 3300005458 | Bacteria | 5718 |
| 119 | Ga0070681_10029162 | 3300005458 | Bacteria | 5540 |
| 120 | Ga0070681_10089340 | 3300005458 | Unclassified | 3032 |
| 121 | Ga0070681_10118109 | 3300005458 | Bacteria | 2589 |
| 122 | Ga0070681_11754994 | 3300005458 | Bacteria | 547 |
| 123 | Ga0068867_100520140 | 3300005459 | Bacteria | 1026 |
| 124 | Ga0068867_100604742 | 3300005459 | Bacteria | 957 |
| 125 | Ga0068867_100973986 | 3300005459 | Bacteria | 767 |
| 126 | Ga0068867_101453226 | 3300005459 | Bacteria | 637 |
| 127 | Ga0070685_10305927 | 3300005466 | Bacteria | 1073 |
| 128 | Ga0070698_100015662 | 3300005471 | Bacteria | 8008 |
| 129 | Ga0070699_102026524 | 3300005518 | Bacteria | 526 |
| 130 | Ga0070679_100066525 | 3300005530 | Bacteria | 3592 |
| 131 | Ga0070679_100087757 | 3300005530 | Bacteria | 3098 |
| 132 | Ga0070679_100128579 | 3300005530 | Unclassified | 2515 |
| 133 | Ga0070679_100132799 | 3300005530 | Bacteria | 2470 |
| 134 | Ga0070679_100507914 | 3300005530 | Bacteria | 1149 |
| 135 | Ga0070679_102134051 | 3300005530 | Bacteria | 510 |
| 136 | Ga0070684_100093077 | 3300005535 | Bacteria | 2683 |
| 137 | Ga0070684_100130862 | 3300005535 | Bacteria | 2264 |
| 138 | Ga0070684_100133152 | 3300005535 | Bacteria | 2243 |
| 139 | Ga0070684_100462925 | 3300005535 | Bacteria | 1172 |
| 140 | Ga0068853_100008660 | 3300005539 | Bacteria | 8180 |
| 141 | Ga0068853_100692800 | 3300005539 | Bacteria | 971 |
| 142 | Ga0068853_101325108 | 3300005539 | Bacteria | 696 |
| 143 | Ga0068853_101968166 | 3300005539 | Bacteria | 567 |
| 144 | Ga0068853_102248829 | 3300005539 | Bacteria | 528 |
| 145 | Ga0070672_100474647 | 3300005543 | Bacteria | 1079 |
| 146 | Ga0070686_101387543 | 3300005544 | Bacteria | 589 |
| 147 | Ga0070695_101081162 | 3300005545 | Bacteria | 656 |
| 148 | Ga0070696_100002294 | 3300005546 | Bacteria | 12611 |
| 149 | Ga0070696_100143615 | 3300005546 | Bacteria | 1746 |
| 150 | Ga0070696_100807503 | 3300005546 | Bacteria | 772 |
| 151 | Ga0070693_100052139 | 3300005547 | Bacteria | 2344 |
| 152 | Ga0070693_100586594 | 3300005547 | Bacteria | 803 |
| 153 | Ga0070665_100001699 | 3300005548 | Bacteria | 25308 |
| 154 | Ga0070665_100108128 | 3300005548 | Bacteria | 2783 |
| 155 | Ga0070665_100665120 | 3300005548 | Bacteria | 1055 |
| 156 | Ga0070665_100869596 | 3300005548 | Bacteria | 914 |
| 157 | Ga0070704_100652717 | 3300005549 | Unclassified | 929 |
| 158 | Ga0070704_101727714 | 3300005549 | Unclassified | 578 |
| 159 | Ga0068855_100041147 | 3300005563 | Bacteria | 5479 |
| 160 | Ga0068855_100062440 | 3300005563 | Bacteria | 4349 |
| 161 | Ga0068855_100260725 | 3300005563 | Bacteria | 1931 |
| 162 | Ga0068855_100468581 | 3300005563 | Bacteria | 1372 |
| 163 | Ga0068855_100752765 | 3300005563 | Unclassified | 1039 |
| 164 | Ga0068855_100920244 | 3300005563 | Bacteria | 923 |
| 165 | Ga0068855_100936557 | 3300005563 | Bacteria | 913 |
| 166 | Ga0070664_100343447 | 3300005564 | Bacteria | 1356 |
| 167 | Ga0070664_100609626 | 3300005564 | Bacteria | 1013 |
| 168 | Ga0070664_101154623 | 3300005564 | Bacteria | 730 |
| 169 | Ga0068857_100135589 | 3300005577 | Bacteria | 2222 |
| 170 | Ga0068857_100267439 | 3300005577 | Bacteria | 1571 |
| 171 | Ga0068857_101428136 | 3300005577 | Bacteria | 673 |
| 172 | Ga0068854_100042202 | 3300005578 | Bacteria | 3227 |
| 173 | Ga0068854_100120335 | 3300005578 | Bacteria | 1992 |
| 174 | Ga0068854_100298936 | 3300005578 | Bacteria | 1301 |
| 175 | Ga0068854_100733067 | 3300005578 | Bacteria | 856 |
| 176 | Ga0068854_100788410 | 3300005578 | Bacteria | 827 |
| 177 | Ga0068856_100010069 | 3300005614 | Bacteria | 9186 |
| 178 | Ga0068856_100025896 | 3300005614 | Bacteria | 5721 |
| 179 | Ga0068856_100075332 | 3300005614 | Bacteria | 3342 |
| 180 | Ga0068856_100102163 | 3300005614 | Bacteria | 2860 |
| 181 | Ga0068856_100836988 | 3300005614 | Bacteria | 939 |
| 182 | Ga0068856_101270568 | 3300005614 | Bacteria | 752 |
| 183 | Ga0068856_102005565 | 3300005614 | Bacteria | 589 |
| 184 | Ga0070702_101814944 | 3300005615 | Bacteria | 509 |
| 185 | Ga0068852_100001584 | 3300005616 | Bacteria | 15464 |
| 186 | Ga0068852_100064971 | 3300005616 | Bacteria | 3182 |
| 187 | Ga0068852_100403855 | 3300005616 | Bacteria | 1344 |
| 188 | Ga0068859_100047914 | 3300005617 | Bacteria | 4294 |
| 189 | Ga0068859_100154876 | 3300005617 | Bacteria | 2369 |
| 190 | Ga0068859_100182278 | 3300005617 | Bacteria | 2183 |
| 191 | Ga0068859_100303991 | 3300005617 | Bacteria | 1688 |
| 192 | Ga0068859_100873847 | 3300005617 | Bacteria | 985 |
| 193 | Ga0068859_100889466 | 3300005617 | Bacteria | 975 |
| 194 | Ga0068859_100926005 | 3300005617 | Bacteria | 956 |
| 195 | Ga0068859_101632010 | 3300005617 | Bacteria | 712 |
| 196 | Ga0068864_100141471 | 3300005618 | Bacteria | 2171 |
| 197 | Ga0068866_10756460 | 3300005718 | Bacteria | 671 |
| 198 | Ga0068866_10946064 | 3300005718 | Bacteria | 609 |
| 199 | Ga0068861_100217883 | 3300005719 | Bacteria | 1611 |
| 200 | Ga0068861_101253916 | 3300005719 | Bacteria | 719 |
| 201 | Ga0068861_101820479 | 3300005719 | Bacteria | 604 |
| 202 | Ga0068851_10094016 | 3300005834 | Bacteria | 1582 |
| 203 | Ga0068870_10505628 | 3300005840 | Bacteria | 806 |
| 204 | Ga0068870_10588278 | 3300005840 | Bacteria | 754 |
| 205 | Ga0068863_100082402 | 3300005841 | Bacteria | 3049 |
| 206 | Ga0068863_100097204 | 3300005841 | Bacteria | 2796 |
| 207 | Ga0068863_100936417 | 3300005841 | Bacteria | 867 |
| 208 | Ga0068863_102368474 | 3300005841 | Bacteria | 540 |
| 209 | Ga0068858_100161521 | 3300005842 | Bacteria | 2109 |
| 210 | Ga0068858_100183086 | 3300005842 | Bacteria | 1978 |
| 211 | Ga0068858_100710801 | 3300005842 | Bacteria | 978 |
| 212 | Ga0068858_100732637 | 3300005842 | Bacteria | 963 |
| 213 | Ga0068860_100023471 | 3300005843 | Bacteria | 5961 |
| 214 | Ga0068860_100293341 | 3300005843 | Bacteria | 1592 |
| 215 | Ga0068860_100323918 | 3300005843 | Bacteria | 1513 |
| 216 | Ga0068860_101213284 | 3300005843 | Bacteria | 775 |
| 217 | Ga0068860_101646832 | 3300005843 | Bacteria | 664 |
| 218 | Ga0068862_100112276 | 3300005844 | Bacteria | 2393 |
| 219 | Ga0068862_100137988 | 3300005844 | Bacteria | 2163 |
| 220 | Ga0068862_100254427 | 3300005844 | Bacteria | 1601 |
| 221 | Ga0068862_100393212 | 3300005844 | Bacteria | 1295 |
| 222 | Ga0068862_100952405 | 3300005844 | Bacteria | 847 |
| 223 | Ga0068862_101697625 | 3300005844 | Unclassified | 640 |
| 224 | Ga0081455_10197634 | 3300005937 | Bacteria | 1508 |
| 225 | Ga0070715_10992291 | 3300006163 | Bacteria | 523 |
| 226 | Ga0070716_100191688 | 3300006173 | Bacteria | 1351 |
| 227 | Ga0070712_100002924 | 3300006175 | Bacteria | 10591 |
| 228 | Ga0070712_100395387 | 3300006175 | Bacteria | 1140 |
| 229 | Ga0097621_100043536 | 3300006237 | Bacteria | 3619 |
| 230 | Ga0097621_100169235 | 3300006237 | Bacteria | 1882 |
| 231 | Ga0097621_101083551 | 3300006237 | Bacteria | 752 |
| 232 | Ga0097621_101263566 | 3300006237 | Bacteria | 696 |
| 233 | Ga0097621_101781540 | 3300006237 | Bacteria | 587 |
| 234 | Ga0075370_10753971 | 3300006353 | Bacteria | 593 |
| 235 | Ga0068871_100011168 | 3300006358 | Bacteria | 6581 |
| 236 | Ga0068871_100215893 | 3300006358 | Bacteria | 1660 |
| 237 | Ga0068871_101724505 | 3300006358 | Bacteria | 594 |
| 238 | Ga0068871_101745633 | 3300006358 | Bacteria | 590 |
| 239 | Ga0075428_100342577 | 3300006844 | Bacteria | 1605 |
| 240 | Ga0075428_100352504 | 3300006844 | Bacteria | 1579 |
| 241 | Ga0075430_100326959 | 3300006846 | Bacteria | 1267 |
| 242 | Ga0075431_101129940 | 3300006847 | Bacteria | 747 |
| 243 | Ga0075429_101887869 | 3300006880 | Bacteria | 518 |
| 244 | Ga0068865_100009644 | 3300006881 | Bacteria | 5988 |
| 245 | Ga0068865_100017320 | 3300006881 | Bacteria | 4633 |
| 246 | Ga0068865_100038582 | 3300006881 | Bacteria | 3234 |
| 247 | Ga0068865_100081125 | 3300006881 | Bacteria | 2328 |
| 248 | Ga0068865_101543814 | 3300006881 | Bacteria | 596 |
| 249 | Ga0097620_100047914 | 3300006931 | Bacteria | 4294 |
| 250 | Ga0097620_100154871 | 3300006931 | Bacteria | 2369 |
| 251 | Ga0097620_100182291 | 3300006931 | Bacteria | 2183 |
| 252 | Ga0097620_100304005 | 3300006931 | Bacteria | 1688 |
| 253 | Ga0097620_100873867 | 3300006931 | Bacteria | 985 |
| 254 | Ga0097620_100889506 | 3300006931 | Bacteria | 975 |
| 255 | Ga0097620_100925935 | 3300006931 | Bacteria | 956 |
| 256 | Ga0097620_101632146 | 3300006931 | Bacteria | 712 |
| 257 | Ga0099794_10048122 | 3300007265 | Bacteria | 2046 |
| 258 | Ga0099795_10019602 | 3300007788 | Bacteria | 2192 |
| 259 | Ga0099795_10126475 | 3300007788 | Bacteria | 1027 |
| 260 | Ga0105250_10000008 | 3300009092 | Bacteria | 343965 |
| 261 | Ga0105240_10015775 | 3300009093 | Bacteria | 10252 |
| 262 | Ga0105240_10041534 | 3300009093 | Bacteria | 5869 |
| 263 | Ga0105240_10090641 | 3300009093 | Bacteria | 3736 |
| 264 | Ga0105240_10134320 | 3300009093 | Bacteria | 2964 |
| 265 | Ga0105240_10540715 | 3300009093 | Bacteria | 1290 |
| 266 | Ga0105240_11327580 | 3300009093 | Bacteria | 758 |
| 267 | Ga0105240_11536783 | 3300009093 | Bacteria | 697 |
| 268 | Ga0105240_12145360 | 3300009093 | Bacteria | 580 |
| 269 | Ga0105240_12244741 | 3300009093 | Bacteria | 566 |
| 270 | Ga0111539_10224808 | 3300009094 | Bacteria | 2186 |
| 271 | Ga0111539_10877895 | 3300009094 | Bacteria | 1043 |
| 272 | Ga0111539_11391212 | 3300009094 | Bacteria | 814 |
| 273 | Ga0111539_12557405 | 3300009094 | Bacteria | 592 |
| 274 | Ga0105245_10982032 | 3300009098 | Bacteria | 888 |
| 275 | Ga0105245_11465095 | 3300009098 | Bacteria | 733 |
| 276 | Ga0105245_11655722 | 3300009098 | Bacteria | 692 |
| 277 | Ga0105245_11937624 | 3300009098 | Bacteria | 642 |
| 278 | Ga0105247_10106647 | 3300009101 | Bacteria | 1798 |
| 279 | Ga0105247_10482083 | 3300009101 | Bacteria | 900 |
| 280 | Ga0105247_11764360 | 3300009101 | Bacteria | 514 |
| 281 | Ga0105243_11097375 | 3300009148 | Bacteria | 804 |
| 282 | Ga0105241_10035532 | 3300009174 | Bacteria | 3747 |
| 283 | Ga0105241_10043847 | 3300009174 | Bacteria | 3388 |
| 284 | Ga0105241_10156914 | 3300009174 | Bacteria | 1867 |
| 285 | Ga0105241_10188228 | 3300009174 | Bacteria | 1717 |
| 286 | Ga0105241_10227568 | 3300009174 | Bacteria | 1571 |
| 287 | Ga0105241_10245553 | 3300009174 | Bacteria | 1515 |
| 288 | Ga0105242_10008331 | 3300009176 | Bacteria | 7966 |
| 289 | Ga0105242_10062818 | 3300009176 | Bacteria | 3057 |
| 290 | Ga0105242_12749447 | 3300009176 | Bacteria | 542 |
| 291 | Ga0105248_10009477 | 3300009177 | Bacteria | 10716 |
| 292 | Ga0105248_10112024 | 3300009177 | Bacteria | 3078 |
| 293 | Ga0105248_10346642 | 3300009177 | Bacteria | 1672 |
| 294 | Ga0105248_10482422 | 3300009177 | Bacteria | 1397 |
| 295 | Ga0105237_10000150 | 3300009545 | Bacteria | 97072 |
| 296 | Ga0105237_10005972 | 3300009545 | Bacteria | 13641 |
| 297 | Ga0105237_10040525 | 3300009545 | Bacteria | 4696 |
| 298 | Ga0105237_10054148 | 3300009545 | Bacteria | 4020 |
| 299 | Ga0105237_10298519 | 3300009545 | Bacteria | 1614 |
| 300 | Ga0105237_10337726 | 3300009545 | Bacteria | 1511 |
| 301 | Ga0105237_11365595 | 3300009545 | Bacteria | 715 |
| 302 | Ga0105238_10008246 | 3300009551 | Bacteria | 10424 |
| 303 | Ga0105238_10026562 | 3300009551 | Bacteria | 5903 |
| 304 | Ga0105238_10031268 | 3300009551 | Bacteria | 5419 |
| 305 | Ga0105238_10165784 | 3300009551 | Bacteria | 2185 |
| 306 | Ga0105238_10268956 | 3300009551 | Bacteria | 1685 |
| 307 | Ga0105238_10281269 | 3300009551 | Bacteria | 1645 |
| 308 | Ga0105238_10473491 | 3300009551 | Bacteria | 1251 |
| 309 | Ga0105238_11466690 | 3300009551 | Bacteria | 710 |
| 310 | Ga0105249_10145185 | 3300009553 | Bacteria | 2279 |
| 311 | Ga0105249_10290326 | 3300009553 | Bacteria | 1637 |
| 312 | Ga0105249_10575293 | 3300009553 | Bacteria | 1179 |
| 313 | Ga0105249_10622523 | 3300009553 | Bacteria | 1135 |
| 314 | Ga0105249_10656020 | 3300009553 | Bacteria | 1107 |
| 315 | Ga0105249_10681332 | 3300009553 | Bacteria | 1087 |
| 316 | Ga0105249_11804265 | 3300009553 | Bacteria | 684 |
| 317 | Ga0105147_100236 | 3300009982 | Bacteria | 5102 |
| 318 | Ga0105028_112468 | 3300009993 | Bacteria | 898 |
| 319 | Ga0099796_10081115 | 3300010159 | Bacteria | 1190 |
| 320 | Ga0105239_10013679 | 3300010375 | Bacteria | 9010 |
| 321 | Ga0105239_10032021 | 3300010375 | Bacteria | 5778 |
| 322 | Ga0105239_11234746 | 3300010375 | Bacteria | 862 |
| 323 | Ga0105239_12062880 | 3300010375 | Bacteria | 662 |
| 324 | Ga0105239_12371021 | 3300010375 | Bacteria | 618 |
| 325 | Ga0105239_12727937 | 3300010375 | Bacteria | 576 |
| 326 | Ga0105246_10936873 | 3300011119 | Bacteria | 779 |
| 327 | Ga0157345_1044836 | 3300012498 | Bacteria | 544 |
| 328 | Ga0157371_10481013 | 3300013102 | Bacteria | 915 |
| 329 | Ga0157370_10026079 | 3300013104 | Bacteria | 5774 |
| 330 | Ga0157370_10048901 | 3300013104 | Bacteria | 4051 |
| 331 | Ga0157370_10183500 | 3300013104 | Bacteria | 1943 |
| 332 | Ga0157370_10306834 | 3300013104 | Bacteria | 1465 |
| 333 | Ga0157370_10372969 | 3300013104 | Bacteria | 1315 |
| 334 | Ga0157369_10000195 | 3300013105 | Bacteria | 84688 |
| 335 | Ga0157369_10006603 | 3300013105 | Bacteria | 13416 |
| 336 | Ga0157369_10032217 | 3300013105 | Bacteria | 5765 |
| 337 | Ga0157369_10457947 | 3300013105 | Bacteria | 1321 |
| 338 | Ga0157369_10782110 | 3300013105 | Bacteria | 981 |
| 339 | Ga0157369_10811291 | 3300013105 | Bacteria | 961 |
| 340 | Ga0157369_12390275 | 3300013105 | Bacteria | 535 |
| 341 | Ga0157374_11180576 | 3300013296 | Bacteria | 786 |
| 342 | Ga0157378_10065280 | 3300013297 | Bacteria | 3258 |
| 343 | Ga0157378_11691481 | 3300013297 | Bacteria | 680 |
| 344 | Ga0163162_10015010 | 3300013306 | Bacteria | 7566 |
| 345 | Ga0163162_10859561 | 3300013306 | Bacteria | 1022 |
| 346 | Ga0163162_10958359 | 3300013306 | Bacteria | 966 |
| 347 | Ga0163162_10964801 | 3300013306 | Bacteria | 963 |
| 348 | Ga0163162_11764840 | 3300013306 | Bacteria | 707 |
| 349 | Ga0157372_10003204 | 3300013307 | Bacteria | 17672 |
| 350 | Ga0157372_10197876 | 3300013307 | Bacteria | 2328 |
| 351 | Ga0157372_10242016 | 3300013307 | Bacteria | 2093 |
| 352 | Ga0157372_10352792 | 3300013307 | Bacteria | 1714 |
| 353 | Ga0157372_11369270 | 3300013307 | Bacteria | 816 |
| 354 | Ga0157372_11919382 | 3300013307 | Bacteria | 681 |
| 355 | Ga0157375_10000940 | 3300013308 | Bacteria | 25256 |
| 356 | Ga0157375_10277551 | 3300013308 | Bacteria | 1838 |
| 357 | Ga0157375_10809396 | 3300013308 | Bacteria | 1085 |
| 358 | Ga0157375_11879304 | 3300013308 | Bacteria | 711 |
| 359 | Ga0163163_10157504 | 3300014325 | Bacteria | 2316 |
| 360 | Ga0163163_11269127 | 3300014325 | Bacteria | 799 |
| 361 | Ga0163163_11621400 | 3300014325 | Bacteria | 708 |
| 362 | Ga0163163_11959003 | 3300014325 | Bacteria | 646 |
| 363 | Ga0163163_12933764 | 3300014325 | Bacteria | 532 |
| 364 | Ga0157380_10438919 | 3300014326 | Bacteria | 1250 |
| 365 | Ga0157380_12049723 | 3300014326 | Bacteria | 634 |
| 366 | Ga0157380_13314531 | 3300014326 | Bacteria | 515 |
| 367 | Ga0182008_10017135 | 3300014497 | Bacteria | 3759 |
| 368 | Ga0182008_10316004 | 3300014497 | Bacteria | 821 |
| 369 | Ga0182008_10550970 | 3300014497 | Bacteria | 641 |
| 370 | Ga0182008_10991618 | 3300014497 | Bacteria | 500 |
| 371 | Ga0157379_10001068 | 3300014968 | Bacteria | 22327 |
| 372 | Ga0157379_10168233 | 3300014968 | Bacteria | 1979 |
| 373 | Ga0157376_10016137 | 3300014969 | Bacteria | 5662 |
| 374 | Ga0157376_10016323 | 3300014969 | Bacteria | 5634 |
| 375 | Ga0157376_10534533 | 3300014969 | Bacteria | 1158 |
| 376 | Ga0182006_1061226 | 3300015261 | Bacteria | 1420 |
| 377 | Ga0182006_1073080 | 3300015261 | Bacteria | 1266 |
| 378 | Ga0182007_10018362 | 3300015262 | Bacteria | 2534 |
| 379 | Ga0182007_10073467 | 3300015262 | Bacteria | 1120 |
| 380 | Ga0182007_10136952 | 3300015262 | Bacteria | 826 |
| 381 | Ga0206349_1264899 | 3300020075 | Bacteria | 618 |
| 382 | Ga0206355_1201516 | 3300020076 | Bacteria | 818 |
| 383 | Ga0206352_10282496 | 3300020078 | Bacteria | 778 |
| 384 | Ga0206352_10293537 | 3300020078 | Bacteria | 564 |
| 385 | Ga0206352_10757564 | 3300020078 | Bacteria | 747 |
| 386 | Ga0206354_10905968 | 3300020081 | Bacteria | 545 |
| 387 | Ga0206354_11701467 | 3300020081 | Bacteria | 736 |
| 388 | Ga0213871_10050786 | 3300021441 | Bacteria | 1136 |
| 389 | Ga0209233_1003300 | 3300025261 | Bacteria | 5723 |
| 390 | Ga0207696_1000106 | 3300025711 | Bacteria | 159964 |
| 391 | Ga0207682_10123677 | 3300025893 | Bacteria | 1149 |
| 392 | Ga0207692_10000125 | 3300025898 | Bacteria | 22996 |
| 393 | Ga0207642_10126051 | 3300025899 | Bacteria | 1329 |
| 394 | Ga0207642_11035704 | 3300025899 | Bacteria | 529 |
| 395 | Ga0207642_11046422 | 3300025899 | Bacteria | 527 |
| 396 | Ga0207710_10179411 | 3300025900 | Bacteria | 1038 |
| 397 | Ga0207680_10765444 | 3300025903 | Bacteria | 692 |
| 398 | Ga0207685_10520394 | 3300025905 | Bacteria | 629 |
| 399 | Ga0207699_10478965 | 3300025906 | Bacteria | 896 |
| 400 | Ga0207699_10617858 | 3300025906 | Bacteria | 790 |
| 401 | Ga0207645_10000555 | 3300025907 | Bacteria | 31018 |
| 402 | Ga0207643_10090881 | 3300025908 | Bacteria | 1780 |
| 403 | Ga0207643_10616609 | 3300025908 | Bacteria | 699 |
| 404 | Ga0207705_10957669 | 3300025909 | Bacteria | 662 |
| 405 | Ga0207654_10068211 | 3300025911 | Bacteria | 2103 |
| 406 | Ga0207654_10585937 | 3300025911 | Bacteria | 795 |
| 407 | Ga0207654_10938105 | 3300025911 | Bacteria | 628 |
| 408 | Ga0207707_10026840 | 3300025912 | Bacteria | 5033 |
| 409 | Ga0207707_10033237 | 3300025912 | Bacteria | 4515 |
| 410 | Ga0207707_10071975 | 3300025912 | Bacteria | 3013 |
| 411 | Ga0207707_10302818 | 3300025912 | Bacteria | 1382 |
| 412 | Ga0207707_10636264 | 3300025912 | Bacteria | 900 |
| 413 | Ga0207695_10002778 | 3300025913 | Bacteria | 25477 |
| 414 | Ga0207695_10053030 | 3300025913 | Bacteria | 4244 |
| 415 | Ga0207695_10145146 | 3300025913 | Bacteria | 2318 |
| 416 | Ga0207695_10155057 | 3300025913 | Unclassified | 2225 |
| 417 | Ga0207695_10551647 | 3300025913 | Bacteria | 1034 |
| 418 | Ga0207695_10558339 | 3300025913 | Bacteria | 1026 |
| 419 | Ga0207695_11144711 | 3300025913 | Bacteria | 658 |
| 420 | Ga0207671_10001147 | 3300025914 | Bacteria | 31646 |
| 421 | Ga0207671_10985260 | 3300025914 | Bacteria | 665 |
| 422 | Ga0207671_11227308 | 3300025914 | Bacteria | 586 |
| 423 | Ga0207671_11518430 | 3300025914 | Bacteria | 517 |
| 424 | Ga0207693_10001835 | 3300025915 | Bacteria | 18617 |
| 425 | Ga0207663_10294265 | 3300025916 | Bacteria | 1210 |
| 426 | Ga0207660_10026252 | 3300025917 | Bacteria | 3965 |
| 427 | Ga0207660_10030564 | 3300025917 | Bacteria | 3703 |
| 428 | Ga0207660_10285568 | 3300025917 | Bacteria | 1311 |
| 429 | Ga0207652_10129603 | 3300025921 | Bacteria | 2249 |
| 430 | Ga0207652_10147104 | 3300025921 | Bacteria | 2109 |
| 431 | Ga0207652_10383822 | 3300025921 | Bacteria | 1268 |
| 432 | Ga0207652_11391459 | 3300025921 | Bacteria | 605 |
| 433 | Ga0207681_10395464 | 3300025923 | Bacteria | 1115 |
| 434 | Ga0207681_10922822 | 3300025923 | Bacteria | 731 |
| 435 | Ga0207694_10000162 | 3300025924 | Bacteria | 68375 |
| 436 | Ga0207694_10067519 | 3300025924 | Unclassified | 2791 |
| 437 | Ga0207694_10160867 | 3300025924 | Bacteria | 1813 |
| 438 | Ga0207694_10422907 | 3300025924 | Bacteria | 1110 |
| 439 | Ga0207650_11595681 | 3300025925 | Bacteria | 554 |
| 440 | Ga0207659_10324316 | 3300025926 | Bacteria | 1271 |
| 441 | Ga0207687_10636388 | 3300025927 | Bacteria | 901 |
| 442 | Ga0207700_10039076 | 3300025928 | Bacteria | 3450 |
| 443 | Ga0207700_10913624 | 3300025928 | Bacteria | 786 |
| 444 | Ga0207664_11386363 | 3300025929 | Unclassified | 623 |
| 445 | Ga0207644_10117210 | 3300025931 | Bacteria | 2022 |
| 446 | Ga0207690_10282998 | 3300025932 | Bacteria | 1292 |
| 447 | Ga0207706_10040416 | 3300025933 | Bacteria | 4133 |
| 448 | Ga0207686_10048381 | 3300025934 | Bacteria | 2633 |
| 449 | Ga0207670_11404998 | 3300025936 | Bacteria | 593 |
| 450 | Ga0207669_10149595 | 3300025937 | Bacteria | 1633 |
| 451 | Ga0207669_10450139 | 3300025937 | Bacteria | 1020 |
| 452 | Ga0207669_10808692 | 3300025937 | Bacteria | 778 |
| 453 | Ga0207704_10006657 | 3300025938 | Bacteria | 5409 |
| 454 | Ga0207704_10425885 | 3300025938 | Unclassified | 1053 |
| 455 | Ga0207665_10003234 | 3300025939 | Bacteria | 10909 |
| 456 | Ga0207691_10000451 | 3300025940 | Bacteria | 40686 |
| 457 | Ga0207711_10003851 | 3300025941 | Bacteria | 12910 |
| 458 | Ga0207711_10482024 | 3300025941 | Bacteria | 1155 |
| 459 | Ga0207711_11012198 | 3300025941 | Bacteria | 771 |
| 460 | Ga0207689_10173787 | 3300025942 | Bacteria | 1776 |
| 461 | Ga0207661_10049975 | 3300025944 | Bacteria | 3330 |
| 462 | Ga0207661_10229631 | 3300025944 | Bacteria | 1643 |
| 463 | Ga0207661_10264444 | 3300025944 | Bacteria | 1533 |
| 464 | Ga0207661_11846301 | 3300025944 | Bacteria | 550 |
| 465 | Ga0207679_10958029 | 3300025945 | Bacteria | 784 |
| 466 | Ga0207667_10432892 | 3300025949 | Bacteria | 1338 |
| 467 | Ga0207667_10576203 | 3300025949 | Bacteria | 1137 |
| 468 | Ga0207667_10722915 | 3300025949 | Bacteria | 997 |
| 469 | Ga0207651_10038543 | 3300025960 | Bacteria | 3143 |
| 470 | Ga0207712_10091893 | 3300025961 | Bacteria | 2236 |
| 471 | Ga0207712_10163995 | 3300025961 | Bacteria | 1730 |
| 472 | Ga0207712_10380477 | 3300025961 | Bacteria | 1181 |
| 473 | Ga0207712_10505403 | 3300025961 | Bacteria | 1034 |
| 474 | Ga0207712_11020633 | 3300025961 | Bacteria | 734 |
| 475 | Ga0207668_10617994 | 3300025972 | Bacteria | 945 |
| 476 | Ga0207640_10928409 | 3300025981 | Bacteria | 762 |
| 477 | Ga0207640_11143830 | 3300025981 | Bacteria | 690 |
| 478 | Ga0207658_10289969 | 3300025986 | Bacteria | 1406 |
| 479 | Ga0207658_11017594 | 3300025986 | Bacteria | 756 |
| 480 | Ga0207658_11272593 | 3300025986 | Bacteria | 672 |
| 481 | Ga0207677_10747923 | 3300026023 | Bacteria | 871 |
| 482 | Ga0207703_10461713 | 3300026035 | Bacteria | 1188 |
| 483 | Ga0207703_11551532 | 3300026035 | Bacteria | 637 |
| 484 | Ga0207703_11807812 | 3300026035 | Bacteria | 587 |
| 485 | Ga0207703_12327105 | 3300026035 | Unclassified | 511 |
| 486 | Ga0207639_11239388 | 3300026041 | Bacteria | 700 |
| 487 | Ga0207708_10177287 | 3300026075 | Bacteria | 1691 |
| 488 | Ga0207702_10038359 | 3300026078 | Bacteria | 4012 |
| 489 | Ga0207702_12060711 | 3300026078 | Bacteria | 561 |
| 490 | Ga0207641_10396615 | 3300026088 | Bacteria | 1324 |
| 491 | Ga0207641_10397575 | 3300026088 | Bacteria | 1322 |
| 492 | Ga0207641_11493250 | 3300026088 | Bacteria | 677 |
| 493 | Ga0207641_12544060 | 3300026088 | Bacteria | 510 |
| 494 | Ga0207648_10001019 | 3300026089 | Bacteria | 31539 |
| 495 | Ga0207648_10645583 | 3300026089 | Bacteria | 978 |
| 496 | Ga0207676_10079761 | 3300026095 | Bacteria | 2655 |
| 497 | Ga0207676_10218162 | 3300026095 | Bacteria | 1697 |
| 498 | Ga0207674_10368667 | 3300026116 | Bacteria | 1388 |
| 499 | Ga0207674_11275510 | 3300026116 | Bacteria | 704 |
| 500 | Ga0207675_100000567 | 3300026118 | Bacteria | 36188 |
| 501 | Ga0207675_101574605 | 3300026118 | Bacteria | 678 |
| 502 | Ga0207683_10042859 | 3300026121 | Bacteria | 3952 |
| 503 | Ga0207683_11596863 | 3300026121 | Bacteria | 601 |
| 504 | Ga0207698_12459574 | 3300026142 | Bacteria | 531 |
| 505 | Ga0209984_1022770 | 3300027424 | Bacteria | 864 |
| 506 | Ga0210000_1014842 | 3300027462 | Bacteria | 1169 |
| 507 | Ga0209179_1000970 | 3300027512 | Bacteria | 3264 |
| 508 | Ga0209968_1102306 | 3300027526 | Bacteria | 523 |
| 509 | Ga0209999_1062402 | 3300027543 | Bacteria | 710 |
| 510 | Ga0209982_1000529 | 3300027552 | Bacteria | 4757 |
| 511 | Ga0209970_1004527 | 3300027614 | Bacteria | 2308 |
| 512 | Ga0210002_1016968 | 3300027617 | Bacteria | 1156 |
| 513 | Ga0209983_1006005 | 3300027665 | Bacteria | 2502 |
| 514 | Ga0209588_1143934 | 3300027671 | Bacteria | 757 |
| 515 | Ga0209971_1000724 | 3300027682 | Bacteria | 8506 |
| 516 | Ga0209974_10001096 | 3300027876 | Bacteria | 9594 |
| 517 | Ga0265356_1001830 | 3300028017 | Bacteria | 2998 |
| 518 | Ga0265357_1041907 | 3300028023 | Unclassified | 538 |
| 519 | Ga0268266_10340617 | 3300028379 | Bacteria | 1407 |
| 520 | Ga0268266_10585406 | 3300028379 | Bacteria | 1071 |
| 521 | Ga0268266_11924877 | 3300028379 | Bacteria | 565 |
| 522 | Ga0268266_12036382 | 3300028379 | Bacteria | 547 |
| 523 | Ga0268265_10005940 | 3300028380 | Bacteria | 8312 |
| 524 | Ga0268265_10038567 | 3300028380 | Bacteria | 3515 |
| 525 | Ga0268265_11114183 | 3300028380 | Bacteria | 784 |
| 526 | Ga0268265_11215964 | 3300028380 | Bacteria | 751 |
| 527 | Ga0268265_12654387 | 3300028380 | Bacteria | 506 |
| 528 | Ga0268264_10337994 | 3300028381 | Bacteria | 1429 |
| 529 | Ga0268264_10420619 | 3300028381 | Bacteria | 1288 |
| 530 | Ga0268264_11001677 | 3300028381 | Bacteria | 842 |
| 531 | Ga0307515_10039654 | 3300028794 | Bacteria | 7479 |
| 532 | Ga0265767_118865 | 3300030836 | Bacteria | 513 |
| 533 | Ga0265765_1062006 | 3300030879 | Bacteria | 530 |
| 534 | Ga0265772_102895 | 3300030886 | Bacteria | 693 |
| 535 | Ga0265329_10223036 | 3300031242 | Bacteria | 624 |
| 536 | Ga0265340_10147244 | 3300031247 | Bacteria | 1075 |
| 537 | Ga0265327_10002526 | 3300031251 | Bacteria | 19071 |
| 538 | Ga0265327_10002740 | 3300031251 | Bacteria | 17939 |
| 539 | Ga0265316_10002788 | 3300031344 | Bacteria | 17910 |
| 540 | Ga0307513_10003009 | 3300031456 | Bacteria | 22993 |
| 541 | Ga0307508_10743798 | 3300031616 | Unclassified | 593 |
| 542 | Ga0316575_10017077 | 3300031665 | Bacteria | 2753 |
| 543 | Ga0316575_10076648 | 3300031665 | Bacteria | 1346 |
| 544 | Ga0316575_10232995 | 3300031665 | Bacteria | 770 |
| 545 | Ga0316579_10097391 | 3300031691 | Bacteria | 1407 |
| 546 | Ga0316579_10162932 | 3300031691 | Bacteria | 1077 |
| 547 | Ga0316579_10166584 | 3300031691 | Bacteria | 1065 |
| 548 | Ga0316576_10012939 | 3300031727 | Bacteria | 5524 |
| 549 | Ga0316576_10085784 | 3300031727 | Bacteria | 2340 |
| 550 | Ga0316576_10348838 | 3300031727 | Bacteria | 1101 |
| 551 | Ga0316578_10079519 | 3300031728 | Bacteria | 1949 |
| 552 | Ga0316578_10096971 | 3300031728 | Bacteria | 1765 |
| 553 | Ga0316578_10213578 | 3300031728 | Bacteria | 1160 |
| 554 | Ga0307516_10000215 | 3300031730 | Bacteria | 74522 |
| 555 | Ga0316577_10099242 | 3300031733 | Bacteria | 1631 |
| 556 | Ga0316577_10324844 | 3300031733 | Bacteria | 872 |
| 557 | Ga0316577_10337157 | 3300031733 | Bacteria | 855 |
| 558 | Ga0316577_10473147 | 3300031733 | Bacteria | 712 |
| 559 | Ga0307407_10358456 | 3300031903 | Bacteria | 1035 |
| 560 | Ga0307409_100623260 | 3300031995 | Bacteria | 1069 |
| 561 | Ga0307414_11590771 | 3300032004 | Bacteria | 609 |
| 562 | Ga0307411_10740166 | 3300032005 | Bacteria | 860 |
| 563 | Ga0316053_115239 | 3300032120 | Bacteria | 570 |
| 564 | Ga0316053_118956 | 3300032120 | Bacteria | 530 |
| 565 | Ga0316583_10038324 | 3300032133 | Bacteria | 1699 |
| 566 | Ga0316583_10051875 | 3300032133 | Bacteria | 1444 |
| 567 | Ga0316583_10075632 | 3300032133 | Bacteria | 1177 |
| 568 | Ga0316583_10200719 | 3300032133 | Bacteria | 692 |
| 569 | Ga0316585_10034979 | 3300032137 | Bacteria | 1590 |
| 570 | Ga0316585_10049331 | 3300032137 | Bacteria | 1350 |
| 571 | Ga0316585_10063620 | 3300032137 | Bacteria | 1193 |
| 572 | Ga0316585_10131291 | 3300032137 | Bacteria | 825 |
| 573 | Ga0316580_10055138 | 3300032139 | Bacteria | 1222 |
| 574 | Ga0316580_10077031 | 3300032139 | Bacteria | 1020 |
| 575 | Ga0316593_10017462 | 3300032168 | Bacteria | 2189 |
| 576 | Ga0316593_10024372 | 3300032168 | Bacteria | 1918 |
| 577 | Ga0316593_10027136 | 3300032168 | Bacteria | 1835 |
| 578 | Ga0316593_10117978 | 3300032168 | Bacteria | 951 |
| 579 | Ga0316593_10177099 | 3300032168 | Bacteria | 783 |
| 580 | Ga0316593_10187060 | 3300032168 | Bacteria | 762 |
| 581 | Ga0316593_10238403 | 3300032168 | Bacteria | 678 |
| 582 | Ga0316593_10251950 | 3300032168 | Bacteria | 661 |
| 583 | Ga0316593_10361588 | 3300032168 | Bacteria | 557 |
| 584 | Ga0316593_10447255 | 3300032168 | Bacteria | 504 |
| 585 | Ga0316592_1016984 | 3300033524 | Bacteria | 1525 |
| 586 | Ga0316592_1029193 | 3300033524 | Bacteria | 1196 |
| 587 | Ga0316586_1075792 | 3300033527 | Bacteria | 624 |
| 588 | Ga0316588_1049815 | 3300033528 | Bacteria | 1014 |
| 589 | Ga0316588_1128663 | 3300033528 | Bacteria | 643 |
| 590 | Ga0316588_1164854 | 3300033528 | Bacteria | 572 |
| 591 | Ga0316587_1008159 | 3300033529 | Bacteria | 1641 |
| 592 | Ga0316587_1035107 | 3300033529 | Bacteria | 895 |
| 593 | Ga0316587_1077861 | 3300033529 | Bacteria | 625 |
| 594 | Ga0316596_1019526 | 3300033541 | Bacteria | 1719 |
| 595 | Ga0316596_1019631 | 3300033541 | Bacteria | 1715 |
| 596 | Ga0316596_1029183 | 3300033541 | Bacteria | 1427 |
| 597 | Ga0316596_1202117 | 3300033541 | Bacteria | 553 |
| 598 | Ga0373934_0252923 | 3300035086 | Bacteria | 729 |
| 599 | Ga0373923_0053484 | 3300035111 | Bacteria | 1698 |
| 600 | Ga0373953_0110411 | 3300035117 | Bacteria | 1163 |
| 601 | Ga0373956_0354586 | 3300035119 | Bacteria | 699 |
| 602 | Ga0373943_0037529 | 3300035170 | Bacteria | 2326 |
| 603 | Ga0373943_0407042 | 3300035170 | Bacteria | 786 |
| 604 | Ga0373962_0368395 | 3300035242 | Bacteria | 523 |
| 605 | Ga0316574_0001466 | 3300035398 | Bacteria | 11223 |
| 606 | Ga0316574_0071068 | 3300035398 | Bacteria | 2197 |
| 607 | Ga0316574_0252151 | 3300035398 | Bacteria | 1127 |
| 608 | Ga0316574_0557954 | 3300035398 | Bacteria | 710 |
| 609 | Ga0316574_0738777 | 3300035398 | Bacteria | 602 |
| 610 | Ga0316574_0938992 | 3300035398 | Bacteria | 522 |
| 611 | Ga0373935_1351796 | 3300035692 | Bacteria | 532 |
| 612 | Ga0373933_0110033 | 3300035724 | Bacteria | 1718 |
| 613 | Ga0373937_0755674 | 3300036401 | Bacteria | 920 |
| 614 | Ga0316582_0016884 | 3300036647 | Bacteria | 4209 |
| 615 | Ga0316582_0056601 | 3300036647 | Bacteria | 2502 |
| 616 | Ga0316582_0150277 | 3300036647 | Bacteria | 1574 |
| 617 | Ga0316582_0597815 | 3300036647 | Bacteria | 759 |
| 618 | Ga0316584_0005998 | 3300036712 | Bacteria | 8207 |
| 619 | Ga0316584_0010426 | 3300036712 | Bacteria | 6492 |
| 620 | Ga0316584_0070263 | 3300036712 | Bacteria | 2625 |
| 621 | Ga0373925_0240568 | 3300037068 | Bacteria | 1449 |
| 622 | Ga0373925_0434199 | 3300037068 | Bacteria | 1074 |
| 623 | Ga0373925_0511731 | 3300037068 | Bacteria | 986 |
| 624 | Ga0316581_0041213 | 3300037588 | Bacteria | 1407 |
| 625 | Ga0436365_0411158 | 3300039437 | Bacteria | 710 |
| 626 | Ga0436360_0392409 | 3300039438 | Bacteria | 2321 |
| 627 | Ga0436363_0456827 | 3300039450 | Bacteria | 2453 |
| 628 | Ga0436363_1573750 | 3300039450 | Bacteria | 844 |
| 629 | Ga0436362_1301351 | 3300039453 | Bacteria | 746 |
| 630 | Ga0451789_0353459 | 3300041443 | Bacteria | 525 |
| 631 | Ga0451793_1825493 | 3300041452 | Bacteria | 829 |
| 632 | Ga0451798_1034020 | 3300041458 | Bacteria | 780 |
| 633 | Ga0451800_1214791 | 3300041459 | Bacteria | 532 |
| 634 | Ga0451807_1485021 | 3300041486 | Bacteria | 1753 |
| 635 | Ga0451807_2215334 | 3300041486 | Bacteria | 717 |
| 636 | Ga0451833_0008883 | 3300041491 | Bacteria | 1485 |
| 637 | Ga0451835_0345989 | 3300041492 | Bacteria | 895 |
| 638 | Ga0451837_0983837 | 3300041494 | Bacteria | 516 |
| 639 | Ga0451837_1501591 | 3300041494 | Bacteria | 808 |
| 640 | Ga0451840_06294 | 3300041497 | Bacteria | 860 |
| 641 | Ga0451841_1463338 | 3300041498 | Bacteria | 1322 |
| 642 | Ga0451845_0229210 | 3300041501 | Bacteria | 771 |
| 643 | Ga0451846_14676 | 3300041502 | Bacteria | 898 |
| 644 | Ga0451849_0473118 | 3300041505 | Bacteria | 2137 |
| 645 | Ga0451850_00677 | 3300041506 | Bacteria | 552 |
| 646 | Ga0451853_1240809 | 3300041512 | Bacteria | 4527 |
| 647 | Ga0452271_01179 | 3300041916 | Bacteria | 861 |
| 648 | Ga0439460_0246194 | 3300042461 | Unclassified | 617 |
| 649 | Ga0451577_0611798 | 3300042876 | Bacteria | 988 |
| 650 | Ga0466972_0008680 | 3300044658 | Bacteria | 5096 |
| 651 | Ga0453683_0304485 | 3300044673 | Bacteria | 1020 |
| 652 | Ga0453684_0451605 | 3300044712 | Bacteria | 1430 |
| 653 | Ga0453684_0686722 | 3300044712 | Bacteria | 1114 |
| 654 | Ga0466970_0009577 | 3300044765 | Bacteria | 4900 |
| 655 | Ga0466970_0078266 | 3300044765 | Bacteria | 1784 |
| 656 | Ga0451576_2104479 | 3300045051 | Unclassified | 580 |
| 657 | Ga0495629_0645374 | 3300046459 | Bacteria | 706 |
| 658 | Ga0495650_0170507 | 3300046471 | Bacteria | 771 |
| 659 | Ga0495580_0013106 | 3300046472 | Bacteria | 6346 |
| 660 | Ga0495594_0645404 | 3300046499 | Bacteria | 599 |
| 661 | Ga0495608_0523263 | 3300046511 | Bacteria | 717 |
| 662 | Ga0495618_0228168 | 3300046514 | Bacteria | 1173 |
| 663 | Ga0495628_0581050 | 3300046516 | Bacteria | 802 |
| 664 | Ga0495630_0152932 | 3300046517 | Bacteria | 1756 |
| 665 | Ga0495630_0165482 | 3300046517 | Bacteria | 1684 |
| 666 | Ga0495640_0266487 | 3300046533 | Bacteria | 1069 |
| 667 | Ga0495640_0432619 | 3300046533 | Bacteria | 805 |
| 668 | Ga0495587_0349952 | 3300046536 | Bacteria | 824 |
| 669 | Ga0495645_0343941 | 3300046543 | Bacteria | 963 |
| 670 | Ga0495599_0317553 | 3300046678 | Bacteria | 938 |
| 671 | Ga0495671_0016881 | 3300046692 | Bacteria | 3891 |
| 672 | Ga0496100_0033871 | 3300048903 | Bacteria | 3199 |
| 673 | Ga0496101_0010790 | 3300048904 | Bacteria | 6044 |
| 674 | Ga0496102_0545215 | 3300048905 | Bacteria | 1082 |
| 675 | Ga0496103_0328727 | 3300048906 | Bacteria | 983 |
| 676 | Ga0496104_0223667 | 3300048907 | Bacteria | 1794 |
| 677 | Ga0496105_0424344 | 3300048908 | Bacteria | 1052 |
| 678 | Ga0496106_0757912 | 3300048909 | Bacteria | 771 |
| 679 | Ga0496107_0085865 | 3300048910 | Bacteria | 2296 |
| 680 | Ga0496108_0681238 | 3300048911 | Unclassified | 892 |
| 681 | Ga0496109_0109550 | 3300048912 | Bacteria | 2567 |
| 682 | Ga0496110_1042907 | 3300048913 | Bacteria | 725 |
| 683 | Ga0496111_0037235 | 3300048914 | Bacteria | 3482 |
| 684 | Ga0496113_0104392 | 3300048916 | Bacteria | 2199 |
| 685 | Ga0496114_0506744 | 3300048917 | Bacteria | 1067 |
| 686 | Ga0496115_0035264 | 3300048918 | Bacteria | 3957 |
| 687 | Ga0496115_1039462 | 3300048918 | Bacteria | 624 |
| 688 | Ga0495682_0162651 | 3300049460 | Bacteria | 795 |
| 689 | Ga0495682_0331662 | 3300049460 | Bacteria | 536 |
| 690 | Ga0501032_0090020 | 3300049569 | Bacteria | 2036 |
| 691 | Ga0501032_0766765 | 3300049569 | Bacteria | 610 |
| 692 | Ga0501033_0054100 | 3300049570 | Bacteria | 2970 |
| 693 | Ga0501033_0467696 | 3300049570 | Bacteria | 874 |
| 694 | Ga0501034_0097084 | 3300049571 | Bacteria | 2942 |
| 695 | Ga0501034_1273316 | 3300049571 | Bacteria | 612 |
| 696 | Ga0501036_1213302 | 3300049572 | Bacteria | 614 |
| 697 | Ga0501037_0143613 | 3300049573 | Bacteria | 1707 |
| 698 | Ga0501037_0234561 | 3300049573 | Bacteria | 1287 |
| 699 | Ga0501038_0003475 | 3300049574 | Bacteria | 14682 |
| 700 | Ga0501038_0870035 | 3300049574 | Bacteria | 666 |
| 701 | Ga0501039_0071659 | 3300049575 | Bacteria | 2692 |
| 702 | Ga0501039_1172331 | 3300049575 | Bacteria | 594 |
| 703 | Ga0501040_0156528 | 3300049576 | Bacteria | 1609 |
| 704 | Ga0501043_0232800 | 3300049579 | Bacteria | 1422 |
| 705 | Ga0501043_1154002 | 3300049579 | Bacteria | 545 |
| 706 | Ga0501046_0018192 | 3300049580 | Bacteria | 5852 |
| 707 | Ga0501047_0120716 | 3300049581 | Bacteria | 2503 |
| 708 | Ga0501047_1051297 | 3300049581 | Bacteria | 627 |
| 709 | Ga0501068_0218363 | 3300049584 | Bacteria | 1211 |
| 710 | Ga0501068_1052655 | 3300049584 | Bacteria | 537 |
| 711 | Ga0501069_0464032 | 3300049585 | Bacteria | 753 |
| 712 | Ga0501070_1002660 | 3300049586 | Bacteria | 647 |
| 713 | Ga0501071_0370558 | 3300049587 | Bacteria | 1091 |
| 714 | Ga0501073_0013869 | 3300049589 | Bacteria | 5858 |
| 715 | Ga0501073_0149688 | 3300049589 | Bacteria | 1617 |
| 716 | Ga0501073_0423152 | 3300049589 | Bacteria | 920 |
| 717 | Ga0501074_0044879 | 3300049590 | Bacteria | 3198 |
| 718 | Ga0501074_0163833 | 3300049590 | Bacteria | 1587 |
| 719 | Ga0501077_0502197 | 3300049593 | Bacteria | 778 |
| 720 | Ga0501217_170714 | 3300049661 | Bacteria | 662 |
| 721 | Ga0501079_0480416 | 3300049741 | Bacteria | 976 |
| 722 | Ga0501080_0166993 | 3300049742 | Bacteria | 2030 |
| 723 | Ga0501080_0707023 | 3300049742 | Bacteria | 888 |
| 724 | Ga0501081_0691398 | 3300049743 | Bacteria | 766 |
| 725 | Ga0501044_0042994 | 3300049823 | Bacteria | 4695 |
| 726 | Ga0501044_0335225 | 3300049823 | Bacteria | 1434 |
| 727 | Ga0501045_1246325 | 3300049824 | Bacteria | 542 |
| 728 | nmdc:mga07m45_848798_c1 | 3300050496 | Bacteria | 523 |
| 729 | nmdc:mga09592_991942_c1 | 3300050508 | Bacteria | 702 |
| 730 | nmdc:mga0qj67_316452_c1 | 3300050509 | Bacteria | 1264 |
| 731 | nmdc:mga06r32_445017_c1 | 3300050510 | Bacteria | 1276 |
| 732 | nmdc:mga08y16_1304457_c1 | 3300050511 | Bacteria | 692 |
| 733 | nmdc:mga08y16_298050_c1 | 3300050511 | Bacteria | 1662 |
| 734 | Ga0495612_0174705 | 3300053078 | Unclassified | 942 |
| 735 | Ga0500610_0005232 | 3300053079 | Bacteria | 5288 |
| 736 | Ga0500610_0362080 | 3300053079 | Bacteria | 608 |
| 737 | Ga0500635_0363587 | 3300053080 | Bacteria | 573 |
| 738 | Ga0495595_0130967 | 3300053084 | Bacteria | 1226 |
| 739 | Ga0495619_0315727 | 3300053085 | Bacteria | 1082 |
| 740 | Ga0500644_0431516 | 3300053088 | Bacteria | 576 |
| 741 | Ga0500646_0090643 | 3300053090 | Bacteria | 946 |
| 742 | Ga0500583_0063188 | 3300053092 | Bacteria | 1753 |
| 743 | Ga0500651_0002589 | 3300053093 | Bacteria | 9606 |
| 744 | Ga0500651_0137464 | 3300053093 | Bacteria | 1475 |
| 745 | Ga0500651_0266889 | 3300053093 | Bacteria | 991 |
| 746 | Ga0500641_0008120 | 3300053096 | Bacteria | 3739 |
| 747 | Ga0500641_0163066 | 3300053096 | Bacteria | 961 |
| 748 | Ga0500562_173204 | 3300053108 | Bacteria | 586 |
| 749 | Ga0500595_168295 | 3300053119 | Bacteria | 609 |
| 750 | Ga0500617_050452 | 3300053124 | Bacteria | 1857 |
| 751 | Ga0500652_050386 | 3300053131 | Bacteria | 1699 |
| 752 | Ga0500658_0343158 | 3300053134 | Unclassified | 686 |
| 753 | Ga0500568_0100495 | 3300053139 | Bacteria | 1085 |
| 754 | Ga0500568_0158097 | 3300053139 | Bacteria | 837 |
| 755 | Ga0500568_0338070 | 3300053139 | Bacteria | 546 |
| 756 | Ga0500588_0005662 | 3300053146 | Bacteria | 2787 |
| 757 | Ga0500588_0068160 | 3300053146 | Bacteria | 1159 |
| 758 | Ga0500600_0247094 | 3300053149 | Bacteria | 802 |
| 759 | Ga0500616_0073908 | 3300053153 | Bacteria | 1729 |
| 760 | Ga0500622_0018332 | 3300053156 | Bacteria | 3722 |
| 761 | Ga0500637_0092901 | 3300053178 | Bacteria | 1748 |
| 762 | Ga0500611_048514 | 3300053727 | Unclassified | 963 |
| 763 | Ga0587094_030746 | 3300059513 | Bacteria | 831 |
| 764 | Ga0587107_004057 | 3300059652 | Bacteria | 1463 |
| 765 | Ga0501082_0032648 | 3300060353 | Bacteria | 4491 |
| 766 | Ga0530510_0114701 | 3300061734 | Bacteria | 1975 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300035398 | Ga0316574_0001466 | Ga0316574_0001466_5313_5543 | 58 |
| 2 | 3300035398 | Ga0316574_0738777 | Ga0316574_0738777_218_439 | 58 |
| 3 | 3300035398 | Ga0316574_0938992 | Ga0316574_0938992_208_447 | 58 |
| 4 | 3300036647 | Ga0316582_0597815 | Ga0316582_0597815_166_396 | 58 |
| 5 | 3300009545 | Ga0105237_11365595 | Ga0105237_113655951 | 59 |
| 6 | 3300010375 | Ga0105239_12727937 | Ga0105239_127279371 | 59 |
| 7 | 3300013104 | Ga0157370_10306834 | Ga0157370_103068342 | 59 |
| 8 | 3300005340 | Ga0070689_100563746 | Ga0070689_1005637461 | 60 |
| 9 | 3300005341 | Ga0070691_10736879 | Ga0070691_107368792 | 60 |
| 10 | 3300005353 | Ga0070669_101329635 | Ga0070669_1013296352 | 60 |
| 11 | 3300005354 | Ga0070675_100463179 | Ga0070675_1004631792 | 60 |
| 12 | 3300005438 | Ga0070701_11308421 | Ga0070701_113084211 | 60 |
| 13 | 3300005441 | Ga0070700_100148850 | Ga0070700_1001488504 | 60 |
| 14 | 3300005459 | Ga0068867_100520140 | Ga0068867_1005201402 | 60 |
| 15 | 3300005466 | Ga0070685_10305927 | Ga0070685_103059272 | 60 |
| 16 | 3300005545 | Ga0070695_101081162 | Ga0070695_1010811621 | 60 |
| 17 | 3300005617 | Ga0068859_100303991 | Ga0068859_1003039912 | 60 |
| 18 | 3300005719 | Ga0068861_101253916 | Ga0068861_1012539161 | 60 |
| 19 | 3300005841 | Ga0068863_100936417 | Ga0068863_1009364174 | 60 |
| 20 | 3300006931 | Ga0097620_100304005 | Ga0097620_1003040052 | 60 |
| 21 | 3300010375 | Ga0105239_12062880 | Ga0105239_120628801 | 60 |
| 22 | 3300013306 | Ga0163162_11764840 | Ga0163162_117648403 | 60 |
| 23 | 3300013308 | Ga0157375_10277551 | Ga0157375_102775512 | 60 |
| 24 | 3300041486 | Ga0451807_1485021 | Ga0451807_1485021_736_945 | 60 |
| 25 | 3300005578 | Ga0068854_100733067 | Ga0068854_1007330673 | 61 |
| 26 | 3300005842 | Ga0068858_100183086 | Ga0068858_1001830862 | 61 |
| 27 | 3300005843 | Ga0068860_101213284 | Ga0068860_1012132841 | 61 |
| 28 | 3300006358 | Ga0068871_101724505 | Ga0068871_1017245052 | 61 |
| 29 | 3300009101 | Ga0105247_11764360 | Ga0105247_117643601 | 61 |
| 30 | 3300009177 | Ga0105248_10346642 | Ga0105248_103466422 | 61 |
| 31 | 3300013308 | Ga0157375_11879304 | Ga0157375_118793042 | 61 |
| 32 | 3300025936 | Ga0207670_11404998 | Ga0207670_114049981 | 61 |
| 33 | 3300025941 | Ga0207711_11012198 | Ga0207711_110121982 | 61 |
| 34 | 3300025981 | Ga0207640_10928409 | Ga0207640_109284092 | 61 |
| 35 | 3300026035 | Ga0207703_11807812 | Ga0207703_118078122 | 61 |
| 36 | 3300026088 | Ga0207641_12544060 | Ga0207641_125440601 | 61 |
| 37 | 3300026095 | Ga0207676_10218162 | Ga0207676_102181621 | 61 |
| 38 | 3300053139 | Ga0500568_0100495 | Ga0500568_0100495_513_731 | 61 |
| 39 | 3300005617 | Ga0068859_100889466 | Ga0068859_1008894662 | 62 |
| 40 | 3300005719 | Ga0068861_101820479 | Ga0068861_1018204792 | 62 |
| 41 | 3300005844 | Ga0068862_100393212 | Ga0068862_1003932122 | 62 |
| 42 | 3300006844 | Ga0075428_100352504 | Ga0075428_1003525042 | 62 |
| 43 | 3300006847 | Ga0075431_101129940 | Ga0075431_1011299402 | 62 |
| 44 | 3300006931 | Ga0097620_100889506 | Ga0097620_1008895062 | 62 |
| 45 | 3300009093 | Ga0105240_10090641 | Ga0105240_100906412 | 62 |
| 46 | 3300009094 | Ga0111539_10877895 | Ga0111539_108778953 | 62 |
| 47 | 3300009545 | Ga0105237_10040525 | Ga0105237_100405253 | 62 |
| 48 | 3300013105 | Ga0157369_10006603 | Ga0157369_1000660314 | 62 |
| 49 | 3300026118 | Ga0207675_101574605 | Ga0207675_1015746051 | 62 |
| 50 | 3300028380 | Ga0268265_10038567 | Ga0268265_100385672 | 62 |
| 51 | 3300028794 | Ga0307515_10039654 | Ga0307515_100396543 | 62 |
| 52 | 3300036712 | Ga0316584_0070263 | Ga0316584_0070263_501_737 | 62 |
| 53 | 3300037588 | Ga0316581_0041213 | Ga0316581_0041213_1108_1344 | 62 |
| 54 | 3300050508 | nmdc:mga09592_991942_c1 | nmdc:mga09592_991942_c1_194_403 | 62 |
| 55 | 3300050511 | nmdc:mga08y16_1304457_c1 | nmdc:mga08y16_1304457_c1_321_530 | 62 |
| 56 | 3300053153 | Ga0500616_0073908 | Ga0500616_0073908_558_776 | 62 |
| 57 | 3300009174 | Ga0105241_10227568 | Ga0105241_102275682 | 63 |
| 58 | 3300025261 | Ga0209233_1003300 | Ga0209233_10033002 | 63 |
| 59 | 3300001904 | JGI24736J21556_1036419 | JGI24736J21556_10364192 | 64 |
| 60 | 3300005331 | Ga0070670_100006835 | Ga0070670_1000068352 | 64 |
| 61 | 3300005335 | Ga0070666_10048447 | Ga0070666_100484474 | 64 |
| 62 | 3300005338 | Ga0068868_100082626 | Ga0068868_1000826262 | 64 |
| 63 | 3300005344 | Ga0070661_100079174 | Ga0070661_1000791742 | 64 |
| 64 | 3300005355 | Ga0070671_100046776 | Ga0070671_1000467764 | 64 |
| 65 | 3300005367 | Ga0070667_100059421 | Ga0070667_1000594212 | 64 |
| 66 | 3300005455 | Ga0070663_100019820 | Ga0070663_1000198202 | 64 |
| 67 | 3300005457 | Ga0070662_100147198 | Ga0070662_1001471982 | 64 |
| 68 | 3300005459 | Ga0068867_100604742 | Ga0068867_1006047422 | 64 |
| 69 | 3300005539 | Ga0068853_100008660 | Ga0068853_1000086601 | 64 |
| 70 | 3300005539 | Ga0068853_102248829 | Ga0068853_1022488291 | 64 |
| 71 | 3300005548 | Ga0070665_100001699 | Ga0070665_10000169921 | 64 |
| 72 | 3300005563 | Ga0068855_100041147 | Ga0068855_1000411471 | 64 |
| 73 | 3300005563 | Ga0068855_100468581 | Ga0068855_1004685812 | 64 |
| 74 | 3300005564 | Ga0070664_100343447 | Ga0070664_1003434473 | 64 |
| 75 | 3300005564 | Ga0070664_101154623 | Ga0070664_1011546232 | 64 |
| 76 | 3300005577 | Ga0068857_101428136 | Ga0068857_1014281361 | 64 |
| 77 | 3300005578 | Ga0068854_100120335 | Ga0068854_1001203358 | 64 |
| 78 | 3300005578 | Ga0068854_100298936 | Ga0068854_1002989362 | 64 |
| 79 | 3300005578 | Ga0068854_100788410 | Ga0068854_1007884102 | 64 |
| 80 | 3300005614 | Ga0068856_100010069 | Ga0068856_1000100694 | 64 |
| 81 | 3300005614 | Ga0068856_100836988 | Ga0068856_1008369883 | 64 |
| 82 | 3300005614 | Ga0068856_102005565 | Ga0068856_1020055651 | 64 |
| 83 | 3300005616 | Ga0068852_100001584 | Ga0068852_1000015842 | 64 |
| 84 | 3300005616 | Ga0068852_100064971 | Ga0068852_1000649712 | 64 |
| 85 | 3300005617 | Ga0068859_100926005 | Ga0068859_1009260052 | 64 |
| 86 | 3300005834 | Ga0068851_10094016 | Ga0068851_100940162 | 64 |
| 87 | 3300005842 | Ga0068858_100161521 | Ga0068858_1001615212 | 64 |
| 88 | 3300006237 | Ga0097621_100169235 | Ga0097621_1001692353 | 64 |
| 89 | 3300006353 | Ga0075370_10753971 | Ga0075370_107539711 | 64 |
| 90 | 3300006358 | Ga0068871_100215893 | Ga0068871_1002158933 | 64 |
| 91 | 3300006881 | Ga0068865_100017320 | Ga0068865_1000173204 | 64 |
| 92 | 3300006881 | Ga0068865_100038582 | Ga0068865_1000385821 | 64 |
| 93 | 3300006931 | Ga0097620_100925935 | Ga0097620_1009259352 | 64 |
| 94 | 3300009093 | Ga0105240_10015775 | Ga0105240_1001577512 | 64 |
| 95 | 3300009093 | Ga0105240_10540715 | Ga0105240_105407151 | 64 |
| 96 | 3300009098 | Ga0105245_11937624 | Ga0105245_119376241 | 64 |
| 97 | 3300009174 | Ga0105241_10035532 | Ga0105241_100355322 | 64 |
| 98 | 3300009174 | Ga0105241_10043847 | Ga0105241_100438472 | 64 |
| 99 | 3300009176 | Ga0105242_10062818 | Ga0105242_100628188 | 64 |
| 100 | 3300009545 | Ga0105237_10005972 | Ga0105237_100059729 | 64 |
| 101 | 3300009545 | Ga0105237_10298519 | Ga0105237_102985191 | 64 |
| 102 | 3300009551 | Ga0105238_10008246 | Ga0105238_100082465 | 64 |
| 103 | 3300009551 | Ga0105238_10165784 | Ga0105238_101657842 | 64 |
| 104 | 3300009553 | Ga0105249_10681332 | Ga0105249_106813324 | 64 |
| 105 | 3300010375 | Ga0105239_10013679 | Ga0105239_1001367911 | 64 |
| 106 | 3300010375 | Ga0105239_10032021 | Ga0105239_100320215 | 64 |
| 107 | 3300013104 | Ga0157370_10183500 | Ga0157370_101835002 | 64 |
| 108 | 3300013104 | Ga0157370_10372969 | Ga0157370_103729693 | 64 |
| 109 | 3300013105 | Ga0157369_10000195 | Ga0157369_1000019544 | 64 |
| 110 | 3300013105 | Ga0157369_10032217 | Ga0157369_100322172 | 64 |
| 111 | 3300013306 | Ga0163162_10015010 | Ga0163162_100150102 | 64 |
| 112 | 3300013307 | Ga0157372_10003204 | Ga0157372_100032046 | 64 |
| 113 | 3300013308 | Ga0157375_10000940 | Ga0157375_1000094018 | 64 |
| 114 | 3300014325 | Ga0163163_11959003 | Ga0163163_119590032 | 64 |
| 115 | 3300014497 | Ga0182008_10550970 | Ga0182008_105509701 | 64 |
| 116 | 3300014969 | Ga0157376_10016323 | Ga0157376_100163235 | 64 |
| 117 | 3300020078 | Ga0206352_10293537 | Ga0206352_102935371 | 64 |
| 118 | 3300025906 | Ga0207699_10617858 | Ga0207699_106178582 | 64 |
| 119 | 3300025911 | Ga0207654_10585937 | Ga0207654_105859371 | 64 |
| 120 | 3300025913 | Ga0207695_10002778 | Ga0207695_100027789 | 64 |
| 121 | 3300025914 | Ga0207671_10001147 | Ga0207671_1000114713 | 64 |
| 122 | 3300025924 | Ga0207694_10000162 | Ga0207694_1000016242 | 64 |
| 123 | 3300025961 | Ga0207712_10505403 | Ga0207712_105054033 | 64 |
| 124 | 3300025981 | Ga0207640_11143830 | Ga0207640_111438302 | 64 |
| 125 | 3300048918 | Ga0496115_1039462 | Ga0496115_1039462_129_392 | 64 |
| 126 | 3300050496 | nmdc:mga07m45_848798_c1 | nmdc:mga07m45_848798_c1_120_329 | 64 |
| 127 | 3300059652 | Ga0587107_004057 | Ga0587107_004057_142_375 | 64 |
| 128 | 3300004803 | Ga0058862_12551623 | Ga0058862_125516232 | 65 |
| 129 | 3300005295 | Ga0065707_10230286 | Ga0065707_102302861 | 65 |
| 130 | 3300005458 | Ga0070681_10027498 | Ga0070681_100274985 | 65 |
| 131 | 3300005530 | Ga0070679_100128579 | Ga0070679_1001285791 | 65 |
| 132 | 3300005530 | Ga0070679_102134051 | Ga0070679_1021340511 | 65 |
| 133 | 3300005563 | Ga0068855_100936557 | Ga0068855_1009365572 | 65 |
| 134 | 3300007788 | Ga0099795_10019602 | Ga0099795_100196022 | 65 |
| 135 | 3300009092 | Ga0105250_10000008 | Ga0105250_10000008128 | 65 |
| 136 | 3300009093 | Ga0105240_11327580 | Ga0105240_113275802 | 65 |
| 137 | 3300009098 | Ga0105245_10982032 | Ga0105245_109820322 | 65 |
| 138 | 3300009174 | Ga0105241_10156914 | Ga0105241_101569141 | 65 |
| 139 | 3300009982 | Ga0105147_100236 | Ga0105147_10023610 | 65 |
| 140 | 3300010375 | Ga0105239_12371021 | Ga0105239_123710212 | 65 |
| 141 | 3300013105 | Ga0157369_10782110 | Ga0157369_107821101 | 65 |
| 142 | 3300014968 | Ga0157379_10001068 | Ga0157379_100010685 | 65 |
| 143 | 3300025711 | Ga0207696_1000106 | Ga0207696_100010617 | 65 |
| 144 | 3300025911 | Ga0207654_10068211 | Ga0207654_100682112 | 65 |
| 145 | 3300025912 | Ga0207707_10026840 | Ga0207707_100268405 | 65 |
| 146 | 3300025913 | Ga0207695_10145146 | Ga0207695_101451462 | 65 |
| 147 | 3300025913 | Ga0207695_10558339 | Ga0207695_105583391 | 65 |
| 148 | 3300025921 | Ga0207652_11391459 | Ga0207652_113914592 | 65 |
| 149 | 3300025927 | Ga0207687_10636388 | Ga0207687_106363882 | 65 |
| 150 | 3300025949 | Ga0207667_10722915 | Ga0207667_107229152 | 65 |
| 151 | 3300031456 | Ga0307513_10003009 | Ga0307513_1000300917 | 65 |
| 152 | 3300032168 | Ga0316593_10027136 | Ga0316593_100271362 | 65 |
| 153 | 3300032168 | Ga0316593_10177099 | Ga0316593_101770991 | 65 |
| 154 | 3300033528 | Ga0316588_1128663 | Ga0316588_11286631 | 65 |
| 155 | 3300041458 | Ga0451798_1034020 | Ga0451798_1034020_32_244 | 65 |
| 156 | 3300041491 | Ga0451833_0008883 | Ga0451833_0008883_1261_1473 | 65 |
| 157 | 3300041492 | Ga0451835_0345989 | Ga0451835_0345989_150_362 | 65 |
| 158 | 3300041494 | Ga0451837_1501591 | Ga0451837_1501591_525_737 | 65 |
| 159 | 3300041497 | Ga0451840_06294 | Ga0451840_06294_174_386 | 65 |
| 160 | 3300041498 | Ga0451841_1463338 | Ga0451841_1463338_601_813 | 65 |
| 161 | 3300041501 | Ga0451845_0229210 | Ga0451845_0229210_24_236 | 65 |
| 162 | 3300041502 | Ga0451846_14676 | Ga0451846_14676_425_637 | 65 |
| 163 | 3300041505 | Ga0451849_0473118 | Ga0451849_0473118_1362_1574 | 65 |
| 164 | 3300041506 | Ga0451850_00677 | Ga0451850_00677_221_433 | 65 |
| 165 | 3300041512 | Ga0451853_1240809 | Ga0451853_1240809_3094_3306 | 65 |
| 166 | 3300041916 | Ga0452271_01179 | Ga0452271_01179_474_686 | 65 |
| 167 | 3300002067 | JGI24735J21928_10125450 | JGI24735J21928_101254502 | 66 |
| 168 | 3300002705 | JGI25156J39149_1004445 | JGI25156J39149_10044452 | 66 |
| 169 | 3300002737 | JGI25162J39368_1004805 | JGI25162J39368_10048052 | 66 |
| 170 | 3300002738 | JGI25154J39366_1012161 | JGI25154J39366_10121613 | 66 |
| 171 | 3300002738 | JGI25154J39366_1028219 | JGI25154J39366_10282191 | 66 |
| 172 | 3300002741 | JGI25157J39369_1000172 | JGI25157J39369_10001722 | 66 |
| 173 | 3300002741 | JGI25157J39369_1000651 | JGI25157J39369_100065113 | 66 |
| 174 | 3300002741 | JGI25157J39369_1003545 | JGI25157J39369_10035452 | 66 |
| 175 | 3300002771 | JGI25163J39215_1000867 | JGI25163J39215_10008672 | 66 |
| 176 | 3300002772 | JGI25164J39214_1000263 | JGI25164J39214_10002632 | 66 |
| 177 | 3300002772 | JGI25164J39214_1001469 | JGI25164J39214_10014696 | 66 |
| 178 | 3300003214 | JGI25165J46597_1000473 | JGI25165J46597_10004732 | 66 |
| 179 | 3300003214 | JGI25165J46597_1002594 | JGI25165J46597_10025946 | 66 |
| 180 | 3300003751 | Ga0055538_1003671 | Ga0055538_10036712 | 66 |
| 181 | 3300003752 | Ga0055539_1001567 | Ga0055539_10015672 | 66 |
| 182 | 3300003756 | Ga0055533_1002616 | Ga0055533_10026161 | 66 |
| 183 | 3300003760 | Ga0055527_1000466 | Ga0055527_100046614 | 66 |
| 184 | 3300003760 | Ga0055527_1004919 | Ga0055527_10049192 | 66 |
| 185 | 3300003761 | Ga0055535_1001065 | Ga0055535_10010652 | 66 |
| 186 | 3300003761 | Ga0055535_1001154 | Ga0055535_100115414 | 66 |
| 187 | 3300003761 | Ga0055535_1001333 | Ga0055535_10013331 | 66 |
| 188 | 3300003761 | Ga0055535_1002782 | Ga0055535_10027826 | 66 |
| 189 | 3300003762 | Ga0055542_1000183 | Ga0055542_10001832 | 66 |
| 190 | 3300003762 | Ga0055542_1000423 | Ga0055542_10004232 | 66 |
| 191 | 3300003762 | Ga0055542_1001148 | Ga0055542_100114814 | 66 |
| 192 | 3300003763 | Ga0055529_1000116 | Ga0055529_1000116120 | 66 |
| 193 | 3300003763 | Ga0055529_1000189 | Ga0055529_100018988 | 66 |
| 194 | 3300003763 | Ga0055529_1000934 | Ga0055529_10009342 | 66 |
| 195 | 3300003763 | Ga0055529_1008658 | Ga0055529_10086582 | 66 |
| 196 | 3300003841 | Ga0055541_1026526 | Ga0055541_10265261 | 66 |
| 197 | 3300004803 | Ga0058862_12834623 | Ga0058862_128346232 | 66 |
| 198 | 3300005293 | Ga0065715_10717176 | Ga0065715_107171762 | 66 |
| 199 | 3300005331 | Ga0070670_100815699 | Ga0070670_1008156992 | 66 |
| 200 | 3300005333 | Ga0070677_10014576 | Ga0070677_100145762 | 66 |
| 201 | 3300005336 | Ga0070680_100848346 | Ga0070680_1008483462 | 66 |
| 202 | 3300005337 | Ga0070682_100082465 | Ga0070682_1000824653 | 66 |
| 203 | 3300005337 | Ga0070682_100406135 | Ga0070682_1004061352 | 66 |
| 204 | 3300005339 | Ga0070660_100100092 | Ga0070660_1001000922 | 66 |
| 205 | 3300005339 | Ga0070660_101177686 | Ga0070660_1011776862 | 66 |
| 206 | 3300005340 | Ga0070689_100041539 | Ga0070689_1000415392 | 66 |
| 207 | 3300005341 | Ga0070691_10438235 | Ga0070691_104382351 | 66 |
| 208 | 3300005344 | Ga0070661_100023087 | Ga0070661_1000230874 | 66 |
| 209 | 3300005344 | Ga0070661_100041870 | Ga0070661_1000418704 | 66 |
| 210 | 3300005344 | Ga0070661_101074462 | Ga0070661_1010744621 | 66 |
| 211 | 3300005345 | Ga0070692_10057912 | Ga0070692_100579123 | 66 |
| 212 | 3300005347 | Ga0070668_100679357 | Ga0070668_1006793571 | 66 |
| 213 | 3300005353 | Ga0070669_100048736 | Ga0070669_1000487363 | 66 |
| 214 | 3300005354 | Ga0070675_100893280 | Ga0070675_1008932802 | 66 |
| 215 | 3300005365 | Ga0070688_100107312 | Ga0070688_1001073122 | 66 |
| 216 | 3300005366 | Ga0070659_100492215 | Ga0070659_1004922153 | 66 |
| 217 | 3300005366 | Ga0070659_100953547 | Ga0070659_1009535472 | 66 |
| 218 | 3300005435 | Ga0070714_100000280 | Ga0070714_10000028028 | 66 |
| 219 | 3300005435 | Ga0070714_101306806 | Ga0070714_1013068061 | 66 |
| 220 | 3300005437 | Ga0070710_10094052 | Ga0070710_100940522 | 66 |
| 221 | 3300005439 | Ga0070711_100847153 | Ga0070711_1008471532 | 66 |
| 222 | 3300005441 | Ga0070700_100014142 | Ga0070700_1000141422 | 66 |
| 223 | 3300005444 | Ga0070694_100384741 | Ga0070694_1003847411 | 66 |
| 224 | 3300005445 | Ga0070708_101612759 | Ga0070708_1016127591 | 66 |
| 225 | 3300005455 | Ga0070663_100457914 | Ga0070663_1004579142 | 66 |
| 226 | 3300005457 | Ga0070662_100686337 | Ga0070662_1006863373 | 66 |
| 227 | 3300005458 | Ga0070681_10029162 | Ga0070681_100291624 | 66 |
| 228 | 3300005458 | Ga0070681_10118109 | Ga0070681_101181092 | 66 |
| 229 | 3300005459 | Ga0068867_100973986 | Ga0068867_1009739861 | 66 |
| 230 | 3300005518 | Ga0070699_102026524 | Ga0070699_1020265241 | 66 |
| 231 | 3300005530 | Ga0070679_100132799 | Ga0070679_1001327992 | 66 |
| 232 | 3300005539 | Ga0068853_100692800 | Ga0068853_1006928001 | 66 |
| 233 | 3300005539 | Ga0068853_101968166 | Ga0068853_1019681662 | 66 |
| 234 | 3300005543 | Ga0070672_100474647 | Ga0070672_1004746472 | 66 |
| 235 | 3300005546 | Ga0070696_100002294 | Ga0070696_1000022948 | 66 |
| 236 | 3300005546 | Ga0070696_100143615 | Ga0070696_1001436152 | 66 |
| 237 | 3300005547 | Ga0070693_100052139 | Ga0070693_1000521392 | 66 |
| 238 | 3300005549 | Ga0070704_101727714 | Ga0070704_1017277141 | 66 |
| 239 | 3300005563 | Ga0068855_100062440 | Ga0068855_1000624402 | 66 |
| 240 | 3300005577 | Ga0068857_100135589 | Ga0068857_1001355893 | 66 |
| 241 | 3300005578 | Ga0068854_100042202 | Ga0068854_1000422022 | 66 |
| 242 | 3300005614 | Ga0068856_100025896 | Ga0068856_1000258962 | 66 |
| 243 | 3300005614 | Ga0068856_100102163 | Ga0068856_1001021633 | 66 |
| 244 | 3300005616 | Ga0068852_100403855 | Ga0068852_1004038553 | 66 |
| 245 | 3300005617 | Ga0068859_100047914 | Ga0068859_1000479142 | 66 |
| 246 | 3300005719 | Ga0068861_100217883 | Ga0068861_1002178833 | 66 |
| 247 | 3300005840 | Ga0068870_10588278 | Ga0068870_105882782 | 66 |
| 248 | 3300005841 | Ga0068863_102368474 | Ga0068863_1023684741 | 66 |
| 249 | 3300005844 | Ga0068862_100112276 | Ga0068862_1001122762 | 66 |
| 250 | 3300005844 | Ga0068862_100137988 | Ga0068862_1001379882 | 66 |
| 251 | 3300005844 | Ga0068862_101697625 | Ga0068862_1016976252 | 66 |
| 252 | 3300006175 | Ga0070712_100395387 | Ga0070712_1003953873 | 66 |
| 253 | 3300006846 | Ga0075430_100326959 | Ga0075430_1003269593 | 66 |
| 254 | 3300006881 | Ga0068865_100081125 | Ga0068865_1000811252 | 66 |
| 255 | 3300006931 | Ga0097620_100047914 | Ga0097620_1000479149 | 66 |
| 256 | 3300007265 | Ga0099794_10048122 | Ga0099794_100481222 | 66 |
| 257 | 3300009093 | Ga0105240_12145360 | Ga0105240_121453602 | 66 |
| 258 | 3300009093 | Ga0105240_12244741 | Ga0105240_122447411 | 66 |
| 259 | 3300009148 | Ga0105243_11097375 | Ga0105243_110973752 | 66 |
| 260 | 3300009174 | Ga0105241_10188228 | Ga0105241_101882282 | 66 |
| 261 | 3300009176 | Ga0105242_12749447 | Ga0105242_127494471 | 66 |
| 262 | 3300009545 | Ga0105237_10000150 | Ga0105237_1000015054 | 66 |
| 263 | 3300009545 | Ga0105237_10337726 | Ga0105237_103377262 | 66 |
| 264 | 3300009551 | Ga0105238_10268956 | Ga0105238_102689561 | 66 |
| 265 | 3300009551 | Ga0105238_10281269 | Ga0105238_102812692 | 66 |
| 266 | 3300009551 | Ga0105238_10473491 | Ga0105238_104734911 | 66 |
| 267 | 3300009553 | Ga0105249_10145185 | Ga0105249_101451853 | 66 |
| 268 | 3300009553 | Ga0105249_10656020 | Ga0105249_106560202 | 66 |
| 269 | 3300009553 | Ga0105249_11804265 | Ga0105249_118042651 | 66 |
| 270 | 3300012498 | Ga0157345_1044836 | Ga0157345_10448361 | 66 |
| 271 | 3300013102 | Ga0157371_10481013 | Ga0157371_104810132 | 66 |
| 272 | 3300013104 | Ga0157370_10026079 | Ga0157370_100260792 | 66 |
| 273 | 3300013104 | Ga0157370_10048901 | Ga0157370_100489012 | 66 |
| 274 | 3300013105 | Ga0157369_10457947 | Ga0157369_104579472 | 66 |
| 275 | 3300013105 | Ga0157369_10811291 | Ga0157369_108112912 | 66 |
| 276 | 3300013105 | Ga0157369_12390275 | Ga0157369_123902751 | 66 |
| 277 | 3300013306 | Ga0163162_10859561 | Ga0163162_108595612 | 66 |
| 278 | 3300013306 | Ga0163162_10958359 | Ga0163162_109583591 | 66 |
| 279 | 3300013307 | Ga0157372_10197876 | Ga0157372_101978762 | 66 |
| 280 | 3300013307 | Ga0157372_10242016 | Ga0157372_102420162 | 66 |
| 281 | 3300013307 | Ga0157372_10352792 | Ga0157372_103527922 | 66 |
| 282 | 3300014325 | Ga0163163_11621400 | Ga0163163_116214001 | 66 |
| 283 | 3300014326 | Ga0157380_13314531 | Ga0157380_133145312 | 66 |
| 284 | 3300014497 | Ga0182008_10017135 | Ga0182008_100171351 | 66 |
| 285 | 3300014497 | Ga0182008_10316004 | Ga0182008_103160041 | 66 |
| 286 | 3300014497 | Ga0182008_10991618 | Ga0182008_109916181 | 66 |
| 287 | 3300014969 | Ga0157376_10016137 | Ga0157376_100161372 | 66 |
| 288 | 3300015261 | Ga0182006_1061226 | Ga0182006_10612262 | 66 |
| 289 | 3300015261 | Ga0182006_1073080 | Ga0182006_10730802 | 66 |
| 290 | 3300015262 | Ga0182007_10018362 | Ga0182007_100183625 | 66 |
| 291 | 3300015262 | Ga0182007_10073467 | Ga0182007_100734673 | 66 |
| 292 | 3300015262 | Ga0182007_10136952 | Ga0182007_101369522 | 66 |
| 293 | 3300021441 | Ga0213871_10050786 | Ga0213871_100507862 | 66 |
| 294 | 3300025893 | Ga0207682_10123677 | Ga0207682_101236772 | 66 |
| 295 | 3300025899 | Ga0207642_11035704 | Ga0207642_110357042 | 66 |
| 296 | 3300025907 | Ga0207645_10000555 | Ga0207645_100005552 | 66 |
| 297 | 3300025908 | Ga0207643_10090881 | Ga0207643_100908813 | 66 |
| 298 | 3300025913 | Ga0207695_10155057 | Ga0207695_101550573 | 66 |
| 299 | 3300025917 | Ga0207660_10285568 | Ga0207660_102855682 | 66 |
| 300 | 3300025923 | Ga0207681_10922822 | Ga0207681_109228221 | 66 |
| 301 | 3300025925 | Ga0207650_11595681 | Ga0207650_115956813 | 66 |
| 302 | 3300025926 | Ga0207659_10324316 | Ga0207659_103243163 | 66 |
| 303 | 3300025932 | Ga0207690_10282998 | Ga0207690_102829982 | 66 |
| 304 | 3300025933 | Ga0207706_10040416 | Ga0207706_100404162 | 66 |
| 305 | 3300025937 | Ga0207669_10149595 | Ga0207669_101495952 | 66 |
| 306 | 3300025938 | Ga0207704_10006657 | Ga0207704_100066575 | 66 |
| 307 | 3300025940 | Ga0207691_10000451 | Ga0207691_1000045125 | 66 |
| 308 | 3300025961 | Ga0207712_10091893 | Ga0207712_100918933 | 66 |
| 309 | 3300025961 | Ga0207712_10380477 | Ga0207712_103804772 | 66 |
| 310 | 3300025972 | Ga0207668_10617994 | Ga0207668_106179941 | 66 |
| 311 | 3300026075 | Ga0207708_10177287 | Ga0207708_101772873 | 66 |
| 312 | 3300026089 | Ga0207648_10001019 | Ga0207648_1000101928 | 66 |
| 313 | 3300026089 | Ga0207648_10645583 | Ga0207648_106455832 | 66 |
| 314 | 3300026118 | Ga0207675_100000567 | Ga0207675_1000005674 | 66 |
| 315 | 3300026142 | Ga0207698_12459574 | Ga0207698_124595741 | 66 |
| 316 | 3300027424 | Ga0209984_1022770 | Ga0209984_10227701 | 66 |
| 317 | 3300027462 | Ga0210000_1014842 | Ga0210000_10148422 | 66 |
| 318 | 3300027526 | Ga0209968_1102306 | Ga0209968_11023061 | 66 |
| 319 | 3300027543 | Ga0209999_1062402 | Ga0209999_10624022 | 66 |
| 320 | 3300027552 | Ga0209982_1000529 | Ga0209982_10005295 | 66 |
| 321 | 3300027614 | Ga0209970_1004527 | Ga0209970_10045272 | 66 |
| 322 | 3300027617 | Ga0210002_1016968 | Ga0210002_10169682 | 66 |
| 323 | 3300027665 | Ga0209983_1006005 | Ga0209983_10060052 | 66 |
| 324 | 3300027682 | Ga0209971_1000724 | Ga0209971_100072410 | 66 |
| 325 | 3300027876 | Ga0209974_10001096 | Ga0209974_100010961 | 66 |
| 326 | 3300028380 | Ga0268265_10005940 | Ga0268265_100059408 | 66 |
| 327 | 3300028380 | Ga0268265_11114183 | Ga0268265_111141832 | 66 |
| 328 | 3300030836 | Ga0265767_118865 | Ga0265767_1188651 | 66 |
| 329 | 3300031242 | Ga0265329_10223036 | Ga0265329_102230361 | 66 |
| 330 | 3300031251 | Ga0265327_10002526 | Ga0265327_1000252612 | 66 |
| 331 | 3300031251 | Ga0265327_10002740 | Ga0265327_1000274010 | 66 |
| 332 | 3300031344 | Ga0265316_10002788 | Ga0265316_1000278812 | 66 |
| 333 | 3300031665 | Ga0316575_10076648 | Ga0316575_100766483 | 66 |
| 334 | 3300031691 | Ga0316579_10097391 | Ga0316579_100973912 | 66 |
| 335 | 3300031727 | Ga0316576_10012939 | Ga0316576_100129392 | 66 |
| 336 | 3300031728 | Ga0316578_10079519 | Ga0316578_100795193 | 66 |
| 337 | 3300031733 | Ga0316577_10099242 | Ga0316577_100992423 | 66 |
| 338 | 3300032137 | Ga0316585_10131291 | Ga0316585_101312913 | 66 |
| 339 | 3300032139 | Ga0316580_10055138 | Ga0316580_100551381 | 66 |
| 340 | 3300033528 | Ga0316588_1164854 | Ga0316588_11648542 | 66 |
| 341 | 3300035398 | Ga0316574_0071068 | Ga0316574_0071068_927_1157 | 66 |
| 342 | 3300036647 | Ga0316582_0150277 | Ga0316582_0150277_1058_1288 | 66 |
| 343 | 3300036712 | Ga0316584_0005998 | Ga0316584_0005998_7052_7282 | 66 |
| 344 | 3300039438 | Ga0436360_0392409 | Ga0436360_0392409_1438_1656 | 66 |
| 345 | 3300039453 | Ga0436362_1301351 | Ga0436362_1301351_486_704 | 66 |
| 346 | 3300042461 | Ga0439460_0246194 | Ga0439460_0246194_283_513 | 66 |
| 347 | 3300049460 | Ga0495682_0331662 | Ga0495682_0331662_35_253 | 66 |
| 348 | 3300049569 | Ga0501032_0090020 | Ga0501032_0090020_790_1011 | 66 |
| 349 | 3300049570 | Ga0501033_0054100 | Ga0501033_0054100_1038_1259 | 66 |
| 350 | 3300049571 | Ga0501034_0097084 | Ga0501034_0097084_1712_1933 | 66 |
| 351 | 3300049573 | Ga0501037_0234561 | Ga0501037_0234561_29_250 | 66 |
| 352 | 3300049574 | Ga0501038_0003475 | Ga0501038_0003475_13473_13694 | 66 |
| 353 | 3300049575 | Ga0501039_0071659 | Ga0501039_0071659_1556_1777 | 66 |
| 354 | 3300049579 | Ga0501043_0232800 | Ga0501043_0232800_1012_1233 | 66 |
| 355 | 3300049580 | Ga0501046_0018192 | Ga0501046_0018192_1035_1256 | 66 |
| 356 | 3300049581 | Ga0501047_0120716 | Ga0501047_0120716_1038_1259 | 66 |
| 357 | 3300049584 | Ga0501068_0218363 | Ga0501068_0218363_201_422 | 66 |
| 358 | 3300049585 | Ga0501069_0464032 | Ga0501069_0464032_15_236 | 66 |
| 359 | 3300049586 | Ga0501070_1002660 | Ga0501070_1002660_347_568 | 66 |
| 360 | 3300049587 | Ga0501071_0370558 | Ga0501071_0370558_570_791 | 66 |
| 361 | 3300049589 | Ga0501073_0013869 | Ga0501073_0013869_1039_1260 | 66 |
| 362 | 3300049590 | Ga0501074_0044879 | Ga0501074_0044879_2711_2932 | 66 |
| 363 | 3300049741 | Ga0501079_0480416 | Ga0501079_0480416_407_628 | 66 |
| 364 | 3300049742 | Ga0501080_0166993 | Ga0501080_0166993_791_1012 | 66 |
| 365 | 3300049823 | Ga0501044_0335225 | Ga0501044_0335225_1027_1236 | 66 |
| 366 | 3300050509 | nmdc:mga0qj67_316452_c1 | nmdc:mga0qj67_316452_c1_450_680 | 66 |
| 367 | 3300050510 | nmdc:mga06r32_445017_c1 | nmdc:mga06r32_445017_c1_925_1155 | 66 |
| 368 | 3300053093 | Ga0500651_0002589 | Ga0500651_0002589_4713_4922 | 66 |
| 369 | 3300053146 | Ga0500588_0068160 | Ga0500588_0068160_846_1070 | 66 |
| 370 | 3300005327 | Ga0070658_10233400 | Ga0070658_102334003 | 67 |
| 371 | 3300005329 | Ga0070683_102061891 | Ga0070683_1020618911 | 67 |
| 372 | 3300005330 | Ga0070690_100912466 | Ga0070690_1009124661 | 67 |
| 373 | 3300005335 | Ga0070666_10799671 | Ga0070666_107996712 | 67 |
| 374 | 3300005338 | Ga0068868_101101065 | Ga0068868_1011010652 | 67 |
| 375 | 3300005355 | Ga0070671_100003573 | Ga0070671_1000035732 | 67 |
| 376 | 3300005356 | Ga0070674_100613382 | Ga0070674_1006133822 | 67 |
| 377 | 3300005367 | Ga0070667_100018316 | Ga0070667_1000183163 | 67 |
| 378 | 3300005434 | Ga0070709_10857423 | Ga0070709_108574231 | 67 |
| 379 | 3300005435 | Ga0070714_101245989 | Ga0070714_1012459891 | 67 |
| 380 | 3300005436 | Ga0070713_100017354 | Ga0070713_1000173542 | 67 |
| 381 | 3300005439 | Ga0070711_100026241 | Ga0070711_1000262413 | 67 |
| 382 | 3300005440 | Ga0070705_101558335 | Ga0070705_1015583351 | 67 |
| 383 | 3300005456 | Ga0070678_101004605 | Ga0070678_1010046051 | 67 |
| 384 | 3300005459 | Ga0068867_101453226 | Ga0068867_1014532261 | 67 |
| 385 | 3300005530 | Ga0070679_100507914 | Ga0070679_1005079141 | 67 |
| 386 | 3300005535 | Ga0070684_100093077 | Ga0070684_1000930775 | 67 |
| 387 | 3300005539 | Ga0068853_101325108 | Ga0068853_1013251081 | 67 |
| 388 | 3300005544 | Ga0070686_101387543 | Ga0070686_1013875431 | 67 |
| 389 | 3300005547 | Ga0070693_100586594 | Ga0070693_1005865942 | 67 |
| 390 | 3300005548 | Ga0070665_100108128 | Ga0070665_1001081282 | 67 |
| 391 | 3300005549 | Ga0070704_100652717 | Ga0070704_1006527172 | 67 |
| 392 | 3300005563 | Ga0068855_100752765 | Ga0068855_1007527651 | 67 |
| 393 | 3300005614 | Ga0068856_100075332 | Ga0068856_1000753323 | 67 |
| 394 | 3300005718 | Ga0068866_10756460 | Ga0068866_107564601 | 67 |
| 395 | 3300005718 | Ga0068866_10946064 | Ga0068866_109460642 | 67 |
| 396 | 3300005841 | Ga0068863_100082402 | Ga0068863_1000824023 | 67 |
| 397 | 3300005842 | Ga0068858_100732637 | Ga0068858_1007326372 | 67 |
| 398 | 3300005843 | Ga0068860_100023471 | Ga0068860_1000234714 | 67 |
| 399 | 3300006163 | Ga0070715_10992291 | Ga0070715_109922911 | 67 |
| 400 | 3300006173 | Ga0070716_100191688 | Ga0070716_1001916882 | 67 |
| 401 | 3300006175 | Ga0070712_100002924 | Ga0070712_1000029241 | 67 |
| 402 | 3300006237 | Ga0097621_100043536 | Ga0097621_1000435362 | 67 |
| 403 | 3300006358 | Ga0068871_100011168 | Ga0068871_1000111681 | 67 |
| 404 | 3300006881 | Ga0068865_100009644 | Ga0068865_1000096443 | 67 |
| 405 | 3300009098 | Ga0105245_11655722 | Ga0105245_116557222 | 67 |
| 406 | 3300009101 | Ga0105247_10106647 | Ga0105247_101066471 | 67 |
| 407 | 3300009174 | Ga0105241_10245553 | Ga0105241_102455532 | 67 |
| 408 | 3300009176 | Ga0105242_10008331 | Ga0105242_100083312 | 67 |
| 409 | 3300009177 | Ga0105248_10112024 | Ga0105248_101120243 | 67 |
| 410 | 3300009545 | Ga0105237_10054148 | Ga0105237_100541482 | 67 |
| 411 | 3300009553 | Ga0105249_10575293 | Ga0105249_105752932 | 67 |
| 412 | 3300009993 | Ga0105028_112468 | Ga0105028_1124681 | 67 |
| 413 | 3300010375 | Ga0105239_11234746 | Ga0105239_112347462 | 67 |
| 414 | 3300013296 | Ga0157374_11180576 | Ga0157374_111805762 | 67 |
| 415 | 3300013297 | Ga0157378_10065280 | Ga0157378_100652803 | 67 |
| 416 | 3300014325 | Ga0163163_10157504 | Ga0163163_101575042 | 67 |
| 417 | 3300014326 | Ga0157380_10438919 | Ga0157380_104389193 | 67 |
| 418 | 3300014969 | Ga0157376_10534533 | Ga0157376_105345331 | 67 |
| 419 | 3300025898 | Ga0207692_10000125 | Ga0207692_1000012517 | 67 |
| 420 | 3300025899 | Ga0207642_10126051 | Ga0207642_101260511 | 67 |
| 421 | 3300025899 | Ga0207642_11046422 | Ga0207642_110464222 | 67 |
| 422 | 3300025900 | Ga0207710_10179411 | Ga0207710_101794112 | 67 |
| 423 | 3300025903 | Ga0207680_10765444 | Ga0207680_107654441 | 67 |
| 424 | 3300025905 | Ga0207685_10520394 | Ga0207685_105203942 | 67 |
| 425 | 3300025906 | Ga0207699_10478965 | Ga0207699_104789651 | 67 |
| 426 | 3300025911 | Ga0207654_10938105 | Ga0207654_109381052 | 67 |
| 427 | 3300025913 | Ga0207695_10053030 | Ga0207695_100530304 | 67 |
| 428 | 3300025914 | Ga0207671_11227308 | Ga0207671_112273081 | 67 |
| 429 | 3300025915 | Ga0207693_10001835 | Ga0207693_1000183511 | 67 |
| 430 | 3300025916 | Ga0207663_10294265 | Ga0207663_102942652 | 67 |
| 431 | 3300025921 | Ga0207652_10147104 | Ga0207652_101471043 | 67 |
| 432 | 3300025928 | Ga0207700_10039076 | Ga0207700_100390763 | 67 |
| 433 | 3300025929 | Ga0207664_11386363 | Ga0207664_113863631 | 67 |
| 434 | 3300025931 | Ga0207644_10117210 | Ga0207644_101172102 | 67 |
| 435 | 3300025934 | Ga0207686_10048381 | Ga0207686_100483812 | 67 |
| 436 | 3300025937 | Ga0207669_10808692 | Ga0207669_108086921 | 67 |
| 437 | 3300025938 | Ga0207704_10425885 | Ga0207704_104258852 | 67 |
| 438 | 3300025939 | Ga0207665_10003234 | Ga0207665_100032341 | 67 |
| 439 | 3300025941 | Ga0207711_10482024 | Ga0207711_104820242 | 67 |
| 440 | 3300025944 | Ga0207661_11846301 | Ga0207661_118463011 | 67 |
| 441 | 3300025945 | Ga0207679_10958029 | Ga0207679_109580292 | 67 |
| 442 | 3300025949 | Ga0207667_10576203 | Ga0207667_105762031 | 67 |
| 443 | 3300025960 | Ga0207651_10038543 | Ga0207651_100385432 | 67 |
| 444 | 3300025986 | Ga0207658_11272593 | Ga0207658_112725931 | 67 |
| 445 | 3300026023 | Ga0207677_10747923 | Ga0207677_107479231 | 67 |
| 446 | 3300026035 | Ga0207703_11551532 | Ga0207703_115515322 | 67 |
| 447 | 3300026041 | Ga0207639_11239388 | Ga0207639_112393882 | 67 |
| 448 | 3300026078 | Ga0207702_10038359 | Ga0207702_100383594 | 67 |
| 449 | 3300026088 | Ga0207641_10396615 | Ga0207641_103966152 | 67 |
| 450 | 3300026121 | Ga0207683_10042859 | Ga0207683_100428591 | 67 |
| 451 | 3300028379 | Ga0268266_10340617 | Ga0268266_103406172 | 67 |
| 452 | 3300028381 | Ga0268264_11001677 | Ga0268264_110016771 | 67 |
| 453 | 3300031247 | Ga0265340_10147244 | Ga0265340_101472442 | 67 |
| 454 | 3300031903 | Ga0307407_10358456 | Ga0307407_103584562 | 67 |
| 455 | 3300032004 | Ga0307414_11590771 | Ga0307414_115907711 | 67 |
| 456 | 3300032005 | Ga0307411_10740166 | Ga0307411_107401661 | 67 |
| 457 | 3300035086 | Ga0373934_0252923 | Ga0373934_0252923_370_588 | 67 |
| 458 | 3300035111 | Ga0373923_0053484 | Ga0373923_0053484_1284_1502 | 67 |
| 459 | 3300035119 | Ga0373956_0354586 | Ga0373956_0354586_52_270 | 67 |
| 460 | 3300035170 | Ga0373943_0037529 | Ga0373943_0037529_1264_1482 | 67 |
| 461 | 3300035170 | Ga0373943_0407042 | Ga0373943_0407042_381_590 | 67 |
| 462 | 3300035724 | Ga0373933_0110033 | Ga0373933_0110033_720_938 | 67 |
| 463 | 3300036401 | Ga0373937_0755674 | Ga0373937_0755674_287_505 | 67 |
| 464 | 3300037068 | Ga0373925_0240568 | Ga0373925_0240568_1022_1240 | 67 |
| 465 | 3300037068 | Ga0373925_0511731 | Ga0373925_0511731_371_580 | 67 |
| 466 | 3300039450 | Ga0436363_1573750 | Ga0436363_1573750_179_397 | 67 |
| 467 | 3300046459 | Ga0495629_0645374 | Ga0495629_0645374_36_254 | 67 |
| 468 | 3300046472 | Ga0495580_0013106 | Ga0495580_0013106_6092_6310 | 67 |
| 469 | 3300046499 | Ga0495594_0645404 | Ga0495594_0645404_220_435 | 67 |
| 470 | 3300046511 | Ga0495608_0523263 | Ga0495608_0523263_367_585 | 67 |
| 471 | 3300046514 | Ga0495618_0228168 | Ga0495618_0228168_931_1149 | 67 |
| 472 | 3300046516 | Ga0495628_0581050 | Ga0495628_0581050_372_581 | 67 |
| 473 | 3300046517 | Ga0495630_0152932 | Ga0495630_0152932_1204_1413 | 67 |
| 474 | 3300046517 | Ga0495630_0165482 | Ga0495630_0165482_506_724 | 67 |
| 475 | 3300046533 | Ga0495640_0266487 | Ga0495640_0266487_697_912 | 67 |
| 476 | 3300046533 | Ga0495640_0432619 | Ga0495640_0432619_91_309 | 67 |
| 477 | 3300046536 | Ga0495587_0349952 | Ga0495587_0349952_513_731 | 67 |
| 478 | 3300046678 | Ga0495599_0317553 | Ga0495599_0317553_588_806 | 67 |
| 479 | 3300048903 | Ga0496100_0033871 | Ga0496100_0033871_2032_2250 | 67 |
| 480 | 3300048904 | Ga0496101_0010790 | Ga0496101_0010790_2893_3111 | 67 |
| 481 | 3300048905 | Ga0496102_0545215 | Ga0496102_0545215_374_592 | 67 |
| 482 | 3300048906 | Ga0496103_0328727 | Ga0496103_0328727_642_860 | 67 |
| 483 | 3300048907 | Ga0496104_0223667 | Ga0496104_0223667_1529_1747 | 67 |
| 484 | 3300048908 | Ga0496105_0424344 | Ga0496105_0424344_634_852 | 67 |
| 485 | 3300048909 | Ga0496106_0757912 | Ga0496106_0757912_464_682 | 67 |
| 486 | 3300048910 | Ga0496107_0085865 | Ga0496107_0085865_1319_1537 | 67 |
| 487 | 3300048911 | Ga0496108_0681238 | Ga0496108_0681238_642_860 | 67 |
| 488 | 3300048912 | Ga0496109_0109550 | Ga0496109_0109550_974_1192 | 67 |
| 489 | 3300048913 | Ga0496110_1042907 | Ga0496110_1042907_77_295 | 67 |
| 490 | 3300048914 | Ga0496111_0037235 | Ga0496111_0037235_1824_2042 | 67 |
| 491 | 3300048916 | Ga0496113_0104392 | Ga0496113_0104392_1907_2125 | 67 |
| 492 | 3300048917 | Ga0496114_0506744 | Ga0496114_0506744_295_513 | 67 |
| 493 | 3300048918 | Ga0496115_0035264 | Ga0496115_0035264_1319_1537 | 67 |
| 494 | 3300049570 | Ga0501033_0467696 | Ga0501033_0467696_486_710 | 67 |
| 495 | 3300049571 | Ga0501034_1273316 | Ga0501034_1273316_262_486 | 67 |
| 496 | 3300049572 | Ga0501036_1213302 | Ga0501036_1213302_150_374 | 67 |
| 497 | 3300049573 | Ga0501037_0143613 | Ga0501037_0143613_250_474 | 67 |
| 498 | 3300049574 | Ga0501038_0870035 | Ga0501038_0870035_165_389 | 67 |
| 499 | 3300049575 | Ga0501039_1172331 | Ga0501039_1172331_115_339 | 67 |
| 500 | 3300049576 | Ga0501040_0156528 | Ga0501040_0156528_1331_1555 | 67 |
| 501 | 3300049579 | Ga0501043_1154002 | Ga0501043_1154002_290_514 | 67 |
| 502 | 3300049581 | Ga0501047_1051297 | Ga0501047_1051297_239_463 | 67 |
| 503 | 3300049584 | Ga0501068_1052655 | Ga0501068_1052655_272_496 | 67 |
| 504 | 3300049589 | Ga0501073_0423152 | Ga0501073_0423152_561_785 | 67 |
| 505 | 3300049590 | Ga0501074_0163833 | Ga0501074_0163833_1241_1465 | 67 |
| 506 | 3300049593 | Ga0501077_0502197 | Ga0501077_0502197_271_495 | 67 |
| 507 | 3300049742 | Ga0501080_0707023 | Ga0501080_0707023_500_724 | 67 |
| 508 | 3300049743 | Ga0501081_0691398 | Ga0501081_0691398_151_375 | 67 |
| 509 | 3300049823 | Ga0501044_0042994 | Ga0501044_0042994_3886_4110 | 67 |
| 510 | 3300049824 | Ga0501045_1246325 | Ga0501045_1246325_44_268 | 67 |
| 511 | 3300053078 | Ga0495612_0174705 | Ga0495612_0174705_57_275 | 67 |
| 512 | 3300053084 | Ga0495595_0130967 | Ga0495595_0130967_877_1095 | 67 |
| 513 | 3300053085 | Ga0495619_0315727 | Ga0495619_0315727_771_989 | 67 |
| 514 | 3300061734 | Ga0530510_0114701 | Ga0530510_0114701_294_518 | 67 |
| 515 | 3300004800 | Ga0058861_11990870 | Ga0058861_119908702 | 68 |
| 516 | 3300004803 | Ga0058862_12768923 | Ga0058862_127689231 | 68 |
| 517 | 3300005290 | Ga0065712_10790436 | Ga0065712_107904361 | 68 |
| 518 | 3300005293 | Ga0065715_10368505 | Ga0065715_103685052 | 68 |
| 519 | 3300005329 | Ga0070683_100038381 | Ga0070683_1000383814 | 68 |
| 520 | 3300005330 | Ga0070690_100523436 | Ga0070690_1005234363 | 68 |
| 521 | 3300005334 | Ga0068869_101096866 | Ga0068869_1010968661 | 68 |
| 522 | 3300005336 | Ga0070680_100033389 | Ga0070680_1000333895 | 68 |
| 523 | 3300005347 | Ga0070668_101466779 | Ga0070668_1014667792 | 68 |
| 524 | 3300005353 | Ga0070669_100134768 | Ga0070669_1001347682 | 68 |
| 525 | 3300005367 | Ga0070667_100566795 | Ga0070667_1005667952 | 68 |
| 526 | 3300005455 | Ga0070663_102096731 | Ga0070663_1020967311 | 68 |
| 527 | 3300005458 | Ga0070681_10089340 | Ga0070681_100893402 | 68 |
| 528 | 3300005530 | Ga0070679_100087757 | Ga0070679_1000877572 | 68 |
| 529 | 3300005535 | Ga0070684_100130862 | Ga0070684_1001308622 | 68 |
| 530 | 3300005548 | Ga0070665_100665120 | Ga0070665_1006651202 | 68 |
| 531 | 3300005548 | Ga0070665_100869596 | Ga0070665_1008695962 | 68 |
| 532 | 3300005563 | Ga0068855_100920244 | Ga0068855_1009202441 | 68 |
| 533 | 3300005564 | Ga0070664_100609626 | Ga0070664_1006096262 | 68 |
| 534 | 3300005614 | Ga0068856_101270568 | Ga0068856_1012705682 | 68 |
| 535 | 3300005617 | Ga0068859_100154876 | Ga0068859_1001548762 | 68 |
| 536 | 3300005617 | Ga0068859_101632010 | Ga0068859_1016320102 | 68 |
| 537 | 3300005618 | Ga0068864_100141471 | Ga0068864_1001414713 | 68 |
| 538 | 3300005840 | Ga0068870_10505628 | Ga0068870_105056282 | 68 |
| 539 | 3300005841 | Ga0068863_100097204 | Ga0068863_1000972046 | 68 |
| 540 | 3300005842 | Ga0068858_100710801 | Ga0068858_1007108012 | 68 |
| 541 | 3300005843 | Ga0068860_100323918 | Ga0068860_1003239183 | 68 |
| 542 | 3300005844 | Ga0068862_100254427 | Ga0068862_1002544272 | 68 |
| 543 | 3300006237 | Ga0097621_101263566 | Ga0097621_1012635663 | 68 |
| 544 | 3300006237 | Ga0097621_101781540 | Ga0097621_1017815402 | 68 |
| 545 | 3300006358 | Ga0068871_101745633 | Ga0068871_1017456332 | 68 |
| 546 | 3300006931 | Ga0097620_100154871 | Ga0097620_1001548713 | 68 |
| 547 | 3300006931 | Ga0097620_101632146 | Ga0097620_1016321462 | 68 |
| 548 | 3300009093 | Ga0105240_11536783 | Ga0105240_115367831 | 68 |
| 549 | 3300009094 | Ga0111539_11391212 | Ga0111539_113912121 | 68 |
| 550 | 3300009101 | Ga0105247_10482083 | Ga0105247_104820833 | 68 |
| 551 | 3300009177 | Ga0105248_10482422 | Ga0105248_104824223 | 68 |
| 552 | 3300009553 | Ga0105249_10290326 | Ga0105249_102903262 | 68 |
| 553 | 3300013306 | Ga0163162_10964801 | Ga0163162_109648012 | 68 |
| 554 | 3300013307 | Ga0157372_11919382 | Ga0157372_119193821 | 68 |
| 555 | 3300013308 | Ga0157375_10809396 | Ga0157375_108093962 | 68 |
| 556 | 3300014325 | Ga0163163_12933764 | Ga0163163_129337641 | 68 |
| 557 | 3300014968 | Ga0157379_10168233 | Ga0157379_101682332 | 68 |
| 558 | 3300020078 | Ga0206352_10757564 | Ga0206352_107575642 | 68 |
| 559 | 3300020081 | Ga0206354_10905968 | Ga0206354_109059682 | 68 |
| 560 | 3300020081 | Ga0206354_11701467 | Ga0206354_117014671 | 68 |
| 561 | 3300025908 | Ga0207643_10616609 | Ga0207643_106166092 | 68 |
| 562 | 3300025912 | Ga0207707_10636264 | Ga0207707_106362642 | 68 |
| 563 | 3300025913 | Ga0207695_11144711 | Ga0207695_111447111 | 68 |
| 564 | 3300025917 | Ga0207660_10026252 | Ga0207660_100262522 | 68 |
| 565 | 3300025921 | Ga0207652_10383822 | Ga0207652_103838222 | 68 |
| 566 | 3300025923 | Ga0207681_10395464 | Ga0207681_103954642 | 68 |
| 567 | 3300025924 | Ga0207694_10422907 | Ga0207694_104229072 | 68 |
| 568 | 3300025944 | Ga0207661_10229631 | Ga0207661_102296311 | 68 |
| 569 | 3300025961 | Ga0207712_10163995 | Ga0207712_101639952 | 68 |
| 570 | 3300025986 | Ga0207658_10289969 | Ga0207658_102899692 | 68 |
| 571 | 3300026035 | Ga0207703_10461713 | Ga0207703_104617133 | 68 |
| 572 | 3300026078 | Ga0207702_12060711 | Ga0207702_120607112 | 68 |
| 573 | 3300026088 | Ga0207641_10397575 | Ga0207641_103975753 | 68 |
| 574 | 3300026095 | Ga0207676_10079761 | Ga0207676_100797612 | 68 |
| 575 | 3300026116 | Ga0207674_11275510 | Ga0207674_112755102 | 68 |
| 576 | 3300026121 | Ga0207683_11596863 | Ga0207683_115968632 | 68 |
| 577 | 3300028379 | Ga0268266_10585406 | Ga0268266_105854062 | 68 |
| 578 | 3300028379 | Ga0268266_11924877 | Ga0268266_119248772 | 68 |
| 579 | 3300028381 | Ga0268264_10337994 | Ga0268264_103379943 | 68 |
| 580 | 3300035242 | Ga0373962_0368395 | Ga0373962_0368395_168_401 | 68 |
| 581 | 3300041443 | Ga0451789_0353459 | Ga0451789_0353459_41_271 | 68 |
| 582 | 3300041452 | Ga0451793_1825493 | Ga0451793_1825493_442_657 | 68 |
| 583 | 3300041459 | Ga0451800_1214791 | Ga0451800_1214791_220_435 | 68 |
| 584 | 3300041494 | Ga0451837_0983837 | Ga0451837_0983837_195_425 | 68 |
| 585 | 3300044658 | Ga0466972_0008680 | Ga0466972_0008680_227_442 | 68 |
| 586 | 3300044673 | Ga0453683_0304485 | Ga0453683_0304485_292_510 | 68 |
| 587 | 3300044712 | Ga0453684_0686722 | Ga0453684_0686722_636_854 | 68 |
| 588 | 3300044765 | Ga0466970_0009577 | Ga0466970_0009577_260_475 | 68 |
| 589 | 3300049569 | Ga0501032_0766765 | Ga0501032_0766765_184_411 | 68 |
| 590 | 3300049589 | Ga0501073_0149688 | Ga0501073_0149688_1349_1576 | 68 |
| 591 | 3300053079 | Ga0500610_0005232 | Ga0500610_0005232_4735_4950 | 68 |
| 592 | 3300053080 | Ga0500635_0363587 | Ga0500635_0363587_130_351 | 68 |
| 593 | 3300060353 | Ga0501082_0032648 | Ga0501082_0032648_4060_4287 | 68 |
| 594 | 3300005327 | Ga0070658_10371490 | Ga0070658_103714902 | 69 |
| 595 | 3300005329 | Ga0070683_100278724 | Ga0070683_1002787241 | 69 |
| 596 | 3300005334 | Ga0068869_100773220 | Ga0068869_1007732202 | 69 |
| 597 | 3300005337 | Ga0070682_100599573 | Ga0070682_1005995731 | 69 |
| 598 | 3300005458 | Ga0070681_10013793 | Ga0070681_100137932 | 69 |
| 599 | 3300005530 | Ga0070679_100066525 | Ga0070679_1000665251 | 69 |
| 600 | 3300005535 | Ga0070684_100462925 | Ga0070684_1004629252 | 69 |
| 601 | 3300005577 | Ga0068857_100267439 | Ga0068857_1002674394 | 69 |
| 602 | 3300005617 | Ga0068859_100182278 | Ga0068859_1001822782 | 69 |
| 603 | 3300005843 | Ga0068860_100293341 | Ga0068860_1002933411 | 69 |
| 604 | 3300005844 | Ga0068862_100952405 | Ga0068862_1009524052 | 69 |
| 605 | 3300005937 | Ga0081455_10197634 | Ga0081455_101976341 | 69 |
| 606 | 3300006237 | Ga0097621_101083551 | Ga0097621_1010835512 | 69 |
| 607 | 3300006844 | Ga0075428_100342577 | Ga0075428_1003425771 | 69 |
| 608 | 3300006880 | Ga0075429_101887869 | Ga0075429_1018878691 | 69 |
| 609 | 3300006881 | Ga0068865_101543814 | Ga0068865_1015438141 | 69 |
| 610 | 3300006931 | Ga0097620_100182291 | Ga0097620_1001822913 | 69 |
| 611 | 3300009094 | Ga0111539_10224808 | Ga0111539_102248082 | 69 |
| 612 | 3300009094 | Ga0111539_12557405 | Ga0111539_125574051 | 69 |
| 613 | 3300009098 | Ga0105245_11465095 | Ga0105245_114650951 | 69 |
| 614 | 3300009551 | Ga0105238_10026562 | Ga0105238_100265623 | 69 |
| 615 | 3300009551 | Ga0105238_10031268 | Ga0105238_100312686 | 69 |
| 616 | 3300009553 | Ga0105249_10622523 | Ga0105249_106225232 | 69 |
| 617 | 3300011119 | Ga0105246_10936873 | Ga0105246_109368731 | 69 |
| 618 | 3300013297 | Ga0157378_11691481 | Ga0157378_116914811 | 69 |
| 619 | 3300013307 | Ga0157372_11369270 | Ga0157372_113692702 | 69 |
| 620 | 3300014325 | Ga0163163_11269127 | Ga0163163_112691272 | 69 |
| 621 | 3300014326 | Ga0157380_12049723 | Ga0157380_120497232 | 69 |
| 622 | 3300025909 | Ga0207705_10957669 | Ga0207705_109576691 | 69 |
| 623 | 3300025912 | Ga0207707_10071975 | Ga0207707_100719753 | 69 |
| 624 | 3300025921 | Ga0207652_10129603 | Ga0207652_101296032 | 69 |
| 625 | 3300025924 | Ga0207694_10067519 | Ga0207694_100675193 | 69 |
| 626 | 3300025924 | Ga0207694_10160867 | Ga0207694_101608672 | 69 |
| 627 | 3300025942 | Ga0207689_10173787 | Ga0207689_101737872 | 69 |
| 628 | 3300025944 | Ga0207661_10264444 | Ga0207661_102644442 | 69 |
| 629 | 3300025961 | Ga0207712_11020633 | Ga0207712_110206331 | 69 |
| 630 | 3300026035 | Ga0207703_12327105 | Ga0207703_123271051 | 69 |
| 631 | 3300026116 | Ga0207674_10368667 | Ga0207674_103686672 | 69 |
| 632 | 3300028380 | Ga0268265_11215964 | Ga0268265_112159642 | 69 |
| 633 | 3300028380 | Ga0268265_12654387 | Ga0268265_126543871 | 69 |
| 634 | 3300028381 | Ga0268264_10420619 | Ga0268264_104206192 | 69 |
| 635 | 3300031665 | Ga0316575_10017077 | Ga0316575_100170773 | 69 |
| 636 | 3300031665 | Ga0316575_10232995 | Ga0316575_102329952 | 69 |
| 637 | 3300031691 | Ga0316579_10162932 | Ga0316579_101629322 | 69 |
| 638 | 3300031691 | Ga0316579_10166584 | Ga0316579_101665842 | 69 |
| 639 | 3300031727 | Ga0316576_10085784 | Ga0316576_100857843 | 69 |
| 640 | 3300031727 | Ga0316576_10348838 | Ga0316576_103488381 | 69 |
| 641 | 3300031728 | Ga0316578_10096971 | Ga0316578_100969711 | 69 |
| 642 | 3300031728 | Ga0316578_10213578 | Ga0316578_102135782 | 69 |
| 643 | 3300031733 | Ga0316577_10324844 | Ga0316577_103248441 | 69 |
| 644 | 3300031733 | Ga0316577_10337157 | Ga0316577_103371571 | 69 |
| 645 | 3300031995 | Ga0307409_100623260 | Ga0307409_1006232602 | 69 |
| 646 | 3300032133 | Ga0316583_10038324 | Ga0316583_100383243 | 69 |
| 647 | 3300032133 | Ga0316583_10051875 | Ga0316583_100518752 | 69 |
| 648 | 3300032137 | Ga0316585_10049331 | Ga0316585_100493311 | 69 |
| 649 | 3300032137 | Ga0316585_10063620 | Ga0316585_100636202 | 69 |
| 650 | 3300032139 | Ga0316580_10077031 | Ga0316580_100770312 | 69 |
| 651 | 3300032168 | Ga0316593_10017462 | Ga0316593_100174623 | 69 |
| 652 | 3300033524 | Ga0316592_1029193 | Ga0316592_10291931 | 69 |
| 653 | 3300033529 | Ga0316587_1008159 | Ga0316587_10081592 | 69 |
| 654 | 3300033529 | Ga0316587_1035107 | Ga0316587_10351072 | 69 |
| 655 | 3300033541 | Ga0316596_1019526 | Ga0316596_10195262 | 69 |
| 656 | 3300033541 | Ga0316596_1019631 | Ga0316596_10196311 | 69 |
| 657 | 3300035398 | Ga0316574_0252151 | Ga0316574_0252151_494_709 | 69 |
| 658 | 3300035692 | Ga0373935_1351796 | Ga0373935_1351796_146_364 | 69 |
| 659 | 3300036647 | Ga0316582_0056601 | Ga0316582_0056601_1645_1860 | 69 |
| 660 | 3300037068 | Ga0373925_0434199 | Ga0373925_0434199_374_592 | 69 |
| 661 | 3300039450 | Ga0436363_0456827 | Ga0436363_0456827_1960_2193 | 69 |
| 662 | 3300041486 | Ga0451807_2215334 | Ga0451807_2215334_240_461 | 69 |
| 663 | 3300046471 | Ga0495650_0170507 | Ga0495650_0170507_56_277 | 69 |
| 664 | 3300046692 | Ga0495671_0016881 | Ga0495671_0016881_3431_3661 | 69 |
| 665 | 3300049460 | Ga0495682_0162651 | Ga0495682_0162651_206_427 | 69 |
| 666 | 3300049661 | Ga0501217_170714 | Ga0501217_170714_280_510 | 69 |
| 667 | 3300050511 | nmdc:mga08y16_298050_c1 | nmdc:mga08y16_298050_c1_905_1120 | 69 |
| 668 | 3300053093 | Ga0500651_0266889 | Ga0500651_0266889_360_581 | 69 |
| 669 | 3300053096 | Ga0500641_0008120 | Ga0500641_0008120_2896_3123 | 69 |
| 670 | 3300053096 | Ga0500641_0163066 | Ga0500641_0163066_329_550 | 69 |
| 671 | 3300053108 | Ga0500562_173204 | Ga0500562_173204_338_565 | 69 |
| 672 | 3300053134 | Ga0500658_0343158 | Ga0500658_0343158_291_518 | 69 |
| 673 | 3300053139 | Ga0500568_0338070 | Ga0500568_0338070_149_370 | 69 |
| 674 | 3300053149 | Ga0500600_0247094 | Ga0500600_0247094_136_357 | 69 |
| 675 | 3300059513 | Ga0587094_030746 | Ga0587094_030746_487_705 | 69 |
| 676 | 3300004799 | Ga0058863_11947076 | Ga0058863_119470762 | 70 |
| 677 | 3300004803 | Ga0058862_12892832 | Ga0058862_128928322 | 70 |
| 678 | 3300005329 | Ga0070683_100071576 | Ga0070683_1000715762 | 70 |
| 679 | 3300005335 | Ga0070666_10866891 | Ga0070666_108668911 | 70 |
| 680 | 3300005336 | Ga0070680_100906673 | Ga0070680_1009066732 | 70 |
| 681 | 3300005338 | Ga0068868_101964569 | Ga0068868_1019645692 | 70 |
| 682 | 3300005458 | Ga0070681_10017187 | Ga0070681_100171872 | 70 |
| 683 | 3300005471 | Ga0070698_100015662 | Ga0070698_1000156625 | 70 |
| 684 | 3300005535 | Ga0070684_100133152 | Ga0070684_1001331524 | 70 |
| 685 | 3300005615 | Ga0070702_101814944 | Ga0070702_1018149442 | 70 |
| 686 | 3300005843 | Ga0068860_101646832 | Ga0068860_1016468322 | 70 |
| 687 | 3300009093 | Ga0105240_10134320 | Ga0105240_101343202 | 70 |
| 688 | 3300009177 | Ga0105248_10009477 | Ga0105248_100094772 | 70 |
| 689 | 3300009551 | Ga0105238_11466690 | Ga0105238_114666901 | 70 |
| 690 | 3300020075 | Ga0206349_1264899 | Ga0206349_12648992 | 70 |
| 691 | 3300020076 | Ga0206355_1201516 | Ga0206355_12015161 | 70 |
| 692 | 3300020078 | Ga0206352_10282496 | Ga0206352_102824962 | 70 |
| 693 | 3300025912 | Ga0207707_10302818 | Ga0207707_103028182 | 70 |
| 694 | 3300025913 | Ga0207695_10551647 | Ga0207695_105516472 | 70 |
| 695 | 3300025914 | Ga0207671_10985260 | Ga0207671_109852601 | 70 |
| 696 | 3300025914 | Ga0207671_11518430 | Ga0207671_115184302 | 70 |
| 697 | 3300025917 | Ga0207660_10030564 | Ga0207660_100305643 | 70 |
| 698 | 3300025928 | Ga0207700_10913624 | Ga0207700_109136242 | 70 |
| 699 | 3300025937 | Ga0207669_10450139 | Ga0207669_104501392 | 70 |
| 700 | 3300025941 | Ga0207711_10003851 | Ga0207711_100038513 | 70 |
| 701 | 3300025944 | Ga0207661_10049975 | Ga0207661_100499752 | 70 |
| 702 | 3300025986 | Ga0207658_11017594 | Ga0207658_110175941 | 70 |
| 703 | 3300026088 | Ga0207641_11493250 | Ga0207641_114932501 | 70 |
| 704 | 3300028379 | Ga0268266_12036382 | Ga0268266_120363822 | 70 |
| 705 | 3300031733 | Ga0316577_10473147 | Ga0316577_104731471 | 70 |
| 706 | 3300032133 | Ga0316583_10075632 | Ga0316583_100756322 | 70 |
| 707 | 3300032137 | Ga0316585_10034979 | Ga0316585_100349792 | 70 |
| 708 | 3300032168 | Ga0316593_10024372 | Ga0316593_100243722 | 70 |
| 709 | 3300032168 | Ga0316593_10117978 | Ga0316593_101179781 | 70 |
| 710 | 3300032168 | Ga0316593_10187060 | Ga0316593_101870602 | 70 |
| 711 | 3300032168 | Ga0316593_10238403 | Ga0316593_102384031 | 70 |
| 712 | 3300032168 | Ga0316593_10251950 | Ga0316593_102519501 | 70 |
| 713 | 3300032168 | Ga0316593_10447255 | Ga0316593_104472551 | 70 |
| 714 | 3300033524 | Ga0316592_1016984 | Ga0316592_10169843 | 70 |
| 715 | 3300033527 | Ga0316586_1075792 | Ga0316586_10757921 | 70 |
| 716 | 3300033528 | Ga0316588_1049815 | Ga0316588_10498152 | 70 |
| 717 | 3300033529 | Ga0316587_1077861 | Ga0316587_10778611 | 70 |
| 718 | 3300033541 | Ga0316596_1029183 | Ga0316596_10291831 | 70 |
| 719 | 3300033541 | Ga0316596_1202117 | Ga0316596_12021171 | 70 |
| 720 | 3300035398 | Ga0316574_0557954 | Ga0316574_0557954_378_596 | 70 |
| 721 | 3300036647 | Ga0316582_0016884 | Ga0316582_0016884_1124_1342 | 70 |
| 722 | 3300036712 | Ga0316584_0010426 | Ga0316584_0010426_3089_3307 | 70 |
| 723 | 3300053088 | Ga0500644_0431516 | Ga0500644_0431516_152_382 | 70 |
| 724 | 3300053090 | Ga0500646_0090643 | Ga0500646_0090643_96_326 | 70 |
| 725 | 3300053093 | Ga0500651_0137464 | Ga0500651_0137464_379_609 | 70 |
| 726 | 3300053119 | Ga0500595_168295 | Ga0500595_168295_51_272 | 70 |
| 727 | 3300053131 | Ga0500652_050386 | Ga0500652_050386_691_921 | 70 |
| 728 | 3300053139 | Ga0500568_0158097 | Ga0500568_0158097_244_474 | 70 |
| 729 | 3300053156 | Ga0500622_0018332 | Ga0500622_0018332_1779_2009 | 70 |
| 730 | 3300053178 | Ga0500637_0092901 | Ga0500637_0092901_515_736 | 70 |
| 731 | 3300053727 | Ga0500611_048514 | Ga0500611_048514_700_930 | 70 |
| 732 | 3300005458 | Ga0070681_10012205 | Ga0070681_1001220510 | 71 |
| 733 | 3300005617 | Ga0068859_100873847 | Ga0068859_1008738471 | 71 |
| 734 | 3300006931 | Ga0097620_100873867 | Ga0097620_1008738671 | 71 |
| 735 | 3300025912 | Ga0207707_10033237 | Ga0207707_100332376 | 71 |
| 736 | 3300032133 | Ga0316583_10200719 | Ga0316583_102007192 | 71 |
| 737 | 3300032168 | Ga0316593_10361588 | Ga0316593_103615881 | 71 |
| 738 | 3300039437 | Ga0436365_0411158 | Ga0436365_0411158_414_695 | 71 |
| 739 | 3300042876 | Ga0451577_0611798 | Ga0451577_0611798_164_409 | 71 |
| 740 | 3300044712 | Ga0453684_0451605 | Ga0453684_0451605_164_409 | 71 |
| 741 | 3300044765 | Ga0466970_0078266 | Ga0466970_0078266_380_622 | 71 |
| 742 | 3300045051 | Ga0451576_2104479 | Ga0451576_2104479_261_506 | 71 |
| 743 | 3300053079 | Ga0500610_0362080 | Ga0500610_0362080_272_496 | 71 |
| 744 | 3300053092 | Ga0500583_0063188 | Ga0500583_0063188_1129_1353 | 71 |
| 745 | 3300053124 | Ga0500617_050452 | Ga0500617_050452_1557_1781 | 71 |
| 746 | 3300053146 | Ga0500588_0005662 | Ga0500588_0005662_87_311 | 71 |
| 747 | 3300000546 | LJNas_1034716 | LJNas_10347161 | 72 |
| 748 | 3300005458 | Ga0070681_11754994 | Ga0070681_117549941 | 72 |
| 749 | 3300005546 | Ga0070696_100807503 | Ga0070696_1008075032 | 72 |
| 750 | 3300005563 | Ga0068855_100260725 | Ga0068855_1002607252 | 72 |
| 751 | 3300007788 | Ga0099795_10126475 | Ga0099795_101264753 | 72 |
| 752 | 3300009093 | Ga0105240_10041534 | Ga0105240_100415349 | 72 |
| 753 | 3300010159 | Ga0099796_10081115 | Ga0099796_100811153 | 72 |
| 754 | 3300025949 | Ga0207667_10432892 | Ga0207667_104328922 | 72 |
| 755 | 3300027512 | Ga0209179_1000970 | Ga0209179_10009702 | 72 |
| 756 | 3300027671 | Ga0209588_1143934 | Ga0209588_11439342 | 72 |
| 757 | 3300028017 | Ga0265356_1001830 | Ga0265356_10018303 | 72 |
| 758 | 3300028023 | Ga0265357_1041907 | Ga0265357_10419071 | 72 |
| 759 | 3300030879 | Ga0265765_1062006 | Ga0265765_10620061 | 72 |
| 760 | 3300030886 | Ga0265772_102895 | Ga0265772_1028952 | 72 |
| 761 | 3300031616 | Ga0307508_10743798 | Ga0307508_107437981 | 72 |
| 762 | 3300031730 | Ga0307516_10000215 | Ga0307516_1000021569 | 72 |
| 763 | 3300032120 | Ga0316053_115239 | Ga0316053_1152391 | 72 |
| 764 | 3300032120 | Ga0316053_118956 | Ga0316053_1189562 | 72 |
| 765 | 3300035117 | Ga0373953_0110411 | Ga0373953_0110411_583_801 | 72 |
| 766 | 3300046543 | Ga0495645_0343941 | Ga0495645_0343941_204_422 | 72 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5z38-assembly1.cif.gz_E | crystal structure of csra bound to cest | 0.8294 | 1 | 37 |
| 5z38-assembly1.cif.gz_G | crystal structure of csra bound to cest | 0.829 | 1 | 37 |
| 5z38-assembly2.cif.gz_I | crystal structure of csra bound to cest | 0.8212 | 1 | 38 |
| 5z38-assembly2.cif.gz_K | crystal structure of csra bound to cest | 0.8198 | 1 | 37 |
| 5z38-assembly1.cif.gz_G | crystal structure of csra bound to cest | 0.7409 | 1 | 37 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A0R0KZP1_7_202_3.60.15.10 | Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like | 0.7703 | 6 | 40 | 3.60.15.10 |
| af_Q1LVQ8_42_197_1.20.140.150 | Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; | 0.7262 | 10 | 36 | 1.20.140.150 |
| af_A0A1D6HX48_28_216_3.10.180.10 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.7197 | 11 | 42 | 3.10.180.10 |
| 4q4lA01 | Mainly Beta;Beta Barrel;Thrombin, subunit H; | 0.7189 | 7 | 37 | 2.40.10.170 |
| 3bk2A01 | Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like | 0.6601 | 8 | 37 | 3.60.15.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3D5Q1T1-F1-model_v4 | Carbon storage regulator | 0.7806 | 7 | 50 |
GO:0005829
GO:0006109 GO:0006402 GO:0045947 GO:0048027 |
| AF-A0A3D5Q1T1-F1-model_v4 | Carbon storage regulator | 0.7654 | 7 | 50 |
GO:0005829
GO:0006109 GO:0006402 GO:0045947 GO:0048027 |
| AF-A0A0B1Z0B0-F1-model_v4 | Carbon storage regulator | 0.7285 | 1 | 50 |
GO:0005829
GO:0006109 GO:0006402 GO:0045947 GO:0048027 |
| AF-A0A524Q8Y5-F1-model_v4 | Carbon storage regulator | 0.7042 | 6 | 55 |
GO:0005829
GO:0006109 GO:0006402 GO:0045947 GO:0048027 |
| AF-A0A0B1Z0B0-F1-model_v4 | Carbon storage regulator | 0.704 | 1 | 50 |
GO:0005829
GO:0006109 GO:0006402 GO:0045947 GO:0048027 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar