F479850

General Info

Members Datasets Scaffolds Average Seq Length
766 375 766 72

Family's Representative Sequence

Representative Sequence 3300013104|Ga0157370_10372969|Ga0157370_103729693
Length 85
Sequence MLRIESFGTTNWLKEICMLILTRRVGETLMIGESVSVTVLGVKGNQVRIGINAPKDVAVHREEIFQRIKREHSDQGDNHSPPPTS

Samples

Sample ID Description Type Environment
1 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
5 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
6 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
7 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
8 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
9 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
10 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
11 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
12 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
13 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
14 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
15 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
16 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
17 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
18 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
19 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
20 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
21 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
22 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
23 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
24 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
25 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
26 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
27 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
28 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
29 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
30 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
31 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
32 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
33 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
34 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
35 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
36 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
37 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
38 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
39 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
40 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
41 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
42 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
43 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
44 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
45 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
46 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
47 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
48 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
49 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
50 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
51 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
52 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
53 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
54 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
55 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
56 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
57 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
58 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
59 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
60 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
61 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
62 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
63 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
64 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
65 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
66 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
67 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
68 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
69 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
70 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
71 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
72 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
73 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
74 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
75 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
76 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
77 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
78 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
79 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
80 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
81 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
82 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
83 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
84 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
85 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
86 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
87 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
88 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
89 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
90 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
91 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
92 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
93 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
94 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
95 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
96 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
97 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
98 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
99 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
100 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
101 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
102 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
103 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
104 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
105 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
106 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
107 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
108 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
109 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
110 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
111 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
112 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
113 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
114 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
115 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
116 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
117 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
118 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
119 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
120 3300009982 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_189 metaG Metagenome Rhizosphere
121 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
122 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
123 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
124 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
125 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
126 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
127 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
128 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
129 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
130 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
131 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
132 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
133 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
134 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
135 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
136 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
137 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
138 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
139 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
140 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
141 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
142 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
143 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
144 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
145 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
146 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
147 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
205 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
206 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
208 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
209 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
210 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
211 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
212 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
213 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
215 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
216 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
217 3300028023 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 Metagenome Rhizosphere
218 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
222 3300030836 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
223 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
224 3300030886 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
225 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
226 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
227 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
228 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
229 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
230 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
231 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
232 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
233 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
234 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
235 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
236 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
237 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
238 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
239 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
240 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
241 3300032120 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
242 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
243 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
244 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
245 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
246 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
247 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
248 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
249 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
250 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
251 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
252 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
253 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
254 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
255 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
256 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
257 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
258 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
259 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
260 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
261 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
262 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
263 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
264 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
265 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
266 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
267 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
268 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
269 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
270 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
271 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
272 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
273 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
274 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
275 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
276 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
277 3300041497 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaT Metatranscriptome Unclassified
278 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
279 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
280 3300041502 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaT Metatranscriptome Unclassified
281 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
282 3300041506 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaT Metatranscriptome Unclassified
283 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
284 3300041916 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaT_extra_run Metatranscriptome Unclassified
285 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
286 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
287 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
288 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
289 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
290 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
291 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
292 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
293 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
294 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
295 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
296 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
297 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
298 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
299 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
300 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
301 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
302 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
303 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
304 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
305 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
306 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
307 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
308 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
309 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
310 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
311 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
312 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
313 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
314 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
315 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
316 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
317 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
318 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
319 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
320 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
321 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
322 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
323 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
324 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
325 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
326 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
327 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
328 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
329 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
330 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
331 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
332 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
333 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
334 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
335 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
336 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
337 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
338 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
339 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
340 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
341 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
342 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
343 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
344 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
345 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
346 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
347 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
348 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
349 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
350 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
351 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
352 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
353 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
354 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
355 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
356 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
357 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
358 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
359 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
360 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
361 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
362 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
363 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
364 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
365 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
366 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
367 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
368 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
369 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
370 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
371 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
372 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
373 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
374 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
375 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.86
Metatranscriptomes 6.14
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.79
Nodule 0
Rhizoplane 2.87
Rhizosphere 87.08
Stem 0
Stem Tuber 0
Unclassified 3.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJNas_1034716 3300000546 Bacteria 544
2 JGI24736J21556_1036419 3300001904 Bacteria 758
3 JGI24735J21928_10125450 3300002067 Bacteria 739
4 JGI25156J39149_1004445 3300002705 Bacteria 4269
5 JGI25162J39368_1004805 3300002737 Bacteria 2945
6 JGI25154J39366_1012161 3300002738 Bacteria 959
7 JGI25154J39366_1028219 3300002738 Bacteria 501
8 JGI25157J39369_1000172 3300002741 Bacteria 54469
9 JGI25157J39369_1000651 3300002741 Bacteria 19348
10 JGI25157J39369_1003545 3300002741 Bacteria 3142
11 JGI25163J39215_1000867 3300002771 Bacteria 7109
12 JGI25164J39214_1000263 3300002772 Bacteria 39612
13 JGI25164J39214_1001469 3300002772 Bacteria 5409
14 JGI25165J46597_1000473 3300003214 Bacteria 39640
15 JGI25165J46597_1002594 3300003214 Bacteria 5511
16 Ga0055538_1003671 3300003751 Bacteria 1892
17 Ga0055539_1001567 3300003752 Bacteria 4141
18 Ga0055533_1002616 3300003756 Bacteria 4006
19 Ga0055527_1000466 3300003760 Bacteria 15580
20 Ga0055527_1004919 3300003760 Bacteria 1789
21 Ga0055535_1001065 3300003761 Bacteria 16907
22 Ga0055535_1001154 3300003761 Bacteria 15575
23 Ga0055535_1001333 3300003761 Bacteria 13057
24 Ga0055535_1002782 3300003761 Bacteria 5583
25 Ga0055542_1000183 3300003762 Bacteria 77794
26 Ga0055542_1000423 3300003762 Bacteria 40916
27 Ga0055542_1001148 3300003762 Bacteria 15575
28 Ga0055529_1000116 3300003763 Bacteria 117929
29 Ga0055529_1000189 3300003763 Bacteria 84123
30 Ga0055529_1000934 3300003763 Bacteria 15580
31 Ga0055529_1008658 3300003763 Bacteria 1350
32 Ga0055541_1026526 3300003841 Bacteria 614
33 Ga0058863_11947076 3300004799 Bacteria 521
34 Ga0058861_11990870 3300004800 Bacteria 1211
35 Ga0058862_12551623 3300004803 Bacteria 725
36 Ga0058862_12768923 3300004803 Bacteria 809
37 Ga0058862_12834623 3300004803 Bacteria 711
38 Ga0058862_12892832 3300004803 Bacteria 673
39 Ga0065712_10790436 3300005290 Bacteria 513
40 Ga0065715_10368505 3300005293 Bacteria 924
41 Ga0065715_10717176 3300005293 Bacteria 645
42 Ga0065707_10230286 3300005295 Bacteria 1191
43 Ga0070658_10233400 3300005327 Bacteria 1558
44 Ga0070658_10371490 3300005327 Bacteria 1226
45 Ga0070683_100038381 3300005329 Bacteria 4390
46 Ga0070683_100071576 3300005329 Bacteria 3235
47 Ga0070683_100278724 3300005329 Bacteria 1590
48 Ga0070683_102061891 3300005329 Bacteria 548
49 Ga0070690_100523436 3300005330 Bacteria 890
50 Ga0070690_100912466 3300005330 Bacteria 688
51 Ga0070670_100006835 3300005331 Bacteria 9667
52 Ga0070670_100815699 3300005331 Bacteria 843
53 Ga0070677_10014576 3300005333 Bacteria 2769
54 Ga0068869_100773220 3300005334 Bacteria 824
55 Ga0068869_101096866 3300005334 Bacteria 696
56 Ga0070666_10048447 3300005335 Bacteria 2855
57 Ga0070666_10799671 3300005335 Bacteria 694
58 Ga0070666_10866891 3300005335 Bacteria 667
59 Ga0070680_100033389 3300005336 Bacteria 4147
60 Ga0070680_100848346 3300005336 Bacteria 788
61 Ga0070680_100906673 3300005336 Bacteria 760
62 Ga0070682_100082465 3300005337 Bacteria 2084
63 Ga0070682_100406135 3300005337 Bacteria 1031
64 Ga0070682_100599573 3300005337 Bacteria 869
65 Ga0068868_100082626 3300005338 Bacteria 2576
66 Ga0068868_101101065 3300005338 Bacteria 731
67 Ga0068868_101964569 3300005338 Unclassified 555
68 Ga0070660_100100092 3300005339 Bacteria 2295
69 Ga0070660_101177686 3300005339 Bacteria 649
70 Ga0070689_100041539 3300005340 Bacteria 3531
71 Ga0070689_100563746 3300005340 Bacteria 983
72 Ga0070691_10438235 3300005341 Bacteria 744
73 Ga0070691_10736879 3300005341 Bacteria 595
74 Ga0070661_100023087 3300005344 Bacteria 4457
75 Ga0070661_100041870 3300005344 Bacteria 3342
76 Ga0070661_100079174 3300005344 Bacteria 2424
77 Ga0070661_101074462 3300005344 Bacteria 670
78 Ga0070692_10057912 3300005345 Bacteria 2033
79 Ga0070668_100679357 3300005347 Bacteria 907
80 Ga0070668_101466779 3300005347 Bacteria 623
81 Ga0070669_100048736 3300005353 Bacteria 3092
82 Ga0070669_100134768 3300005353 Bacteria 1899
83 Ga0070669_101329635 3300005353 Bacteria 623
84 Ga0070675_100463179 3300005354 Bacteria 1138
85 Ga0070675_100893280 3300005354 Bacteria 814
86 Ga0070671_100003573 3300005355 Bacteria 12159
87 Ga0070671_100046776 3300005355 Bacteria 3598
88 Ga0070674_100613382 3300005356 Unclassified 921
89 Ga0070688_100107312 3300005365 Bacteria 1851
90 Ga0070659_100492215 3300005366 Bacteria 1044
91 Ga0070659_100953547 3300005366 Bacteria 751
92 Ga0070667_100018316 3300005367 Bacteria 5805
93 Ga0070667_100059421 3300005367 Bacteria 3234
94 Ga0070667_100566795 3300005367 Bacteria 1045
95 Ga0070709_10857423 3300005434 Bacteria 716
96 Ga0070714_100000280 3300005435 Bacteria 39190
97 Ga0070714_101245989 3300005435 Bacteria 726
98 Ga0070714_101306806 3300005435 Bacteria 708
99 Ga0070713_100017354 3300005436 Bacteria 5441
100 Ga0070710_10094052 3300005437 Bacteria 1773
101 Ga0070701_11308421 3300005438 Bacteria 518
102 Ga0070711_100026241 3300005439 Bacteria 3817
103 Ga0070711_100847153 3300005439 Bacteria 778
104 Ga0070705_101558335 3300005440 Bacteria 555
105 Ga0070700_100014142 3300005441 Bacteria 4503
106 Ga0070700_100148850 3300005441 Bacteria 1599
107 Ga0070694_100384741 3300005444 Bacteria 1095
108 Ga0070708_101612759 3300005445 Bacteria 604
109 Ga0070663_100019820 3300005455 Bacteria 4441
110 Ga0070663_100457914 3300005455 Bacteria 1052
111 Ga0070663_102096731 3300005455 Bacteria 509
112 Ga0070678_101004605 3300005456 Bacteria 767
113 Ga0070662_100147198 3300005457 Bacteria 1830
114 Ga0070662_100686337 3300005457 Bacteria 865
115 Ga0070681_10012205 3300005458 Bacteria 8519
116 Ga0070681_10013793 3300005458 Bacteria 8044
117 Ga0070681_10017187 3300005458 Bacteria 7232
118 Ga0070681_10027498 3300005458 Bacteria 5718
119 Ga0070681_10029162 3300005458 Bacteria 5540
120 Ga0070681_10089340 3300005458 Unclassified 3032
121 Ga0070681_10118109 3300005458 Bacteria 2589
122 Ga0070681_11754994 3300005458 Bacteria 547
123 Ga0068867_100520140 3300005459 Bacteria 1026
124 Ga0068867_100604742 3300005459 Bacteria 957
125 Ga0068867_100973986 3300005459 Bacteria 767
126 Ga0068867_101453226 3300005459 Bacteria 637
127 Ga0070685_10305927 3300005466 Bacteria 1073
128 Ga0070698_100015662 3300005471 Bacteria 8008
129 Ga0070699_102026524 3300005518 Bacteria 526
130 Ga0070679_100066525 3300005530 Bacteria 3592
131 Ga0070679_100087757 3300005530 Bacteria 3098
132 Ga0070679_100128579 3300005530 Unclassified 2515
133 Ga0070679_100132799 3300005530 Bacteria 2470
134 Ga0070679_100507914 3300005530 Bacteria 1149
135 Ga0070679_102134051 3300005530 Bacteria 510
136 Ga0070684_100093077 3300005535 Bacteria 2683
137 Ga0070684_100130862 3300005535 Bacteria 2264
138 Ga0070684_100133152 3300005535 Bacteria 2243
139 Ga0070684_100462925 3300005535 Bacteria 1172
140 Ga0068853_100008660 3300005539 Bacteria 8180
141 Ga0068853_100692800 3300005539 Bacteria 971
142 Ga0068853_101325108 3300005539 Bacteria 696
143 Ga0068853_101968166 3300005539 Bacteria 567
144 Ga0068853_102248829 3300005539 Bacteria 528
145 Ga0070672_100474647 3300005543 Bacteria 1079
146 Ga0070686_101387543 3300005544 Bacteria 589
147 Ga0070695_101081162 3300005545 Bacteria 656
148 Ga0070696_100002294 3300005546 Bacteria 12611
149 Ga0070696_100143615 3300005546 Bacteria 1746
150 Ga0070696_100807503 3300005546 Bacteria 772
151 Ga0070693_100052139 3300005547 Bacteria 2344
152 Ga0070693_100586594 3300005547 Bacteria 803
153 Ga0070665_100001699 3300005548 Bacteria 25308
154 Ga0070665_100108128 3300005548 Bacteria 2783
155 Ga0070665_100665120 3300005548 Bacteria 1055
156 Ga0070665_100869596 3300005548 Bacteria 914
157 Ga0070704_100652717 3300005549 Unclassified 929
158 Ga0070704_101727714 3300005549 Unclassified 578
159 Ga0068855_100041147 3300005563 Bacteria 5479
160 Ga0068855_100062440 3300005563 Bacteria 4349
161 Ga0068855_100260725 3300005563 Bacteria 1931
162 Ga0068855_100468581 3300005563 Bacteria 1372
163 Ga0068855_100752765 3300005563 Unclassified 1039
164 Ga0068855_100920244 3300005563 Bacteria 923
165 Ga0068855_100936557 3300005563 Bacteria 913
166 Ga0070664_100343447 3300005564 Bacteria 1356
167 Ga0070664_100609626 3300005564 Bacteria 1013
168 Ga0070664_101154623 3300005564 Bacteria 730
169 Ga0068857_100135589 3300005577 Bacteria 2222
170 Ga0068857_100267439 3300005577 Bacteria 1571
171 Ga0068857_101428136 3300005577 Bacteria 673
172 Ga0068854_100042202 3300005578 Bacteria 3227
173 Ga0068854_100120335 3300005578 Bacteria 1992
174 Ga0068854_100298936 3300005578 Bacteria 1301
175 Ga0068854_100733067 3300005578 Bacteria 856
176 Ga0068854_100788410 3300005578 Bacteria 827
177 Ga0068856_100010069 3300005614 Bacteria 9186
178 Ga0068856_100025896 3300005614 Bacteria 5721
179 Ga0068856_100075332 3300005614 Bacteria 3342
180 Ga0068856_100102163 3300005614 Bacteria 2860
181 Ga0068856_100836988 3300005614 Bacteria 939
182 Ga0068856_101270568 3300005614 Bacteria 752
183 Ga0068856_102005565 3300005614 Bacteria 589
184 Ga0070702_101814944 3300005615 Bacteria 509
185 Ga0068852_100001584 3300005616 Bacteria 15464
186 Ga0068852_100064971 3300005616 Bacteria 3182
187 Ga0068852_100403855 3300005616 Bacteria 1344
188 Ga0068859_100047914 3300005617 Bacteria 4294
189 Ga0068859_100154876 3300005617 Bacteria 2369
190 Ga0068859_100182278 3300005617 Bacteria 2183
191 Ga0068859_100303991 3300005617 Bacteria 1688
192 Ga0068859_100873847 3300005617 Bacteria 985
193 Ga0068859_100889466 3300005617 Bacteria 975
194 Ga0068859_100926005 3300005617 Bacteria 956
195 Ga0068859_101632010 3300005617 Bacteria 712
196 Ga0068864_100141471 3300005618 Bacteria 2171
197 Ga0068866_10756460 3300005718 Bacteria 671
198 Ga0068866_10946064 3300005718 Bacteria 609
199 Ga0068861_100217883 3300005719 Bacteria 1611
200 Ga0068861_101253916 3300005719 Bacteria 719
201 Ga0068861_101820479 3300005719 Bacteria 604
202 Ga0068851_10094016 3300005834 Bacteria 1582
203 Ga0068870_10505628 3300005840 Bacteria 806
204 Ga0068870_10588278 3300005840 Bacteria 754
205 Ga0068863_100082402 3300005841 Bacteria 3049
206 Ga0068863_100097204 3300005841 Bacteria 2796
207 Ga0068863_100936417 3300005841 Bacteria 867
208 Ga0068863_102368474 3300005841 Bacteria 540
209 Ga0068858_100161521 3300005842 Bacteria 2109
210 Ga0068858_100183086 3300005842 Bacteria 1978
211 Ga0068858_100710801 3300005842 Bacteria 978
212 Ga0068858_100732637 3300005842 Bacteria 963
213 Ga0068860_100023471 3300005843 Bacteria 5961
214 Ga0068860_100293341 3300005843 Bacteria 1592
215 Ga0068860_100323918 3300005843 Bacteria 1513
216 Ga0068860_101213284 3300005843 Bacteria 775
217 Ga0068860_101646832 3300005843 Bacteria 664
218 Ga0068862_100112276 3300005844 Bacteria 2393
219 Ga0068862_100137988 3300005844 Bacteria 2163
220 Ga0068862_100254427 3300005844 Bacteria 1601
221 Ga0068862_100393212 3300005844 Bacteria 1295
222 Ga0068862_100952405 3300005844 Bacteria 847
223 Ga0068862_101697625 3300005844 Unclassified 640
224 Ga0081455_10197634 3300005937 Bacteria 1508
225 Ga0070715_10992291 3300006163 Bacteria 523
226 Ga0070716_100191688 3300006173 Bacteria 1351
227 Ga0070712_100002924 3300006175 Bacteria 10591
228 Ga0070712_100395387 3300006175 Bacteria 1140
229 Ga0097621_100043536 3300006237 Bacteria 3619
230 Ga0097621_100169235 3300006237 Bacteria 1882
231 Ga0097621_101083551 3300006237 Bacteria 752
232 Ga0097621_101263566 3300006237 Bacteria 696
233 Ga0097621_101781540 3300006237 Bacteria 587
234 Ga0075370_10753971 3300006353 Bacteria 593
235 Ga0068871_100011168 3300006358 Bacteria 6581
236 Ga0068871_100215893 3300006358 Bacteria 1660
237 Ga0068871_101724505 3300006358 Bacteria 594
238 Ga0068871_101745633 3300006358 Bacteria 590
239 Ga0075428_100342577 3300006844 Bacteria 1605
240 Ga0075428_100352504 3300006844 Bacteria 1579
241 Ga0075430_100326959 3300006846 Bacteria 1267
242 Ga0075431_101129940 3300006847 Bacteria 747
243 Ga0075429_101887869 3300006880 Bacteria 518
244 Ga0068865_100009644 3300006881 Bacteria 5988
245 Ga0068865_100017320 3300006881 Bacteria 4633
246 Ga0068865_100038582 3300006881 Bacteria 3234
247 Ga0068865_100081125 3300006881 Bacteria 2328
248 Ga0068865_101543814 3300006881 Bacteria 596
249 Ga0097620_100047914 3300006931 Bacteria 4294
250 Ga0097620_100154871 3300006931 Bacteria 2369
251 Ga0097620_100182291 3300006931 Bacteria 2183
252 Ga0097620_100304005 3300006931 Bacteria 1688
253 Ga0097620_100873867 3300006931 Bacteria 985
254 Ga0097620_100889506 3300006931 Bacteria 975
255 Ga0097620_100925935 3300006931 Bacteria 956
256 Ga0097620_101632146 3300006931 Bacteria 712
257 Ga0099794_10048122 3300007265 Bacteria 2046
258 Ga0099795_10019602 3300007788 Bacteria 2192
259 Ga0099795_10126475 3300007788 Bacteria 1027
260 Ga0105250_10000008 3300009092 Bacteria 343965
261 Ga0105240_10015775 3300009093 Bacteria 10252
262 Ga0105240_10041534 3300009093 Bacteria 5869
263 Ga0105240_10090641 3300009093 Bacteria 3736
264 Ga0105240_10134320 3300009093 Bacteria 2964
265 Ga0105240_10540715 3300009093 Bacteria 1290
266 Ga0105240_11327580 3300009093 Bacteria 758
267 Ga0105240_11536783 3300009093 Bacteria 697
268 Ga0105240_12145360 3300009093 Bacteria 580
269 Ga0105240_12244741 3300009093 Bacteria 566
270 Ga0111539_10224808 3300009094 Bacteria 2186
271 Ga0111539_10877895 3300009094 Bacteria 1043
272 Ga0111539_11391212 3300009094 Bacteria 814
273 Ga0111539_12557405 3300009094 Bacteria 592
274 Ga0105245_10982032 3300009098 Bacteria 888
275 Ga0105245_11465095 3300009098 Bacteria 733
276 Ga0105245_11655722 3300009098 Bacteria 692
277 Ga0105245_11937624 3300009098 Bacteria 642
278 Ga0105247_10106647 3300009101 Bacteria 1798
279 Ga0105247_10482083 3300009101 Bacteria 900
280 Ga0105247_11764360 3300009101 Bacteria 514
281 Ga0105243_11097375 3300009148 Bacteria 804
282 Ga0105241_10035532 3300009174 Bacteria 3747
283 Ga0105241_10043847 3300009174 Bacteria 3388
284 Ga0105241_10156914 3300009174 Bacteria 1867
285 Ga0105241_10188228 3300009174 Bacteria 1717
286 Ga0105241_10227568 3300009174 Bacteria 1571
287 Ga0105241_10245553 3300009174 Bacteria 1515
288 Ga0105242_10008331 3300009176 Bacteria 7966
289 Ga0105242_10062818 3300009176 Bacteria 3057
290 Ga0105242_12749447 3300009176 Bacteria 542
291 Ga0105248_10009477 3300009177 Bacteria 10716
292 Ga0105248_10112024 3300009177 Bacteria 3078
293 Ga0105248_10346642 3300009177 Bacteria 1672
294 Ga0105248_10482422 3300009177 Bacteria 1397
295 Ga0105237_10000150 3300009545 Bacteria 97072
296 Ga0105237_10005972 3300009545 Bacteria 13641
297 Ga0105237_10040525 3300009545 Bacteria 4696
298 Ga0105237_10054148 3300009545 Bacteria 4020
299 Ga0105237_10298519 3300009545 Bacteria 1614
300 Ga0105237_10337726 3300009545 Bacteria 1511
301 Ga0105237_11365595 3300009545 Bacteria 715
302 Ga0105238_10008246 3300009551 Bacteria 10424
303 Ga0105238_10026562 3300009551 Bacteria 5903
304 Ga0105238_10031268 3300009551 Bacteria 5419
305 Ga0105238_10165784 3300009551 Bacteria 2185
306 Ga0105238_10268956 3300009551 Bacteria 1685
307 Ga0105238_10281269 3300009551 Bacteria 1645
308 Ga0105238_10473491 3300009551 Bacteria 1251
309 Ga0105238_11466690 3300009551 Bacteria 710
310 Ga0105249_10145185 3300009553 Bacteria 2279
311 Ga0105249_10290326 3300009553 Bacteria 1637
312 Ga0105249_10575293 3300009553 Bacteria 1179
313 Ga0105249_10622523 3300009553 Bacteria 1135
314 Ga0105249_10656020 3300009553 Bacteria 1107
315 Ga0105249_10681332 3300009553 Bacteria 1087
316 Ga0105249_11804265 3300009553 Bacteria 684
317 Ga0105147_100236 3300009982 Bacteria 5102
318 Ga0105028_112468 3300009993 Bacteria 898
319 Ga0099796_10081115 3300010159 Bacteria 1190
320 Ga0105239_10013679 3300010375 Bacteria 9010
321 Ga0105239_10032021 3300010375 Bacteria 5778
322 Ga0105239_11234746 3300010375 Bacteria 862
323 Ga0105239_12062880 3300010375 Bacteria 662
324 Ga0105239_12371021 3300010375 Bacteria 618
325 Ga0105239_12727937 3300010375 Bacteria 576
326 Ga0105246_10936873 3300011119 Bacteria 779
327 Ga0157345_1044836 3300012498 Bacteria 544
328 Ga0157371_10481013 3300013102 Bacteria 915
329 Ga0157370_10026079 3300013104 Bacteria 5774
330 Ga0157370_10048901 3300013104 Bacteria 4051
331 Ga0157370_10183500 3300013104 Bacteria 1943
332 Ga0157370_10306834 3300013104 Bacteria 1465
333 Ga0157370_10372969 3300013104 Bacteria 1315
334 Ga0157369_10000195 3300013105 Bacteria 84688
335 Ga0157369_10006603 3300013105 Bacteria 13416
336 Ga0157369_10032217 3300013105 Bacteria 5765
337 Ga0157369_10457947 3300013105 Bacteria 1321
338 Ga0157369_10782110 3300013105 Bacteria 981
339 Ga0157369_10811291 3300013105 Bacteria 961
340 Ga0157369_12390275 3300013105 Bacteria 535
341 Ga0157374_11180576 3300013296 Bacteria 786
342 Ga0157378_10065280 3300013297 Bacteria 3258
343 Ga0157378_11691481 3300013297 Bacteria 680
344 Ga0163162_10015010 3300013306 Bacteria 7566
345 Ga0163162_10859561 3300013306 Bacteria 1022
346 Ga0163162_10958359 3300013306 Bacteria 966
347 Ga0163162_10964801 3300013306 Bacteria 963
348 Ga0163162_11764840 3300013306 Bacteria 707
349 Ga0157372_10003204 3300013307 Bacteria 17672
350 Ga0157372_10197876 3300013307 Bacteria 2328
351 Ga0157372_10242016 3300013307 Bacteria 2093
352 Ga0157372_10352792 3300013307 Bacteria 1714
353 Ga0157372_11369270 3300013307 Bacteria 816
354 Ga0157372_11919382 3300013307 Bacteria 681
355 Ga0157375_10000940 3300013308 Bacteria 25256
356 Ga0157375_10277551 3300013308 Bacteria 1838
357 Ga0157375_10809396 3300013308 Bacteria 1085
358 Ga0157375_11879304 3300013308 Bacteria 711
359 Ga0163163_10157504 3300014325 Bacteria 2316
360 Ga0163163_11269127 3300014325 Bacteria 799
361 Ga0163163_11621400 3300014325 Bacteria 708
362 Ga0163163_11959003 3300014325 Bacteria 646
363 Ga0163163_12933764 3300014325 Bacteria 532
364 Ga0157380_10438919 3300014326 Bacteria 1250
365 Ga0157380_12049723 3300014326 Bacteria 634
366 Ga0157380_13314531 3300014326 Bacteria 515
367 Ga0182008_10017135 3300014497 Bacteria 3759
368 Ga0182008_10316004 3300014497 Bacteria 821
369 Ga0182008_10550970 3300014497 Bacteria 641
370 Ga0182008_10991618 3300014497 Bacteria 500
371 Ga0157379_10001068 3300014968 Bacteria 22327
372 Ga0157379_10168233 3300014968 Bacteria 1979
373 Ga0157376_10016137 3300014969 Bacteria 5662
374 Ga0157376_10016323 3300014969 Bacteria 5634
375 Ga0157376_10534533 3300014969 Bacteria 1158
376 Ga0182006_1061226 3300015261 Bacteria 1420
377 Ga0182006_1073080 3300015261 Bacteria 1266
378 Ga0182007_10018362 3300015262 Bacteria 2534
379 Ga0182007_10073467 3300015262 Bacteria 1120
380 Ga0182007_10136952 3300015262 Bacteria 826
381 Ga0206349_1264899 3300020075 Bacteria 618
382 Ga0206355_1201516 3300020076 Bacteria 818
383 Ga0206352_10282496 3300020078 Bacteria 778
384 Ga0206352_10293537 3300020078 Bacteria 564
385 Ga0206352_10757564 3300020078 Bacteria 747
386 Ga0206354_10905968 3300020081 Bacteria 545
387 Ga0206354_11701467 3300020081 Bacteria 736
388 Ga0213871_10050786 3300021441 Bacteria 1136
389 Ga0209233_1003300 3300025261 Bacteria 5723
390 Ga0207696_1000106 3300025711 Bacteria 159964
391 Ga0207682_10123677 3300025893 Bacteria 1149
392 Ga0207692_10000125 3300025898 Bacteria 22996
393 Ga0207642_10126051 3300025899 Bacteria 1329
394 Ga0207642_11035704 3300025899 Bacteria 529
395 Ga0207642_11046422 3300025899 Bacteria 527
396 Ga0207710_10179411 3300025900 Bacteria 1038
397 Ga0207680_10765444 3300025903 Bacteria 692
398 Ga0207685_10520394 3300025905 Bacteria 629
399 Ga0207699_10478965 3300025906 Bacteria 896
400 Ga0207699_10617858 3300025906 Bacteria 790
401 Ga0207645_10000555 3300025907 Bacteria 31018
402 Ga0207643_10090881 3300025908 Bacteria 1780
403 Ga0207643_10616609 3300025908 Bacteria 699
404 Ga0207705_10957669 3300025909 Bacteria 662
405 Ga0207654_10068211 3300025911 Bacteria 2103
406 Ga0207654_10585937 3300025911 Bacteria 795
407 Ga0207654_10938105 3300025911 Bacteria 628
408 Ga0207707_10026840 3300025912 Bacteria 5033
409 Ga0207707_10033237 3300025912 Bacteria 4515
410 Ga0207707_10071975 3300025912 Bacteria 3013
411 Ga0207707_10302818 3300025912 Bacteria 1382
412 Ga0207707_10636264 3300025912 Bacteria 900
413 Ga0207695_10002778 3300025913 Bacteria 25477
414 Ga0207695_10053030 3300025913 Bacteria 4244
415 Ga0207695_10145146 3300025913 Bacteria 2318
416 Ga0207695_10155057 3300025913 Unclassified 2225
417 Ga0207695_10551647 3300025913 Bacteria 1034
418 Ga0207695_10558339 3300025913 Bacteria 1026
419 Ga0207695_11144711 3300025913 Bacteria 658
420 Ga0207671_10001147 3300025914 Bacteria 31646
421 Ga0207671_10985260 3300025914 Bacteria 665
422 Ga0207671_11227308 3300025914 Bacteria 586
423 Ga0207671_11518430 3300025914 Bacteria 517
424 Ga0207693_10001835 3300025915 Bacteria 18617
425 Ga0207663_10294265 3300025916 Bacteria 1210
426 Ga0207660_10026252 3300025917 Bacteria 3965
427 Ga0207660_10030564 3300025917 Bacteria 3703
428 Ga0207660_10285568 3300025917 Bacteria 1311
429 Ga0207652_10129603 3300025921 Bacteria 2249
430 Ga0207652_10147104 3300025921 Bacteria 2109
431 Ga0207652_10383822 3300025921 Bacteria 1268
432 Ga0207652_11391459 3300025921 Bacteria 605
433 Ga0207681_10395464 3300025923 Bacteria 1115
434 Ga0207681_10922822 3300025923 Bacteria 731
435 Ga0207694_10000162 3300025924 Bacteria 68375
436 Ga0207694_10067519 3300025924 Unclassified 2791
437 Ga0207694_10160867 3300025924 Bacteria 1813
438 Ga0207694_10422907 3300025924 Bacteria 1110
439 Ga0207650_11595681 3300025925 Bacteria 554
440 Ga0207659_10324316 3300025926 Bacteria 1271
441 Ga0207687_10636388 3300025927 Bacteria 901
442 Ga0207700_10039076 3300025928 Bacteria 3450
443 Ga0207700_10913624 3300025928 Bacteria 786
444 Ga0207664_11386363 3300025929 Unclassified 623
445 Ga0207644_10117210 3300025931 Bacteria 2022
446 Ga0207690_10282998 3300025932 Bacteria 1292
447 Ga0207706_10040416 3300025933 Bacteria 4133
448 Ga0207686_10048381 3300025934 Bacteria 2633
449 Ga0207670_11404998 3300025936 Bacteria 593
450 Ga0207669_10149595 3300025937 Bacteria 1633
451 Ga0207669_10450139 3300025937 Bacteria 1020
452 Ga0207669_10808692 3300025937 Bacteria 778
453 Ga0207704_10006657 3300025938 Bacteria 5409
454 Ga0207704_10425885 3300025938 Unclassified 1053
455 Ga0207665_10003234 3300025939 Bacteria 10909
456 Ga0207691_10000451 3300025940 Bacteria 40686
457 Ga0207711_10003851 3300025941 Bacteria 12910
458 Ga0207711_10482024 3300025941 Bacteria 1155
459 Ga0207711_11012198 3300025941 Bacteria 771
460 Ga0207689_10173787 3300025942 Bacteria 1776
461 Ga0207661_10049975 3300025944 Bacteria 3330
462 Ga0207661_10229631 3300025944 Bacteria 1643
463 Ga0207661_10264444 3300025944 Bacteria 1533
464 Ga0207661_11846301 3300025944 Bacteria 550
465 Ga0207679_10958029 3300025945 Bacteria 784
466 Ga0207667_10432892 3300025949 Bacteria 1338
467 Ga0207667_10576203 3300025949 Bacteria 1137
468 Ga0207667_10722915 3300025949 Bacteria 997
469 Ga0207651_10038543 3300025960 Bacteria 3143
470 Ga0207712_10091893 3300025961 Bacteria 2236
471 Ga0207712_10163995 3300025961 Bacteria 1730
472 Ga0207712_10380477 3300025961 Bacteria 1181
473 Ga0207712_10505403 3300025961 Bacteria 1034
474 Ga0207712_11020633 3300025961 Bacteria 734
475 Ga0207668_10617994 3300025972 Bacteria 945
476 Ga0207640_10928409 3300025981 Bacteria 762
477 Ga0207640_11143830 3300025981 Bacteria 690
478 Ga0207658_10289969 3300025986 Bacteria 1406
479 Ga0207658_11017594 3300025986 Bacteria 756
480 Ga0207658_11272593 3300025986 Bacteria 672
481 Ga0207677_10747923 3300026023 Bacteria 871
482 Ga0207703_10461713 3300026035 Bacteria 1188
483 Ga0207703_11551532 3300026035 Bacteria 637
484 Ga0207703_11807812 3300026035 Bacteria 587
485 Ga0207703_12327105 3300026035 Unclassified 511
486 Ga0207639_11239388 3300026041 Bacteria 700
487 Ga0207708_10177287 3300026075 Bacteria 1691
488 Ga0207702_10038359 3300026078 Bacteria 4012
489 Ga0207702_12060711 3300026078 Bacteria 561
490 Ga0207641_10396615 3300026088 Bacteria 1324
491 Ga0207641_10397575 3300026088 Bacteria 1322
492 Ga0207641_11493250 3300026088 Bacteria 677
493 Ga0207641_12544060 3300026088 Bacteria 510
494 Ga0207648_10001019 3300026089 Bacteria 31539
495 Ga0207648_10645583 3300026089 Bacteria 978
496 Ga0207676_10079761 3300026095 Bacteria 2655
497 Ga0207676_10218162 3300026095 Bacteria 1697
498 Ga0207674_10368667 3300026116 Bacteria 1388
499 Ga0207674_11275510 3300026116 Bacteria 704
500 Ga0207675_100000567 3300026118 Bacteria 36188
501 Ga0207675_101574605 3300026118 Bacteria 678
502 Ga0207683_10042859 3300026121 Bacteria 3952
503 Ga0207683_11596863 3300026121 Bacteria 601
504 Ga0207698_12459574 3300026142 Bacteria 531
505 Ga0209984_1022770 3300027424 Bacteria 864
506 Ga0210000_1014842 3300027462 Bacteria 1169
507 Ga0209179_1000970 3300027512 Bacteria 3264
508 Ga0209968_1102306 3300027526 Bacteria 523
509 Ga0209999_1062402 3300027543 Bacteria 710
510 Ga0209982_1000529 3300027552 Bacteria 4757
511 Ga0209970_1004527 3300027614 Bacteria 2308
512 Ga0210002_1016968 3300027617 Bacteria 1156
513 Ga0209983_1006005 3300027665 Bacteria 2502
514 Ga0209588_1143934 3300027671 Bacteria 757
515 Ga0209971_1000724 3300027682 Bacteria 8506
516 Ga0209974_10001096 3300027876 Bacteria 9594
517 Ga0265356_1001830 3300028017 Bacteria 2998
518 Ga0265357_1041907 3300028023 Unclassified 538
519 Ga0268266_10340617 3300028379 Bacteria 1407
520 Ga0268266_10585406 3300028379 Bacteria 1071
521 Ga0268266_11924877 3300028379 Bacteria 565
522 Ga0268266_12036382 3300028379 Bacteria 547
523 Ga0268265_10005940 3300028380 Bacteria 8312
524 Ga0268265_10038567 3300028380 Bacteria 3515
525 Ga0268265_11114183 3300028380 Bacteria 784
526 Ga0268265_11215964 3300028380 Bacteria 751
527 Ga0268265_12654387 3300028380 Bacteria 506
528 Ga0268264_10337994 3300028381 Bacteria 1429
529 Ga0268264_10420619 3300028381 Bacteria 1288
530 Ga0268264_11001677 3300028381 Bacteria 842
531 Ga0307515_10039654 3300028794 Bacteria 7479
532 Ga0265767_118865 3300030836 Bacteria 513
533 Ga0265765_1062006 3300030879 Bacteria 530
534 Ga0265772_102895 3300030886 Bacteria 693
535 Ga0265329_10223036 3300031242 Bacteria 624
536 Ga0265340_10147244 3300031247 Bacteria 1075
537 Ga0265327_10002526 3300031251 Bacteria 19071
538 Ga0265327_10002740 3300031251 Bacteria 17939
539 Ga0265316_10002788 3300031344 Bacteria 17910
540 Ga0307513_10003009 3300031456 Bacteria 22993
541 Ga0307508_10743798 3300031616 Unclassified 593
542 Ga0316575_10017077 3300031665 Bacteria 2753
543 Ga0316575_10076648 3300031665 Bacteria 1346
544 Ga0316575_10232995 3300031665 Bacteria 770
545 Ga0316579_10097391 3300031691 Bacteria 1407
546 Ga0316579_10162932 3300031691 Bacteria 1077
547 Ga0316579_10166584 3300031691 Bacteria 1065
548 Ga0316576_10012939 3300031727 Bacteria 5524
549 Ga0316576_10085784 3300031727 Bacteria 2340
550 Ga0316576_10348838 3300031727 Bacteria 1101
551 Ga0316578_10079519 3300031728 Bacteria 1949
552 Ga0316578_10096971 3300031728 Bacteria 1765
553 Ga0316578_10213578 3300031728 Bacteria 1160
554 Ga0307516_10000215 3300031730 Bacteria 74522
555 Ga0316577_10099242 3300031733 Bacteria 1631
556 Ga0316577_10324844 3300031733 Bacteria 872
557 Ga0316577_10337157 3300031733 Bacteria 855
558 Ga0316577_10473147 3300031733 Bacteria 712
559 Ga0307407_10358456 3300031903 Bacteria 1035
560 Ga0307409_100623260 3300031995 Bacteria 1069
561 Ga0307414_11590771 3300032004 Bacteria 609
562 Ga0307411_10740166 3300032005 Bacteria 860
563 Ga0316053_115239 3300032120 Bacteria 570
564 Ga0316053_118956 3300032120 Bacteria 530
565 Ga0316583_10038324 3300032133 Bacteria 1699
566 Ga0316583_10051875 3300032133 Bacteria 1444
567 Ga0316583_10075632 3300032133 Bacteria 1177
568 Ga0316583_10200719 3300032133 Bacteria 692
569 Ga0316585_10034979 3300032137 Bacteria 1590
570 Ga0316585_10049331 3300032137 Bacteria 1350
571 Ga0316585_10063620 3300032137 Bacteria 1193
572 Ga0316585_10131291 3300032137 Bacteria 825
573 Ga0316580_10055138 3300032139 Bacteria 1222
574 Ga0316580_10077031 3300032139 Bacteria 1020
575 Ga0316593_10017462 3300032168 Bacteria 2189
576 Ga0316593_10024372 3300032168 Bacteria 1918
577 Ga0316593_10027136 3300032168 Bacteria 1835
578 Ga0316593_10117978 3300032168 Bacteria 951
579 Ga0316593_10177099 3300032168 Bacteria 783
580 Ga0316593_10187060 3300032168 Bacteria 762
581 Ga0316593_10238403 3300032168 Bacteria 678
582 Ga0316593_10251950 3300032168 Bacteria 661
583 Ga0316593_10361588 3300032168 Bacteria 557
584 Ga0316593_10447255 3300032168 Bacteria 504
585 Ga0316592_1016984 3300033524 Bacteria 1525
586 Ga0316592_1029193 3300033524 Bacteria 1196
587 Ga0316586_1075792 3300033527 Bacteria 624
588 Ga0316588_1049815 3300033528 Bacteria 1014
589 Ga0316588_1128663 3300033528 Bacteria 643
590 Ga0316588_1164854 3300033528 Bacteria 572
591 Ga0316587_1008159 3300033529 Bacteria 1641
592 Ga0316587_1035107 3300033529 Bacteria 895
593 Ga0316587_1077861 3300033529 Bacteria 625
594 Ga0316596_1019526 3300033541 Bacteria 1719
595 Ga0316596_1019631 3300033541 Bacteria 1715
596 Ga0316596_1029183 3300033541 Bacteria 1427
597 Ga0316596_1202117 3300033541 Bacteria 553
598 Ga0373934_0252923 3300035086 Bacteria 729
599 Ga0373923_0053484 3300035111 Bacteria 1698
600 Ga0373953_0110411 3300035117 Bacteria 1163
601 Ga0373956_0354586 3300035119 Bacteria 699
602 Ga0373943_0037529 3300035170 Bacteria 2326
603 Ga0373943_0407042 3300035170 Bacteria 786
604 Ga0373962_0368395 3300035242 Bacteria 523
605 Ga0316574_0001466 3300035398 Bacteria 11223
606 Ga0316574_0071068 3300035398 Bacteria 2197
607 Ga0316574_0252151 3300035398 Bacteria 1127
608 Ga0316574_0557954 3300035398 Bacteria 710
609 Ga0316574_0738777 3300035398 Bacteria 602
610 Ga0316574_0938992 3300035398 Bacteria 522
611 Ga0373935_1351796 3300035692 Bacteria 532
612 Ga0373933_0110033 3300035724 Bacteria 1718
613 Ga0373937_0755674 3300036401 Bacteria 920
614 Ga0316582_0016884 3300036647 Bacteria 4209
615 Ga0316582_0056601 3300036647 Bacteria 2502
616 Ga0316582_0150277 3300036647 Bacteria 1574
617 Ga0316582_0597815 3300036647 Bacteria 759
618 Ga0316584_0005998 3300036712 Bacteria 8207
619 Ga0316584_0010426 3300036712 Bacteria 6492
620 Ga0316584_0070263 3300036712 Bacteria 2625
621 Ga0373925_0240568 3300037068 Bacteria 1449
622 Ga0373925_0434199 3300037068 Bacteria 1074
623 Ga0373925_0511731 3300037068 Bacteria 986
624 Ga0316581_0041213 3300037588 Bacteria 1407
625 Ga0436365_0411158 3300039437 Bacteria 710
626 Ga0436360_0392409 3300039438 Bacteria 2321
627 Ga0436363_0456827 3300039450 Bacteria 2453
628 Ga0436363_1573750 3300039450 Bacteria 844
629 Ga0436362_1301351 3300039453 Bacteria 746
630 Ga0451789_0353459 3300041443 Bacteria 525
631 Ga0451793_1825493 3300041452 Bacteria 829
632 Ga0451798_1034020 3300041458 Bacteria 780
633 Ga0451800_1214791 3300041459 Bacteria 532
634 Ga0451807_1485021 3300041486 Bacteria 1753
635 Ga0451807_2215334 3300041486 Bacteria 717
636 Ga0451833_0008883 3300041491 Bacteria 1485
637 Ga0451835_0345989 3300041492 Bacteria 895
638 Ga0451837_0983837 3300041494 Bacteria 516
639 Ga0451837_1501591 3300041494 Bacteria 808
640 Ga0451840_06294 3300041497 Bacteria 860
641 Ga0451841_1463338 3300041498 Bacteria 1322
642 Ga0451845_0229210 3300041501 Bacteria 771
643 Ga0451846_14676 3300041502 Bacteria 898
644 Ga0451849_0473118 3300041505 Bacteria 2137
645 Ga0451850_00677 3300041506 Bacteria 552
646 Ga0451853_1240809 3300041512 Bacteria 4527
647 Ga0452271_01179 3300041916 Bacteria 861
648 Ga0439460_0246194 3300042461 Unclassified 617
649 Ga0451577_0611798 3300042876 Bacteria 988
650 Ga0466972_0008680 3300044658 Bacteria 5096
651 Ga0453683_0304485 3300044673 Bacteria 1020
652 Ga0453684_0451605 3300044712 Bacteria 1430
653 Ga0453684_0686722 3300044712 Bacteria 1114
654 Ga0466970_0009577 3300044765 Bacteria 4900
655 Ga0466970_0078266 3300044765 Bacteria 1784
656 Ga0451576_2104479 3300045051 Unclassified 580
657 Ga0495629_0645374 3300046459 Bacteria 706
658 Ga0495650_0170507 3300046471 Bacteria 771
659 Ga0495580_0013106 3300046472 Bacteria 6346
660 Ga0495594_0645404 3300046499 Bacteria 599
661 Ga0495608_0523263 3300046511 Bacteria 717
662 Ga0495618_0228168 3300046514 Bacteria 1173
663 Ga0495628_0581050 3300046516 Bacteria 802
664 Ga0495630_0152932 3300046517 Bacteria 1756
665 Ga0495630_0165482 3300046517 Bacteria 1684
666 Ga0495640_0266487 3300046533 Bacteria 1069
667 Ga0495640_0432619 3300046533 Bacteria 805
668 Ga0495587_0349952 3300046536 Bacteria 824
669 Ga0495645_0343941 3300046543 Bacteria 963
670 Ga0495599_0317553 3300046678 Bacteria 938
671 Ga0495671_0016881 3300046692 Bacteria 3891
672 Ga0496100_0033871 3300048903 Bacteria 3199
673 Ga0496101_0010790 3300048904 Bacteria 6044
674 Ga0496102_0545215 3300048905 Bacteria 1082
675 Ga0496103_0328727 3300048906 Bacteria 983
676 Ga0496104_0223667 3300048907 Bacteria 1794
677 Ga0496105_0424344 3300048908 Bacteria 1052
678 Ga0496106_0757912 3300048909 Bacteria 771
679 Ga0496107_0085865 3300048910 Bacteria 2296
680 Ga0496108_0681238 3300048911 Unclassified 892
681 Ga0496109_0109550 3300048912 Bacteria 2567
682 Ga0496110_1042907 3300048913 Bacteria 725
683 Ga0496111_0037235 3300048914 Bacteria 3482
684 Ga0496113_0104392 3300048916 Bacteria 2199
685 Ga0496114_0506744 3300048917 Bacteria 1067
686 Ga0496115_0035264 3300048918 Bacteria 3957
687 Ga0496115_1039462 3300048918 Bacteria 624
688 Ga0495682_0162651 3300049460 Bacteria 795
689 Ga0495682_0331662 3300049460 Bacteria 536
690 Ga0501032_0090020 3300049569 Bacteria 2036
691 Ga0501032_0766765 3300049569 Bacteria 610
692 Ga0501033_0054100 3300049570 Bacteria 2970
693 Ga0501033_0467696 3300049570 Bacteria 874
694 Ga0501034_0097084 3300049571 Bacteria 2942
695 Ga0501034_1273316 3300049571 Bacteria 612
696 Ga0501036_1213302 3300049572 Bacteria 614
697 Ga0501037_0143613 3300049573 Bacteria 1707
698 Ga0501037_0234561 3300049573 Bacteria 1287
699 Ga0501038_0003475 3300049574 Bacteria 14682
700 Ga0501038_0870035 3300049574 Bacteria 666
701 Ga0501039_0071659 3300049575 Bacteria 2692
702 Ga0501039_1172331 3300049575 Bacteria 594
703 Ga0501040_0156528 3300049576 Bacteria 1609
704 Ga0501043_0232800 3300049579 Bacteria 1422
705 Ga0501043_1154002 3300049579 Bacteria 545
706 Ga0501046_0018192 3300049580 Bacteria 5852
707 Ga0501047_0120716 3300049581 Bacteria 2503
708 Ga0501047_1051297 3300049581 Bacteria 627
709 Ga0501068_0218363 3300049584 Bacteria 1211
710 Ga0501068_1052655 3300049584 Bacteria 537
711 Ga0501069_0464032 3300049585 Bacteria 753
712 Ga0501070_1002660 3300049586 Bacteria 647
713 Ga0501071_0370558 3300049587 Bacteria 1091
714 Ga0501073_0013869 3300049589 Bacteria 5858
715 Ga0501073_0149688 3300049589 Bacteria 1617
716 Ga0501073_0423152 3300049589 Bacteria 920
717 Ga0501074_0044879 3300049590 Bacteria 3198
718 Ga0501074_0163833 3300049590 Bacteria 1587
719 Ga0501077_0502197 3300049593 Bacteria 778
720 Ga0501217_170714 3300049661 Bacteria 662
721 Ga0501079_0480416 3300049741 Bacteria 976
722 Ga0501080_0166993 3300049742 Bacteria 2030
723 Ga0501080_0707023 3300049742 Bacteria 888
724 Ga0501081_0691398 3300049743 Bacteria 766
725 Ga0501044_0042994 3300049823 Bacteria 4695
726 Ga0501044_0335225 3300049823 Bacteria 1434
727 Ga0501045_1246325 3300049824 Bacteria 542
728 nmdc:mga07m45_848798_c1 3300050496 Bacteria 523
729 nmdc:mga09592_991942_c1 3300050508 Bacteria 702
730 nmdc:mga0qj67_316452_c1 3300050509 Bacteria 1264
731 nmdc:mga06r32_445017_c1 3300050510 Bacteria 1276
732 nmdc:mga08y16_1304457_c1 3300050511 Bacteria 692
733 nmdc:mga08y16_298050_c1 3300050511 Bacteria 1662
734 Ga0495612_0174705 3300053078 Unclassified 942
735 Ga0500610_0005232 3300053079 Bacteria 5288
736 Ga0500610_0362080 3300053079 Bacteria 608
737 Ga0500635_0363587 3300053080 Bacteria 573
738 Ga0495595_0130967 3300053084 Bacteria 1226
739 Ga0495619_0315727 3300053085 Bacteria 1082
740 Ga0500644_0431516 3300053088 Bacteria 576
741 Ga0500646_0090643 3300053090 Bacteria 946
742 Ga0500583_0063188 3300053092 Bacteria 1753
743 Ga0500651_0002589 3300053093 Bacteria 9606
744 Ga0500651_0137464 3300053093 Bacteria 1475
745 Ga0500651_0266889 3300053093 Bacteria 991
746 Ga0500641_0008120 3300053096 Bacteria 3739
747 Ga0500641_0163066 3300053096 Bacteria 961
748 Ga0500562_173204 3300053108 Bacteria 586
749 Ga0500595_168295 3300053119 Bacteria 609
750 Ga0500617_050452 3300053124 Bacteria 1857
751 Ga0500652_050386 3300053131 Bacteria 1699
752 Ga0500658_0343158 3300053134 Unclassified 686
753 Ga0500568_0100495 3300053139 Bacteria 1085
754 Ga0500568_0158097 3300053139 Bacteria 837
755 Ga0500568_0338070 3300053139 Bacteria 546
756 Ga0500588_0005662 3300053146 Bacteria 2787
757 Ga0500588_0068160 3300053146 Bacteria 1159
758 Ga0500600_0247094 3300053149 Bacteria 802
759 Ga0500616_0073908 3300053153 Bacteria 1729
760 Ga0500622_0018332 3300053156 Bacteria 3722
761 Ga0500637_0092901 3300053178 Bacteria 1748
762 Ga0500611_048514 3300053727 Unclassified 963
763 Ga0587094_030746 3300059513 Bacteria 831
764 Ga0587107_004057 3300059652 Bacteria 1463
765 Ga0501082_0032648 3300060353 Bacteria 4491
766 Ga0530510_0114701 3300061734 Bacteria 1975

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035398 Ga0316574_0001466 Ga0316574_0001466_5313_5543 58
2 3300035398 Ga0316574_0738777 Ga0316574_0738777_218_439 58
3 3300035398 Ga0316574_0938992 Ga0316574_0938992_208_447 58
4 3300036647 Ga0316582_0597815 Ga0316582_0597815_166_396 58
5 3300009545 Ga0105237_11365595 Ga0105237_113655951 59
6 3300010375 Ga0105239_12727937 Ga0105239_127279371 59
7 3300013104 Ga0157370_10306834 Ga0157370_103068342 59
8 3300005340 Ga0070689_100563746 Ga0070689_1005637461 60
9 3300005341 Ga0070691_10736879 Ga0070691_107368792 60
10 3300005353 Ga0070669_101329635 Ga0070669_1013296352 60
11 3300005354 Ga0070675_100463179 Ga0070675_1004631792 60
12 3300005438 Ga0070701_11308421 Ga0070701_113084211 60
13 3300005441 Ga0070700_100148850 Ga0070700_1001488504 60
14 3300005459 Ga0068867_100520140 Ga0068867_1005201402 60
15 3300005466 Ga0070685_10305927 Ga0070685_103059272 60
16 3300005545 Ga0070695_101081162 Ga0070695_1010811621 60
17 3300005617 Ga0068859_100303991 Ga0068859_1003039912 60
18 3300005719 Ga0068861_101253916 Ga0068861_1012539161 60
19 3300005841 Ga0068863_100936417 Ga0068863_1009364174 60
20 3300006931 Ga0097620_100304005 Ga0097620_1003040052 60
21 3300010375 Ga0105239_12062880 Ga0105239_120628801 60
22 3300013306 Ga0163162_11764840 Ga0163162_117648403 60
23 3300013308 Ga0157375_10277551 Ga0157375_102775512 60
24 3300041486 Ga0451807_1485021 Ga0451807_1485021_736_945 60
25 3300005578 Ga0068854_100733067 Ga0068854_1007330673 61
26 3300005842 Ga0068858_100183086 Ga0068858_1001830862 61
27 3300005843 Ga0068860_101213284 Ga0068860_1012132841 61
28 3300006358 Ga0068871_101724505 Ga0068871_1017245052 61
29 3300009101 Ga0105247_11764360 Ga0105247_117643601 61
30 3300009177 Ga0105248_10346642 Ga0105248_103466422 61
31 3300013308 Ga0157375_11879304 Ga0157375_118793042 61
32 3300025936 Ga0207670_11404998 Ga0207670_114049981 61
33 3300025941 Ga0207711_11012198 Ga0207711_110121982 61
34 3300025981 Ga0207640_10928409 Ga0207640_109284092 61
35 3300026035 Ga0207703_11807812 Ga0207703_118078122 61
36 3300026088 Ga0207641_12544060 Ga0207641_125440601 61
37 3300026095 Ga0207676_10218162 Ga0207676_102181621 61
38 3300053139 Ga0500568_0100495 Ga0500568_0100495_513_731 61
39 3300005617 Ga0068859_100889466 Ga0068859_1008894662 62
40 3300005719 Ga0068861_101820479 Ga0068861_1018204792 62
41 3300005844 Ga0068862_100393212 Ga0068862_1003932122 62
42 3300006844 Ga0075428_100352504 Ga0075428_1003525042 62
43 3300006847 Ga0075431_101129940 Ga0075431_1011299402 62
44 3300006931 Ga0097620_100889506 Ga0097620_1008895062 62
45 3300009093 Ga0105240_10090641 Ga0105240_100906412 62
46 3300009094 Ga0111539_10877895 Ga0111539_108778953 62
47 3300009545 Ga0105237_10040525 Ga0105237_100405253 62
48 3300013105 Ga0157369_10006603 Ga0157369_1000660314 62
49 3300026118 Ga0207675_101574605 Ga0207675_1015746051 62
50 3300028380 Ga0268265_10038567 Ga0268265_100385672 62
51 3300028794 Ga0307515_10039654 Ga0307515_100396543 62
52 3300036712 Ga0316584_0070263 Ga0316584_0070263_501_737 62
53 3300037588 Ga0316581_0041213 Ga0316581_0041213_1108_1344 62
54 3300050508 nmdc:mga09592_991942_c1 nmdc:mga09592_991942_c1_194_403 62
55 3300050511 nmdc:mga08y16_1304457_c1 nmdc:mga08y16_1304457_c1_321_530 62
56 3300053153 Ga0500616_0073908 Ga0500616_0073908_558_776 62
57 3300009174 Ga0105241_10227568 Ga0105241_102275682 63
58 3300025261 Ga0209233_1003300 Ga0209233_10033002 63
59 3300001904 JGI24736J21556_1036419 JGI24736J21556_10364192 64
60 3300005331 Ga0070670_100006835 Ga0070670_1000068352 64
61 3300005335 Ga0070666_10048447 Ga0070666_100484474 64
62 3300005338 Ga0068868_100082626 Ga0068868_1000826262 64
63 3300005344 Ga0070661_100079174 Ga0070661_1000791742 64
64 3300005355 Ga0070671_100046776 Ga0070671_1000467764 64
65 3300005367 Ga0070667_100059421 Ga0070667_1000594212 64
66 3300005455 Ga0070663_100019820 Ga0070663_1000198202 64
67 3300005457 Ga0070662_100147198 Ga0070662_1001471982 64
68 3300005459 Ga0068867_100604742 Ga0068867_1006047422 64
69 3300005539 Ga0068853_100008660 Ga0068853_1000086601 64
70 3300005539 Ga0068853_102248829 Ga0068853_1022488291 64
71 3300005548 Ga0070665_100001699 Ga0070665_10000169921 64
72 3300005563 Ga0068855_100041147 Ga0068855_1000411471 64
73 3300005563 Ga0068855_100468581 Ga0068855_1004685812 64
74 3300005564 Ga0070664_100343447 Ga0070664_1003434473 64
75 3300005564 Ga0070664_101154623 Ga0070664_1011546232 64
76 3300005577 Ga0068857_101428136 Ga0068857_1014281361 64
77 3300005578 Ga0068854_100120335 Ga0068854_1001203358 64
78 3300005578 Ga0068854_100298936 Ga0068854_1002989362 64
79 3300005578 Ga0068854_100788410 Ga0068854_1007884102 64
80 3300005614 Ga0068856_100010069 Ga0068856_1000100694 64
81 3300005614 Ga0068856_100836988 Ga0068856_1008369883 64
82 3300005614 Ga0068856_102005565 Ga0068856_1020055651 64
83 3300005616 Ga0068852_100001584 Ga0068852_1000015842 64
84 3300005616 Ga0068852_100064971 Ga0068852_1000649712 64
85 3300005617 Ga0068859_100926005 Ga0068859_1009260052 64
86 3300005834 Ga0068851_10094016 Ga0068851_100940162 64
87 3300005842 Ga0068858_100161521 Ga0068858_1001615212 64
88 3300006237 Ga0097621_100169235 Ga0097621_1001692353 64
89 3300006353 Ga0075370_10753971 Ga0075370_107539711 64
90 3300006358 Ga0068871_100215893 Ga0068871_1002158933 64
91 3300006881 Ga0068865_100017320 Ga0068865_1000173204 64
92 3300006881 Ga0068865_100038582 Ga0068865_1000385821 64
93 3300006931 Ga0097620_100925935 Ga0097620_1009259352 64
94 3300009093 Ga0105240_10015775 Ga0105240_1001577512 64
95 3300009093 Ga0105240_10540715 Ga0105240_105407151 64
96 3300009098 Ga0105245_11937624 Ga0105245_119376241 64
97 3300009174 Ga0105241_10035532 Ga0105241_100355322 64
98 3300009174 Ga0105241_10043847 Ga0105241_100438472 64
99 3300009176 Ga0105242_10062818 Ga0105242_100628188 64
100 3300009545 Ga0105237_10005972 Ga0105237_100059729 64
101 3300009545 Ga0105237_10298519 Ga0105237_102985191 64
102 3300009551 Ga0105238_10008246 Ga0105238_100082465 64
103 3300009551 Ga0105238_10165784 Ga0105238_101657842 64
104 3300009553 Ga0105249_10681332 Ga0105249_106813324 64
105 3300010375 Ga0105239_10013679 Ga0105239_1001367911 64
106 3300010375 Ga0105239_10032021 Ga0105239_100320215 64
107 3300013104 Ga0157370_10183500 Ga0157370_101835002 64
108 3300013104 Ga0157370_10372969 Ga0157370_103729693 64
109 3300013105 Ga0157369_10000195 Ga0157369_1000019544 64
110 3300013105 Ga0157369_10032217 Ga0157369_100322172 64
111 3300013306 Ga0163162_10015010 Ga0163162_100150102 64
112 3300013307 Ga0157372_10003204 Ga0157372_100032046 64
113 3300013308 Ga0157375_10000940 Ga0157375_1000094018 64
114 3300014325 Ga0163163_11959003 Ga0163163_119590032 64
115 3300014497 Ga0182008_10550970 Ga0182008_105509701 64
116 3300014969 Ga0157376_10016323 Ga0157376_100163235 64
117 3300020078 Ga0206352_10293537 Ga0206352_102935371 64
118 3300025906 Ga0207699_10617858 Ga0207699_106178582 64
119 3300025911 Ga0207654_10585937 Ga0207654_105859371 64
120 3300025913 Ga0207695_10002778 Ga0207695_100027789 64
121 3300025914 Ga0207671_10001147 Ga0207671_1000114713 64
122 3300025924 Ga0207694_10000162 Ga0207694_1000016242 64
123 3300025961 Ga0207712_10505403 Ga0207712_105054033 64
124 3300025981 Ga0207640_11143830 Ga0207640_111438302 64
125 3300048918 Ga0496115_1039462 Ga0496115_1039462_129_392 64
126 3300050496 nmdc:mga07m45_848798_c1 nmdc:mga07m45_848798_c1_120_329 64
127 3300059652 Ga0587107_004057 Ga0587107_004057_142_375 64
128 3300004803 Ga0058862_12551623 Ga0058862_125516232 65
129 3300005295 Ga0065707_10230286 Ga0065707_102302861 65
130 3300005458 Ga0070681_10027498 Ga0070681_100274985 65
131 3300005530 Ga0070679_100128579 Ga0070679_1001285791 65
132 3300005530 Ga0070679_102134051 Ga0070679_1021340511 65
133 3300005563 Ga0068855_100936557 Ga0068855_1009365572 65
134 3300007788 Ga0099795_10019602 Ga0099795_100196022 65
135 3300009092 Ga0105250_10000008 Ga0105250_10000008128 65
136 3300009093 Ga0105240_11327580 Ga0105240_113275802 65
137 3300009098 Ga0105245_10982032 Ga0105245_109820322 65
138 3300009174 Ga0105241_10156914 Ga0105241_101569141 65
139 3300009982 Ga0105147_100236 Ga0105147_10023610 65
140 3300010375 Ga0105239_12371021 Ga0105239_123710212 65
141 3300013105 Ga0157369_10782110 Ga0157369_107821101 65
142 3300014968 Ga0157379_10001068 Ga0157379_100010685 65
143 3300025711 Ga0207696_1000106 Ga0207696_100010617 65
144 3300025911 Ga0207654_10068211 Ga0207654_100682112 65
145 3300025912 Ga0207707_10026840 Ga0207707_100268405 65
146 3300025913 Ga0207695_10145146 Ga0207695_101451462 65
147 3300025913 Ga0207695_10558339 Ga0207695_105583391 65
148 3300025921 Ga0207652_11391459 Ga0207652_113914592 65
149 3300025927 Ga0207687_10636388 Ga0207687_106363882 65
150 3300025949 Ga0207667_10722915 Ga0207667_107229152 65
151 3300031456 Ga0307513_10003009 Ga0307513_1000300917 65
152 3300032168 Ga0316593_10027136 Ga0316593_100271362 65
153 3300032168 Ga0316593_10177099 Ga0316593_101770991 65
154 3300033528 Ga0316588_1128663 Ga0316588_11286631 65
155 3300041458 Ga0451798_1034020 Ga0451798_1034020_32_244 65
156 3300041491 Ga0451833_0008883 Ga0451833_0008883_1261_1473 65
157 3300041492 Ga0451835_0345989 Ga0451835_0345989_150_362 65
158 3300041494 Ga0451837_1501591 Ga0451837_1501591_525_737 65
159 3300041497 Ga0451840_06294 Ga0451840_06294_174_386 65
160 3300041498 Ga0451841_1463338 Ga0451841_1463338_601_813 65
161 3300041501 Ga0451845_0229210 Ga0451845_0229210_24_236 65
162 3300041502 Ga0451846_14676 Ga0451846_14676_425_637 65
163 3300041505 Ga0451849_0473118 Ga0451849_0473118_1362_1574 65
164 3300041506 Ga0451850_00677 Ga0451850_00677_221_433 65
165 3300041512 Ga0451853_1240809 Ga0451853_1240809_3094_3306 65
166 3300041916 Ga0452271_01179 Ga0452271_01179_474_686 65
167 3300002067 JGI24735J21928_10125450 JGI24735J21928_101254502 66
168 3300002705 JGI25156J39149_1004445 JGI25156J39149_10044452 66
169 3300002737 JGI25162J39368_1004805 JGI25162J39368_10048052 66
170 3300002738 JGI25154J39366_1012161 JGI25154J39366_10121613 66
171 3300002738 JGI25154J39366_1028219 JGI25154J39366_10282191 66
172 3300002741 JGI25157J39369_1000172 JGI25157J39369_10001722 66
173 3300002741 JGI25157J39369_1000651 JGI25157J39369_100065113 66
174 3300002741 JGI25157J39369_1003545 JGI25157J39369_10035452 66
175 3300002771 JGI25163J39215_1000867 JGI25163J39215_10008672 66
176 3300002772 JGI25164J39214_1000263 JGI25164J39214_10002632 66
177 3300002772 JGI25164J39214_1001469 JGI25164J39214_10014696 66
178 3300003214 JGI25165J46597_1000473 JGI25165J46597_10004732 66
179 3300003214 JGI25165J46597_1002594 JGI25165J46597_10025946 66
180 3300003751 Ga0055538_1003671 Ga0055538_10036712 66
181 3300003752 Ga0055539_1001567 Ga0055539_10015672 66
182 3300003756 Ga0055533_1002616 Ga0055533_10026161 66
183 3300003760 Ga0055527_1000466 Ga0055527_100046614 66
184 3300003760 Ga0055527_1004919 Ga0055527_10049192 66
185 3300003761 Ga0055535_1001065 Ga0055535_10010652 66
186 3300003761 Ga0055535_1001154 Ga0055535_100115414 66
187 3300003761 Ga0055535_1001333 Ga0055535_10013331 66
188 3300003761 Ga0055535_1002782 Ga0055535_10027826 66
189 3300003762 Ga0055542_1000183 Ga0055542_10001832 66
190 3300003762 Ga0055542_1000423 Ga0055542_10004232 66
191 3300003762 Ga0055542_1001148 Ga0055542_100114814 66
192 3300003763 Ga0055529_1000116 Ga0055529_1000116120 66
193 3300003763 Ga0055529_1000189 Ga0055529_100018988 66
194 3300003763 Ga0055529_1000934 Ga0055529_10009342 66
195 3300003763 Ga0055529_1008658 Ga0055529_10086582 66
196 3300003841 Ga0055541_1026526 Ga0055541_10265261 66
197 3300004803 Ga0058862_12834623 Ga0058862_128346232 66
198 3300005293 Ga0065715_10717176 Ga0065715_107171762 66
199 3300005331 Ga0070670_100815699 Ga0070670_1008156992 66
200 3300005333 Ga0070677_10014576 Ga0070677_100145762 66
201 3300005336 Ga0070680_100848346 Ga0070680_1008483462 66
202 3300005337 Ga0070682_100082465 Ga0070682_1000824653 66
203 3300005337 Ga0070682_100406135 Ga0070682_1004061352 66
204 3300005339 Ga0070660_100100092 Ga0070660_1001000922 66
205 3300005339 Ga0070660_101177686 Ga0070660_1011776862 66
206 3300005340 Ga0070689_100041539 Ga0070689_1000415392 66
207 3300005341 Ga0070691_10438235 Ga0070691_104382351 66
208 3300005344 Ga0070661_100023087 Ga0070661_1000230874 66
209 3300005344 Ga0070661_100041870 Ga0070661_1000418704 66
210 3300005344 Ga0070661_101074462 Ga0070661_1010744621 66
211 3300005345 Ga0070692_10057912 Ga0070692_100579123 66
212 3300005347 Ga0070668_100679357 Ga0070668_1006793571 66
213 3300005353 Ga0070669_100048736 Ga0070669_1000487363 66
214 3300005354 Ga0070675_100893280 Ga0070675_1008932802 66
215 3300005365 Ga0070688_100107312 Ga0070688_1001073122 66
216 3300005366 Ga0070659_100492215 Ga0070659_1004922153 66
217 3300005366 Ga0070659_100953547 Ga0070659_1009535472 66
218 3300005435 Ga0070714_100000280 Ga0070714_10000028028 66
219 3300005435 Ga0070714_101306806 Ga0070714_1013068061 66
220 3300005437 Ga0070710_10094052 Ga0070710_100940522 66
221 3300005439 Ga0070711_100847153 Ga0070711_1008471532 66
222 3300005441 Ga0070700_100014142 Ga0070700_1000141422 66
223 3300005444 Ga0070694_100384741 Ga0070694_1003847411 66
224 3300005445 Ga0070708_101612759 Ga0070708_1016127591 66
225 3300005455 Ga0070663_100457914 Ga0070663_1004579142 66
226 3300005457 Ga0070662_100686337 Ga0070662_1006863373 66
227 3300005458 Ga0070681_10029162 Ga0070681_100291624 66
228 3300005458 Ga0070681_10118109 Ga0070681_101181092 66
229 3300005459 Ga0068867_100973986 Ga0068867_1009739861 66
230 3300005518 Ga0070699_102026524 Ga0070699_1020265241 66
231 3300005530 Ga0070679_100132799 Ga0070679_1001327992 66
232 3300005539 Ga0068853_100692800 Ga0068853_1006928001 66
233 3300005539 Ga0068853_101968166 Ga0068853_1019681662 66
234 3300005543 Ga0070672_100474647 Ga0070672_1004746472 66
235 3300005546 Ga0070696_100002294 Ga0070696_1000022948 66
236 3300005546 Ga0070696_100143615 Ga0070696_1001436152 66
237 3300005547 Ga0070693_100052139 Ga0070693_1000521392 66
238 3300005549 Ga0070704_101727714 Ga0070704_1017277141 66
239 3300005563 Ga0068855_100062440 Ga0068855_1000624402 66
240 3300005577 Ga0068857_100135589 Ga0068857_1001355893 66
241 3300005578 Ga0068854_100042202 Ga0068854_1000422022 66
242 3300005614 Ga0068856_100025896 Ga0068856_1000258962 66
243 3300005614 Ga0068856_100102163 Ga0068856_1001021633 66
244 3300005616 Ga0068852_100403855 Ga0068852_1004038553 66
245 3300005617 Ga0068859_100047914 Ga0068859_1000479142 66
246 3300005719 Ga0068861_100217883 Ga0068861_1002178833 66
247 3300005840 Ga0068870_10588278 Ga0068870_105882782 66
248 3300005841 Ga0068863_102368474 Ga0068863_1023684741 66
249 3300005844 Ga0068862_100112276 Ga0068862_1001122762 66
250 3300005844 Ga0068862_100137988 Ga0068862_1001379882 66
251 3300005844 Ga0068862_101697625 Ga0068862_1016976252 66
252 3300006175 Ga0070712_100395387 Ga0070712_1003953873 66
253 3300006846 Ga0075430_100326959 Ga0075430_1003269593 66
254 3300006881 Ga0068865_100081125 Ga0068865_1000811252 66
255 3300006931 Ga0097620_100047914 Ga0097620_1000479149 66
256 3300007265 Ga0099794_10048122 Ga0099794_100481222 66
257 3300009093 Ga0105240_12145360 Ga0105240_121453602 66
258 3300009093 Ga0105240_12244741 Ga0105240_122447411 66
259 3300009148 Ga0105243_11097375 Ga0105243_110973752 66
260 3300009174 Ga0105241_10188228 Ga0105241_101882282 66
261 3300009176 Ga0105242_12749447 Ga0105242_127494471 66
262 3300009545 Ga0105237_10000150 Ga0105237_1000015054 66
263 3300009545 Ga0105237_10337726 Ga0105237_103377262 66
264 3300009551 Ga0105238_10268956 Ga0105238_102689561 66
265 3300009551 Ga0105238_10281269 Ga0105238_102812692 66
266 3300009551 Ga0105238_10473491 Ga0105238_104734911 66
267 3300009553 Ga0105249_10145185 Ga0105249_101451853 66
268 3300009553 Ga0105249_10656020 Ga0105249_106560202 66
269 3300009553 Ga0105249_11804265 Ga0105249_118042651 66
270 3300012498 Ga0157345_1044836 Ga0157345_10448361 66
271 3300013102 Ga0157371_10481013 Ga0157371_104810132 66
272 3300013104 Ga0157370_10026079 Ga0157370_100260792 66
273 3300013104 Ga0157370_10048901 Ga0157370_100489012 66
274 3300013105 Ga0157369_10457947 Ga0157369_104579472 66
275 3300013105 Ga0157369_10811291 Ga0157369_108112912 66
276 3300013105 Ga0157369_12390275 Ga0157369_123902751 66
277 3300013306 Ga0163162_10859561 Ga0163162_108595612 66
278 3300013306 Ga0163162_10958359 Ga0163162_109583591 66
279 3300013307 Ga0157372_10197876 Ga0157372_101978762 66
280 3300013307 Ga0157372_10242016 Ga0157372_102420162 66
281 3300013307 Ga0157372_10352792 Ga0157372_103527922 66
282 3300014325 Ga0163163_11621400 Ga0163163_116214001 66
283 3300014326 Ga0157380_13314531 Ga0157380_133145312 66
284 3300014497 Ga0182008_10017135 Ga0182008_100171351 66
285 3300014497 Ga0182008_10316004 Ga0182008_103160041 66
286 3300014497 Ga0182008_10991618 Ga0182008_109916181 66
287 3300014969 Ga0157376_10016137 Ga0157376_100161372 66
288 3300015261 Ga0182006_1061226 Ga0182006_10612262 66
289 3300015261 Ga0182006_1073080 Ga0182006_10730802 66
290 3300015262 Ga0182007_10018362 Ga0182007_100183625 66
291 3300015262 Ga0182007_10073467 Ga0182007_100734673 66
292 3300015262 Ga0182007_10136952 Ga0182007_101369522 66
293 3300021441 Ga0213871_10050786 Ga0213871_100507862 66
294 3300025893 Ga0207682_10123677 Ga0207682_101236772 66
295 3300025899 Ga0207642_11035704 Ga0207642_110357042 66
296 3300025907 Ga0207645_10000555 Ga0207645_100005552 66
297 3300025908 Ga0207643_10090881 Ga0207643_100908813 66
298 3300025913 Ga0207695_10155057 Ga0207695_101550573 66
299 3300025917 Ga0207660_10285568 Ga0207660_102855682 66
300 3300025923 Ga0207681_10922822 Ga0207681_109228221 66
301 3300025925 Ga0207650_11595681 Ga0207650_115956813 66
302 3300025926 Ga0207659_10324316 Ga0207659_103243163 66
303 3300025932 Ga0207690_10282998 Ga0207690_102829982 66
304 3300025933 Ga0207706_10040416 Ga0207706_100404162 66
305 3300025937 Ga0207669_10149595 Ga0207669_101495952 66
306 3300025938 Ga0207704_10006657 Ga0207704_100066575 66
307 3300025940 Ga0207691_10000451 Ga0207691_1000045125 66
308 3300025961 Ga0207712_10091893 Ga0207712_100918933 66
309 3300025961 Ga0207712_10380477 Ga0207712_103804772 66
310 3300025972 Ga0207668_10617994 Ga0207668_106179941 66
311 3300026075 Ga0207708_10177287 Ga0207708_101772873 66
312 3300026089 Ga0207648_10001019 Ga0207648_1000101928 66
313 3300026089 Ga0207648_10645583 Ga0207648_106455832 66
314 3300026118 Ga0207675_100000567 Ga0207675_1000005674 66
315 3300026142 Ga0207698_12459574 Ga0207698_124595741 66
316 3300027424 Ga0209984_1022770 Ga0209984_10227701 66
317 3300027462 Ga0210000_1014842 Ga0210000_10148422 66
318 3300027526 Ga0209968_1102306 Ga0209968_11023061 66
319 3300027543 Ga0209999_1062402 Ga0209999_10624022 66
320 3300027552 Ga0209982_1000529 Ga0209982_10005295 66
321 3300027614 Ga0209970_1004527 Ga0209970_10045272 66
322 3300027617 Ga0210002_1016968 Ga0210002_10169682 66
323 3300027665 Ga0209983_1006005 Ga0209983_10060052 66
324 3300027682 Ga0209971_1000724 Ga0209971_100072410 66
325 3300027876 Ga0209974_10001096 Ga0209974_100010961 66
326 3300028380 Ga0268265_10005940 Ga0268265_100059408 66
327 3300028380 Ga0268265_11114183 Ga0268265_111141832 66
328 3300030836 Ga0265767_118865 Ga0265767_1188651 66
329 3300031242 Ga0265329_10223036 Ga0265329_102230361 66
330 3300031251 Ga0265327_10002526 Ga0265327_1000252612 66
331 3300031251 Ga0265327_10002740 Ga0265327_1000274010 66
332 3300031344 Ga0265316_10002788 Ga0265316_1000278812 66
333 3300031665 Ga0316575_10076648 Ga0316575_100766483 66
334 3300031691 Ga0316579_10097391 Ga0316579_100973912 66
335 3300031727 Ga0316576_10012939 Ga0316576_100129392 66
336 3300031728 Ga0316578_10079519 Ga0316578_100795193 66
337 3300031733 Ga0316577_10099242 Ga0316577_100992423 66
338 3300032137 Ga0316585_10131291 Ga0316585_101312913 66
339 3300032139 Ga0316580_10055138 Ga0316580_100551381 66
340 3300033528 Ga0316588_1164854 Ga0316588_11648542 66
341 3300035398 Ga0316574_0071068 Ga0316574_0071068_927_1157 66
342 3300036647 Ga0316582_0150277 Ga0316582_0150277_1058_1288 66
343 3300036712 Ga0316584_0005998 Ga0316584_0005998_7052_7282 66
344 3300039438 Ga0436360_0392409 Ga0436360_0392409_1438_1656 66
345 3300039453 Ga0436362_1301351 Ga0436362_1301351_486_704 66
346 3300042461 Ga0439460_0246194 Ga0439460_0246194_283_513 66
347 3300049460 Ga0495682_0331662 Ga0495682_0331662_35_253 66
348 3300049569 Ga0501032_0090020 Ga0501032_0090020_790_1011 66
349 3300049570 Ga0501033_0054100 Ga0501033_0054100_1038_1259 66
350 3300049571 Ga0501034_0097084 Ga0501034_0097084_1712_1933 66
351 3300049573 Ga0501037_0234561 Ga0501037_0234561_29_250 66
352 3300049574 Ga0501038_0003475 Ga0501038_0003475_13473_13694 66
353 3300049575 Ga0501039_0071659 Ga0501039_0071659_1556_1777 66
354 3300049579 Ga0501043_0232800 Ga0501043_0232800_1012_1233 66
355 3300049580 Ga0501046_0018192 Ga0501046_0018192_1035_1256 66
356 3300049581 Ga0501047_0120716 Ga0501047_0120716_1038_1259 66
357 3300049584 Ga0501068_0218363 Ga0501068_0218363_201_422 66
358 3300049585 Ga0501069_0464032 Ga0501069_0464032_15_236 66
359 3300049586 Ga0501070_1002660 Ga0501070_1002660_347_568 66
360 3300049587 Ga0501071_0370558 Ga0501071_0370558_570_791 66
361 3300049589 Ga0501073_0013869 Ga0501073_0013869_1039_1260 66
362 3300049590 Ga0501074_0044879 Ga0501074_0044879_2711_2932 66
363 3300049741 Ga0501079_0480416 Ga0501079_0480416_407_628 66
364 3300049742 Ga0501080_0166993 Ga0501080_0166993_791_1012 66
365 3300049823 Ga0501044_0335225 Ga0501044_0335225_1027_1236 66
366 3300050509 nmdc:mga0qj67_316452_c1 nmdc:mga0qj67_316452_c1_450_680 66
367 3300050510 nmdc:mga06r32_445017_c1 nmdc:mga06r32_445017_c1_925_1155 66
368 3300053093 Ga0500651_0002589 Ga0500651_0002589_4713_4922 66
369 3300053146 Ga0500588_0068160 Ga0500588_0068160_846_1070 66
370 3300005327 Ga0070658_10233400 Ga0070658_102334003 67
371 3300005329 Ga0070683_102061891 Ga0070683_1020618911 67
372 3300005330 Ga0070690_100912466 Ga0070690_1009124661 67
373 3300005335 Ga0070666_10799671 Ga0070666_107996712 67
374 3300005338 Ga0068868_101101065 Ga0068868_1011010652 67
375 3300005355 Ga0070671_100003573 Ga0070671_1000035732 67
376 3300005356 Ga0070674_100613382 Ga0070674_1006133822 67
377 3300005367 Ga0070667_100018316 Ga0070667_1000183163 67
378 3300005434 Ga0070709_10857423 Ga0070709_108574231 67
379 3300005435 Ga0070714_101245989 Ga0070714_1012459891 67
380 3300005436 Ga0070713_100017354 Ga0070713_1000173542 67
381 3300005439 Ga0070711_100026241 Ga0070711_1000262413 67
382 3300005440 Ga0070705_101558335 Ga0070705_1015583351 67
383 3300005456 Ga0070678_101004605 Ga0070678_1010046051 67
384 3300005459 Ga0068867_101453226 Ga0068867_1014532261 67
385 3300005530 Ga0070679_100507914 Ga0070679_1005079141 67
386 3300005535 Ga0070684_100093077 Ga0070684_1000930775 67
387 3300005539 Ga0068853_101325108 Ga0068853_1013251081 67
388 3300005544 Ga0070686_101387543 Ga0070686_1013875431 67
389 3300005547 Ga0070693_100586594 Ga0070693_1005865942 67
390 3300005548 Ga0070665_100108128 Ga0070665_1001081282 67
391 3300005549 Ga0070704_100652717 Ga0070704_1006527172 67
392 3300005563 Ga0068855_100752765 Ga0068855_1007527651 67
393 3300005614 Ga0068856_100075332 Ga0068856_1000753323 67
394 3300005718 Ga0068866_10756460 Ga0068866_107564601 67
395 3300005718 Ga0068866_10946064 Ga0068866_109460642 67
396 3300005841 Ga0068863_100082402 Ga0068863_1000824023 67
397 3300005842 Ga0068858_100732637 Ga0068858_1007326372 67
398 3300005843 Ga0068860_100023471 Ga0068860_1000234714 67
399 3300006163 Ga0070715_10992291 Ga0070715_109922911 67
400 3300006173 Ga0070716_100191688 Ga0070716_1001916882 67
401 3300006175 Ga0070712_100002924 Ga0070712_1000029241 67
402 3300006237 Ga0097621_100043536 Ga0097621_1000435362 67
403 3300006358 Ga0068871_100011168 Ga0068871_1000111681 67
404 3300006881 Ga0068865_100009644 Ga0068865_1000096443 67
405 3300009098 Ga0105245_11655722 Ga0105245_116557222 67
406 3300009101 Ga0105247_10106647 Ga0105247_101066471 67
407 3300009174 Ga0105241_10245553 Ga0105241_102455532 67
408 3300009176 Ga0105242_10008331 Ga0105242_100083312 67
409 3300009177 Ga0105248_10112024 Ga0105248_101120243 67
410 3300009545 Ga0105237_10054148 Ga0105237_100541482 67
411 3300009553 Ga0105249_10575293 Ga0105249_105752932 67
412 3300009993 Ga0105028_112468 Ga0105028_1124681 67
413 3300010375 Ga0105239_11234746 Ga0105239_112347462 67
414 3300013296 Ga0157374_11180576 Ga0157374_111805762 67
415 3300013297 Ga0157378_10065280 Ga0157378_100652803 67
416 3300014325 Ga0163163_10157504 Ga0163163_101575042 67
417 3300014326 Ga0157380_10438919 Ga0157380_104389193 67
418 3300014969 Ga0157376_10534533 Ga0157376_105345331 67
419 3300025898 Ga0207692_10000125 Ga0207692_1000012517 67
420 3300025899 Ga0207642_10126051 Ga0207642_101260511 67
421 3300025899 Ga0207642_11046422 Ga0207642_110464222 67
422 3300025900 Ga0207710_10179411 Ga0207710_101794112 67
423 3300025903 Ga0207680_10765444 Ga0207680_107654441 67
424 3300025905 Ga0207685_10520394 Ga0207685_105203942 67
425 3300025906 Ga0207699_10478965 Ga0207699_104789651 67
426 3300025911 Ga0207654_10938105 Ga0207654_109381052 67
427 3300025913 Ga0207695_10053030 Ga0207695_100530304 67
428 3300025914 Ga0207671_11227308 Ga0207671_112273081 67
429 3300025915 Ga0207693_10001835 Ga0207693_1000183511 67
430 3300025916 Ga0207663_10294265 Ga0207663_102942652 67
431 3300025921 Ga0207652_10147104 Ga0207652_101471043 67
432 3300025928 Ga0207700_10039076 Ga0207700_100390763 67
433 3300025929 Ga0207664_11386363 Ga0207664_113863631 67
434 3300025931 Ga0207644_10117210 Ga0207644_101172102 67
435 3300025934 Ga0207686_10048381 Ga0207686_100483812 67
436 3300025937 Ga0207669_10808692 Ga0207669_108086921 67
437 3300025938 Ga0207704_10425885 Ga0207704_104258852 67
438 3300025939 Ga0207665_10003234 Ga0207665_100032341 67
439 3300025941 Ga0207711_10482024 Ga0207711_104820242 67
440 3300025944 Ga0207661_11846301 Ga0207661_118463011 67
441 3300025945 Ga0207679_10958029 Ga0207679_109580292 67
442 3300025949 Ga0207667_10576203 Ga0207667_105762031 67
443 3300025960 Ga0207651_10038543 Ga0207651_100385432 67
444 3300025986 Ga0207658_11272593 Ga0207658_112725931 67
445 3300026023 Ga0207677_10747923 Ga0207677_107479231 67
446 3300026035 Ga0207703_11551532 Ga0207703_115515322 67
447 3300026041 Ga0207639_11239388 Ga0207639_112393882 67
448 3300026078 Ga0207702_10038359 Ga0207702_100383594 67
449 3300026088 Ga0207641_10396615 Ga0207641_103966152 67
450 3300026121 Ga0207683_10042859 Ga0207683_100428591 67
451 3300028379 Ga0268266_10340617 Ga0268266_103406172 67
452 3300028381 Ga0268264_11001677 Ga0268264_110016771 67
453 3300031247 Ga0265340_10147244 Ga0265340_101472442 67
454 3300031903 Ga0307407_10358456 Ga0307407_103584562 67
455 3300032004 Ga0307414_11590771 Ga0307414_115907711 67
456 3300032005 Ga0307411_10740166 Ga0307411_107401661 67
457 3300035086 Ga0373934_0252923 Ga0373934_0252923_370_588 67
458 3300035111 Ga0373923_0053484 Ga0373923_0053484_1284_1502 67
459 3300035119 Ga0373956_0354586 Ga0373956_0354586_52_270 67
460 3300035170 Ga0373943_0037529 Ga0373943_0037529_1264_1482 67
461 3300035170 Ga0373943_0407042 Ga0373943_0407042_381_590 67
462 3300035724 Ga0373933_0110033 Ga0373933_0110033_720_938 67
463 3300036401 Ga0373937_0755674 Ga0373937_0755674_287_505 67
464 3300037068 Ga0373925_0240568 Ga0373925_0240568_1022_1240 67
465 3300037068 Ga0373925_0511731 Ga0373925_0511731_371_580 67
466 3300039450 Ga0436363_1573750 Ga0436363_1573750_179_397 67
467 3300046459 Ga0495629_0645374 Ga0495629_0645374_36_254 67
468 3300046472 Ga0495580_0013106 Ga0495580_0013106_6092_6310 67
469 3300046499 Ga0495594_0645404 Ga0495594_0645404_220_435 67
470 3300046511 Ga0495608_0523263 Ga0495608_0523263_367_585 67
471 3300046514 Ga0495618_0228168 Ga0495618_0228168_931_1149 67
472 3300046516 Ga0495628_0581050 Ga0495628_0581050_372_581 67
473 3300046517 Ga0495630_0152932 Ga0495630_0152932_1204_1413 67
474 3300046517 Ga0495630_0165482 Ga0495630_0165482_506_724 67
475 3300046533 Ga0495640_0266487 Ga0495640_0266487_697_912 67
476 3300046533 Ga0495640_0432619 Ga0495640_0432619_91_309 67
477 3300046536 Ga0495587_0349952 Ga0495587_0349952_513_731 67
478 3300046678 Ga0495599_0317553 Ga0495599_0317553_588_806 67
479 3300048903 Ga0496100_0033871 Ga0496100_0033871_2032_2250 67
480 3300048904 Ga0496101_0010790 Ga0496101_0010790_2893_3111 67
481 3300048905 Ga0496102_0545215 Ga0496102_0545215_374_592 67
482 3300048906 Ga0496103_0328727 Ga0496103_0328727_642_860 67
483 3300048907 Ga0496104_0223667 Ga0496104_0223667_1529_1747 67
484 3300048908 Ga0496105_0424344 Ga0496105_0424344_634_852 67
485 3300048909 Ga0496106_0757912 Ga0496106_0757912_464_682 67
486 3300048910 Ga0496107_0085865 Ga0496107_0085865_1319_1537 67
487 3300048911 Ga0496108_0681238 Ga0496108_0681238_642_860 67
488 3300048912 Ga0496109_0109550 Ga0496109_0109550_974_1192 67
489 3300048913 Ga0496110_1042907 Ga0496110_1042907_77_295 67
490 3300048914 Ga0496111_0037235 Ga0496111_0037235_1824_2042 67
491 3300048916 Ga0496113_0104392 Ga0496113_0104392_1907_2125 67
492 3300048917 Ga0496114_0506744 Ga0496114_0506744_295_513 67
493 3300048918 Ga0496115_0035264 Ga0496115_0035264_1319_1537 67
494 3300049570 Ga0501033_0467696 Ga0501033_0467696_486_710 67
495 3300049571 Ga0501034_1273316 Ga0501034_1273316_262_486 67
496 3300049572 Ga0501036_1213302 Ga0501036_1213302_150_374 67
497 3300049573 Ga0501037_0143613 Ga0501037_0143613_250_474 67
498 3300049574 Ga0501038_0870035 Ga0501038_0870035_165_389 67
499 3300049575 Ga0501039_1172331 Ga0501039_1172331_115_339 67
500 3300049576 Ga0501040_0156528 Ga0501040_0156528_1331_1555 67
501 3300049579 Ga0501043_1154002 Ga0501043_1154002_290_514 67
502 3300049581 Ga0501047_1051297 Ga0501047_1051297_239_463 67
503 3300049584 Ga0501068_1052655 Ga0501068_1052655_272_496 67
504 3300049589 Ga0501073_0423152 Ga0501073_0423152_561_785 67
505 3300049590 Ga0501074_0163833 Ga0501074_0163833_1241_1465 67
506 3300049593 Ga0501077_0502197 Ga0501077_0502197_271_495 67
507 3300049742 Ga0501080_0707023 Ga0501080_0707023_500_724 67
508 3300049743 Ga0501081_0691398 Ga0501081_0691398_151_375 67
509 3300049823 Ga0501044_0042994 Ga0501044_0042994_3886_4110 67
510 3300049824 Ga0501045_1246325 Ga0501045_1246325_44_268 67
511 3300053078 Ga0495612_0174705 Ga0495612_0174705_57_275 67
512 3300053084 Ga0495595_0130967 Ga0495595_0130967_877_1095 67
513 3300053085 Ga0495619_0315727 Ga0495619_0315727_771_989 67
514 3300061734 Ga0530510_0114701 Ga0530510_0114701_294_518 67
515 3300004800 Ga0058861_11990870 Ga0058861_119908702 68
516 3300004803 Ga0058862_12768923 Ga0058862_127689231 68
517 3300005290 Ga0065712_10790436 Ga0065712_107904361 68
518 3300005293 Ga0065715_10368505 Ga0065715_103685052 68
519 3300005329 Ga0070683_100038381 Ga0070683_1000383814 68
520 3300005330 Ga0070690_100523436 Ga0070690_1005234363 68
521 3300005334 Ga0068869_101096866 Ga0068869_1010968661 68
522 3300005336 Ga0070680_100033389 Ga0070680_1000333895 68
523 3300005347 Ga0070668_101466779 Ga0070668_1014667792 68
524 3300005353 Ga0070669_100134768 Ga0070669_1001347682 68
525 3300005367 Ga0070667_100566795 Ga0070667_1005667952 68
526 3300005455 Ga0070663_102096731 Ga0070663_1020967311 68
527 3300005458 Ga0070681_10089340 Ga0070681_100893402 68
528 3300005530 Ga0070679_100087757 Ga0070679_1000877572 68
529 3300005535 Ga0070684_100130862 Ga0070684_1001308622 68
530 3300005548 Ga0070665_100665120 Ga0070665_1006651202 68
531 3300005548 Ga0070665_100869596 Ga0070665_1008695962 68
532 3300005563 Ga0068855_100920244 Ga0068855_1009202441 68
533 3300005564 Ga0070664_100609626 Ga0070664_1006096262 68
534 3300005614 Ga0068856_101270568 Ga0068856_1012705682 68
535 3300005617 Ga0068859_100154876 Ga0068859_1001548762 68
536 3300005617 Ga0068859_101632010 Ga0068859_1016320102 68
537 3300005618 Ga0068864_100141471 Ga0068864_1001414713 68
538 3300005840 Ga0068870_10505628 Ga0068870_105056282 68
539 3300005841 Ga0068863_100097204 Ga0068863_1000972046 68
540 3300005842 Ga0068858_100710801 Ga0068858_1007108012 68
541 3300005843 Ga0068860_100323918 Ga0068860_1003239183 68
542 3300005844 Ga0068862_100254427 Ga0068862_1002544272 68
543 3300006237 Ga0097621_101263566 Ga0097621_1012635663 68
544 3300006237 Ga0097621_101781540 Ga0097621_1017815402 68
545 3300006358 Ga0068871_101745633 Ga0068871_1017456332 68
546 3300006931 Ga0097620_100154871 Ga0097620_1001548713 68
547 3300006931 Ga0097620_101632146 Ga0097620_1016321462 68
548 3300009093 Ga0105240_11536783 Ga0105240_115367831 68
549 3300009094 Ga0111539_11391212 Ga0111539_113912121 68
550 3300009101 Ga0105247_10482083 Ga0105247_104820833 68
551 3300009177 Ga0105248_10482422 Ga0105248_104824223 68
552 3300009553 Ga0105249_10290326 Ga0105249_102903262 68
553 3300013306 Ga0163162_10964801 Ga0163162_109648012 68
554 3300013307 Ga0157372_11919382 Ga0157372_119193821 68
555 3300013308 Ga0157375_10809396 Ga0157375_108093962 68
556 3300014325 Ga0163163_12933764 Ga0163163_129337641 68
557 3300014968 Ga0157379_10168233 Ga0157379_101682332 68
558 3300020078 Ga0206352_10757564 Ga0206352_107575642 68
559 3300020081 Ga0206354_10905968 Ga0206354_109059682 68
560 3300020081 Ga0206354_11701467 Ga0206354_117014671 68
561 3300025908 Ga0207643_10616609 Ga0207643_106166092 68
562 3300025912 Ga0207707_10636264 Ga0207707_106362642 68
563 3300025913 Ga0207695_11144711 Ga0207695_111447111 68
564 3300025917 Ga0207660_10026252 Ga0207660_100262522 68
565 3300025921 Ga0207652_10383822 Ga0207652_103838222 68
566 3300025923 Ga0207681_10395464 Ga0207681_103954642 68
567 3300025924 Ga0207694_10422907 Ga0207694_104229072 68
568 3300025944 Ga0207661_10229631 Ga0207661_102296311 68
569 3300025961 Ga0207712_10163995 Ga0207712_101639952 68
570 3300025986 Ga0207658_10289969 Ga0207658_102899692 68
571 3300026035 Ga0207703_10461713 Ga0207703_104617133 68
572 3300026078 Ga0207702_12060711 Ga0207702_120607112 68
573 3300026088 Ga0207641_10397575 Ga0207641_103975753 68
574 3300026095 Ga0207676_10079761 Ga0207676_100797612 68
575 3300026116 Ga0207674_11275510 Ga0207674_112755102 68
576 3300026121 Ga0207683_11596863 Ga0207683_115968632 68
577 3300028379 Ga0268266_10585406 Ga0268266_105854062 68
578 3300028379 Ga0268266_11924877 Ga0268266_119248772 68
579 3300028381 Ga0268264_10337994 Ga0268264_103379943 68
580 3300035242 Ga0373962_0368395 Ga0373962_0368395_168_401 68
581 3300041443 Ga0451789_0353459 Ga0451789_0353459_41_271 68
582 3300041452 Ga0451793_1825493 Ga0451793_1825493_442_657 68
583 3300041459 Ga0451800_1214791 Ga0451800_1214791_220_435 68
584 3300041494 Ga0451837_0983837 Ga0451837_0983837_195_425 68
585 3300044658 Ga0466972_0008680 Ga0466972_0008680_227_442 68
586 3300044673 Ga0453683_0304485 Ga0453683_0304485_292_510 68
587 3300044712 Ga0453684_0686722 Ga0453684_0686722_636_854 68
588 3300044765 Ga0466970_0009577 Ga0466970_0009577_260_475 68
589 3300049569 Ga0501032_0766765 Ga0501032_0766765_184_411 68
590 3300049589 Ga0501073_0149688 Ga0501073_0149688_1349_1576 68
591 3300053079 Ga0500610_0005232 Ga0500610_0005232_4735_4950 68
592 3300053080 Ga0500635_0363587 Ga0500635_0363587_130_351 68
593 3300060353 Ga0501082_0032648 Ga0501082_0032648_4060_4287 68
594 3300005327 Ga0070658_10371490 Ga0070658_103714902 69
595 3300005329 Ga0070683_100278724 Ga0070683_1002787241 69
596 3300005334 Ga0068869_100773220 Ga0068869_1007732202 69
597 3300005337 Ga0070682_100599573 Ga0070682_1005995731 69
598 3300005458 Ga0070681_10013793 Ga0070681_100137932 69
599 3300005530 Ga0070679_100066525 Ga0070679_1000665251 69
600 3300005535 Ga0070684_100462925 Ga0070684_1004629252 69
601 3300005577 Ga0068857_100267439 Ga0068857_1002674394 69
602 3300005617 Ga0068859_100182278 Ga0068859_1001822782 69
603 3300005843 Ga0068860_100293341 Ga0068860_1002933411 69
604 3300005844 Ga0068862_100952405 Ga0068862_1009524052 69
605 3300005937 Ga0081455_10197634 Ga0081455_101976341 69
606 3300006237 Ga0097621_101083551 Ga0097621_1010835512 69
607 3300006844 Ga0075428_100342577 Ga0075428_1003425771 69
608 3300006880 Ga0075429_101887869 Ga0075429_1018878691 69
609 3300006881 Ga0068865_101543814 Ga0068865_1015438141 69
610 3300006931 Ga0097620_100182291 Ga0097620_1001822913 69
611 3300009094 Ga0111539_10224808 Ga0111539_102248082 69
612 3300009094 Ga0111539_12557405 Ga0111539_125574051 69
613 3300009098 Ga0105245_11465095 Ga0105245_114650951 69
614 3300009551 Ga0105238_10026562 Ga0105238_100265623 69
615 3300009551 Ga0105238_10031268 Ga0105238_100312686 69
616 3300009553 Ga0105249_10622523 Ga0105249_106225232 69
617 3300011119 Ga0105246_10936873 Ga0105246_109368731 69
618 3300013297 Ga0157378_11691481 Ga0157378_116914811 69
619 3300013307 Ga0157372_11369270 Ga0157372_113692702 69
620 3300014325 Ga0163163_11269127 Ga0163163_112691272 69
621 3300014326 Ga0157380_12049723 Ga0157380_120497232 69
622 3300025909 Ga0207705_10957669 Ga0207705_109576691 69
623 3300025912 Ga0207707_10071975 Ga0207707_100719753 69
624 3300025921 Ga0207652_10129603 Ga0207652_101296032 69
625 3300025924 Ga0207694_10067519 Ga0207694_100675193 69
626 3300025924 Ga0207694_10160867 Ga0207694_101608672 69
627 3300025942 Ga0207689_10173787 Ga0207689_101737872 69
628 3300025944 Ga0207661_10264444 Ga0207661_102644442 69
629 3300025961 Ga0207712_11020633 Ga0207712_110206331 69
630 3300026035 Ga0207703_12327105 Ga0207703_123271051 69
631 3300026116 Ga0207674_10368667 Ga0207674_103686672 69
632 3300028380 Ga0268265_11215964 Ga0268265_112159642 69
633 3300028380 Ga0268265_12654387 Ga0268265_126543871 69
634 3300028381 Ga0268264_10420619 Ga0268264_104206192 69
635 3300031665 Ga0316575_10017077 Ga0316575_100170773 69
636 3300031665 Ga0316575_10232995 Ga0316575_102329952 69
637 3300031691 Ga0316579_10162932 Ga0316579_101629322 69
638 3300031691 Ga0316579_10166584 Ga0316579_101665842 69
639 3300031727 Ga0316576_10085784 Ga0316576_100857843 69
640 3300031727 Ga0316576_10348838 Ga0316576_103488381 69
641 3300031728 Ga0316578_10096971 Ga0316578_100969711 69
642 3300031728 Ga0316578_10213578 Ga0316578_102135782 69
643 3300031733 Ga0316577_10324844 Ga0316577_103248441 69
644 3300031733 Ga0316577_10337157 Ga0316577_103371571 69
645 3300031995 Ga0307409_100623260 Ga0307409_1006232602 69
646 3300032133 Ga0316583_10038324 Ga0316583_100383243 69
647 3300032133 Ga0316583_10051875 Ga0316583_100518752 69
648 3300032137 Ga0316585_10049331 Ga0316585_100493311 69
649 3300032137 Ga0316585_10063620 Ga0316585_100636202 69
650 3300032139 Ga0316580_10077031 Ga0316580_100770312 69
651 3300032168 Ga0316593_10017462 Ga0316593_100174623 69
652 3300033524 Ga0316592_1029193 Ga0316592_10291931 69
653 3300033529 Ga0316587_1008159 Ga0316587_10081592 69
654 3300033529 Ga0316587_1035107 Ga0316587_10351072 69
655 3300033541 Ga0316596_1019526 Ga0316596_10195262 69
656 3300033541 Ga0316596_1019631 Ga0316596_10196311 69
657 3300035398 Ga0316574_0252151 Ga0316574_0252151_494_709 69
658 3300035692 Ga0373935_1351796 Ga0373935_1351796_146_364 69
659 3300036647 Ga0316582_0056601 Ga0316582_0056601_1645_1860 69
660 3300037068 Ga0373925_0434199 Ga0373925_0434199_374_592 69
661 3300039450 Ga0436363_0456827 Ga0436363_0456827_1960_2193 69
662 3300041486 Ga0451807_2215334 Ga0451807_2215334_240_461 69
663 3300046471 Ga0495650_0170507 Ga0495650_0170507_56_277 69
664 3300046692 Ga0495671_0016881 Ga0495671_0016881_3431_3661 69
665 3300049460 Ga0495682_0162651 Ga0495682_0162651_206_427 69
666 3300049661 Ga0501217_170714 Ga0501217_170714_280_510 69
667 3300050511 nmdc:mga08y16_298050_c1 nmdc:mga08y16_298050_c1_905_1120 69
668 3300053093 Ga0500651_0266889 Ga0500651_0266889_360_581 69
669 3300053096 Ga0500641_0008120 Ga0500641_0008120_2896_3123 69
670 3300053096 Ga0500641_0163066 Ga0500641_0163066_329_550 69
671 3300053108 Ga0500562_173204 Ga0500562_173204_338_565 69
672 3300053134 Ga0500658_0343158 Ga0500658_0343158_291_518 69
673 3300053139 Ga0500568_0338070 Ga0500568_0338070_149_370 69
674 3300053149 Ga0500600_0247094 Ga0500600_0247094_136_357 69
675 3300059513 Ga0587094_030746 Ga0587094_030746_487_705 69
676 3300004799 Ga0058863_11947076 Ga0058863_119470762 70
677 3300004803 Ga0058862_12892832 Ga0058862_128928322 70
678 3300005329 Ga0070683_100071576 Ga0070683_1000715762 70
679 3300005335 Ga0070666_10866891 Ga0070666_108668911 70
680 3300005336 Ga0070680_100906673 Ga0070680_1009066732 70
681 3300005338 Ga0068868_101964569 Ga0068868_1019645692 70
682 3300005458 Ga0070681_10017187 Ga0070681_100171872 70
683 3300005471 Ga0070698_100015662 Ga0070698_1000156625 70
684 3300005535 Ga0070684_100133152 Ga0070684_1001331524 70
685 3300005615 Ga0070702_101814944 Ga0070702_1018149442 70
686 3300005843 Ga0068860_101646832 Ga0068860_1016468322 70
687 3300009093 Ga0105240_10134320 Ga0105240_101343202 70
688 3300009177 Ga0105248_10009477 Ga0105248_100094772 70
689 3300009551 Ga0105238_11466690 Ga0105238_114666901 70
690 3300020075 Ga0206349_1264899 Ga0206349_12648992 70
691 3300020076 Ga0206355_1201516 Ga0206355_12015161 70
692 3300020078 Ga0206352_10282496 Ga0206352_102824962 70
693 3300025912 Ga0207707_10302818 Ga0207707_103028182 70
694 3300025913 Ga0207695_10551647 Ga0207695_105516472 70
695 3300025914 Ga0207671_10985260 Ga0207671_109852601 70
696 3300025914 Ga0207671_11518430 Ga0207671_115184302 70
697 3300025917 Ga0207660_10030564 Ga0207660_100305643 70
698 3300025928 Ga0207700_10913624 Ga0207700_109136242 70
699 3300025937 Ga0207669_10450139 Ga0207669_104501392 70
700 3300025941 Ga0207711_10003851 Ga0207711_100038513 70
701 3300025944 Ga0207661_10049975 Ga0207661_100499752 70
702 3300025986 Ga0207658_11017594 Ga0207658_110175941 70
703 3300026088 Ga0207641_11493250 Ga0207641_114932501 70
704 3300028379 Ga0268266_12036382 Ga0268266_120363822 70
705 3300031733 Ga0316577_10473147 Ga0316577_104731471 70
706 3300032133 Ga0316583_10075632 Ga0316583_100756322 70
707 3300032137 Ga0316585_10034979 Ga0316585_100349792 70
708 3300032168 Ga0316593_10024372 Ga0316593_100243722 70
709 3300032168 Ga0316593_10117978 Ga0316593_101179781 70
710 3300032168 Ga0316593_10187060 Ga0316593_101870602 70
711 3300032168 Ga0316593_10238403 Ga0316593_102384031 70
712 3300032168 Ga0316593_10251950 Ga0316593_102519501 70
713 3300032168 Ga0316593_10447255 Ga0316593_104472551 70
714 3300033524 Ga0316592_1016984 Ga0316592_10169843 70
715 3300033527 Ga0316586_1075792 Ga0316586_10757921 70
716 3300033528 Ga0316588_1049815 Ga0316588_10498152 70
717 3300033529 Ga0316587_1077861 Ga0316587_10778611 70
718 3300033541 Ga0316596_1029183 Ga0316596_10291831 70
719 3300033541 Ga0316596_1202117 Ga0316596_12021171 70
720 3300035398 Ga0316574_0557954 Ga0316574_0557954_378_596 70
721 3300036647 Ga0316582_0016884 Ga0316582_0016884_1124_1342 70
722 3300036712 Ga0316584_0010426 Ga0316584_0010426_3089_3307 70
723 3300053088 Ga0500644_0431516 Ga0500644_0431516_152_382 70
724 3300053090 Ga0500646_0090643 Ga0500646_0090643_96_326 70
725 3300053093 Ga0500651_0137464 Ga0500651_0137464_379_609 70
726 3300053119 Ga0500595_168295 Ga0500595_168295_51_272 70
727 3300053131 Ga0500652_050386 Ga0500652_050386_691_921 70
728 3300053139 Ga0500568_0158097 Ga0500568_0158097_244_474 70
729 3300053156 Ga0500622_0018332 Ga0500622_0018332_1779_2009 70
730 3300053178 Ga0500637_0092901 Ga0500637_0092901_515_736 70
731 3300053727 Ga0500611_048514 Ga0500611_048514_700_930 70
732 3300005458 Ga0070681_10012205 Ga0070681_1001220510 71
733 3300005617 Ga0068859_100873847 Ga0068859_1008738471 71
734 3300006931 Ga0097620_100873867 Ga0097620_1008738671 71
735 3300025912 Ga0207707_10033237 Ga0207707_100332376 71
736 3300032133 Ga0316583_10200719 Ga0316583_102007192 71
737 3300032168 Ga0316593_10361588 Ga0316593_103615881 71
738 3300039437 Ga0436365_0411158 Ga0436365_0411158_414_695 71
739 3300042876 Ga0451577_0611798 Ga0451577_0611798_164_409 71
740 3300044712 Ga0453684_0451605 Ga0453684_0451605_164_409 71
741 3300044765 Ga0466970_0078266 Ga0466970_0078266_380_622 71
742 3300045051 Ga0451576_2104479 Ga0451576_2104479_261_506 71
743 3300053079 Ga0500610_0362080 Ga0500610_0362080_272_496 71
744 3300053092 Ga0500583_0063188 Ga0500583_0063188_1129_1353 71
745 3300053124 Ga0500617_050452 Ga0500617_050452_1557_1781 71
746 3300053146 Ga0500588_0005662 Ga0500588_0005662_87_311 71
747 3300000546 LJNas_1034716 LJNas_10347161 72
748 3300005458 Ga0070681_11754994 Ga0070681_117549941 72
749 3300005546 Ga0070696_100807503 Ga0070696_1008075032 72
750 3300005563 Ga0068855_100260725 Ga0068855_1002607252 72
751 3300007788 Ga0099795_10126475 Ga0099795_101264753 72
752 3300009093 Ga0105240_10041534 Ga0105240_100415349 72
753 3300010159 Ga0099796_10081115 Ga0099796_100811153 72
754 3300025949 Ga0207667_10432892 Ga0207667_104328922 72
755 3300027512 Ga0209179_1000970 Ga0209179_10009702 72
756 3300027671 Ga0209588_1143934 Ga0209588_11439342 72
757 3300028017 Ga0265356_1001830 Ga0265356_10018303 72
758 3300028023 Ga0265357_1041907 Ga0265357_10419071 72
759 3300030879 Ga0265765_1062006 Ga0265765_10620061 72
760 3300030886 Ga0265772_102895 Ga0265772_1028952 72
761 3300031616 Ga0307508_10743798 Ga0307508_107437981 72
762 3300031730 Ga0307516_10000215 Ga0307516_1000021569 72
763 3300032120 Ga0316053_115239 Ga0316053_1152391 72
764 3300032120 Ga0316053_118956 Ga0316053_1189562 72
765 3300035117 Ga0373953_0110411 Ga0373953_0110411_583_801 72
766 3300046543 Ga0495645_0343941 Ga0495645_0343941_204_422 72

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02599

CsrA

Global regulator protein family

18

70

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
5z38-assembly1.cif.gz_E crystal structure of csra bound to cest 0.8294 1 37
5z38-assembly1.cif.gz_G crystal structure of csra bound to cest 0.829 1 37
5z38-assembly2.cif.gz_I crystal structure of csra bound to cest 0.8212 1 38
5z38-assembly2.cif.gz_K crystal structure of csra bound to cest 0.8198 1 37
5z38-assembly1.cif.gz_G crystal structure of csra bound to cest 0.7409 1 37
ID Description Score Start End Superfamily
af_A0A0R0KZP1_7_202_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.7703 6 40 3.60.15.10
af_Q1LVQ8_42_197_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.7262 10 36 1.20.140.150
af_A0A1D6HX48_28_216_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.7197 11 42 3.10.180.10
4q4lA01 Mainly Beta;Beta Barrel;Thrombin, subunit H; 0.7189 7 37 2.40.10.170
3bk2A01 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.6601 8 37 3.60.15.10
ID Description Score Start End GO Terms
AF-A0A3D5Q1T1-F1-model_v4 Carbon storage regulator 0.7806 7 50 GO:0005829
GO:0006109
GO:0006402
GO:0045947
GO:0048027
AF-A0A3D5Q1T1-F1-model_v4 Carbon storage regulator 0.7654 7 50 GO:0005829
GO:0006109
GO:0006402
GO:0045947
GO:0048027
AF-A0A0B1Z0B0-F1-model_v4 Carbon storage regulator 0.7285 1 50 GO:0005829
GO:0006109
GO:0006402
GO:0045947
GO:0048027
AF-A0A524Q8Y5-F1-model_v4 Carbon storage regulator 0.7042 6 55 GO:0005829
GO:0006109
GO:0006402
GO:0045947
GO:0048027
AF-A0A0B1Z0B0-F1-model_v4 Carbon storage regulator 0.704 1 50 GO:0005829
GO:0006109
GO:0006402
GO:0045947
GO:0048027

Feature Viewer

pLDDT pTM Quality
72.11 0.51 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map