F478213

General Info

Members Datasets Scaffolds Average Seq Length
735 411 701 276

Family's Representative Sequence

Representative Sequence 3300037466|Ga0395898_0054594|Ga0395898_0054594_2429_3445
Length 338
Sequence MPHSLLLLVPFRCLAGFRGRVITSRQGLWKEGPFKALTEGLSRSGGRNAQGGITMRHRGGGHRKVYRLVAFARPAGMAAGVVQRIEYDPNRSARIALVRHKGADASAALRQQYSYFLAPQDVKEGDVLHSGADAPIRPGNTLPLSAIPVGMAVHNVELRPGAGGQLARSAGTSCTLVKKGEVLAYFELSAYESAASCTVRPVVHAKLSGHPSLFTCHSPFMIPSTCAGDDGYSVVKLPSGEQRLVLSRCMATIGTLSNPQHKNRKLGKAGAARWLGRRPRVRGVAMNPVDHPHGGGRGKSKGRISQTPWGKPTKGYRTRHNPRTDWVIRQSRHKAMRA

Samples

Sample ID Description Type Environment
1 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
2 2537561592 Arthrobacter crystallopoietes BAB-32 Isolate Rhizosphere
3 2643221576 Nocardioides sp. Root614 Isolate Unclassified
4 2643221590 Nocardioides sp. Root682 Isolate Unclassified
5 2643221615 Nocardioides sp. Root224 Isolate Unclassified
6 2643221617 Nocardioides sp. Root79 Isolate Unclassified
7 2643221620 Nocardioides sp. Root240 Isolate Unclassified
8 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
9 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
10 2687453341 Pirellula sp. SH-Sr6A Isolate Unclassified
11 2728369276 Kineococcus rhizosphaerae DSM 19711 Isolate Rhizosphere
12 2738541305 Nocardioides sp. CF167 Isolate Unclassified
13 2738543024 Aminobacter sp. AP02 Isolate Unclassified
14 2811994874 Nocardioides sp. SLBN-35 Isolate Unclassified
15 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere
16 2848551377 Brachybacterium saurashtrense DSM 23186 Isolate Unclassified
17 2854911287 Brucella lupini LUP21 Isolate Unclassified
18 2857481737 Nocardioides sp. R-74106 Isolate Unclassified
19 2858438669 Leuconostoc mesenteroides YL48 Isolate Unclassified
20 2883821847 Microlunatus elymi KUDC0627 Isolate Rhizosphere
21 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
22 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
23 2894817345 Aureimonas psammosilenae YIM DR1026 Isolate Unclassified
24 2909399089 Nguyenibacter vanlangensis LMG 31431 Isolate Unclassified
25 2910245624 Adhaeribacter radiodurans KUDC8001 Isolate Rhizosphere
26 2928519762 Leuconostoc citreum 1377 Isolate Rhizosphere
27 2929199973 Roseomonas sp. R-73070 Hybrid assembly Isolate Unclassified
28 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
29 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
30 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
31 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
32 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
33 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
34 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
35 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
36 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
37 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
38 3300003162 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
39 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
40 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
41 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
42 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
43 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
44 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
45 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
46 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
47 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
48 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
49 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
50 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
51 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
52 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
53 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
54 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
55 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
56 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
57 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
58 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
59 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
60 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
61 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
62 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
63 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
64 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
65 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
66 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
67 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
68 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
69 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
70 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
71 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
72 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
73 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
74 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
75 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
76 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
77 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
78 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
79 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
80 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
81 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
82 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
83 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
84 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
85 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
86 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
87 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
88 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
89 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
90 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
91 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
92 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
93 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
94 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
95 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
96 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
97 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
98 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
99 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
100 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
101 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
102 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
103 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
104 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
105 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
106 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
107 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
108 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
109 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
110 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
111 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
112 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
113 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
114 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
115 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
116 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
117 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
118 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
119 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
120 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
121 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
122 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
123 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
124 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
125 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
126 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
127 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
128 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
129 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
130 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
131 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
132 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
133 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
134 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
135 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
136 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
176 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
177 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
179 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
180 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
181 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
182 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
183 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
184 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
185 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
186 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
187 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
188 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
189 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
190 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
191 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
192 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
193 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
194 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
195 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
196 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
197 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
198 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
199 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
200 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
201 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
202 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
203 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
204 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
205 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
206 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
207 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
208 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
209 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
210 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
211 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
212 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
213 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
214 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
215 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
216 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
217 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
218 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
219 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
220 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
221 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
222 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
223 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
224 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
225 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
226 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
227 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
228 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
229 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
230 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
231 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
232 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
233 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
234 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
235 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
236 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
237 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
238 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
239 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
240 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
241 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
242 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
243 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
244 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
245 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
246 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
247 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
248 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
249 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
250 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
251 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
252 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
253 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
254 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
255 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
256 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
257 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
258 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
259 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
260 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
261 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
262 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
263 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
264 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
265 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
266 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
267 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
268 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
269 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
270 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
271 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
272 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
273 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
274 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
275 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
276 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
277 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
278 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
279 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
280 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
281 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
282 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
283 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
284 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
285 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
286 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
287 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
288 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
289 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
290 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
291 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
292 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
293 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
294 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
295 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
296 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
297 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
298 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
299 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
300 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
301 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
302 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
303 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
304 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
305 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
306 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
307 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
308 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
309 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
310 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
311 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
312 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
313 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
314 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
315 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
316 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
317 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
318 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
319 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
320 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
321 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
322 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
323 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
324 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
325 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
326 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
327 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
328 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
329 3300049132 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
330 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
331 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
332 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
333 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
334 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
335 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
336 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
337 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
338 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
339 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
340 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
341 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
342 3300049556 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
343 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
344 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
345 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
346 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
347 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
348 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
349 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
350 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
351 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
352 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
353 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
354 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
355 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
356 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
357 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
358 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
359 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
360 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
361 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
362 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
363 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
364 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
365 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
366 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
367 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
368 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
369 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
370 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
371 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
372 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
373 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
374 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
375 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
376 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
377 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
378 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
379 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
380 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
381 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
382 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
383 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
384 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
385 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
386 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
387 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
388 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
389 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
390 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
391 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
392 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
393 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
394 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
395 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
396 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
397 3300059607 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
398 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
399 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
400 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
401 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
402 3300059660 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 161R_SW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
403 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
404 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
405 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
406 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
407 641228493 Gluconacetobacter diazotrophicus PA1 5 Isolate Unclassified
408 643348555 Gluconacetobacter diazotrophicus PA1 5 Isolate Unclassified
409 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
410 8055909800 Plastoroseomonas hellenica LMG 31523 Isolate Unclassified
411 8056579771 Promicromonospora iranensis UTMC 00792 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 88.98
Metatranscriptomes 6.39
Isolates 4.63

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.95
Nodule 0.27
Rhizoplane 2.45
Rhizosphere 89.25
Stem 0
Stem Tuber 0
Unclassified 7.07

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 ARcpr5oldR_c005287 3300000041 Bacteria 1110
2 ARSoilOldRDRAFT_c004574 3300000044 Bacteria 1172
3 LJNas_1009084 3300000546 Bacteria 1066
4 ARCol0yngRDRAFT_1002500 3300000652 Bacteria 1382
5 JGI24739J22299_10014413 3300001989 Bacteria 2877
6 JGI24739J22299_10028557 3300001989 Bacteria 1945
7 JGI24737J22298_10001920 3300001990 Bacteria 7427
8 JGI25154J39366_1006883 3300002738 Bacteria 1612
9 JGI25152J39213_1000684 3300002773 Bacteria 17665
10 JGI25152J39213_1012216 3300002773 Bacteria 1855
11 Ga0006778J45830_1021879 3300003162 Bacteria 2215
12 JGI25406J46586_10001890 3300003203 Bacteria 9855
13 JGI25406J46586_10025734 3300003203 Bacteria 2279
14 JGI25407J50210_10046065 3300003373 Bacteria 1111
15 Ga0006562J51391_1004293 3300003578 Bacteria 16914
16 Ga0065712_10001248 3300005290 Bacteria 11167
17 Ga0065715_10158979 3300005293 Bacteria 1648
18 Ga0065707_10088640 3300005295 Bacteria 4590
19 Ga0065707_10133633 3300005295 Bacteria 1878
20 Ga0070658_10006748 3300005327 Bacteria 9291
21 Ga0070658_10095168 3300005327 Bacteria 2458
22 Ga0070658_10453883 3300005327 Bacteria 1104
23 Ga0070683_100033140 3300005329 Bacteria 4708
24 Ga0070683_100099873 3300005329 Bacteria 2732
25 Ga0070683_100198008 3300005329 Bacteria 1908
26 Ga0070683_100498931 3300005329 Bacteria 1163
27 Ga0070670_100152576 3300005331 Bacteria 2000
28 Ga0068869_100219093 3300005334 Bacteria 1508
29 Ga0070666_10036702 3300005335 Bacteria 3254
30 Ga0070680_100002147 3300005336 Bacteria 14571
31 Ga0070682_100031259 3300005337 Bacteria 3219
32 Ga0068868_100024919 3300005338 Bacteria 4543
33 Ga0068868_100346771 3300005338 Bacteria 1271
34 Ga0070660_100101675 3300005339 Bacteria 2278
35 Ga0070689_100124088 3300005340 Bacteria 2065
36 Ga0070691_10023324 3300005341 Bacteria 2873
37 Ga0070691_10051030 3300005341 Bacteria 1974
38 Ga0070668_100042683 3300005347 Bacteria 3476
39 Ga0070668_100045508 3300005347 Bacteria 3367
40 Ga0070668_100062064 3300005347 Bacteria 2895
41 Ga0070669_100100198 3300005353 Bacteria 2184
42 Ga0070669_100191891 3300005353 Bacteria 1603
43 Ga0070669_100221540 3300005353 Bacteria 1496
44 Ga0070675_100076470 3300005354 Bacteria 2785
45 Ga0070674_100002048 3300005356 Bacteria 11040
46 Ga0070674_100595200 3300005356 Bacteria 934
47 Ga0070659_100054114 3300005366 Bacteria 3160
48 Ga0070667_100106316 3300005367 Bacteria 2429
49 Ga0070667_100313417 3300005367 Bacteria 1414
50 Ga0070714_100001163 3300005435 Bacteria 18957
51 Ga0070714_100049770 3300005435 Bacteria 3568
52 Ga0070713_100001675 3300005436 Bacteria 14235
53 Ga0070713_100061709 3300005436 Bacteria 3137
54 Ga0070713_100070192 3300005436 Bacteria 2957
55 Ga0070713_100096238 3300005436 Bacteria 2555
56 Ga0070713_100464287 3300005436 Bacteria 1191
57 Ga0070710_10218754 3300005437 Bacteria 1211
58 Ga0070701_10380530 3300005438 Bacteria 889
59 Ga0070711_100153181 3300005439 Bacteria 1740
60 Ga0070700_100147284 3300005441 Bacteria 1606
61 Ga0070694_100041677 3300005444 Bacteria 3064
62 Ga0070662_100029774 3300005457 Bacteria 3813
63 Ga0070662_100056709 3300005457 Bacteria 2844
64 Ga0070662_100100806 3300005457 Bacteria 2185
65 Ga0070681_10012326 3300005458 Bacteria 8476
66 Ga0070681_10401460 3300005458 Bacteria 1282
67 Ga0068867_100178803 3300005459 Bacteria 1685
68 Ga0068867_100213734 3300005459 Bacteria 1550
69 Ga0068867_100319634 3300005459 Bacteria 1286
70 Ga0070706_100200060 3300005467 Bacteria 1866
71 Ga0070707_100135302 3300005468 Bacteria 2397
72 Ga0070699_100237826 3300005518 Bacteria 1625
73 Ga0070679_100002074 3300005530 Bacteria 18031
74 Ga0068853_100079767 3300005539 Bacteria 2863
75 Ga0068853_100151119 3300005539 Bacteria 2090
76 Ga0068853_100164124 3300005539 Bacteria 2006
77 Ga0070665_100015455 3300005548 Bacteria 7667
78 Ga0070704_100037541 3300005549 Bacteria 3310
79 Ga0068855_100106565 3300005563 Bacteria 3221
80 Ga0068855_100107969 3300005563 Bacteria 3197
81 Ga0068855_100169574 3300005563 Bacteria 2472
82 Ga0068855_100257885 3300005563 Bacteria 1943
83 Ga0068857_100001770 3300005577 Bacteria 17362
84 Ga0068856_100012640 3300005614 Bacteria 8174
85 Ga0068856_100153031 3300005614 Bacteria 2316
86 Ga0068856_100160364 3300005614 Bacteria 2259
87 Ga0068852_100120419 3300005616 Bacteria 2401
88 Ga0068852_100382228 3300005616 Bacteria 1381
89 Ga0068859_100081864 3300005617 Bacteria 3270
90 Ga0068861_100039191 3300005719 Bacteria 3535
91 Ga0068858_100141406 3300005842 Bacteria 2259
92 Ga0068862_100226636 3300005844 Bacteria 1694
93 Ga0068862_100238340 3300005844 Bacteria 1653
94 Ga0081455_10009428 3300005937 Bacteria 10043
95 Ga0081455_10022468 3300005937 Bacteria 5894
96 Ga0081455_10061103 3300005937 Bacteria 3172
97 Ga0081455_10062816 3300005937 Bacteria 3120
98 Ga0081455_10095013 3300005937 Bacteria 2407
99 Ga0081455_10108833 3300005937 Bacteria 2206
100 Ga0081538_10010547 3300005981 Bacteria 7572
101 Ga0081538_10038576 3300005981 Bacteria 3079
102 Ga0081540_1006273 3300005983 Bacteria 8701
103 Ga0081539_10001286 3300005985 Bacteria 44180
104 Ga0070717_10085206 3300006028 Bacteria 2659
105 Ga0070717_10107179 3300006028 Bacteria 2379
106 Ga0075363_100232164 3300006048 Bacteria 1059
107 Ga0075432_10002369 3300006058 Bacteria 6284
108 Ga0075432_10005901 3300006058 Bacteria 4165
109 Ga0070712_100004619 3300006175 Bacteria 8513
110 Ga0070712_100010110 3300006175 Bacteria 5947
111 Ga0097621_100068382 3300006237 Bacteria 2929
112 Ga0097621_100231168 3300006237 Bacteria 1614
113 Ga0068871_100063920 3300006358 Bacteria 3011
114 Ga0068871_100092414 3300006358 Bacteria 2523
115 Ga0075428_100000009 3300006844 Bacteria 266370
116 Ga0075428_100017186 3300006844 Bacteria 7993
117 Ga0075428_100027125 3300006844 Bacteria 6341
118 Ga0075428_100089387 3300006844 Bacteria 3360
119 Ga0075428_100201398 3300006844 Bacteria 2152
120 Ga0075428_100280060 3300006844 Bacteria 1794
121 Ga0075430_100005226 3300006846 Bacteria 10945
122 Ga0075430_100252224 3300006846 Bacteria 1462
123 Ga0075431_100001734 3300006847 Bacteria 20513
124 Ga0075431_100014269 3300006847 Bacteria 8034
125 Ga0075433_10000978 3300006852 Bacteria 20308
126 Ga0075433_10006179 3300006852 Bacteria 9447
127 Ga0075433_10032299 3300006852 Bacteria 4483
128 Ga0075434_100003203 3300006871 Bacteria 14595
129 Ga0075434_100003585 3300006871 Bacteria 13870
130 Ga0075434_100011038 3300006871 Bacteria 8499
131 Ga0075429_100169067 3300006880 Bacteria 1915
132 Ga0075429_100201226 3300006880 Bacteria 1745
133 Ga0075429_100661484 3300006880 Bacteria 915
134 Ga0068865_100159615 3300006881 Bacteria 1719
135 Ga0075436_100004373 3300006914 Bacteria 9696
136 Ga0075436_100004891 3300006914 Bacteria 9208
137 Ga0097620_100081865 3300006931 Bacteria 3270
138 Ga0075435_100002118 3300007076 Bacteria 13070
139 Ga0075435_100027841 3300007076 Bacteria 4426
140 Ga0075435_100115827 3300007076 Bacteria 2232
141 Ga0105240_10114469 3300009093 Bacteria 3258
142 Ga0105240_10122115 3300009093 Bacteria 3135
143 Ga0105240_10188196 3300009093 Bacteria 2429
144 Ga0105240_10380517 3300009093 Bacteria 1594
145 Ga0111539_10000010 3300009094 Bacteria 366246
146 Ga0111539_10005852 3300009094 Bacteria 15894
147 Ga0111539_10023680 3300009094 Bacteria 7545
148 Ga0111539_10042172 3300009094 Bacteria 5483
149 Ga0105245_10061281 3300009098 Bacteria 3391
150 Ga0105245_10086439 3300009098 Bacteria 2876
151 Ga0105247_10144028 3300009101 Bacteria 1564
152 Ga0114129_10000234 3300009147 Bacteria 61922
153 Ga0114129_10001031 3300009147 Bacteria 36419
154 Ga0114129_10064618 3300009147 Bacteria 5107
155 Ga0105243_10006200 3300009148 Bacteria 9247
156 Ga0105243_10018664 3300009148 Bacteria 5256
157 Ga0105241_10088531 3300009174 Bacteria 2438
158 Ga0105242_10043876 3300009176 Bacteria 3619
159 Ga0105242_10714606 3300009176 Bacteria 982
160 Ga0105248_10284388 3300009177 Bacteria 1862
161 Ga0105238_10002481 3300009551 Bacteria 18468
162 Ga0105249_10006301 3300009553 Bacteria 10308
163 Ga0105239_10006176 3300010375 Bacteria 13938
164 Ga0105239_10291478 3300010375 Bacteria 1838
165 Ga0105239_10427731 3300010375 Bacteria 1500
166 Ga0157369_10004249 3300013105 Bacteria 16965
167 Ga0157369_10375546 3300013105 Bacteria 1476
168 Ga0157374_10106962 3300013296 Bacteria 2688
169 Ga0157378_10005119 3300013297 Bacteria 11510
170 Ga0157378_10723981 3300013297 Bacteria 1016
171 Ga0163162_10018828 3300013306 Bacteria 6769
172 Ga0163162_10032281 3300013306 Bacteria 5200
173 Ga0163162_10434103 3300013306 Bacteria 1445
174 Ga0163162_10712235 3300013306 Bacteria 1125
175 Ga0157372_10003029 3300013307 Bacteria 18103
176 Ga0157372_10064662 3300013307 Bacteria 4104
177 Ga0157372_10126193 3300013307 Bacteria 2942
178 Ga0157372_10550984 3300013307 Bacteria 1344
179 Ga0157375_10079983 3300013308 Bacteria 3305
180 Ga0157375_10446902 3300013308 Bacteria 1458
181 Ga0157375_11593496 3300013308 Bacteria 772
182 Ga0163163_10007538 3300014325 Bacteria 9607
183 Ga0163163_10142252 3300014325 Bacteria 2441
184 Ga0163163_10151103 3300014325 Bacteria 2366
185 Ga0163163_10919796 3300014325 Bacteria 938
186 Ga0157380_10119197 3300014326 Bacteria 2232
187 Ga0157376_10223096 3300014969 Bacteria 1747
188 Ga0157376_10258266 3300014969 Bacteria 1631
189 Ga0163161_10149335 3300017792 Bacteria 1775
190 Ga0163161_10152796 3300017792 Bacteria 1755
191 Ga0206354_10115950 3300020081 Bacteria 1155
192 Ga0206354_10954251 3300020081 Bacteria 2646
193 Ga0154015_1213429 3300020610 Bacteria 2724
194 Ga0213876_10029742 3300021384 Bacteria 2878
195 Ga0213876_10135683 3300021384 Bacteria 1309
196 Ga0213875_10008279 3300021388 Bacteria 5333
197 Ga0213875_10028865 3300021388 Bacteria 2631
198 Ga0213875_10039023 3300021388 Bacteria 2237
199 Ga0213875_10063969 3300021388 Bacteria 1719
200 Ga0213875_10117849 3300021388 Bacteria 1240
201 Ga0213871_10009852 3300021441 Bacteria 2152
202 Ga0213871_10016668 3300021441 Bacteria 1775
203 Ga0213871_10018399 3300021441 Bacteria 1709
204 Ga0224712_10003182 3300022467 Bacteria 4212
205 Ga0209025_1052425 3300025294 Bacteria 1610
206 Ga0207688_10009707 3300025901 Bacteria 5237
207 Ga0207688_10090599 3300025901 Bacteria 1755
208 Ga0207680_10250809 3300025903 Bacteria 1222
209 Ga0207647_10177936 3300025904 Bacteria 1237
210 Ga0207654_10045892 3300025911 Bacteria 2489
211 Ga0207707_10004150 3300025912 Bacteria 12833
212 Ga0207707_10145067 3300025912 Bacteria 2075
213 Ga0207707_10182209 3300025912 Bacteria 1833
214 Ga0207707_10242136 3300025912 Bacteria 1568
215 Ga0207695_10004731 3300025913 Bacteria 18438
216 Ga0207695_10150035 3300025913 Bacteria 2271
217 Ga0207693_10014094 3300025915 Bacteria 6437
218 Ga0207693_10029783 3300025915 Bacteria 4309
219 Ga0207693_10484244 3300025915 Bacteria 966
220 Ga0207663_10094109 3300025916 Bacteria 1996
221 Ga0207660_10006183 3300025917 Bacteria 7778
222 Ga0207660_10278872 3300025917 Bacteria 1326
223 Ga0207657_10152434 3300025919 Bacteria 1882
224 Ga0207652_10266259 3300025921 Bacteria 1546
225 Ga0207681_10084898 3300025923 Bacteria 2246
226 Ga0207694_10005630 3300025924 Bacteria 9606
227 Ga0207694_10010354 3300025924 Bacteria 7030
228 Ga0207694_10356163 3300025924 Bacteria 1212
229 Ga0207659_10074709 3300025926 Bacteria 2485
230 Ga0207687_10258199 3300025927 Bacteria 1388
231 Ga0207687_10275367 3300025927 Bacteria 1347
232 Ga0207700_10033174 3300025928 Bacteria 3692
233 Ga0207700_10225655 3300025928 Bacteria 1590
234 Ga0207664_10006241 3300025929 Bacteria 8187
235 Ga0207664_10075173 3300025929 Bacteria 2731
236 Ga0207644_10055038 3300025931 Bacteria 2867
237 Ga0207690_10069348 3300025932 Bacteria 2426
238 Ga0207706_10016355 3300025933 Bacteria 6697
239 Ga0207706_10021255 3300025933 Bacteria 5830
240 Ga0207709_10051484 3300025935 Bacteria 2525
241 Ga0207709_10158366 3300025935 Bacteria 1576
242 Ga0207669_10029404 3300025937 Bacteria 3039
243 Ga0207669_10091444 3300025937 Bacteria 1982
244 Ga0207704_10310871 3300025938 Bacteria 1211
245 Ga0207711_10189269 3300025941 Bacteria 1875
246 Ga0207711_10256587 3300025941 Bacteria 1606
247 Ga0207661_10026560 3300025944 Bacteria 4413
248 Ga0207661_10100411 3300025944 Bacteria 2429
249 Ga0207661_10150275 3300025944 Bacteria 2013
250 Ga0207667_10003860 3300025949 Bacteria 18438
251 Ga0207667_10014395 3300025949 Bacteria 9022
252 Ga0207667_10107977 3300025949 Bacteria 2871
253 Ga0207667_10145375 3300025949 Bacteria 2441
254 Ga0207712_10025609 3300025961 Bacteria 3921
255 Ga0207712_10131354 3300025961 Bacteria 1909
256 Ga0207668_10030370 3300025972 Bacteria 3551
257 Ga0207668_10358872 3300025972 Bacteria 1221
258 Ga0207658_10083039 3300025986 Bacteria 2461
259 Ga0207677_10005586 3300026023 Bacteria 6831
260 Ga0207703_10030380 3300026035 Bacteria 4270
261 Ga0207703_10057141 3300026035 Bacteria 3180
262 Ga0207703_10125321 3300026035 Bacteria 2211
263 Ga0207703_10129650 3300026035 Bacteria 2176
264 Ga0207639_10039754 3300026041 Bacteria 3507
265 Ga0207639_10292678 3300026041 Bacteria 1436
266 Ga0207639_10648943 3300026041 Bacteria 976
267 Ga0207708_10073277 3300026075 Bacteria 2624
268 Ga0207708_10212591 3300026075 Bacteria 1547
269 Ga0207708_10297615 3300026075 Bacteria 1311
270 Ga0207702_10002606 3300026078 Bacteria 16944
271 Ga0207702_10227978 3300026078 Bacteria 1739
272 Ga0207702_10563353 3300026078 Bacteria 1115
273 Ga0207641_10024102 3300026088 Bacteria 5015
274 Ga0207648_10078394 3300026089 Bacteria 2882
275 Ga0207674_10003800 3300026116 Bacteria 18420
276 Ga0207675_100033691 3300026118 Bacteria 4772
277 Ga0207698_10009516 3300026142 Bacteria 6201
278 Ga0207698_10480465 3300026142 Bacteria 1205
279 Ga0207698_10501858 3300026142 Bacteria 1181
280 Ga0209974_10004194 3300027876 Bacteria 5152
281 Ga0207428_10000034 3300027907 Bacteria 231306
282 Ga0207428_10001294 3300027907 Bacteria 26662
283 Ga0207428_10001309 3300027907 Bacteria 26510
284 Ga0268266_10011799 3300028379 Bacteria 7574
285 Ga0265319_1000011 3300028563 Bacteria 184643
286 Ga0265334_10004519 3300028573 Bacteria 6167
287 Ga0265318_10000003 3300028577 Bacteria 333722
288 Ga0265318_10001100 3300028577 Bacteria 16981
289 Ga0307515_10043659 3300028794 Bacteria 6959
290 Ga0265338_10008853 3300028800 Bacteria 12137
291 Ga0265338_10199692 3300028800 Bacteria 1509
292 Ga0265338_10307724 3300028800 Bacteria 1150
293 Ga0265324_10013735 3300029957 Bacteria 3013
294 Ga0314311_1038998 3300030733 Bacteria 3937
295 Ga0265760_10089938 3300031090 Bacteria 960
296 Ga0265320_10002219 3300031240 Bacteria 13630
297 Ga0265329_10030032 3300031242 Bacteria 1773
298 Ga0265340_10021103 3300031247 Bacteria 3341
299 Ga0265339_10018439 3300031249 Bacteria 4114
300 Ga0265339_10061008 3300031249 Bacteria 2031
301 Ga0265331_10008339 3300031250 Bacteria 5900
302 Ga0265327_10000318 3300031251 Bacteria 92042
303 Ga0265327_10024399 3300031251 Bacteria 3555
304 Ga0265316_10009231 3300031344 Bacteria 9080
305 Ga0265316_10078086 3300031344 Bacteria 2542
306 Ga0265316_10262348 3300031344 Bacteria 1266
307 Ga0307408_100010829 3300031548 Bacteria 6017
308 Ga0307408_100063904 3300031548 Bacteria 2694
309 Ga0307408_100193251 3300031548 Bacteria 1641
310 Ga0265313_10003503 3300031595 Bacteria 12649
311 Ga0265313_10007926 3300031595 Bacteria 7140
312 Ga0265313_10014640 3300031595 Bacteria 4622
313 Ga0307508_10000276 3300031616 Bacteria 63298
314 Ga0316575_10033954 3300031665 Bacteria 2003
315 Ga0316579_10026903 3300031691 Bacteria 2608
316 Ga0265314_10000612 3300031711 Bacteria 44102
317 Ga0265314_10000833 3300031711 Bacteria 36549
318 Ga0265314_10009286 3300031711 Bacteria 8330
319 Ga0265342_10000111 3300031712 Bacteria 90609
320 Ga0265342_10066802 3300031712 Bacteria 2106
321 Ga0316576_10001965 3300031727 Bacteria 11485
322 Ga0316576_10038621 3300031727 Bacteria 3424
323 Ga0316578_10019064 3300031728 Bacteria 3770
324 Ga0316578_10317608 3300031728 Bacteria 930
325 Ga0307405_10002221 3300031731 Bacteria 8485
326 Ga0307405_10023768 3300031731 Bacteria 3489
327 Ga0307413_10005596 3300031824 Bacteria 5630
328 Ga0307413_10345954 3300031824 Bacteria 1145
329 Ga0307410_10003149 3300031852 Bacteria 8200
330 Ga0307410_10028825 3300031852 Bacteria 3526
331 Ga0307410_10144730 3300031852 Bacteria 1763
332 Ga0307410_10466457 3300031852 Bacteria 1033
333 Ga0307406_10000352 3300031901 Bacteria 26840
334 Ga0307406_10006213 3300031901 Bacteria 6574
335 Ga0307406_10012506 3300031901 Bacteria 4838
336 Ga0307406_10040541 3300031901 Bacteria 2896
337 Ga0307407_10001962 3300031903 Bacteria 7806
338 Ga0307407_10076278 3300031903 Bacteria 2012
339 Ga0307412_10011241 3300031911 Bacteria 5178
340 Ga0307409_100018091 3300031995 Bacteria 4722
341 Ga0307409_100043245 3300031995 Bacteria 3380
342 Ga0307416_100000084 3300032002 Bacteria 64599
343 Ga0307416_100043820 3300032002 Bacteria 3507
344 Ga0307416_100082529 3300032002 Bacteria 2723
345 Ga0307416_100128536 3300032002 Bacteria 2275
346 Ga0307416_100156454 3300032002 Bacteria 2099
347 Ga0307416_100421857 3300032002 Bacteria 1378
348 Ga0307414_10014132 3300032004 Bacteria 4772
349 Ga0307414_10018122 3300032004 Bacteria 4325
350 Ga0307414_10270892 3300032004 Bacteria 1422
351 Ga0307411_10001782 3300032005 Bacteria 9096
352 Ga0307411_10091805 3300032005 Bacteria 2122
353 Ga0307411_10145028 3300032005 Bacteria 1756
354 Ga0307415_100039636 3300032126 Bacteria 3115
355 Ga0307415_100091820 3300032126 Bacteria 2200
356 Ga0307415_100132154 3300032126 Bacteria 1891
357 Ga0307415_100213867 3300032126 Bacteria 1540
358 Ga0316583_10003862 3300032133 Bacteria 5316
359 Ga0316583_10041645 3300032133 Bacteria 1625
360 Ga0316580_10011148 3300032139 Bacteria 2724
361 Ga0316593_10000765 3300032168 Bacteria 6363
362 Ga0316593_10033258 3300032168 Bacteria 1687
363 Ga0316592_1000022 3300033524 Bacteria 11920
364 Ga0316588_1001826 3300033528 Bacteria 3604
365 Ga0316588_1021223 3300033528 Bacteria 1476
366 Ga0316596_1003568 3300033541 Bacteria 3425
367 Ga0316596_1006644 3300033541 Bacteria 2700
368 Ga0316596_1041000 3300033541 Bacteria 1216
369 Ga0373926_0029697 3300035083 Bacteria 1922
370 Ga0373929_0012321 3300035085 Bacteria 1624
371 Ga0373944_0002105 3300035089 Bacteria 5058
372 Ga0373949_0031199 3300035090 Bacteria 1270
373 Ga0373923_0044734 3300035111 Bacteria 1837
374 Ga0373953_0004557 3300035117 Bacteria 4422
375 Ga0373954_0074868 3300035118 Bacteria 1612
376 Ga0373957_0016069 3300035120 Bacteria 2587
377 Ga0373946_0012800 3300035171 Bacteria 3146
378 Ga0373955_0102640 3300035172 Bacteria 1644
379 Ga0373955_0143743 3300035172 Bacteria 1400
380 Ga0373942_0014525 3300035207 Bacteria 1909
381 Ga0373931_0030612 3300035691 Bacteria 2772
382 Ga0373935_0203768 3300035692 Bacteria 1368
383 Ga0373933_0019715 3300035724 Bacteria 3815
384 Ga0373933_0072510 3300035724 Bacteria 2097
385 Ga0373937_0000922 3300036401 Bacteria 24939
386 Ga0373937_0015501 3300036401 Bacteria 6741
387 Ga0373937_0041143 3300036401 Bacteria 4216
388 Ga0373937_0058846 3300036401 Bacteria 3530
389 Ga0373937_0061124 3300036401 Bacteria 3463
390 Ga0373937_0074325 3300036401 Bacteria 3136
391 Ga0373937_0084294 3300036401 Bacteria 2940
392 Ga0373937_0125512 3300036401 Bacteria 2394
393 Ga0373937_0138314 3300036401 Bacteria 2278
394 Ga0373937_0168158 3300036401 Bacteria 2057
395 Ga0373937_0247931 3300036401 Bacteria 1679
396 Ga0316582_0055389 3300036647 Bacteria 2527
397 Ga0373925_0008231 3300037068 Bacteria 7590
398 Ga0395900_0003432 3300037418 Bacteria 17137
399 Ga0395900_0042235 3300037418 Bacteria 4697
400 Ga0395900_0050861 3300037418 Bacteria 4268
401 Ga0395898_0054594 3300037466 Bacteria 3898
402 Ga0395898_0130984 3300037466 Bacteria 2402
403 Ga0395905_0003848 3300037471 Bacteria 15828
404 Ga0395905_0141225 3300037471 Bacteria 2265
405 Ga0436364_0000682 3300037853 Bacteria 2241
406 Ga0436364_0052675 3300037853 Bacteria 2449
407 Ga0436364_0171064 3300037853 Bacteria 1409
408 Ga0436364_0389284 3300037853 Bacteria 5767
409 Ga0436364_0554982 3300037853 Bacteria 6536
410 Ga0436364_1053341 3300037853 Bacteria 4230
411 Ga0436364_1266987 3300037853 Bacteria 1990
412 Ga0395901_0006624 3300038443 Bacteria 11701
413 Ga0395901_0149529 3300038443 Bacteria 2454
414 Ga0395901_0440359 3300038443 Bacteria 1334
415 Ga0400489_47982 3300039093 Bacteria 6330
416 Ga0436365_0045604 3300039437 Bacteria 951
417 Ga0436365_0334948 3300039437 Bacteria 1465
418 Ga0436365_0615041 3300039437 Bacteria 1217
419 Ga0436365_0743626 3300039437 Bacteria 2698
420 Ga0436360_0333232 3300039438 Bacteria 5402
421 Ga0436360_0432234 3300039438 Bacteria 1838
422 Ga0436360_0558978 3300039438 Bacteria 2949
423 Ga0436360_0651402 3300039438 Bacteria 1001
424 Ga0436360_0902642 3300039438 Bacteria 1876
425 Ga0436360_1031006 3300039438 Bacteria 1003
426 Ga0436360_1332781 3300039438 Bacteria 3795
427 Ga0436361_0278088 3300039447 Bacteria 3953
428 Ga0436363_0517643 3300039450 Bacteria 1033
429 Ga0436363_0590019 3300039450 Bacteria 1236
430 Ga0436362_0192210 3300039453 Bacteria 1393
431 Ga0436362_0446646 3300039453 Bacteria 2374
432 Ga0436362_0632372 3300039453 Bacteria 1291
433 Ga0436362_1298757 3300039453 Bacteria 1805
434 Ga0439465_0016498 3300041413 Bacteria 2303
435 Ga0451797_1211872 3300041453 Bacteria 1347
436 Ga0451833_0393181 3300041491 Bacteria 2121
437 Ga0451843_0866875 3300041509 Bacteria 2401
438 Ga0451855_1581117 3300041511 Bacteria 1083
439 Ga0451855_1660956 3300041511 Bacteria 1056
440 Ga0439448_0078783 3300042005 Bacteria 1104
441 Ga0439455_0039210 3300042012 Bacteria 1207
442 Ga0439463_009011 3300042016 Bacteria 2458
443 Ga0439446_0066691 3300042156 Bacteria 1096
444 Ga0439444_0006030 3300042437 Bacteria 1816
445 Ga0439444_0013747 3300042437 Bacteria 1344
446 Ga0439459_0001406 3300042438 Bacteria 3534
447 Ga0439464_0007832 3300042439 Bacteria 2794
448 Ga0451577_0003056 3300042876 Bacteria 19007
449 Ga0451577_0038846 3300042876 Bacteria 4280
450 Ga0439440_0029912 3300042993 Bacteria 1280
451 Ga0453683_0012218 3300044673 Bacteria 5632
452 Ga0453683_0041549 3300044673 Bacteria 2888
453 Ga0466965_0029069 3300044683 Bacteria 2688
454 Ga0466961_0103620 3300044693 Bacteria 1791
455 Ga0466961_0149441 3300044693 Bacteria 1459
456 Ga0466963_0056459 3300044694 Bacteria 2613
457 Ga0453684_0257466 3300044712 Bacteria 2001
458 Ga0466971_0061994 3300044719 Bacteria 1692
459 Ga0466970_0008583 3300044765 Bacteria 5145
460 Ga0466970_0056218 3300044765 Bacteria 2103
461 Ga0466957_0146121 3300044842 Bacteria 1526
462 Ga0466960_0012755 3300044901 Bacteria 3555
463 Ga0466960_0044553 3300044901 Bacteria 2115
464 Ga0466960_0083379 3300044901 Bacteria 1615
465 Ga0451576_0000055 3300045051 Bacteria 304830
466 Ga0451576_0019276 3300045051 Bacteria 7448
467 Ga0466967_0404941 3300045976 Bacteria 1328
468 Ga0495592_0033801 3300046454 Bacteria 3857
469 Ga0495592_0083336 3300046454 Bacteria 2309
470 Ga0495651_0170453 3300046462 Bacteria 1550
471 Ga0495653_0017391 3300046463 Bacteria 5848
472 Ga0495653_0145439 3300046463 Bacteria 1662
473 Ga0495580_0029203 3300046472 Bacteria 4003
474 Ga0495639_0028928 3300046475 Bacteria 2457
475 Ga0495662_0096485 3300046476 Bacteria 1445
476 Ga0495664_0026792 3300046477 Bacteria 3358
477 Ga0495664_0125907 3300046477 Bacteria 1550
478 Ga0495596_0147204 3300046500 Bacteria 915
479 Ga0495608_0025697 3300046511 Bacteria 4020
480 Ga0495610_0002336 3300046512 Bacteria 16035
481 Ga0495628_0064752 3300046516 Bacteria 2861
482 Ga0495628_0098948 3300046516 Bacteria 2253
483 Ga0495630_0076639 3300046517 Bacteria 2520
484 Ga0495630_0196254 3300046517 Bacteria 1540
485 Ga0495631_0180668 3300046518 Bacteria 904
486 Ga0495637_0052624 3300046520 Bacteria 1699
487 Ga0495663_0035487 3300046525 Bacteria 1498
488 Ga0495663_0093480 3300046525 Bacteria 983
489 Ga0495642_0296072 3300046528 Bacteria 709
490 Ga0495652_0011282 3300046529 Bacteria 8085
491 Ga0495652_0154828 3300046529 Bacteria 1786
492 Ga0495652_0202807 3300046529 Bacteria 1504
493 Ga0495665_0196821 3300046531 Bacteria 1045
494 Ga0495586_0119340 3300046535 Bacteria 1472
495 Ga0495587_0006550 3300046536 Bacteria 7580
496 Ga0495587_0013173 3300046536 Bacteria 5200
497 Ga0495587_0048278 3300046536 Bacteria 2521
498 Ga0495645_0006077 3300046543 Bacteria 8353
499 Ga0495667_0033623 3300046559 Bacteria 3431
500 Ga0495625_0081017 3300046660 Bacteria 2260
501 Ga0495635_0066422 3300046663 Bacteria 2473
502 Ga0495661_0047641 3300046665 Bacteria 2609
503 Ga0495661_0195327 3300046665 Bacteria 1063
504 Ga0495657_0157040 3300046675 Bacteria 1409
505 Ga0495657_0197392 3300046675 Bacteria 1228
506 Ga0495599_0053456 3300046678 Bacteria 2530
507 Ga0495669_0015190 3300046684 Bacteria 3296
508 Ga0495670_0052195 3300046691 Bacteria 2047
509 Ga0495670_0070410 3300046691 Bacteria 1770
510 Ga0495589_0081329 3300046794 Bacteria 1576
511 Ga0495600_0068501 3300046809 Bacteria 2319
512 Ga0495660_0085240 3300046810 Bacteria 1651
513 Ga0495581_0176803 3300047315 Bacteria 1248
514 Ga0495604_0071028 3300047317 Bacteria 2635
515 Ga0495604_0214971 3300047317 Bacteria 1327
516 Ga0495674_0229292 3300047319 Bacteria 1533
517 Ga0495674_0234203 3300047319 Bacteria 1515
518 Ga0495676_0121004 3300047321 Bacteria 1904
519 Ga0495680_0225272 3300047322 Bacteria 1337
520 Ga0495680_0249415 3300047322 Bacteria 1258
521 Ga0495675_0014092 3300047444 Bacteria 5054
522 Ga0495675_0196397 3300047444 Bacteria 1230
523 Ga0495684_0089527 3300047471 Bacteria 2332
524 Ga0495602_0000485 3300048088 Bacteria 36933
525 Ga0495602_0019157 3300048088 Bacteria 6807
526 Ga0495602_0076138 3300048088 Bacteria 2845
527 Ga0496100_0217752 3300048903 Bacteria 1400
528 Ga0496101_0089284 3300048904 Bacteria 2290
529 Ga0496102_0058442 3300048905 Bacteria 3524
530 Ga0496104_0106431 3300048907 Bacteria 2688
531 Ga0496105_0163403 3300048908 Bacteria 1827
532 Ga0496106_0153574 3300048909 Bacteria 1817
533 Ga0496106_0170666 3300048909 Bacteria 1724
534 Ga0496108_0005024 3300048911 Bacteria 10690
535 Ga0496108_0388405 3300048911 Bacteria 1219
536 Ga0496109_0011059 3300048912 Bacteria 7737
537 Ga0496110_0076651 3300048913 Bacteria 2973
538 Ga0496110_0275300 3300048913 Bacteria 1533
539 Ga0496113_0141414 3300048916 Bacteria 1894
540 Ga0496114_0020960 3300048917 Bacteria 5309
541 Ga0496114_0033898 3300048917 Bacteria 4209
542 Ga0496114_0046076 3300048917 Bacteria 3623
543 Ga0496115_0020789 3300048918 Bacteria 5064
544 Ga0496119_0014326 3300048922 Bacteria 6218
545 Ga0501306_000335 3300049127 Bacteria 3401
546 Ga0501306_006304 3300049127 Bacteria 1387
547 Ga0501308_002475 3300049128 Bacteria 1623
548 Ga0501309_000178 3300049129 Bacteria 4209
549 Ga0501310_000304 3300049130 Bacteria 4547
550 Ga0501310_006139 3300049130 Bacteria 1253
551 Ga0501343_001193 3300049132 Bacteria 1718
552 Ga0501307_002419 3300049162 Bacteria 1738
553 Ga0501299_009671 3300049522 Bacteria 1595
554 Ga0501311_000103 3300049527 Bacteria 4135
555 Ga0501311_009391 3300049527 Bacteria 1167
556 Ga0501315_000132 3300049531 Bacteria 4114
557 Ga0501316_001182 3300049532 Bacteria 2139
558 Ga0501318_000232 3300049534 Bacteria 3094
559 Ga0501319_000044 3300049535 Bacteria 3984
560 Ga0501319_000062 3300049535 Bacteria 3621
561 Ga0501320_000195 3300049536 Bacteria 3108
562 Ga0501321_001182 3300049537 Bacteria 2003
563 Ga0501323_001180 3300049539 Bacteria 2235
564 Ga0501324_000812 3300049540 Bacteria 1882
565 Ga0501325_000185 3300049541 Bacteria 2457
566 Ga0501340_000481 3300049556 Bacteria 1772
567 Ga0501031_0000651 3300049568 Bacteria 20547
568 Ga0501031_0002157 3300049568 Bacteria 12414
569 Ga0501031_0026812 3300049568 Bacteria 3756
570 Ga0501032_0000111 3300049569 Bacteria 69802
571 Ga0501032_0000438 3300049569 Bacteria 34232
572 Ga0501032_0000512 3300049569 Bacteria 31496
573 Ga0501032_0003488 3300049569 Bacteria 12021
574 Ga0501033_0000121 3300049570 Bacteria 75242
575 Ga0501033_0001612 3300049570 Bacteria 19830
576 Ga0501033_0001877 3300049570 Bacteria 18276
577 Ga0501034_0000298 3300049571 Bacteria 88154
578 Ga0501034_0001245 3300049571 Bacteria 34615
579 Ga0501034_0008844 3300049571 Bacteria 10590
580 Ga0501034_0026519 3300049571 Bacteria 5901
581 Ga0501034_0064759 3300049571 Bacteria 3669
582 Ga0501036_0000724 3300049572 Bacteria 24360
583 Ga0501036_0002605 3300049572 Bacteria 14223
584 Ga0501036_0003863 3300049572 Bacteria 12020
585 Ga0501036_0039645 3300049572 Bacteria 3986
586 Ga0501037_0000131 3300049573 Bacteria 69802
587 Ga0501037_0000998 3300049573 Bacteria 20981
588 Ga0501037_0030444 3300049573 Bacteria 3988
589 Ga0501038_0000109 3300049574 Bacteria 69802
590 Ga0501038_0000265 3300049574 Bacteria 44237
591 Ga0501038_0005274 3300049574 Bacteria 12021
592 Ga0501038_0080319 3300049574 Bacteria 2749
593 Ga0501038_0230739 3300049574 Bacteria 1473
594 Ga0501039_0000080 3300049575 Bacteria 72519
595 Ga0501039_0000814 3300049575 Bacteria 22509
596 Ga0501039_0002279 3300049575 Bacteria 14235
597 Ga0501039_0209224 3300049575 Bacteria 1534
598 Ga0501039_0489187 3300049575 Bacteria 966
599 Ga0501040_0138951 3300049576 Bacteria 1710
600 Ga0501042_0334874 3300049578 Bacteria 1094
601 Ga0501043_0001438 3300049579 Bacteria 20808
602 Ga0501043_0004023 3300049579 Bacteria 12021
603 Ga0501043_0034474 3300049579 Bacteria 3980
604 Ga0501043_0380594 3300049579 Bacteria 1068
605 Ga0501046_0001551 3300049580 Bacteria 21926
606 Ga0501046_0111284 3300049580 Bacteria 2091
607 Ga0501046_0125633 3300049580 Bacteria 1949
608 Ga0501047_0000855 3300049581 Bacteria 31151
609 Ga0501047_0045646 3300049581 Bacteria 4236
610 Ga0501047_0193542 3300049581 Bacteria 1896
611 Ga0501048_0000857 3300049582 Bacteria 22424
612 Ga0501067_0004323 3300049583 Bacteria 7825
613 Ga0501068_0042645 3300049584 Bacteria 2728
614 Ga0501069_0000702 3300049585 Bacteria 15604
615 Ga0501070_0001773 3300049586 Bacteria 19097
616 Ga0501070_0119781 3300049586 Bacteria 2175
617 Ga0501071_0073586 3300049587 Bacteria 2493
618 Ga0501071_0098554 3300049587 Bacteria 2153
619 Ga0501072_0063471 3300049588 Bacteria 2914
620 Ga0501073_0002543 3300049589 Bacteria 13627
621 Ga0501073_0135900 3300049589 Bacteria 1704
622 Ga0501074_0000257 3300049590 Bacteria 30059
623 Ga0501074_0304899 3300049590 Bacteria 1131
624 Ga0501075_0085597 3300049591 Bacteria 2388
625 Ga0501075_0414557 3300049591 Bacteria 1027
626 Ga0501076_0028034 3300049592 Bacteria 4370
627 Ga0501202_021135 3300049652 Bacteria 1298
628 Ga0501208_006843 3300049655 Bacteria 1472
629 Ga0501243_008476 3300049675 Bacteria 1585
630 Ga0501079_0082673 3300049741 Bacteria 2484
631 Ga0501080_0002067 3300049742 Bacteria 17401
632 Ga0501080_0371323 3300049742 Bacteria 1290
633 Ga0501083_0000801 3300049744 Bacteria 20607
634 Ga0501035_0000160 3300049822 Bacteria 82214
635 Ga0501035_0001522 3300049822 Bacteria 23684
636 Ga0501035_0043204 3300049822 Bacteria 4062
637 Ga0501035_0130044 3300049822 Bacteria 2195
638 Ga0501035_0436587 3300049822 Bacteria 1085
639 Ga0501044_0000188 3300049823 Bacteria 77610
640 Ga0501044_0000234 3300049823 Bacteria 69802
641 Ga0501044_0002854 3300049823 Bacteria 19664
642 Ga0501044_0158981 3300049823 Bacteria 2238
643 Ga0501044_0174932 3300049823 Bacteria 2116
644 Ga0501044_0240652 3300049823 Bacteria 1754
645 Ga0501045_0012622 3300049824 Bacteria 5949
646 Ga0501212_006277 3300049851 Bacteria 1599
647 nmdc:mga05p37_1182_c1 3300050507 Bacteria 30133
648 nmdc:mga05p37_2785_c1 3300050507 Bacteria 20326
649 nmdc:mga05p37_43946_c1 3300050507 Bacteria 5496
650 nmdc:mga05p37_64020_c1 3300050507 Bacteria 4524
651 nmdc:mga09592_120860_c1 3300050508 Bacteria 2250
652 nmdc:mga09592_150406_c1 3300050508 Bacteria 2008
653 nmdc:mga09592_159868_c1 3300050508 Bacteria 1946
654 nmdc:mga09592_1799_c1 3300050508 Bacteria 17199
655 nmdc:mga09592_404123_c1 3300050508 Bacteria 1180
656 nmdc:mga09592_79290_c1 3300050508 Bacteria 2795
657 nmdc:mga0qj67_230128_c1 3300050509 Bacteria 1504
658 nmdc:mga0qj67_591_c1 3300050509 Bacteria 24706
659 nmdc:mga06r32_12774_c1 3300050510 Bacteria 7592
660 nmdc:mga06r32_4895_c1 3300050510 Bacteria 12063
661 nmdc:mga08y16_10_c1 3300050511 Bacteria 470512
662 nmdc:mga08y16_14815_c1 3300050511 Bacteria 8199
663 nmdc:mga08y16_7477_c1 3300050511 Bacteria 11442
664 nmdc:mga08y16_97083_c1 3300050511 Bacteria 3069
665 nmdc:mga0n895_113612_c1 3300050512 Bacteria 2726
666 nmdc:mga0n895_1321_c1 3300050512 Bacteria 18347
667 nmdc:mga0n895_1534_c1 3300050512 Bacteria 17352
668 nmdc:mga0rr50_1290_c2 3300050513 Bacteria 9760
669 nmdc:mga0rr50_6615_c1 3300050513 Bacteria 7082
670 nmdc:mga08x19_10642_c1 3300050514 Bacteria 5531
671 nmdc:mga08x19_217303_c1 3300050514 Bacteria 1313
672 nmdc:mga0a205_226583_c1 3300050515 Bacteria 1754
673 nmdc:mga0a205_5430_c1 3300050515 Bacteria 11488
674 nmdc:mga0a205_890_c1 3300050515 Bacteria 24549
675 Ga0495601_0113669 3300053077 Bacteria 1755
676 Ga0495601_0120923 3300053077 Bacteria 1700
677 Ga0495601_0127230 3300053077 Bacteria 1658
678 Ga0495612_0064158 3300053078 Bacteria 1524
679 Ga0495655_0053186 3300053083 Bacteria 1079
680 Ga0495595_0028363 3300053084 Bacteria 2500
681 Ga0495595_0115885 3300053084 Bacteria 1302
682 Ga0495619_0004308 3300053085 Bacteria 9078
683 Ga0495619_0008993 3300053085 Bacteria 6303
684 Ga0500568_0000001 3300053139 Bacteria 988705
685 Ga0500620_107972 3300053155 Bacteria 974
686 Ga0500622_0005115 3300053156 Bacteria 7960
687 Ga0501084_0000487 3300054114 Bacteria 30390
688 Ga0587070_005110 3300059491 Bacteria 1702
689 Ga0587070_019379 3300059491 Bacteria 1126
690 Ga0587077_003683 3300059493 Bacteria 1950
691 Ga0587125_000437 3300059607 Bacteria 2426
692 Ga0587109_003270 3300059624 Bacteria 2146
693 Ga0587109_008626 3300059624 Bacteria 1579
694 Ga0587062_000275 3300059639 Bacteria 3263
695 Ga0587068_004016 3300059641 Bacteria 1921
696 Ga0587079_015422 3300059647 Bacteria 1297
697 Ga0587124_002532 3300059660 Bacteria 1296
698 Ga0587111_0005171 3300060346 Bacteria 1991
699 Ga0501082_0121129 3300060353 Bacteria 2268
700 Ga0466962_0013172 3300061719 Bacteria 3978
701 Ga0530510_0040074 3300061734 Bacteria 3381

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013308 Ga0157375_11593496 Ga0157375_115934961 218
2 3300042438 Ga0439459_0001406 Ga0439459_0001406_63_737 221
3 3300046528 Ga0495642_0296072 Ga0495642_0296072_12_695 223
4 3300049575 Ga0501039_0209224 Ga0501039_0209224_25_714 223
5 3300046794 Ga0495589_0081329 Ga0495589_0081329_17_748 237
6 3300039450 Ga0436363_0517643 Ga0436363_0517643_289_1023 240
7 3300053155 Ga0500620_107972 Ga0500620_107972_29_814 243
8 3300036401 Ga0373937_0125512 Ga0373937_0125512_580_1410 249
9 3300028800 Ga0265338_10307724 Ga0265338_103077242 250
10 3300031595 Ga0265313_10003503 Ga0265313_1000350318 250
11 3300031711 Ga0265314_10000833 Ga0265314_1000083343 250
12 3300036401 Ga0373937_0084294 Ga0373937_0084294_1403_2233 250
13 3300046454 Ga0495592_0033801 Ga0495592_0033801_2927_3757 250
14 3300046529 Ga0495652_0154828 Ga0495652_0154828_854_1684 250
15 3300046536 Ga0495587_0013173 Ga0495587_0013173_2975_3805 250
16 3300048088 Ga0495602_0019157 Ga0495602_0019157_2932_3762 250
17 3300005327 Ga0070658_10453883 Ga0070658_104538831 252
18 3300025904 Ga0207647_10177936 Ga0207647_101779361 252
19 3300009101 Ga0105247_10144028 Ga0105247_101440282 253
20 3300026035 Ga0207703_10125321 Ga0207703_101253213 253
21 3300036401 Ga0373937_0168158 Ga0373937_0168158_1013_1873 253
22 3300053077 Ga0495601_0127230 Ga0495601_0127230_226_1086 253
23 3300036401 Ga0373937_0247931 Ga0373937_0247931_764_1537 254
24 3300005468 Ga0070707_100135302 Ga0070707_1001353023 255
25 3300009093 Ga0105240_10114469 Ga0105240_101144692 255
26 3300014325 Ga0163163_10142252 Ga0163163_101422524 255
27 3300035085 Ga0373929_0012321 Ga0373929_0012321_213_1052 255
28 3300009093 Ga0105240_10122115 Ga0105240_101221151 256
29 3300013296 Ga0157374_10106962 Ga0157374_101069624 256
30 3300049574 Ga0501038_0080319 Ga0501038_0080319_1945_2730 256
31 3300035724 Ga0373933_0019715 Ga0373933_0019715_1743_2609 258
32 3300049591 Ga0501075_0414557 Ga0501075_0414557_176_1012 258
33 3300035207 Ga0373942_0014525 Ga0373942_0014525_801_1640 259
34 3300027876 Ga0209974_10004194 Ga0209974_100041945 260
35 3300049130 Ga0501310_000304 Ga0501310_000304_2205_3041 260
36 3300033524 Ga0316592_1000022 Ga0316592_100002217 263
37 3300033528 Ga0316588_1021223 Ga0316588_10212232 263
38 3300049568 Ga0501031_0026812 Ga0501031_0026812_1914_2747 264
39 3300049569 Ga0501032_0003488 Ga0501032_0003488_8993_9826 264
40 3300049570 Ga0501033_0000121 Ga0501033_0000121_40559_41392 264
41 3300049571 Ga0501034_0000298 Ga0501034_0000298_85126_85959 264
42 3300049572 Ga0501036_0000724 Ga0501036_0000724_21718_22551 264
43 3300049573 Ga0501037_0030444 Ga0501037_0030444_960_1793 264
44 3300049574 Ga0501038_0005274 Ga0501038_0005274_8993_9826 264
45 3300049575 Ga0501039_0000080 Ga0501039_0000080_69491_70324 264
46 3300049579 Ga0501043_0004023 Ga0501043_0004023_2196_3029 264
47 3300049822 Ga0501035_0000160 Ga0501035_0000160_2186_3019 264
48 3300049823 Ga0501044_0174932 Ga0501044_0174932_395_1228 264
49 3300028563 Ga0265319_1000011 Ga0265319_100001141 265
50 3300028577 Ga0265318_10001100 Ga0265318_1000110010 265
51 3300031595 Ga0265313_10014640 Ga0265313_100146406 265
52 3300031711 Ga0265314_10000612 Ga0265314_100006128 265
53 3300046529 Ga0495652_0202807 Ga0495652_0202807_628_1485 265
54 3300049742 Ga0501080_0371323 Ga0501080_0371323_367_1194 265
55 3300005356 Ga0070674_100002048 Ga0070674_10000204818 266
56 3300005438 Ga0070701_10380530 Ga0070701_103805301 266
57 3300005441 Ga0070700_100147284 Ga0070700_1001472842 266
58 3300005459 Ga0068867_100213734 Ga0068867_1002137341 266
59 3300025937 Ga0207669_10091444 Ga0207669_100914442 266
60 3300031852 Ga0307410_10144730 Ga0307410_101447302 266
61 3300013308 Ga0157375_10446902 Ga0157375_104469022 267
62 3300046500 Ga0495596_0147204 Ga0495596_0147204_14_841 267
63 3300048907 Ga0496104_0106431 Ga0496104_0106431_793_1650 267
64 3300049823 Ga0501044_0240652 Ga0501044_0240652_139_975 267
65 iso_pu_bacteria 2643221576 2643890023 267
66 iso_pu_bacteria 2643221590 2643959079 267
67 iso_pu_bacteria 2643221615 2644091090 267
68 iso_pu_bacteria 2643221617 2644099743 267
69 iso_pu_bacteria 2643221620 2644116629 267
70 iso_pu_bacteria 2643221657 2644320893 267
71 iso_pu_bacteria 2738541305 2738870336 267
72 iso_pu_bacteria 2811994874 2812331443 267
73 iso_pu_bacteria 2816332119 2816421165 267
74 iso_pu_bacteria 2857481737 2857485189 267
75 3300047317 Ga0495604_0214971 Ga0495604_0214971_80_919 268
76 3300047321 Ga0495676_0121004 Ga0495676_0121004_1036_1875 268
77 iso_pu_bacteria 2513237351 2514589865 268
78 iso_pu_bacteria 2537561592 2537898399 268
79 iso_pu_bacteria 2643221623 2644131927 268
80 iso_pu_bacteria 2728369276 2729906678 268
81 iso_pu_bacteria 2738543024 2739309045 268
82 iso_pu_bacteria 2848551377 2848553265 268
83 iso_pu_bacteria 2854911287 2854912166 268
84 iso_pu_bacteria 2883821847 2883823109 268
85 iso_pu_bacteria 2889790730 2889793669 268
86 iso_pu_bacteria 2889914905 2889919533 268
87 iso_pu_bacteria 2894817345 2894818628 268
88 iso_pu_bacteria 2909399089 2909399537 268
89 iso_pu_bacteria 2929199973 2929200706 268
90 iso_pu_bacteria 2937843397 2937845873 268
91 iso_pu_bacteria 2996336353 2996340575 268
92 iso_pu_bacteria 641228493 641337359 268
93 iso_pu_bacteria 643348555 643392477 268
94 iso_pu_bacteria 8002285264 8002285918 268
95 iso_pu_bacteria 8055909800 8055913923 268
96 iso_pu_bacteria 8056579771 8056583175 268
97 3300005444 Ga0070694_100041677 Ga0070694_1000416771 269
98 3300005549 Ga0070704_100037541 Ga0070704_1000375414 269
99 3300025917 Ga0207660_10278872 Ga0207660_102788722 269
100 3300032133 Ga0316583_10003862 Ga0316583_100038624 269
101 3300032133 Ga0316583_10041645 Ga0316583_100416453 269
102 3300032168 Ga0316593_10033258 Ga0316593_100332583 269
103 3300039450 Ga0436363_0590019 Ga0436363_0590019_13_837 269
104 3300046516 Ga0495628_0098948 Ga0495628_0098948_448_1275 269
105 3300046517 Ga0495630_0076639 Ga0495630_0076639_511_1338 269
106 3300046517 Ga0495630_0196254 Ga0495630_0196254_679_1506 269
107 3300049587 Ga0501071_0098554 Ga0501071_0098554_1124_1957 269
108 3300049823 Ga0501044_0158981 Ga0501044_0158981_1306_2139 269
109 iso_pu_bacteria 2858438669 2858440287 269
110 iso_pu_bacteria 2910245624 2910249758 269
111 iso_pu_bacteria 2928519762 2928521457 269
112 3300033541 Ga0316596_1006644 Ga0316596_10066443 270
113 3300033541 Ga0316596_1041000 Ga0316596_10410002 270
114 3300039437 Ga0436365_0743626 Ga0436365_0743626_223_1047 270
115 iso_pu_bacteria 2687453341 2688394937 270
116 3300000546 LJNas_1009084 LJNas_10090842 271
117 3300001989 JGI24739J22299_10014413 JGI24739J22299_100144134 271
118 3300005290 Ga0065712_10001248 Ga0065712_1000124818 271
119 3300005354 Ga0070675_100076470 Ga0070675_1000764703 271
120 3300005435 Ga0070714_100049770 Ga0070714_1000497705 271
121 3300005467 Ga0070706_100200060 Ga0070706_1002000603 271
122 3300005518 Ga0070699_100237826 Ga0070699_1002378261 271
123 3300005937 Ga0081455_10009428 Ga0081455_100094286 271
124 3300005981 Ga0081538_10038576 Ga0081538_100385763 271
125 3300006844 Ga0075428_100280060 Ga0075428_1002800602 271
126 3300006846 Ga0075430_100005226 Ga0075430_1000052264 271
127 3300006847 Ga0075431_100001734 Ga0075431_10000173411 271
128 3300009147 Ga0114129_10000234 Ga0114129_100002347 271
129 3300013307 Ga0157372_10126193 Ga0157372_101261934 271
130 3300021384 Ga0213876_10029742 Ga0213876_100297423 271
131 3300025926 Ga0207659_10074709 Ga0207659_100747094 271
132 3300025931 Ga0207644_10055038 Ga0207644_100550384 271
133 3300025941 Ga0207711_10256587 Ga0207711_102565871 271
134 3300026075 Ga0207708_10297615 Ga0207708_102976152 271
135 3300031090 Ga0265760_10089938 Ga0265760_100899381 271
136 3300037418 Ga0395900_0042235 Ga0395900_0042235_3286_4122 271
137 3300037466 Ga0395898_0054594 Ga0395898_0054594_2429_3445 271
138 3300037471 Ga0395905_0141225 Ga0395905_0141225_1271_2107 271
139 3300038443 Ga0395901_0149529 Ga0395901_0149529_1365_2201 271
140 3300038443 Ga0395901_0440359 Ga0395901_0440359_46_882 271
141 3300039453 Ga0436362_0192210 Ga0436362_0192210_212_1039 271
142 3300042012 Ga0439455_0039210 Ga0439455_0039210_233_1066 271
143 3300044901 Ga0466960_0083379 Ga0466960_0083379_197_1033 271
144 3300048909 Ga0496106_0153574 Ga0496106_0153574_145_969 271
145 3300049127 Ga0501306_000335 Ga0501306_000335_2269_3102 271
146 3300049129 Ga0501309_000178 Ga0501309_000178_2551_3384 271
147 3300049130 Ga0501310_006139 Ga0501310_006139_15_848 271
148 3300049527 Ga0501311_000103 Ga0501311_000103_2482_3315 271
149 3300049531 Ga0501315_000132 Ga0501315_000132_794_1627 271
150 3300049534 Ga0501318_000232 Ga0501318_000232_2028_2861 271
151 3300049535 Ga0501319_000044 Ga0501319_000044_257_1093 271
152 3300049536 Ga0501320_000195 Ga0501320_000195_1450_2283 271
153 3300049537 Ga0501321_001182 Ga0501321_001182_282_1115 271
154 3300049541 Ga0501325_000185 Ga0501325_000185_854_1687 271
155 3300049571 Ga0501034_0064759 Ga0501034_0064759_1974_2807 271
156 3300049589 Ga0501073_0135900 Ga0501073_0135900_457_1281 271
157 3300049590 Ga0501074_0304899 Ga0501074_0304899_87_983 271
158 3300049822 Ga0501035_0436587 Ga0501035_0436587_134_970 271
159 3300050507 nmdc:mga05p37_2785_c1 nmdc:mga05p37_2785_c1_9384_10217 271
160 3300050508 nmdc:mga09592_159868_c1 nmdc:mga09592_159868_c1_966_1796 271
161 3300050508 nmdc:mga09592_1799_c1 nmdc:mga09592_1799_c1_9747_10580 271
162 3300050509 nmdc:mga0qj67_591_c1 nmdc:mga0qj67_591_c1_879_1712 271
163 3300050510 nmdc:mga06r32_4895_c1 nmdc:mga06r32_4895_c1_9875_10708 271
164 3300053084 Ga0495595_0115885 Ga0495595_0115885_163_999 271
165 3300060353 Ga0501082_0121129 Ga0501082_0121129_38_874 271
166 3300001989 JGI24739J22299_10028557 JGI24739J22299_100285573 272
167 3300001990 JGI24737J22298_10001920 JGI24737J22298_100019207 272
168 3300002738 JGI25154J39366_1006883 JGI25154J39366_10068832 272
169 3300002773 JGI25152J39213_1000684 JGI25152J39213_10006848 272
170 3300002773 JGI25152J39213_1012216 JGI25152J39213_10122161 272
171 3300003162 Ga0006778J45830_1021879 Ga0006778J45830_10218793 272
172 3300003203 JGI25406J46586_10025734 JGI25406J46586_100257343 272
173 3300003578 Ga0006562J51391_1004293 Ga0006562J51391_10042936 272
174 3300005327 Ga0070658_10006748 Ga0070658_1000674815 272
175 3300005329 Ga0070683_100198008 Ga0070683_1001980083 272
176 3300005329 Ga0070683_100498931 Ga0070683_1004989311 272
177 3300005331 Ga0070670_100152576 Ga0070670_1001525763 272
178 3300005334 Ga0068869_100219093 Ga0068869_1002190931 272
179 3300005338 Ga0068868_100346771 Ga0068868_1003467712 272
180 3300005339 Ga0070660_100101675 Ga0070660_1001016752 272
181 3300005340 Ga0070689_100124088 Ga0070689_1001240882 272
182 3300005341 Ga0070691_10051030 Ga0070691_100510302 272
183 3300005347 Ga0070668_100042683 Ga0070668_1000426834 272
184 3300005347 Ga0070668_100062064 Ga0070668_1000620644 272
185 3300005353 Ga0070669_100100198 Ga0070669_1001001982 272
186 3300005353 Ga0070669_100221540 Ga0070669_1002215403 272
187 3300005356 Ga0070674_100595200 Ga0070674_1005952001 272
188 3300005366 Ga0070659_100054114 Ga0070659_1000541143 272
189 3300005367 Ga0070667_100313417 Ga0070667_1003134173 272
190 3300005435 Ga0070714_100001163 Ga0070714_10000116310 272
191 3300005436 Ga0070713_100001675 Ga0070713_10000167522 272
192 3300005436 Ga0070713_100061709 Ga0070713_1000617094 272
193 3300005436 Ga0070713_100070192 Ga0070713_1000701922 272
194 3300005436 Ga0070713_100464287 Ga0070713_1004642872 272
195 3300005437 Ga0070710_10218754 Ga0070710_102187542 272
196 3300005439 Ga0070711_100153181 Ga0070711_1001531813 272
197 3300005457 Ga0070662_100029774 Ga0070662_1000297743 272
198 3300005457 Ga0070662_100056709 Ga0070662_1000567093 272
199 3300005458 Ga0070681_10401460 Ga0070681_104014602 272
200 3300005459 Ga0068867_100178803 Ga0068867_1001788033 272
201 3300005459 Ga0068867_100319634 Ga0068867_1003196341 272
202 3300005539 Ga0068853_100164124 Ga0068853_1001641242 272
203 3300005616 Ga0068852_100120419 Ga0068852_1001204194 272
204 3300005719 Ga0068861_100039191 Ga0068861_1000391914 272
205 3300005844 Ga0068862_100238340 Ga0068862_1002383403 272
206 3300005937 Ga0081455_10022468 Ga0081455_100224688 272
207 3300005937 Ga0081455_10061103 Ga0081455_100611035 272
208 3300005937 Ga0081455_10062816 Ga0081455_100628161 272
209 3300005937 Ga0081455_10095013 Ga0081455_100950131 272
210 3300005937 Ga0081455_10108833 Ga0081455_101088334 272
211 3300005981 Ga0081538_10010547 Ga0081538_100105472 272
212 3300005983 Ga0081540_1006273 Ga0081540_10062738 272
213 3300005985 Ga0081539_10001286 Ga0081539_1000128632 272
214 3300006028 Ga0070717_10085206 Ga0070717_100852064 272
215 3300006028 Ga0070717_10107179 Ga0070717_101071793 272
216 3300006048 Ga0075363_100232164 Ga0075363_1002321642 272
217 3300006058 Ga0075432_10002369 Ga0075432_100023694 272
218 3300006058 Ga0075432_10005901 Ga0075432_100059017 272
219 3300006175 Ga0070712_100004619 Ga0070712_1000046194 272
220 3300006175 Ga0070712_100010110 Ga0070712_1000101109 272
221 3300006844 Ga0075428_100017186 Ga0075428_10001718614 272
222 3300006844 Ga0075428_100027125 Ga0075428_1000271256 272
223 3300006844 Ga0075428_100089387 Ga0075428_1000893875 272
224 3300006844 Ga0075428_100201398 Ga0075428_1002013983 272
225 3300006846 Ga0075430_100252224 Ga0075430_1002522242 272
226 3300006847 Ga0075431_100014269 Ga0075431_10001426910 272
227 3300006852 Ga0075433_10000978 Ga0075433_100009789 272
228 3300006852 Ga0075433_10006179 Ga0075433_100061796 272
229 3300006852 Ga0075433_10032299 Ga0075433_100322994 272
230 3300006871 Ga0075434_100003203 Ga0075434_10000320313 272
231 3300006871 Ga0075434_100003585 Ga0075434_1000035854 272
232 3300006871 Ga0075434_100011038 Ga0075434_10001103814 272
233 3300006880 Ga0075429_100169067 Ga0075429_1001690671 272
234 3300006880 Ga0075429_100661484 Ga0075429_1006614841 272
235 3300006881 Ga0068865_100159615 Ga0068865_1001596153 272
236 3300006914 Ga0075436_100004373 Ga0075436_10000437310 272
237 3300007076 Ga0075435_100002118 Ga0075435_1000021183 272
238 3300007076 Ga0075435_100027841 Ga0075435_1000278418 272
239 3300007076 Ga0075435_100115827 Ga0075435_1001158274 272
240 3300009094 Ga0111539_10005852 Ga0111539_100058524 272
241 3300009094 Ga0111539_10023680 Ga0111539_100236806 272
242 3300009094 Ga0111539_10042172 Ga0111539_100421724 272
243 3300009098 Ga0105245_10061281 Ga0105245_100612811 272
244 3300009098 Ga0105245_10086439 Ga0105245_100864393 272
245 3300009147 Ga0114129_10001031 Ga0114129_1000103125 272
246 3300009148 Ga0105243_10006200 Ga0105243_100062009 272
247 3300009148 Ga0105243_10018664 Ga0105243_100186644 272
248 3300009553 Ga0105249_10006301 Ga0105249_100063019 272
249 3300010375 Ga0105239_10427731 Ga0105239_104277312 272
250 3300013297 Ga0157378_10723981 Ga0157378_107239811 272
251 3300013306 Ga0163162_10018828 Ga0163162_100188288 272
252 3300013306 Ga0163162_10032281 Ga0163162_100322819 272
253 3300013306 Ga0163162_10434103 Ga0163162_104341032 272
254 3300013307 Ga0157372_10064662 Ga0157372_100646626 272
255 3300013307 Ga0157372_10550984 Ga0157372_105509841 272
256 3300014325 Ga0163163_10151103 Ga0163163_101511034 272
257 3300014326 Ga0157380_10119197 Ga0157380_101191973 272
258 3300014969 Ga0157376_10258266 Ga0157376_102582662 272
259 3300017792 Ga0163161_10149335 Ga0163161_101493351 272
260 3300017792 Ga0163161_10152796 Ga0163161_101527961 272
261 3300020081 Ga0206354_10115950 Ga0206354_101159501 272
262 3300020081 Ga0206354_10954251 Ga0206354_109542514 272
263 3300020610 Ga0154015_1213429 Ga0154015_12134294 272
264 3300021388 Ga0213875_10008279 Ga0213875_100082794 272
265 3300021388 Ga0213875_10028865 Ga0213875_100288654 272
266 3300021388 Ga0213875_10039023 Ga0213875_100390232 272
267 3300021441 Ga0213871_10009852 Ga0213871_100098522 272
268 3300021441 Ga0213871_10016668 Ga0213871_100166681 272
269 3300021441 Ga0213871_10018399 Ga0213871_100183992 272
270 3300022467 Ga0224712_10003182 Ga0224712_100031824 272
271 3300025294 Ga0209025_1052425 Ga0209025_10524253 272
272 3300025901 Ga0207688_10009707 Ga0207688_100097075 272
273 3300025901 Ga0207688_10090599 Ga0207688_100905991 272
274 3300025912 Ga0207707_10145067 Ga0207707_101450674 272
275 3300025912 Ga0207707_10242136 Ga0207707_102421362 272
276 3300025915 Ga0207693_10014094 Ga0207693_100140942 272
277 3300025915 Ga0207693_10029783 Ga0207693_100297836 272
278 3300025915 Ga0207693_10484244 Ga0207693_104842441 272
279 3300025916 Ga0207663_10094109 Ga0207663_100941094 272
280 3300025919 Ga0207657_10152434 Ga0207657_101524342 272
281 3300025923 Ga0207681_10084898 Ga0207681_100848982 272
282 3300025927 Ga0207687_10258199 Ga0207687_102581992 272
283 3300025927 Ga0207687_10275367 Ga0207687_102753672 272
284 3300025928 Ga0207700_10225655 Ga0207700_102256551 272
285 3300025929 Ga0207664_10006241 Ga0207664_1000624114 272
286 3300025929 Ga0207664_10075173 Ga0207664_100751732 272
287 3300025932 Ga0207690_10069348 Ga0207690_100693484 272
288 3300025933 Ga0207706_10016355 Ga0207706_100163552 272
289 3300025933 Ga0207706_10021255 Ga0207706_100212554 272
290 3300025935 Ga0207709_10051484 Ga0207709_100514844 272
291 3300025935 Ga0207709_10158366 Ga0207709_101583661 272
292 3300025937 Ga0207669_10029404 Ga0207669_100294043 272
293 3300025938 Ga0207704_10310871 Ga0207704_103108712 272
294 3300025944 Ga0207661_10150275 Ga0207661_101502752 272
295 3300025949 Ga0207667_10145375 Ga0207667_101453755 272
296 3300025961 Ga0207712_10025609 Ga0207712_100256094 272
297 3300025961 Ga0207712_10131354 Ga0207712_101313542 272
298 3300025972 Ga0207668_10030370 Ga0207668_100303703 272
299 3300025972 Ga0207668_10358872 Ga0207668_103588722 272
300 3300026035 Ga0207703_10129650 Ga0207703_101296503 272
301 3300026075 Ga0207708_10073277 Ga0207708_100732773 272
302 3300026089 Ga0207648_10078394 Ga0207648_100783944 272
303 3300026118 Ga0207675_100033691 Ga0207675_1000336914 272
304 3300027907 Ga0207428_10001294 Ga0207428_1000129434 272
305 3300027907 Ga0207428_10001309 Ga0207428_1000130916 272
306 3300028800 Ga0265338_10008853 Ga0265338_100088536 272
307 3300028800 Ga0265338_10199692 Ga0265338_101996923 272
308 3300030733 Ga0314311_1038998 Ga0314311_10389984 272
309 3300031251 Ga0265327_10024399 Ga0265327_100243996 272
310 3300031548 Ga0307408_100010829 Ga0307408_10001082910 272
311 3300031548 Ga0307408_100063904 Ga0307408_1000639043 272
312 3300031548 Ga0307408_100193251 Ga0307408_1001932513 272
313 3300031728 Ga0316578_10317608 Ga0316578_103176081 272
314 3300031731 Ga0307405_10002221 Ga0307405_100022215 272
315 3300031731 Ga0307405_10023768 Ga0307405_100237685 272
316 3300031824 Ga0307413_10005596 Ga0307413_100055968 272
317 3300031824 Ga0307413_10345954 Ga0307413_103459542 272
318 3300031852 Ga0307410_10003149 Ga0307410_100031495 272
319 3300031852 Ga0307410_10028825 Ga0307410_100288251 272
320 3300031852 Ga0307410_10466457 Ga0307410_104664571 272
321 3300031901 Ga0307406_10000352 Ga0307406_100003528 272
322 3300031901 Ga0307406_10006213 Ga0307406_100062135 272
323 3300031901 Ga0307406_10012506 Ga0307406_100125063 272
324 3300031903 Ga0307407_10001962 Ga0307407_100019629 272
325 3300031903 Ga0307407_10076278 Ga0307407_100762781 272
326 3300031911 Ga0307412_10011241 Ga0307412_1001124110 272
327 3300031995 Ga0307409_100018091 Ga0307409_1000180914 272
328 3300031995 Ga0307409_100043245 Ga0307409_1000432454 272
329 3300032002 Ga0307416_100000084 Ga0307416_10000008444 272
330 3300032002 Ga0307416_100043820 Ga0307416_1000438202 272
331 3300032002 Ga0307416_100128536 Ga0307416_1001285362 272
332 3300032002 Ga0307416_100156454 Ga0307416_1001564543 272
333 3300032002 Ga0307416_100421857 Ga0307416_1004218573 272
334 3300032004 Ga0307414_10014132 Ga0307414_100141324 272
335 3300032004 Ga0307414_10270892 Ga0307414_102708922 272
336 3300032005 Ga0307411_10001782 Ga0307411_100017827 272
337 3300032005 Ga0307411_10145028 Ga0307411_101450283 272
338 3300032126 Ga0307415_100039636 Ga0307415_1000396365 272
339 3300032126 Ga0307415_100091820 Ga0307415_1000918204 272
340 3300032126 Ga0307415_100132154 Ga0307415_1001321544 272
341 3300032168 Ga0316593_10000765 Ga0316593_100007652 272
342 3300033528 Ga0316588_1001826 Ga0316588_10018266 272
343 3300035083 Ga0373926_0029697 Ga0373926_0029697_289_1119 272
344 3300035090 Ga0373949_0031199 Ga0373949_0031199_99_935 272
345 3300035111 Ga0373923_0044734 Ga0373923_0044734_230_1060 272
346 3300035117 Ga0373953_0004557 Ga0373953_0004557_1996_2826 272
347 3300035118 Ga0373954_0074868 Ga0373954_0074868_715_1545 272
348 3300035120 Ga0373957_0016069 Ga0373957_0016069_669_1499 272
349 3300035172 Ga0373955_0102640 Ga0373955_0102640_563_1393 272
350 3300035172 Ga0373955_0143743 Ga0373955_0143743_270_1100 272
351 3300035691 Ga0373931_0030612 Ga0373931_0030612_757_1593 272
352 3300035724 Ga0373933_0072510 Ga0373933_0072510_535_1365 272
353 3300036401 Ga0373937_0000922 Ga0373937_0000922_18364_19194 272
354 3300036401 Ga0373937_0015501 Ga0373937_0015501_2242_3072 272
355 3300036401 Ga0373937_0041143 Ga0373937_0041143_1191_2021 272
356 3300036401 Ga0373937_0058846 Ga0373937_0058846_2431_3261 272
357 3300036401 Ga0373937_0061124 Ga0373937_0061124_1876_2706 272
358 3300036401 Ga0373937_0074325 Ga0373937_0074325_107_937 272
359 3300036401 Ga0373937_0138314 Ga0373937_0138314_1410_2240 272
360 3300037068 Ga0373925_0008231 Ga0373925_0008231_5099_5929 272
361 3300037418 Ga0395900_0050861 Ga0395900_0050861_1132_1968 272
362 3300037853 Ga0436364_0000682 Ga0436364_0000682_1174_2004 272
363 3300037853 Ga0436364_0389284 Ga0436364_0389284_211_1041 272
364 3300037853 Ga0436364_0554982 Ga0436364_0554982_4644_5477 272
365 3300037853 Ga0436364_1053341 Ga0436364_1053341_1869_2699 272
366 3300037853 Ga0436364_1266987 Ga0436364_1266987_17_847 272
367 3300039437 Ga0436365_0045604 Ga0436365_0045604_14_844 272
368 3300039437 Ga0436365_0615041 Ga0436365_0615041_177_1007 272
369 3300039438 Ga0436360_0333232 Ga0436360_0333232_3610_4440 272
370 3300039438 Ga0436360_0432234 Ga0436360_0432234_276_1106 272
371 3300039438 Ga0436360_0558978 Ga0436360_0558978_1859_2689 272
372 3300039438 Ga0436360_0651402 Ga0436360_0651402_131_961 272
373 3300039438 Ga0436360_0902642 Ga0436360_0902642_991_1824 272
374 3300039438 Ga0436360_1031006 Ga0436360_1031006_115_945 272
375 3300039438 Ga0436360_1332781 Ga0436360_1332781_462_1295 272
376 3300039447 Ga0436361_0278088 Ga0436361_0278088_2096_2926 272
377 3300039453 Ga0436362_0446646 Ga0436362_0446646_1381_2211 272
378 3300039453 Ga0436362_0632372 Ga0436362_0632372_14_847 272
379 3300039453 Ga0436362_1298757 Ga0436362_1298757_927_1757 272
380 3300041413 Ga0439465_0016498 Ga0439465_0016498_523_1356 272
381 3300041453 Ga0451797_1211872 Ga0451797_1211872_27_863 272
382 3300041491 Ga0451833_0393181 Ga0451833_0393181_583_1419 272
383 3300041509 Ga0451843_0866875 Ga0451843_0866875_835_1671 272
384 3300041511 Ga0451855_1581117 Ga0451855_1581117_204_1028 272
385 3300041511 Ga0451855_1660956 Ga0451855_1660956_22_846 272
386 3300042005 Ga0439448_0078783 Ga0439448_0078783_209_1045 272
387 3300042016 Ga0439463_009011 Ga0439463_009011_178_1014 272
388 3300042156 Ga0439446_0066691 Ga0439446_0066691_17_850 272
389 3300042437 Ga0439444_0006030 Ga0439444_0006030_247_1083 272
390 3300042437 Ga0439444_0013747 Ga0439444_0013747_31_867 272
391 3300042439 Ga0439464_0007832 Ga0439464_0007832_1879_2715 272
392 3300042876 Ga0451577_0003056 Ga0451577_0003056_8653_9492 272
393 3300042876 Ga0451577_0038846 Ga0451577_0038846_27_851 272
394 3300042993 Ga0439440_0029912 Ga0439440_0029912_200_1036 272
395 3300044673 Ga0453683_0041549 Ga0453683_0041549_1600_2424 272
396 3300044683 Ga0466965_0029069 Ga0466965_0029069_1053_1889 272
397 3300044693 Ga0466961_0103620 Ga0466961_0103620_643_1482 272
398 3300044693 Ga0466961_0149441 Ga0466961_0149441_584_1420 272
399 3300044694 Ga0466963_0056459 Ga0466963_0056459_696_1532 272
400 3300044712 Ga0453684_0257466 Ga0453684_0257466_304_1140 272
401 3300044719 Ga0466971_0061994 Ga0466971_0061994_272_1108 272
402 3300044765 Ga0466970_0008583 Ga0466970_0008583_692_1528 272
403 3300044765 Ga0466970_0056218 Ga0466970_0056218_898_1734 272
404 3300044842 Ga0466957_0146121 Ga0466957_0146121_231_1070 272
405 3300044901 Ga0466960_0012755 Ga0466960_0012755_1102_1938 272
406 3300044901 Ga0466960_0044553 Ga0466960_0044553_220_1059 272
407 3300045051 Ga0451576_0019276 Ga0451576_0019276_4351_5175 272
408 3300045976 Ga0466967_0404941 Ga0466967_0404941_322_1155 272
409 3300046454 Ga0495592_0083336 Ga0495592_0083336_1306_2136 272
410 3300046462 Ga0495651_0170453 Ga0495651_0170453_449_1279 272
411 3300046463 Ga0495653_0017391 Ga0495653_0017391_1672_2508 272
412 3300046463 Ga0495653_0145439 Ga0495653_0145439_50_886 272
413 3300046475 Ga0495639_0028928 Ga0495639_0028928_1320_2150 272
414 3300046476 Ga0495662_0096485 Ga0495662_0096485_328_1158 272
415 3300046477 Ga0495664_0026792 Ga0495664_0026792_2509_3339 272
416 3300046477 Ga0495664_0125907 Ga0495664_0125907_710_1540 272
417 3300046511 Ga0495608_0025697 Ga0495608_0025697_1027_1857 272
418 3300046512 Ga0495610_0002336 Ga0495610_0002336_1387_2223 272
419 3300046516 Ga0495628_0064752 Ga0495628_0064752_654_1484 272
420 3300046518 Ga0495631_0180668 Ga0495631_0180668_47_883 272
421 3300046520 Ga0495637_0052624 Ga0495637_0052624_356_1192 272
422 3300046525 Ga0495663_0035487 Ga0495663_0035487_240_1076 272
423 3300046535 Ga0495586_0119340 Ga0495586_0119340_194_1024 272
424 3300046536 Ga0495587_0006550 Ga0495587_0006550_6558_7388 272
425 3300046536 Ga0495587_0048278 Ga0495587_0048278_1651_2481 272
426 3300046543 Ga0495645_0006077 Ga0495645_0006077_5094_5924 272
427 3300046559 Ga0495667_0033623 Ga0495667_0033623_2244_3074 272
428 3300046660 Ga0495625_0081017 Ga0495625_0081017_387_1220 272
429 3300046663 Ga0495635_0066422 Ga0495635_0066422_680_1510 272
430 3300046665 Ga0495661_0047641 Ga0495661_0047641_934_1770 272
431 3300046665 Ga0495661_0195327 Ga0495661_0195327_77_901 272
432 3300046675 Ga0495657_0157040 Ga0495657_0157040_538_1368 272
433 3300046675 Ga0495657_0197392 Ga0495657_0197392_362_1192 272
434 3300046678 Ga0495599_0053456 Ga0495599_0053456_652_1482 272
435 3300046691 Ga0495670_0052195 Ga0495670_0052195_947_1783 272
436 3300046691 Ga0495670_0070410 Ga0495670_0070410_133_957 272
437 3300046809 Ga0495600_0068501 Ga0495600_0068501_331_1161 272
438 3300046810 Ga0495660_0085240 Ga0495660_0085240_264_1100 272
439 3300047315 Ga0495581_0176803 Ga0495581_0176803_222_1052 272
440 3300047317 Ga0495604_0071028 Ga0495604_0071028_617_1447 272
441 3300047319 Ga0495674_0229292 Ga0495674_0229292_476_1315 272
442 3300047322 Ga0495680_0225272 Ga0495680_0225272_170_1006 272
443 3300047322 Ga0495680_0249415 Ga0495680_0249415_116_946 272
444 3300047444 Ga0495675_0014092 Ga0495675_0014092_3400_4230 272
445 3300047444 Ga0495675_0196397 Ga0495675_0196397_200_1030 272
446 3300047471 Ga0495684_0089527 Ga0495684_0089527_929_1759 272
447 3300048088 Ga0495602_0000485 Ga0495602_0000485_25136_25966 272
448 3300048088 Ga0495602_0076138 Ga0495602_0076138_1359_2189 272
449 3300048903 Ga0496100_0217752 Ga0496100_0217752_181_1020 272
450 3300048904 Ga0496101_0089284 Ga0496101_0089284_728_1567 272
451 3300048905 Ga0496102_0058442 Ga0496102_0058442_1086_1925 272
452 3300048908 Ga0496105_0163403 Ga0496105_0163403_353_1192 272
453 3300048909 Ga0496106_0170666 Ga0496106_0170666_811_1650 272
454 3300048911 Ga0496108_0005024 Ga0496108_0005024_3104_3940 272
455 3300048911 Ga0496108_0388405 Ga0496108_0388405_132_968 272
456 3300048912 Ga0496109_0011059 Ga0496109_0011059_3976_4812 272
457 3300048913 Ga0496110_0076651 Ga0496110_0076651_1280_2116 272
458 3300048913 Ga0496110_0275300 Ga0496110_0275300_466_1302 272
459 3300048916 Ga0496113_0141414 Ga0496113_0141414_520_1356 272
460 3300048917 Ga0496114_0020960 Ga0496114_0020960_2314_3150 272
461 3300048917 Ga0496114_0033898 Ga0496114_0033898_122_961 272
462 3300048917 Ga0496114_0046076 Ga0496114_0046076_218_1054 272
463 3300048918 Ga0496115_0020789 Ga0496115_0020789_3852_4691 272
464 3300048922 Ga0496119_0014326 Ga0496119_0014326_30_860 272
465 3300049127 Ga0501306_006304 Ga0501306_006304_502_1326 272
466 3300049128 Ga0501308_002475 Ga0501308_002475_15_839 272
467 3300049132 Ga0501343_001193 Ga0501343_001193_674_1498 272
468 3300049162 Ga0501307_002419 Ga0501307_002419_875_1714 272
469 3300049522 Ga0501299_009671 Ga0501299_009671_160_996 272
470 3300049527 Ga0501311_009391 Ga0501311_009391_317_1141 272
471 3300049532 Ga0501316_001182 Ga0501316_001182_328_1152 272
472 3300049535 Ga0501319_000062 Ga0501319_000062_1868_2704 272
473 3300049539 Ga0501323_001180 Ga0501323_001180_624_1448 272
474 3300049540 Ga0501324_000812 Ga0501324_000812_675_1499 272
475 3300049556 Ga0501340_000481 Ga0501340_000481_261_1085 272
476 3300049568 Ga0501031_0000651 Ga0501031_0000651_17452_18285 272
477 3300049568 Ga0501031_0002157 Ga0501031_0002157_10430_11266 272
478 3300049569 Ga0501032_0000111 Ga0501032_0000111_2263_3096 272
479 3300049569 Ga0501032_0000438 Ga0501032_0000438_12782_13618 272
480 3300049570 Ga0501033_0001612 Ga0501033_0001612_9432_10268 272
481 3300049570 Ga0501033_0001877 Ga0501033_0001877_859_1692 272
482 3300049571 Ga0501034_0001245 Ga0501034_0001245_10009_10845 272
483 3300049571 Ga0501034_0026519 Ga0501034_0026519_2263_3096 272
484 3300049572 Ga0501036_0002605 Ga0501036_0002605_11128_11961 272
485 3300049572 Ga0501036_0003863 Ga0501036_0003863_862_1698 272
486 3300049573 Ga0501037_0000131 Ga0501037_0000131_66707_67540 272
487 3300049573 Ga0501037_0000998 Ga0501037_0000998_10617_11453 272
488 3300049574 Ga0501038_0000109 Ga0501038_0000109_66707_67540 272
489 3300049574 Ga0501038_0000265 Ga0501038_0000265_23684_24520 272
490 3300049575 Ga0501039_0000814 Ga0501039_0000814_9270_10106 272
491 3300049575 Ga0501039_0002279 Ga0501039_0002279_2263_3096 272
492 3300049576 Ga0501040_0138951 Ga0501040_0138951_314_1147 272
493 3300049578 Ga0501042_0334874 Ga0501042_0334874_178_1014 272
494 3300049579 Ga0501043_0001438 Ga0501043_0001438_9356_10192 272
495 3300049579 Ga0501043_0034474 Ga0501043_0034474_2310_3143 272
496 3300049580 Ga0501046_0001551 Ga0501046_0001551_11774_12610 272
497 3300049580 Ga0501046_0125633 Ga0501046_0125633_150_983 272
498 3300049581 Ga0501047_0000855 Ga0501047_0000855_10617_11453 272
499 3300049581 Ga0501047_0193542 Ga0501047_0193542_389_1222 272
500 3300049582 Ga0501048_0000857 Ga0501048_0000857_11975_12811 272
501 3300049583 Ga0501067_0004323 Ga0501067_0004323_6676_7512 272
502 3300049584 Ga0501068_0042645 Ga0501068_0042645_1855_2691 272
503 3300049585 Ga0501069_0000702 Ga0501069_0000702_1664_2500 272
504 3300049586 Ga0501070_0001773 Ga0501070_0001773_9331_10167 272
505 3300049586 Ga0501070_0119781 Ga0501070_0119781_221_1054 272
506 3300049589 Ga0501073_0002543 Ga0501073_0002543_8986_9822 272
507 3300049590 Ga0501074_0000257 Ga0501074_0000257_22912_23748 272
508 3300049652 Ga0501202_021135 Ga0501202_021135_322_1158 272
509 3300049655 Ga0501208_006843 Ga0501208_006843_100_936 272
510 3300049675 Ga0501243_008476 Ga0501243_008476_561_1397 272
511 3300049742 Ga0501080_0002067 Ga0501080_0002067_6813_7649 272
512 3300049744 Ga0501083_0000801 Ga0501083_0000801_9594_10430 272
513 3300049822 Ga0501035_0001522 Ga0501035_0001522_9563_10399 272
514 3300049822 Ga0501035_0043204 Ga0501035_0043204_424_1257 272
515 3300049823 Ga0501044_0000234 Ga0501044_0000234_66707_67540 272
516 3300049823 Ga0501044_0002854 Ga0501044_0002854_9266_10102 272
517 3300049851 Ga0501212_006277 Ga0501212_006277_289_1125 272
518 3300050507 nmdc:mga05p37_1182_c1 nmdc:mga05p37_1182_c1_6602_7438 272
519 3300050507 nmdc:mga05p37_64020_c1 nmdc:mga05p37_64020_c1_1054_1890 272
520 3300050508 nmdc:mga09592_120860_c1 nmdc:mga09592_120860_c1_923_1759 272
521 3300050508 nmdc:mga09592_404123_c1 nmdc:mga09592_404123_c1_307_1131 272
522 3300050508 nmdc:mga09592_79290_c1 nmdc:mga09592_79290_c1_761_1597 272
523 3300050509 nmdc:mga0qj67_230128_c1 nmdc:mga0qj67_230128_c1_285_1121 272
524 3300050510 nmdc:mga06r32_12774_c1 nmdc:mga06r32_12774_c1_2037_2873 272
525 3300050511 nmdc:mga08y16_14815_c1 nmdc:mga08y16_14815_c1_214_1050 272
526 3300050511 nmdc:mga08y16_97083_c1 nmdc:mga08y16_97083_c1_1741_2577 272
527 3300050512 nmdc:mga0n895_113612_c1 nmdc:mga0n895_113612_c1_725_1561 272
528 3300050512 nmdc:mga0n895_1321_c1 nmdc:mga0n895_1321_c1_6561_7397 272
529 3300050512 nmdc:mga0n895_1534_c1 nmdc:mga0n895_1534_c1_7457_8299 272
530 3300050513 nmdc:mga0rr50_1290_c2 nmdc:mga0rr50_1290_c2_3603_4439 272
531 3300050513 nmdc:mga0rr50_6615_c1 nmdc:mga0rr50_6615_c1_545_1381 272
532 3300050514 nmdc:mga08x19_10642_c1 nmdc:mga08x19_10642_c1_3156_3998 272
533 3300050514 nmdc:mga08x19_217303_c1 nmdc:mga08x19_217303_c1_106_942 272
534 3300050515 nmdc:mga0a205_226583_c1 nmdc:mga0a205_226583_c1_106_942 272
535 3300050515 nmdc:mga0a205_5430_c1 nmdc:mga0a205_5430_c1_1759_2595 272
536 3300050515 nmdc:mga0a205_890_c1 nmdc:mga0a205_890_c1_6593_7435 272
537 3300053077 Ga0495601_0113669 Ga0495601_0113669_232_1062 272
538 3300053077 Ga0495601_0120923 Ga0495601_0120923_754_1584 272
539 3300053078 Ga0495612_0064158 Ga0495612_0064158_586_1422 272
540 3300053083 Ga0495655_0053186 Ga0495655_0053186_77_913 272
541 3300053084 Ga0495595_0028363 Ga0495595_0028363_1137_1967 272
542 3300053085 Ga0495619_0004308 Ga0495619_0004308_6557_7387 272
543 3300053085 Ga0495619_0008993 Ga0495619_0008993_2616_3446 272
544 3300053139 Ga0500568_0000001 Ga0500568_0000001_2962_3795 272
545 3300054114 Ga0501084_0000487 Ga0501084_0000487_25059_25895 272
546 3300059491 Ga0587070_005110 Ga0587070_005110_231_1061 272
547 3300059491 Ga0587070_019379 Ga0587070_019379_271_1107 272
548 3300059493 Ga0587077_003683 Ga0587077_003683_390_1214 272
549 3300059607 Ga0587125_000437 Ga0587125_000437_1055_1927 272
550 3300059624 Ga0587109_003270 Ga0587109_003270_183_1007 272
551 3300059624 Ga0587109_008626 Ga0587109_008626_148_981 272
552 3300059639 Ga0587062_000275 Ga0587062_000275_1366_2190 272
553 3300059641 Ga0587068_004016 Ga0587068_004016_366_1202 272
554 3300059647 Ga0587079_015422 Ga0587079_015422_155_988 272
555 3300059660 Ga0587124_002532 Ga0587124_002532_41_880 272
556 3300060346 Ga0587111_0005171 Ga0587111_0005171_399_1223 272
557 3300061719 Ga0466962_0013172 Ga0466962_0013172_1422_2258 272
558 3300003203 JGI25406J46586_10001890 JGI25406J46586_1000189017 273
559 3300003373 JGI25407J50210_10046065 JGI25407J50210_100460651 273
560 3300005293 Ga0065715_10158979 Ga0065715_101589792 273
561 3300005295 Ga0065707_10088640 Ga0065707_100886406 273
562 3300005327 Ga0070658_10095168 Ga0070658_100951682 273
563 3300005329 Ga0070683_100033140 Ga0070683_1000331405 273
564 3300005335 Ga0070666_10036702 Ga0070666_100367024 273
565 3300005336 Ga0070680_100002147 Ga0070680_10000214723 273
566 3300005337 Ga0070682_100031259 Ga0070682_1000312594 273
567 3300005338 Ga0068868_100024919 Ga0068868_1000249196 273
568 3300005341 Ga0070691_10023324 Ga0070691_100233244 273
569 3300005367 Ga0070667_100106316 Ga0070667_1001063164 273
570 3300005436 Ga0070713_100096238 Ga0070713_1000962384 273
571 3300005458 Ga0070681_10012326 Ga0070681_1001232614 273
572 3300005530 Ga0070679_100002074 Ga0070679_10000207428 273
573 3300005539 Ga0068853_100079767 Ga0068853_1000797672 273
574 3300005539 Ga0068853_100151119 Ga0068853_1001511193 273
575 3300005548 Ga0070665_100015455 Ga0070665_1000154556 273
576 3300005563 Ga0068855_100106565 Ga0068855_1001065656 273
577 3300005563 Ga0068855_100107969 Ga0068855_1001079692 273
578 3300005563 Ga0068855_100169574 Ga0068855_1001695743 273
579 3300005563 Ga0068855_100257885 Ga0068855_1002578852 273
580 3300005577 Ga0068857_100001770 Ga0068857_1000017706 273
581 3300005614 Ga0068856_100012640 Ga0068856_10001264013 273
582 3300005614 Ga0068856_100153031 Ga0068856_1001530314 273
583 3300005614 Ga0068856_100160364 Ga0068856_1001603644 273
584 3300005616 Ga0068852_100382228 Ga0068852_1003822282 273
585 3300005617 Ga0068859_100081864 Ga0068859_1000818644 273
586 3300005842 Ga0068858_100141406 Ga0068858_1001414061 273
587 3300006237 Ga0097621_100068382 Ga0097621_1000683821 273
588 3300006237 Ga0097621_100231168 Ga0097621_1002311681 273
589 3300006358 Ga0068871_100063920 Ga0068871_1000639205 273
590 3300006358 Ga0068871_100092414 Ga0068871_1000924145 273
591 3300006844 Ga0075428_100000009 Ga0075428_100000009189 273
592 3300006880 Ga0075429_100201226 Ga0075429_1002012263 273
593 3300006931 Ga0097620_100081865 Ga0097620_1000818654 273
594 3300009093 Ga0105240_10188196 Ga0105240_101881964 273
595 3300009093 Ga0105240_10380517 Ga0105240_103805172 273
596 3300009094 Ga0111539_10000010 Ga0111539_1000001049 273
597 3300009174 Ga0105241_10088531 Ga0105241_100885314 273
598 3300009176 Ga0105242_10714606 Ga0105242_107146062 273
599 3300009177 Ga0105248_10284388 Ga0105248_102843882 273
600 3300009551 Ga0105238_10002481 Ga0105238_100024816 273
601 3300010375 Ga0105239_10006176 Ga0105239_100061766 273
602 3300010375 Ga0105239_10291478 Ga0105239_102914783 273
603 3300013105 Ga0157369_10004249 Ga0157369_100042494 273
604 3300013105 Ga0157369_10375546 Ga0157369_103755463 273
605 3300013306 Ga0163162_10712235 Ga0163162_107122352 273
606 3300013307 Ga0157372_10003029 Ga0157372_1000302929 273
607 3300013308 Ga0157375_10079983 Ga0157375_100799833 273
608 3300014325 Ga0163163_10007538 Ga0163163_100075383 273
609 3300014325 Ga0163163_10919796 Ga0163163_109197961 273
610 3300014969 Ga0157376_10223096 Ga0157376_102230963 273
611 3300021384 Ga0213876_10135683 Ga0213876_101356833 273
612 3300021388 Ga0213875_10063969 Ga0213875_100639693 273
613 3300021388 Ga0213875_10117849 Ga0213875_101178492 273
614 3300025903 Ga0207680_10250809 Ga0207680_102508092 273
615 3300025911 Ga0207654_10045892 Ga0207654_100458924 273
616 3300025912 Ga0207707_10004150 Ga0207707_1000415016 273
617 3300025912 Ga0207707_10182209 Ga0207707_101822093 273
618 3300025913 Ga0207695_10004731 Ga0207695_100047316 273
619 3300025913 Ga0207695_10150035 Ga0207695_101500352 273
620 3300025917 Ga0207660_10006183 Ga0207660_100061836 273
621 3300025921 Ga0207652_10266259 Ga0207652_102662591 273
622 3300025924 Ga0207694_10005630 Ga0207694_100056306 273
623 3300025924 Ga0207694_10010354 Ga0207694_100103545 273
624 3300025924 Ga0207694_10356163 Ga0207694_103561631 273
625 3300025928 Ga0207700_10033174 Ga0207700_100331746 273
626 3300025941 Ga0207711_10189269 Ga0207711_101892693 273
627 3300025944 Ga0207661_10026560 Ga0207661_100265604 273
628 3300025949 Ga0207667_10003860 Ga0207667_100038606 273
629 3300025949 Ga0207667_10014395 Ga0207667_1001439514 273
630 3300025949 Ga0207667_10107977 Ga0207667_101079775 273
631 3300025986 Ga0207658_10083039 Ga0207658_100830394 273
632 3300026023 Ga0207677_10005586 Ga0207677_100055866 273
633 3300026035 Ga0207703_10030380 Ga0207703_100303804 273
634 3300026035 Ga0207703_10057141 Ga0207703_100571415 273
635 3300026041 Ga0207639_10039754 Ga0207639_100397545 273
636 3300026041 Ga0207639_10292678 Ga0207639_102926782 273
637 3300026041 Ga0207639_10648943 Ga0207639_106489432 273
638 3300026078 Ga0207702_10002606 Ga0207702_100026066 273
639 3300026078 Ga0207702_10227978 Ga0207702_102279782 273
640 3300026078 Ga0207702_10563353 Ga0207702_105633531 273
641 3300026088 Ga0207641_10024102 Ga0207641_100241026 273
642 3300026116 Ga0207674_10003800 Ga0207674_1000380029 273
643 3300026142 Ga0207698_10009516 Ga0207698_100095161 273
644 3300026142 Ga0207698_10480465 Ga0207698_104804652 273
645 3300026142 Ga0207698_10501858 Ga0207698_105018582 273
646 3300027907 Ga0207428_10000034 Ga0207428_10000034171 273
647 3300028379 Ga0268266_10011799 Ga0268266_1001179912 273
648 3300031240 Ga0265320_10002219 Ga0265320_1000221919 273
649 3300031249 Ga0265339_10061008 Ga0265339_100610082 273
650 3300031711 Ga0265314_10009286 Ga0265314_1000928618 273
651 3300031712 Ga0265342_10066802 Ga0265342_100668023 273
652 3300031901 Ga0307406_10040541 Ga0307406_100405413 273
653 3300032002 Ga0307416_100082529 Ga0307416_1000825293 273
654 3300032004 Ga0307414_10018122 Ga0307414_100181226 273
655 3300032005 Ga0307411_10091805 Ga0307411_100918053 273
656 3300032126 Ga0307415_100213867 Ga0307415_1002138672 273
657 3300035692 Ga0373935_0203768 Ga0373935_0203768_111_944 273
658 3300037418 Ga0395900_0003432 Ga0395900_0003432_6960_7802 273
659 3300037466 Ga0395898_0130984 Ga0395898_0130984_134_976 273
660 3300037471 Ga0395905_0003848 Ga0395905_0003848_5291_6133 273
661 3300037853 Ga0436364_0052675 Ga0436364_0052675_1586_2431 273
662 3300037853 Ga0436364_0171064 Ga0436364_0171064_331_1167 273
663 3300038443 Ga0395901_0006624 Ga0395901_0006624_2129_2971 273
664 3300039093 Ga0400489_47982 Ga0400489_47982_4626_5489 273
665 3300039437 Ga0436365_0334948 Ga0436365_0334948_120_956 273
666 3300044673 Ga0453683_0012218 Ga0453683_0012218_4504_5340 273
667 3300045051 Ga0451576_0000055 Ga0451576_0000055_249784_250620 273
668 3300046529 Ga0495652_0011282 Ga0495652_0011282_4151_4981 273
669 3300046531 Ga0495665_0196821 Ga0495665_0196821_193_1023 273
670 3300049574 Ga0501038_0230739 Ga0501038_0230739_603_1436 273
671 3300049575 Ga0501039_0489187 Ga0501039_0489187_76_909 273
672 3300049587 Ga0501071_0073586 Ga0501071_0073586_789_1622 273
673 3300049588 Ga0501072_0063471 Ga0501072_0063471_135_968 273
674 3300049591 Ga0501075_0085597 Ga0501075_0085597_508_1341 273
675 3300049592 Ga0501076_0028034 Ga0501076_0028034_2280_3113 273
676 3300049741 Ga0501079_0082673 Ga0501079_0082673_1448_2281 273
677 3300049824 Ga0501045_0012622 Ga0501045_0012622_152_985 273
678 3300050508 nmdc:mga09592_150406_c1 nmdc:mga09592_150406_c1_868_1701 273
679 3300050511 nmdc:mga08y16_10_c1 nmdc:mga08y16_10_c1_428869_429702 273
680 3300061734 Ga0530510_0040074 Ga0530510_0040074_2440_3273 273
681 3300005329 Ga0070683_100099873 Ga0070683_1000998735 274
682 3300005844 Ga0068862_100226636 Ga0068862_1002266363 274
683 3300025944 Ga0207661_10100411 Ga0207661_101004114 274
684 3300028573 Ga0265334_10004519 Ga0265334_100045195 274
685 3300028577 Ga0265318_10000003 Ga0265318_10000003189 274
686 3300028794 Ga0307515_10043659 Ga0307515_100436594 274
687 3300029957 Ga0265324_10013735 Ga0265324_100137354 274
688 3300031250 Ga0265331_10008339 Ga0265331_100083399 274
689 3300031251 Ga0265327_10000318 Ga0265327_1000031848 274
690 3300031595 Ga0265313_10007926 Ga0265313_1000792611 274
691 3300031616 Ga0307508_10000276 Ga0307508_1000027613 274
692 3300031665 Ga0316575_10033954 Ga0316575_100339544 274
693 3300031691 Ga0316579_10026903 Ga0316579_100269034 274
694 3300031727 Ga0316576_10001965 Ga0316576_100019659 274
695 3300031727 Ga0316576_10038621 Ga0316576_100386213 274
696 3300031728 Ga0316578_10019064 Ga0316578_100190647 274
697 3300032139 Ga0316580_10011148 Ga0316580_100111483 274
698 3300033541 Ga0316596_1003568 Ga0316596_10035686 274
699 3300036647 Ga0316582_0055389 Ga0316582_0055389_478_1311 274
700 3300049569 Ga0501032_0000512 Ga0501032_0000512_2053_2919 274
701 3300049571 Ga0501034_0008844 Ga0501034_0008844_9354_10211 274
702 3300049572 Ga0501036_0039645 Ga0501036_0039645_1139_2005 274
703 3300049579 Ga0501043_0380594 Ga0501043_0380594_104_970 274
704 3300049580 Ga0501046_0111284 Ga0501046_0111284_1191_2057 274
705 3300049581 Ga0501047_0045646 Ga0501047_0045646_1209_2075 274
706 3300049822 Ga0501035_0130044 Ga0501035_0130044_773_1639 274
707 3300049823 Ga0501044_0000188 Ga0501044_0000188_71115_71981 274
708 3300053156 Ga0500622_0005115 Ga0500622_0005115_681_1547 274
709 3300000041 ARcpr5oldR_c005287 ARcpr5oldR_0052871 275
710 3300000044 ARSoilOldRDRAFT_c004574 ARSoilOldRDRAFT_0045742 275
711 3300000652 ARCol0yngRDRAFT_1002500 ARCol0yngRDRAFT_10025002 275
712 3300005295 Ga0065707_10133633 Ga0065707_101336333 275
713 3300005347 Ga0070668_100045508 Ga0070668_1000455084 275
714 3300005353 Ga0070669_100191891 Ga0070669_1001918913 275
715 3300005457 Ga0070662_100100806 Ga0070662_1001008064 275
716 3300006914 Ga0075436_100004891 Ga0075436_10000489115 275
717 3300009147 Ga0114129_10064618 Ga0114129_100646185 275
718 3300009176 Ga0105242_10043876 Ga0105242_100438764 275
719 3300013297 Ga0157378_10005119 Ga0157378_1000511916 275
720 3300026075 Ga0207708_10212591 Ga0207708_102125912 275
721 3300031242 Ga0265329_10030032 Ga0265329_100300322 275
722 3300031247 Ga0265340_10021103 Ga0265340_100211035 275
723 3300031249 Ga0265339_10018439 Ga0265339_1001843910 275
724 3300031344 Ga0265316_10009231 Ga0265316_100092319 275
725 3300031344 Ga0265316_10078086 Ga0265316_100780862 275
726 3300031344 Ga0265316_10262348 Ga0265316_102623482 275
727 3300031712 Ga0265342_10000111 Ga0265342_1000011163 275
728 3300035089 Ga0373944_0002105 Ga0373944_0002105_3473_4300 275
729 3300035171 Ga0373946_0012800 Ga0373946_0012800_1812_2639 275
730 3300046472 Ga0495580_0029203 Ga0495580_0029203_3118_3945 275
731 3300046525 Ga0495663_0093480 Ga0495663_0093480_130_957 275
732 3300046684 Ga0495669_0015190 Ga0495669_0015190_2407_3234 275
733 3300047319 Ga0495674_0234203 Ga0495674_0234203_205_1032 275
734 3300050507 nmdc:mga05p37_43946_c1 nmdc:mga05p37_43946_c1_2117_2944 275
735 3300050511 nmdc:mga08y16_7477_c1 nmdc:mga08y16_7477_c1_1705_2532 275

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03947

Ribosomal_L2_C

Ribosomal Proteins L2, C-terminal domain

220

310

0.95

PF00181

Ribosomal_L2

Ribosomal Proteins L2, RNA binding domain

46

130

0.91

PF03947

Ribosomal_L2_C

Ribosomal Proteins L2, C-terminal domain

137

200

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
1c04-assembly1.cif.gz_A identification of known protein and rna structures in a 5 a map of the large ribosomal subunit from haloarcula marismortui 0.9508 62 192
1c04-assembly1.cif.gz_A identification of known protein and rna structures in a 5 a map of the large ribosomal subunit from haloarcula marismortui 0.9168 62 192
8c91-assembly1.cif.gz_C cryo-em captures early ribosome assembly in action 0.9131 20 198
4ce4-assembly1.cif.gz_D 39s large subunit of the porcine mitochondrial ribosome 0.9047 33 220
8c91-assembly1.cif.gz_C cryo-em captures early ribosome assembly in action 0.9019 20 198
ID Description Score Start End Superfamily
af_Q6R9C6_19_86_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.9913 132 195 2.30.30.30
1rl2B01 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9774 62 113 2.40.50.140
af_Q23888_102_178_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.9733 124 194 2.30.30.30
af_Q25807_101_178_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.9664 124 192 2.30.30.30
af_E7F8R3_156_236_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.966 123 194 2.30.30.30
ID Description Score Start End GO Terms
AF-E0Z4E7-F1-model_v4 50S ribosomal protein L2 0.954 33 198 GO:0002181
GO:0003723
GO:0003735
GO:0015934
GO:0016740
AF-X1NK91-F1-model_v4 Large ribosomal subunit protein uL2 C-terminal domain-containing protein 0.9485 20 195 GO:0002181
GO:0003723
GO:0003735
GO:0015934
GO:0016740
AF-A0A1Q9ER84-F1-model_v4 50S ribosomal protein L2 0.945 24 206 GO:0003723
GO:0003735
GO:0005762
GO:0016740
GO:0032543
AF-A0A2M7TJ93-F1-model_v4 50S ribosomal protein L2 0.9392 33 152 GO:0002181
GO:0003723
GO:0003735
GO:0015934
GO:0016740
AF-A0A350QRB4-F1-model_v4 50S ribosomal protein L2 0.9383 44 208 GO:0003723
GO:0003735
GO:0006412
GO:0015934
GO:0016740

Feature Viewer

pLDDT pTM Quality
80.42 0.74 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map