F478213
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 735 | 411 | 701 | 276 |
Family's Representative Sequence
| Representative Sequence | 3300037466|Ga0395898_0054594|Ga0395898_0054594_2429_3445 |
| Length | 338 |
| Sequence | MPHSLLLLVPFRCLAGFRGRVITSRQGLWKEGPFKALTEGLSRSGGRNAQGGITMRHRGGGHRKVYRLVAFARPAGMAAGVVQRIEYDPNRSARIALVRHKGADASAALRQQYSYFLAPQDVKEGDVLHSGADAPIRPGNTLPLSAIPVGMAVHNVELRPGAGGQLARSAGTSCTLVKKGEVLAYFELSAYESAASCTVRPVVHAKLSGHPSLFTCHSPFMIPSTCAGDDGYSVVKLPSGEQRLVLSRCMATIGTLSNPQHKNRKLGKAGAARWLGRRPRVRGVAMNPVDHPHGGGRGKSKGRISQTPWGKPTKGYRTRHNPRTDWVIRQSRHKAMRA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2513237351 | Mesorhizobium alhagi CCNWXJ12-2 | Isolate | Nodule |
| 2 | 2537561592 | Arthrobacter crystallopoietes BAB-32 | Isolate | Rhizosphere |
| 3 | 2643221576 | Nocardioides sp. Root614 | Isolate | Unclassified |
| 4 | 2643221590 | Nocardioides sp. Root682 | Isolate | Unclassified |
| 5 | 2643221615 | Nocardioides sp. Root224 | Isolate | Unclassified |
| 6 | 2643221617 | Nocardioides sp. Root79 | Isolate | Unclassified |
| 7 | 2643221620 | Nocardioides sp. Root240 | Isolate | Unclassified |
| 8 | 2643221623 | Aminobacter sp. DSM 101952 Root100 | Isolate | Unclassified |
| 9 | 2643221657 | Nocardioides sp. Root1257 | Isolate | Unclassified |
| 10 | 2687453341 | Pirellula sp. SH-Sr6A | Isolate | Unclassified |
| 11 | 2728369276 | Kineococcus rhizosphaerae DSM 19711 | Isolate | Rhizosphere |
| 12 | 2738541305 | Nocardioides sp. CF167 | Isolate | Unclassified |
| 13 | 2738543024 | Aminobacter sp. AP02 | Isolate | Unclassified |
| 14 | 2811994874 | Nocardioides sp. SLBN-35 | Isolate | Unclassified |
| 15 | 2816332119 | Kribbella amoyensis DSM 24683 | Isolate | Rhizosphere |
| 16 | 2848551377 | Brachybacterium saurashtrense DSM 23186 | Isolate | Unclassified |
| 17 | 2854911287 | Brucella lupini LUP21 | Isolate | Unclassified |
| 18 | 2857481737 | Nocardioides sp. R-74106 | Isolate | Unclassified |
| 19 | 2858438669 | Leuconostoc mesenteroides YL48 | Isolate | Unclassified |
| 20 | 2883821847 | Microlunatus elymi KUDC0627 | Isolate | Rhizosphere |
| 21 | 2889790730 | Chelativorans xinjiangense lm93 | Isolate | Rhizosphere |
| 22 | 2889914905 | Chelativorans alearense UJN715 | Isolate | Rhizosphere |
| 23 | 2894817345 | Aureimonas psammosilenae YIM DR1026 | Isolate | Unclassified |
| 24 | 2909399089 | Nguyenibacter vanlangensis LMG 31431 | Isolate | Unclassified |
| 25 | 2910245624 | Adhaeribacter radiodurans KUDC8001 | Isolate | Rhizosphere |
| 26 | 2928519762 | Leuconostoc citreum 1377 | Isolate | Rhizosphere |
| 27 | 2929199973 | Roseomonas sp. R-73070 Hybrid assembly | Isolate | Unclassified |
| 28 | 2937843397 | Mesorhizobium xinjiangense lm94 | Isolate | Rhizosphere |
| 29 | 2996336353 | Mesorhizobium sp. YM1C-6-2 | Isolate | Unclassified |
| 30 | 3300000041 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere | Metagenome | Rhizosphere |
| 31 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 32 | 3300000546 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled | Metagenome | Rhizosphere |
| 33 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 34 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 35 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 36 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 37 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 38 | 3300003162 | Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 39 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 40 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 41 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 42 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 43 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 44 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 45 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 49 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 51 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 53 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 55 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 64 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 66 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 68 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 69 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 71 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 72 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 73 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 74 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 76 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 77 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 79 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 80 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 81 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 82 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 83 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 84 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 85 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 86 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 87 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 88 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 89 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 90 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 91 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 92 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 93 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 94 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 95 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 97 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 98 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 99 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 100 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 101 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 102 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 103 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 104 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 105 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 107 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 130 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 131 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 132 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 133 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 134 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 135 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 177 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 179 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 180 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 181 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 182 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 183 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 184 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 185 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 186 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 187 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 188 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 189 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 190 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 191 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 192 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 193 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 194 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 195 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 196 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 197 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 198 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 199 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 200 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 201 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 202 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 203 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 204 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 205 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 206 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 207 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 208 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 209 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 210 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 211 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 212 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 213 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 214 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 215 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 216 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 217 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 218 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 219 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 220 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 221 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 222 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 223 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 224 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 225 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 226 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 227 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 228 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 229 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 230 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 231 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 232 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 233 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 234 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 235 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 236 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 237 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 238 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 239 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 240 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 241 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 242 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 243 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 244 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 245 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 246 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 247 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 248 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 249 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 250 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 251 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 252 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 253 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 254 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 255 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 256 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 257 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 258 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 259 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 260 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 261 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 262 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 263 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 264 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 265 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 266 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 267 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 268 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 269 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 270 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 271 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 272 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 313 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 314 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 315 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 316 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 317 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 318 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 319 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 320 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 321 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 322 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 323 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 324 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 325 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 326 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 327 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 328 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 329 | 3300049132 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 330 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 331 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 332 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 333 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 334 | 3300049532 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 335 | 3300049534 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 336 | 3300049535 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 337 | 3300049536 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 338 | 3300049537 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 339 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 340 | 3300049540 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 341 | 3300049541 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 342 | 3300049556 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 343 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 344 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 345 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 346 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 347 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 348 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 349 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 350 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 351 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 352 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 353 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 354 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 355 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 356 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 357 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 358 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 359 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 360 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 361 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 362 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 363 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 364 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 365 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 366 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 367 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 368 | 3300049655 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought | Metagenome | Rhizosphere |
| 369 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 370 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 371 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 372 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 373 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 374 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 375 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 376 | 3300049851 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought | Metagenome | Rhizosphere |
| 377 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 378 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 379 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 380 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 381 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 382 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 383 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 384 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 385 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 386 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 392 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 393 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 394 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 395 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 396 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 397 | 3300059607 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 398 | 3300059624 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 399 | 3300059639 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 400 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 401 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 402 | 3300059660 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 161R_SW_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 403 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 404 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 405 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 406 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 407 | 641228493 | Gluconacetobacter diazotrophicus PA1 5 | Isolate | Unclassified |
| 408 | 643348555 | Gluconacetobacter diazotrophicus PA1 5 | Isolate | Unclassified |
| 409 | 8002285264 | Aminobacter anthyllidis LMG 26462 | Isolate | Nodule |
| 410 | 8055909800 | Plastoroseomonas hellenica LMG 31523 | Isolate | Unclassified |
| 411 | 8056579771 | Promicromonospora iranensis UTMC 00792 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 88.98 |
| Metatranscriptomes | 6.39 |
| Isolates | 4.63 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.95 |
| Nodule | 0.27 |
| Rhizoplane | 2.45 |
| Rhizosphere | 89.25 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.07 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | ARcpr5oldR_c005287 | 3300000041 | Bacteria | 1110 |
| 2 | ARSoilOldRDRAFT_c004574 | 3300000044 | Bacteria | 1172 |
| 3 | LJNas_1009084 | 3300000546 | Bacteria | 1066 |
| 4 | ARCol0yngRDRAFT_1002500 | 3300000652 | Bacteria | 1382 |
| 5 | JGI24739J22299_10014413 | 3300001989 | Bacteria | 2877 |
| 6 | JGI24739J22299_10028557 | 3300001989 | Bacteria | 1945 |
| 7 | JGI24737J22298_10001920 | 3300001990 | Bacteria | 7427 |
| 8 | JGI25154J39366_1006883 | 3300002738 | Bacteria | 1612 |
| 9 | JGI25152J39213_1000684 | 3300002773 | Bacteria | 17665 |
| 10 | JGI25152J39213_1012216 | 3300002773 | Bacteria | 1855 |
| 11 | Ga0006778J45830_1021879 | 3300003162 | Bacteria | 2215 |
| 12 | JGI25406J46586_10001890 | 3300003203 | Bacteria | 9855 |
| 13 | JGI25406J46586_10025734 | 3300003203 | Bacteria | 2279 |
| 14 | JGI25407J50210_10046065 | 3300003373 | Bacteria | 1111 |
| 15 | Ga0006562J51391_1004293 | 3300003578 | Bacteria | 16914 |
| 16 | Ga0065712_10001248 | 3300005290 | Bacteria | 11167 |
| 17 | Ga0065715_10158979 | 3300005293 | Bacteria | 1648 |
| 18 | Ga0065707_10088640 | 3300005295 | Bacteria | 4590 |
| 19 | Ga0065707_10133633 | 3300005295 | Bacteria | 1878 |
| 20 | Ga0070658_10006748 | 3300005327 | Bacteria | 9291 |
| 21 | Ga0070658_10095168 | 3300005327 | Bacteria | 2458 |
| 22 | Ga0070658_10453883 | 3300005327 | Bacteria | 1104 |
| 23 | Ga0070683_100033140 | 3300005329 | Bacteria | 4708 |
| 24 | Ga0070683_100099873 | 3300005329 | Bacteria | 2732 |
| 25 | Ga0070683_100198008 | 3300005329 | Bacteria | 1908 |
| 26 | Ga0070683_100498931 | 3300005329 | Bacteria | 1163 |
| 27 | Ga0070670_100152576 | 3300005331 | Bacteria | 2000 |
| 28 | Ga0068869_100219093 | 3300005334 | Bacteria | 1508 |
| 29 | Ga0070666_10036702 | 3300005335 | Bacteria | 3254 |
| 30 | Ga0070680_100002147 | 3300005336 | Bacteria | 14571 |
| 31 | Ga0070682_100031259 | 3300005337 | Bacteria | 3219 |
| 32 | Ga0068868_100024919 | 3300005338 | Bacteria | 4543 |
| 33 | Ga0068868_100346771 | 3300005338 | Bacteria | 1271 |
| 34 | Ga0070660_100101675 | 3300005339 | Bacteria | 2278 |
| 35 | Ga0070689_100124088 | 3300005340 | Bacteria | 2065 |
| 36 | Ga0070691_10023324 | 3300005341 | Bacteria | 2873 |
| 37 | Ga0070691_10051030 | 3300005341 | Bacteria | 1974 |
| 38 | Ga0070668_100042683 | 3300005347 | Bacteria | 3476 |
| 39 | Ga0070668_100045508 | 3300005347 | Bacteria | 3367 |
| 40 | Ga0070668_100062064 | 3300005347 | Bacteria | 2895 |
| 41 | Ga0070669_100100198 | 3300005353 | Bacteria | 2184 |
| 42 | Ga0070669_100191891 | 3300005353 | Bacteria | 1603 |
| 43 | Ga0070669_100221540 | 3300005353 | Bacteria | 1496 |
| 44 | Ga0070675_100076470 | 3300005354 | Bacteria | 2785 |
| 45 | Ga0070674_100002048 | 3300005356 | Bacteria | 11040 |
| 46 | Ga0070674_100595200 | 3300005356 | Bacteria | 934 |
| 47 | Ga0070659_100054114 | 3300005366 | Bacteria | 3160 |
| 48 | Ga0070667_100106316 | 3300005367 | Bacteria | 2429 |
| 49 | Ga0070667_100313417 | 3300005367 | Bacteria | 1414 |
| 50 | Ga0070714_100001163 | 3300005435 | Bacteria | 18957 |
| 51 | Ga0070714_100049770 | 3300005435 | Bacteria | 3568 |
| 52 | Ga0070713_100001675 | 3300005436 | Bacteria | 14235 |
| 53 | Ga0070713_100061709 | 3300005436 | Bacteria | 3137 |
| 54 | Ga0070713_100070192 | 3300005436 | Bacteria | 2957 |
| 55 | Ga0070713_100096238 | 3300005436 | Bacteria | 2555 |
| 56 | Ga0070713_100464287 | 3300005436 | Bacteria | 1191 |
| 57 | Ga0070710_10218754 | 3300005437 | Bacteria | 1211 |
| 58 | Ga0070701_10380530 | 3300005438 | Bacteria | 889 |
| 59 | Ga0070711_100153181 | 3300005439 | Bacteria | 1740 |
| 60 | Ga0070700_100147284 | 3300005441 | Bacteria | 1606 |
| 61 | Ga0070694_100041677 | 3300005444 | Bacteria | 3064 |
| 62 | Ga0070662_100029774 | 3300005457 | Bacteria | 3813 |
| 63 | Ga0070662_100056709 | 3300005457 | Bacteria | 2844 |
| 64 | Ga0070662_100100806 | 3300005457 | Bacteria | 2185 |
| 65 | Ga0070681_10012326 | 3300005458 | Bacteria | 8476 |
| 66 | Ga0070681_10401460 | 3300005458 | Bacteria | 1282 |
| 67 | Ga0068867_100178803 | 3300005459 | Bacteria | 1685 |
| 68 | Ga0068867_100213734 | 3300005459 | Bacteria | 1550 |
| 69 | Ga0068867_100319634 | 3300005459 | Bacteria | 1286 |
| 70 | Ga0070706_100200060 | 3300005467 | Bacteria | 1866 |
| 71 | Ga0070707_100135302 | 3300005468 | Bacteria | 2397 |
| 72 | Ga0070699_100237826 | 3300005518 | Bacteria | 1625 |
| 73 | Ga0070679_100002074 | 3300005530 | Bacteria | 18031 |
| 74 | Ga0068853_100079767 | 3300005539 | Bacteria | 2863 |
| 75 | Ga0068853_100151119 | 3300005539 | Bacteria | 2090 |
| 76 | Ga0068853_100164124 | 3300005539 | Bacteria | 2006 |
| 77 | Ga0070665_100015455 | 3300005548 | Bacteria | 7667 |
| 78 | Ga0070704_100037541 | 3300005549 | Bacteria | 3310 |
| 79 | Ga0068855_100106565 | 3300005563 | Bacteria | 3221 |
| 80 | Ga0068855_100107969 | 3300005563 | Bacteria | 3197 |
| 81 | Ga0068855_100169574 | 3300005563 | Bacteria | 2472 |
| 82 | Ga0068855_100257885 | 3300005563 | Bacteria | 1943 |
| 83 | Ga0068857_100001770 | 3300005577 | Bacteria | 17362 |
| 84 | Ga0068856_100012640 | 3300005614 | Bacteria | 8174 |
| 85 | Ga0068856_100153031 | 3300005614 | Bacteria | 2316 |
| 86 | Ga0068856_100160364 | 3300005614 | Bacteria | 2259 |
| 87 | Ga0068852_100120419 | 3300005616 | Bacteria | 2401 |
| 88 | Ga0068852_100382228 | 3300005616 | Bacteria | 1381 |
| 89 | Ga0068859_100081864 | 3300005617 | Bacteria | 3270 |
| 90 | Ga0068861_100039191 | 3300005719 | Bacteria | 3535 |
| 91 | Ga0068858_100141406 | 3300005842 | Bacteria | 2259 |
| 92 | Ga0068862_100226636 | 3300005844 | Bacteria | 1694 |
| 93 | Ga0068862_100238340 | 3300005844 | Bacteria | 1653 |
| 94 | Ga0081455_10009428 | 3300005937 | Bacteria | 10043 |
| 95 | Ga0081455_10022468 | 3300005937 | Bacteria | 5894 |
| 96 | Ga0081455_10061103 | 3300005937 | Bacteria | 3172 |
| 97 | Ga0081455_10062816 | 3300005937 | Bacteria | 3120 |
| 98 | Ga0081455_10095013 | 3300005937 | Bacteria | 2407 |
| 99 | Ga0081455_10108833 | 3300005937 | Bacteria | 2206 |
| 100 | Ga0081538_10010547 | 3300005981 | Bacteria | 7572 |
| 101 | Ga0081538_10038576 | 3300005981 | Bacteria | 3079 |
| 102 | Ga0081540_1006273 | 3300005983 | Bacteria | 8701 |
| 103 | Ga0081539_10001286 | 3300005985 | Bacteria | 44180 |
| 104 | Ga0070717_10085206 | 3300006028 | Bacteria | 2659 |
| 105 | Ga0070717_10107179 | 3300006028 | Bacteria | 2379 |
| 106 | Ga0075363_100232164 | 3300006048 | Bacteria | 1059 |
| 107 | Ga0075432_10002369 | 3300006058 | Bacteria | 6284 |
| 108 | Ga0075432_10005901 | 3300006058 | Bacteria | 4165 |
| 109 | Ga0070712_100004619 | 3300006175 | Bacteria | 8513 |
| 110 | Ga0070712_100010110 | 3300006175 | Bacteria | 5947 |
| 111 | Ga0097621_100068382 | 3300006237 | Bacteria | 2929 |
| 112 | Ga0097621_100231168 | 3300006237 | Bacteria | 1614 |
| 113 | Ga0068871_100063920 | 3300006358 | Bacteria | 3011 |
| 114 | Ga0068871_100092414 | 3300006358 | Bacteria | 2523 |
| 115 | Ga0075428_100000009 | 3300006844 | Bacteria | 266370 |
| 116 | Ga0075428_100017186 | 3300006844 | Bacteria | 7993 |
| 117 | Ga0075428_100027125 | 3300006844 | Bacteria | 6341 |
| 118 | Ga0075428_100089387 | 3300006844 | Bacteria | 3360 |
| 119 | Ga0075428_100201398 | 3300006844 | Bacteria | 2152 |
| 120 | Ga0075428_100280060 | 3300006844 | Bacteria | 1794 |
| 121 | Ga0075430_100005226 | 3300006846 | Bacteria | 10945 |
| 122 | Ga0075430_100252224 | 3300006846 | Bacteria | 1462 |
| 123 | Ga0075431_100001734 | 3300006847 | Bacteria | 20513 |
| 124 | Ga0075431_100014269 | 3300006847 | Bacteria | 8034 |
| 125 | Ga0075433_10000978 | 3300006852 | Bacteria | 20308 |
| 126 | Ga0075433_10006179 | 3300006852 | Bacteria | 9447 |
| 127 | Ga0075433_10032299 | 3300006852 | Bacteria | 4483 |
| 128 | Ga0075434_100003203 | 3300006871 | Bacteria | 14595 |
| 129 | Ga0075434_100003585 | 3300006871 | Bacteria | 13870 |
| 130 | Ga0075434_100011038 | 3300006871 | Bacteria | 8499 |
| 131 | Ga0075429_100169067 | 3300006880 | Bacteria | 1915 |
| 132 | Ga0075429_100201226 | 3300006880 | Bacteria | 1745 |
| 133 | Ga0075429_100661484 | 3300006880 | Bacteria | 915 |
| 134 | Ga0068865_100159615 | 3300006881 | Bacteria | 1719 |
| 135 | Ga0075436_100004373 | 3300006914 | Bacteria | 9696 |
| 136 | Ga0075436_100004891 | 3300006914 | Bacteria | 9208 |
| 137 | Ga0097620_100081865 | 3300006931 | Bacteria | 3270 |
| 138 | Ga0075435_100002118 | 3300007076 | Bacteria | 13070 |
| 139 | Ga0075435_100027841 | 3300007076 | Bacteria | 4426 |
| 140 | Ga0075435_100115827 | 3300007076 | Bacteria | 2232 |
| 141 | Ga0105240_10114469 | 3300009093 | Bacteria | 3258 |
| 142 | Ga0105240_10122115 | 3300009093 | Bacteria | 3135 |
| 143 | Ga0105240_10188196 | 3300009093 | Bacteria | 2429 |
| 144 | Ga0105240_10380517 | 3300009093 | Bacteria | 1594 |
| 145 | Ga0111539_10000010 | 3300009094 | Bacteria | 366246 |
| 146 | Ga0111539_10005852 | 3300009094 | Bacteria | 15894 |
| 147 | Ga0111539_10023680 | 3300009094 | Bacteria | 7545 |
| 148 | Ga0111539_10042172 | 3300009094 | Bacteria | 5483 |
| 149 | Ga0105245_10061281 | 3300009098 | Bacteria | 3391 |
| 150 | Ga0105245_10086439 | 3300009098 | Bacteria | 2876 |
| 151 | Ga0105247_10144028 | 3300009101 | Bacteria | 1564 |
| 152 | Ga0114129_10000234 | 3300009147 | Bacteria | 61922 |
| 153 | Ga0114129_10001031 | 3300009147 | Bacteria | 36419 |
| 154 | Ga0114129_10064618 | 3300009147 | Bacteria | 5107 |
| 155 | Ga0105243_10006200 | 3300009148 | Bacteria | 9247 |
| 156 | Ga0105243_10018664 | 3300009148 | Bacteria | 5256 |
| 157 | Ga0105241_10088531 | 3300009174 | Bacteria | 2438 |
| 158 | Ga0105242_10043876 | 3300009176 | Bacteria | 3619 |
| 159 | Ga0105242_10714606 | 3300009176 | Bacteria | 982 |
| 160 | Ga0105248_10284388 | 3300009177 | Bacteria | 1862 |
| 161 | Ga0105238_10002481 | 3300009551 | Bacteria | 18468 |
| 162 | Ga0105249_10006301 | 3300009553 | Bacteria | 10308 |
| 163 | Ga0105239_10006176 | 3300010375 | Bacteria | 13938 |
| 164 | Ga0105239_10291478 | 3300010375 | Bacteria | 1838 |
| 165 | Ga0105239_10427731 | 3300010375 | Bacteria | 1500 |
| 166 | Ga0157369_10004249 | 3300013105 | Bacteria | 16965 |
| 167 | Ga0157369_10375546 | 3300013105 | Bacteria | 1476 |
| 168 | Ga0157374_10106962 | 3300013296 | Bacteria | 2688 |
| 169 | Ga0157378_10005119 | 3300013297 | Bacteria | 11510 |
| 170 | Ga0157378_10723981 | 3300013297 | Bacteria | 1016 |
| 171 | Ga0163162_10018828 | 3300013306 | Bacteria | 6769 |
| 172 | Ga0163162_10032281 | 3300013306 | Bacteria | 5200 |
| 173 | Ga0163162_10434103 | 3300013306 | Bacteria | 1445 |
| 174 | Ga0163162_10712235 | 3300013306 | Bacteria | 1125 |
| 175 | Ga0157372_10003029 | 3300013307 | Bacteria | 18103 |
| 176 | Ga0157372_10064662 | 3300013307 | Bacteria | 4104 |
| 177 | Ga0157372_10126193 | 3300013307 | Bacteria | 2942 |
| 178 | Ga0157372_10550984 | 3300013307 | Bacteria | 1344 |
| 179 | Ga0157375_10079983 | 3300013308 | Bacteria | 3305 |
| 180 | Ga0157375_10446902 | 3300013308 | Bacteria | 1458 |
| 181 | Ga0157375_11593496 | 3300013308 | Bacteria | 772 |
| 182 | Ga0163163_10007538 | 3300014325 | Bacteria | 9607 |
| 183 | Ga0163163_10142252 | 3300014325 | Bacteria | 2441 |
| 184 | Ga0163163_10151103 | 3300014325 | Bacteria | 2366 |
| 185 | Ga0163163_10919796 | 3300014325 | Bacteria | 938 |
| 186 | Ga0157380_10119197 | 3300014326 | Bacteria | 2232 |
| 187 | Ga0157376_10223096 | 3300014969 | Bacteria | 1747 |
| 188 | Ga0157376_10258266 | 3300014969 | Bacteria | 1631 |
| 189 | Ga0163161_10149335 | 3300017792 | Bacteria | 1775 |
| 190 | Ga0163161_10152796 | 3300017792 | Bacteria | 1755 |
| 191 | Ga0206354_10115950 | 3300020081 | Bacteria | 1155 |
| 192 | Ga0206354_10954251 | 3300020081 | Bacteria | 2646 |
| 193 | Ga0154015_1213429 | 3300020610 | Bacteria | 2724 |
| 194 | Ga0213876_10029742 | 3300021384 | Bacteria | 2878 |
| 195 | Ga0213876_10135683 | 3300021384 | Bacteria | 1309 |
| 196 | Ga0213875_10008279 | 3300021388 | Bacteria | 5333 |
| 197 | Ga0213875_10028865 | 3300021388 | Bacteria | 2631 |
| 198 | Ga0213875_10039023 | 3300021388 | Bacteria | 2237 |
| 199 | Ga0213875_10063969 | 3300021388 | Bacteria | 1719 |
| 200 | Ga0213875_10117849 | 3300021388 | Bacteria | 1240 |
| 201 | Ga0213871_10009852 | 3300021441 | Bacteria | 2152 |
| 202 | Ga0213871_10016668 | 3300021441 | Bacteria | 1775 |
| 203 | Ga0213871_10018399 | 3300021441 | Bacteria | 1709 |
| 204 | Ga0224712_10003182 | 3300022467 | Bacteria | 4212 |
| 205 | Ga0209025_1052425 | 3300025294 | Bacteria | 1610 |
| 206 | Ga0207688_10009707 | 3300025901 | Bacteria | 5237 |
| 207 | Ga0207688_10090599 | 3300025901 | Bacteria | 1755 |
| 208 | Ga0207680_10250809 | 3300025903 | Bacteria | 1222 |
| 209 | Ga0207647_10177936 | 3300025904 | Bacteria | 1237 |
| 210 | Ga0207654_10045892 | 3300025911 | Bacteria | 2489 |
| 211 | Ga0207707_10004150 | 3300025912 | Bacteria | 12833 |
| 212 | Ga0207707_10145067 | 3300025912 | Bacteria | 2075 |
| 213 | Ga0207707_10182209 | 3300025912 | Bacteria | 1833 |
| 214 | Ga0207707_10242136 | 3300025912 | Bacteria | 1568 |
| 215 | Ga0207695_10004731 | 3300025913 | Bacteria | 18438 |
| 216 | Ga0207695_10150035 | 3300025913 | Bacteria | 2271 |
| 217 | Ga0207693_10014094 | 3300025915 | Bacteria | 6437 |
| 218 | Ga0207693_10029783 | 3300025915 | Bacteria | 4309 |
| 219 | Ga0207693_10484244 | 3300025915 | Bacteria | 966 |
| 220 | Ga0207663_10094109 | 3300025916 | Bacteria | 1996 |
| 221 | Ga0207660_10006183 | 3300025917 | Bacteria | 7778 |
| 222 | Ga0207660_10278872 | 3300025917 | Bacteria | 1326 |
| 223 | Ga0207657_10152434 | 3300025919 | Bacteria | 1882 |
| 224 | Ga0207652_10266259 | 3300025921 | Bacteria | 1546 |
| 225 | Ga0207681_10084898 | 3300025923 | Bacteria | 2246 |
| 226 | Ga0207694_10005630 | 3300025924 | Bacteria | 9606 |
| 227 | Ga0207694_10010354 | 3300025924 | Bacteria | 7030 |
| 228 | Ga0207694_10356163 | 3300025924 | Bacteria | 1212 |
| 229 | Ga0207659_10074709 | 3300025926 | Bacteria | 2485 |
| 230 | Ga0207687_10258199 | 3300025927 | Bacteria | 1388 |
| 231 | Ga0207687_10275367 | 3300025927 | Bacteria | 1347 |
| 232 | Ga0207700_10033174 | 3300025928 | Bacteria | 3692 |
| 233 | Ga0207700_10225655 | 3300025928 | Bacteria | 1590 |
| 234 | Ga0207664_10006241 | 3300025929 | Bacteria | 8187 |
| 235 | Ga0207664_10075173 | 3300025929 | Bacteria | 2731 |
| 236 | Ga0207644_10055038 | 3300025931 | Bacteria | 2867 |
| 237 | Ga0207690_10069348 | 3300025932 | Bacteria | 2426 |
| 238 | Ga0207706_10016355 | 3300025933 | Bacteria | 6697 |
| 239 | Ga0207706_10021255 | 3300025933 | Bacteria | 5830 |
| 240 | Ga0207709_10051484 | 3300025935 | Bacteria | 2525 |
| 241 | Ga0207709_10158366 | 3300025935 | Bacteria | 1576 |
| 242 | Ga0207669_10029404 | 3300025937 | Bacteria | 3039 |
| 243 | Ga0207669_10091444 | 3300025937 | Bacteria | 1982 |
| 244 | Ga0207704_10310871 | 3300025938 | Bacteria | 1211 |
| 245 | Ga0207711_10189269 | 3300025941 | Bacteria | 1875 |
| 246 | Ga0207711_10256587 | 3300025941 | Bacteria | 1606 |
| 247 | Ga0207661_10026560 | 3300025944 | Bacteria | 4413 |
| 248 | Ga0207661_10100411 | 3300025944 | Bacteria | 2429 |
| 249 | Ga0207661_10150275 | 3300025944 | Bacteria | 2013 |
| 250 | Ga0207667_10003860 | 3300025949 | Bacteria | 18438 |
| 251 | Ga0207667_10014395 | 3300025949 | Bacteria | 9022 |
| 252 | Ga0207667_10107977 | 3300025949 | Bacteria | 2871 |
| 253 | Ga0207667_10145375 | 3300025949 | Bacteria | 2441 |
| 254 | Ga0207712_10025609 | 3300025961 | Bacteria | 3921 |
| 255 | Ga0207712_10131354 | 3300025961 | Bacteria | 1909 |
| 256 | Ga0207668_10030370 | 3300025972 | Bacteria | 3551 |
| 257 | Ga0207668_10358872 | 3300025972 | Bacteria | 1221 |
| 258 | Ga0207658_10083039 | 3300025986 | Bacteria | 2461 |
| 259 | Ga0207677_10005586 | 3300026023 | Bacteria | 6831 |
| 260 | Ga0207703_10030380 | 3300026035 | Bacteria | 4270 |
| 261 | Ga0207703_10057141 | 3300026035 | Bacteria | 3180 |
| 262 | Ga0207703_10125321 | 3300026035 | Bacteria | 2211 |
| 263 | Ga0207703_10129650 | 3300026035 | Bacteria | 2176 |
| 264 | Ga0207639_10039754 | 3300026041 | Bacteria | 3507 |
| 265 | Ga0207639_10292678 | 3300026041 | Bacteria | 1436 |
| 266 | Ga0207639_10648943 | 3300026041 | Bacteria | 976 |
| 267 | Ga0207708_10073277 | 3300026075 | Bacteria | 2624 |
| 268 | Ga0207708_10212591 | 3300026075 | Bacteria | 1547 |
| 269 | Ga0207708_10297615 | 3300026075 | Bacteria | 1311 |
| 270 | Ga0207702_10002606 | 3300026078 | Bacteria | 16944 |
| 271 | Ga0207702_10227978 | 3300026078 | Bacteria | 1739 |
| 272 | Ga0207702_10563353 | 3300026078 | Bacteria | 1115 |
| 273 | Ga0207641_10024102 | 3300026088 | Bacteria | 5015 |
| 274 | Ga0207648_10078394 | 3300026089 | Bacteria | 2882 |
| 275 | Ga0207674_10003800 | 3300026116 | Bacteria | 18420 |
| 276 | Ga0207675_100033691 | 3300026118 | Bacteria | 4772 |
| 277 | Ga0207698_10009516 | 3300026142 | Bacteria | 6201 |
| 278 | Ga0207698_10480465 | 3300026142 | Bacteria | 1205 |
| 279 | Ga0207698_10501858 | 3300026142 | Bacteria | 1181 |
| 280 | Ga0209974_10004194 | 3300027876 | Bacteria | 5152 |
| 281 | Ga0207428_10000034 | 3300027907 | Bacteria | 231306 |
| 282 | Ga0207428_10001294 | 3300027907 | Bacteria | 26662 |
| 283 | Ga0207428_10001309 | 3300027907 | Bacteria | 26510 |
| 284 | Ga0268266_10011799 | 3300028379 | Bacteria | 7574 |
| 285 | Ga0265319_1000011 | 3300028563 | Bacteria | 184643 |
| 286 | Ga0265334_10004519 | 3300028573 | Bacteria | 6167 |
| 287 | Ga0265318_10000003 | 3300028577 | Bacteria | 333722 |
| 288 | Ga0265318_10001100 | 3300028577 | Bacteria | 16981 |
| 289 | Ga0307515_10043659 | 3300028794 | Bacteria | 6959 |
| 290 | Ga0265338_10008853 | 3300028800 | Bacteria | 12137 |
| 291 | Ga0265338_10199692 | 3300028800 | Bacteria | 1509 |
| 292 | Ga0265338_10307724 | 3300028800 | Bacteria | 1150 |
| 293 | Ga0265324_10013735 | 3300029957 | Bacteria | 3013 |
| 294 | Ga0314311_1038998 | 3300030733 | Bacteria | 3937 |
| 295 | Ga0265760_10089938 | 3300031090 | Bacteria | 960 |
| 296 | Ga0265320_10002219 | 3300031240 | Bacteria | 13630 |
| 297 | Ga0265329_10030032 | 3300031242 | Bacteria | 1773 |
| 298 | Ga0265340_10021103 | 3300031247 | Bacteria | 3341 |
| 299 | Ga0265339_10018439 | 3300031249 | Bacteria | 4114 |
| 300 | Ga0265339_10061008 | 3300031249 | Bacteria | 2031 |
| 301 | Ga0265331_10008339 | 3300031250 | Bacteria | 5900 |
| 302 | Ga0265327_10000318 | 3300031251 | Bacteria | 92042 |
| 303 | Ga0265327_10024399 | 3300031251 | Bacteria | 3555 |
| 304 | Ga0265316_10009231 | 3300031344 | Bacteria | 9080 |
| 305 | Ga0265316_10078086 | 3300031344 | Bacteria | 2542 |
| 306 | Ga0265316_10262348 | 3300031344 | Bacteria | 1266 |
| 307 | Ga0307408_100010829 | 3300031548 | Bacteria | 6017 |
| 308 | Ga0307408_100063904 | 3300031548 | Bacteria | 2694 |
| 309 | Ga0307408_100193251 | 3300031548 | Bacteria | 1641 |
| 310 | Ga0265313_10003503 | 3300031595 | Bacteria | 12649 |
| 311 | Ga0265313_10007926 | 3300031595 | Bacteria | 7140 |
| 312 | Ga0265313_10014640 | 3300031595 | Bacteria | 4622 |
| 313 | Ga0307508_10000276 | 3300031616 | Bacteria | 63298 |
| 314 | Ga0316575_10033954 | 3300031665 | Bacteria | 2003 |
| 315 | Ga0316579_10026903 | 3300031691 | Bacteria | 2608 |
| 316 | Ga0265314_10000612 | 3300031711 | Bacteria | 44102 |
| 317 | Ga0265314_10000833 | 3300031711 | Bacteria | 36549 |
| 318 | Ga0265314_10009286 | 3300031711 | Bacteria | 8330 |
| 319 | Ga0265342_10000111 | 3300031712 | Bacteria | 90609 |
| 320 | Ga0265342_10066802 | 3300031712 | Bacteria | 2106 |
| 321 | Ga0316576_10001965 | 3300031727 | Bacteria | 11485 |
| 322 | Ga0316576_10038621 | 3300031727 | Bacteria | 3424 |
| 323 | Ga0316578_10019064 | 3300031728 | Bacteria | 3770 |
| 324 | Ga0316578_10317608 | 3300031728 | Bacteria | 930 |
| 325 | Ga0307405_10002221 | 3300031731 | Bacteria | 8485 |
| 326 | Ga0307405_10023768 | 3300031731 | Bacteria | 3489 |
| 327 | Ga0307413_10005596 | 3300031824 | Bacteria | 5630 |
| 328 | Ga0307413_10345954 | 3300031824 | Bacteria | 1145 |
| 329 | Ga0307410_10003149 | 3300031852 | Bacteria | 8200 |
| 330 | Ga0307410_10028825 | 3300031852 | Bacteria | 3526 |
| 331 | Ga0307410_10144730 | 3300031852 | Bacteria | 1763 |
| 332 | Ga0307410_10466457 | 3300031852 | Bacteria | 1033 |
| 333 | Ga0307406_10000352 | 3300031901 | Bacteria | 26840 |
| 334 | Ga0307406_10006213 | 3300031901 | Bacteria | 6574 |
| 335 | Ga0307406_10012506 | 3300031901 | Bacteria | 4838 |
| 336 | Ga0307406_10040541 | 3300031901 | Bacteria | 2896 |
| 337 | Ga0307407_10001962 | 3300031903 | Bacteria | 7806 |
| 338 | Ga0307407_10076278 | 3300031903 | Bacteria | 2012 |
| 339 | Ga0307412_10011241 | 3300031911 | Bacteria | 5178 |
| 340 | Ga0307409_100018091 | 3300031995 | Bacteria | 4722 |
| 341 | Ga0307409_100043245 | 3300031995 | Bacteria | 3380 |
| 342 | Ga0307416_100000084 | 3300032002 | Bacteria | 64599 |
| 343 | Ga0307416_100043820 | 3300032002 | Bacteria | 3507 |
| 344 | Ga0307416_100082529 | 3300032002 | Bacteria | 2723 |
| 345 | Ga0307416_100128536 | 3300032002 | Bacteria | 2275 |
| 346 | Ga0307416_100156454 | 3300032002 | Bacteria | 2099 |
| 347 | Ga0307416_100421857 | 3300032002 | Bacteria | 1378 |
| 348 | Ga0307414_10014132 | 3300032004 | Bacteria | 4772 |
| 349 | Ga0307414_10018122 | 3300032004 | Bacteria | 4325 |
| 350 | Ga0307414_10270892 | 3300032004 | Bacteria | 1422 |
| 351 | Ga0307411_10001782 | 3300032005 | Bacteria | 9096 |
| 352 | Ga0307411_10091805 | 3300032005 | Bacteria | 2122 |
| 353 | Ga0307411_10145028 | 3300032005 | Bacteria | 1756 |
| 354 | Ga0307415_100039636 | 3300032126 | Bacteria | 3115 |
| 355 | Ga0307415_100091820 | 3300032126 | Bacteria | 2200 |
| 356 | Ga0307415_100132154 | 3300032126 | Bacteria | 1891 |
| 357 | Ga0307415_100213867 | 3300032126 | Bacteria | 1540 |
| 358 | Ga0316583_10003862 | 3300032133 | Bacteria | 5316 |
| 359 | Ga0316583_10041645 | 3300032133 | Bacteria | 1625 |
| 360 | Ga0316580_10011148 | 3300032139 | Bacteria | 2724 |
| 361 | Ga0316593_10000765 | 3300032168 | Bacteria | 6363 |
| 362 | Ga0316593_10033258 | 3300032168 | Bacteria | 1687 |
| 363 | Ga0316592_1000022 | 3300033524 | Bacteria | 11920 |
| 364 | Ga0316588_1001826 | 3300033528 | Bacteria | 3604 |
| 365 | Ga0316588_1021223 | 3300033528 | Bacteria | 1476 |
| 366 | Ga0316596_1003568 | 3300033541 | Bacteria | 3425 |
| 367 | Ga0316596_1006644 | 3300033541 | Bacteria | 2700 |
| 368 | Ga0316596_1041000 | 3300033541 | Bacteria | 1216 |
| 369 | Ga0373926_0029697 | 3300035083 | Bacteria | 1922 |
| 370 | Ga0373929_0012321 | 3300035085 | Bacteria | 1624 |
| 371 | Ga0373944_0002105 | 3300035089 | Bacteria | 5058 |
| 372 | Ga0373949_0031199 | 3300035090 | Bacteria | 1270 |
| 373 | Ga0373923_0044734 | 3300035111 | Bacteria | 1837 |
| 374 | Ga0373953_0004557 | 3300035117 | Bacteria | 4422 |
| 375 | Ga0373954_0074868 | 3300035118 | Bacteria | 1612 |
| 376 | Ga0373957_0016069 | 3300035120 | Bacteria | 2587 |
| 377 | Ga0373946_0012800 | 3300035171 | Bacteria | 3146 |
| 378 | Ga0373955_0102640 | 3300035172 | Bacteria | 1644 |
| 379 | Ga0373955_0143743 | 3300035172 | Bacteria | 1400 |
| 380 | Ga0373942_0014525 | 3300035207 | Bacteria | 1909 |
| 381 | Ga0373931_0030612 | 3300035691 | Bacteria | 2772 |
| 382 | Ga0373935_0203768 | 3300035692 | Bacteria | 1368 |
| 383 | Ga0373933_0019715 | 3300035724 | Bacteria | 3815 |
| 384 | Ga0373933_0072510 | 3300035724 | Bacteria | 2097 |
| 385 | Ga0373937_0000922 | 3300036401 | Bacteria | 24939 |
| 386 | Ga0373937_0015501 | 3300036401 | Bacteria | 6741 |
| 387 | Ga0373937_0041143 | 3300036401 | Bacteria | 4216 |
| 388 | Ga0373937_0058846 | 3300036401 | Bacteria | 3530 |
| 389 | Ga0373937_0061124 | 3300036401 | Bacteria | 3463 |
| 390 | Ga0373937_0074325 | 3300036401 | Bacteria | 3136 |
| 391 | Ga0373937_0084294 | 3300036401 | Bacteria | 2940 |
| 392 | Ga0373937_0125512 | 3300036401 | Bacteria | 2394 |
| 393 | Ga0373937_0138314 | 3300036401 | Bacteria | 2278 |
| 394 | Ga0373937_0168158 | 3300036401 | Bacteria | 2057 |
| 395 | Ga0373937_0247931 | 3300036401 | Bacteria | 1679 |
| 396 | Ga0316582_0055389 | 3300036647 | Bacteria | 2527 |
| 397 | Ga0373925_0008231 | 3300037068 | Bacteria | 7590 |
| 398 | Ga0395900_0003432 | 3300037418 | Bacteria | 17137 |
| 399 | Ga0395900_0042235 | 3300037418 | Bacteria | 4697 |
| 400 | Ga0395900_0050861 | 3300037418 | Bacteria | 4268 |
| 401 | Ga0395898_0054594 | 3300037466 | Bacteria | 3898 |
| 402 | Ga0395898_0130984 | 3300037466 | Bacteria | 2402 |
| 403 | Ga0395905_0003848 | 3300037471 | Bacteria | 15828 |
| 404 | Ga0395905_0141225 | 3300037471 | Bacteria | 2265 |
| 405 | Ga0436364_0000682 | 3300037853 | Bacteria | 2241 |
| 406 | Ga0436364_0052675 | 3300037853 | Bacteria | 2449 |
| 407 | Ga0436364_0171064 | 3300037853 | Bacteria | 1409 |
| 408 | Ga0436364_0389284 | 3300037853 | Bacteria | 5767 |
| 409 | Ga0436364_0554982 | 3300037853 | Bacteria | 6536 |
| 410 | Ga0436364_1053341 | 3300037853 | Bacteria | 4230 |
| 411 | Ga0436364_1266987 | 3300037853 | Bacteria | 1990 |
| 412 | Ga0395901_0006624 | 3300038443 | Bacteria | 11701 |
| 413 | Ga0395901_0149529 | 3300038443 | Bacteria | 2454 |
| 414 | Ga0395901_0440359 | 3300038443 | Bacteria | 1334 |
| 415 | Ga0400489_47982 | 3300039093 | Bacteria | 6330 |
| 416 | Ga0436365_0045604 | 3300039437 | Bacteria | 951 |
| 417 | Ga0436365_0334948 | 3300039437 | Bacteria | 1465 |
| 418 | Ga0436365_0615041 | 3300039437 | Bacteria | 1217 |
| 419 | Ga0436365_0743626 | 3300039437 | Bacteria | 2698 |
| 420 | Ga0436360_0333232 | 3300039438 | Bacteria | 5402 |
| 421 | Ga0436360_0432234 | 3300039438 | Bacteria | 1838 |
| 422 | Ga0436360_0558978 | 3300039438 | Bacteria | 2949 |
| 423 | Ga0436360_0651402 | 3300039438 | Bacteria | 1001 |
| 424 | Ga0436360_0902642 | 3300039438 | Bacteria | 1876 |
| 425 | Ga0436360_1031006 | 3300039438 | Bacteria | 1003 |
| 426 | Ga0436360_1332781 | 3300039438 | Bacteria | 3795 |
| 427 | Ga0436361_0278088 | 3300039447 | Bacteria | 3953 |
| 428 | Ga0436363_0517643 | 3300039450 | Bacteria | 1033 |
| 429 | Ga0436363_0590019 | 3300039450 | Bacteria | 1236 |
| 430 | Ga0436362_0192210 | 3300039453 | Bacteria | 1393 |
| 431 | Ga0436362_0446646 | 3300039453 | Bacteria | 2374 |
| 432 | Ga0436362_0632372 | 3300039453 | Bacteria | 1291 |
| 433 | Ga0436362_1298757 | 3300039453 | Bacteria | 1805 |
| 434 | Ga0439465_0016498 | 3300041413 | Bacteria | 2303 |
| 435 | Ga0451797_1211872 | 3300041453 | Bacteria | 1347 |
| 436 | Ga0451833_0393181 | 3300041491 | Bacteria | 2121 |
| 437 | Ga0451843_0866875 | 3300041509 | Bacteria | 2401 |
| 438 | Ga0451855_1581117 | 3300041511 | Bacteria | 1083 |
| 439 | Ga0451855_1660956 | 3300041511 | Bacteria | 1056 |
| 440 | Ga0439448_0078783 | 3300042005 | Bacteria | 1104 |
| 441 | Ga0439455_0039210 | 3300042012 | Bacteria | 1207 |
| 442 | Ga0439463_009011 | 3300042016 | Bacteria | 2458 |
| 443 | Ga0439446_0066691 | 3300042156 | Bacteria | 1096 |
| 444 | Ga0439444_0006030 | 3300042437 | Bacteria | 1816 |
| 445 | Ga0439444_0013747 | 3300042437 | Bacteria | 1344 |
| 446 | Ga0439459_0001406 | 3300042438 | Bacteria | 3534 |
| 447 | Ga0439464_0007832 | 3300042439 | Bacteria | 2794 |
| 448 | Ga0451577_0003056 | 3300042876 | Bacteria | 19007 |
| 449 | Ga0451577_0038846 | 3300042876 | Bacteria | 4280 |
| 450 | Ga0439440_0029912 | 3300042993 | Bacteria | 1280 |
| 451 | Ga0453683_0012218 | 3300044673 | Bacteria | 5632 |
| 452 | Ga0453683_0041549 | 3300044673 | Bacteria | 2888 |
| 453 | Ga0466965_0029069 | 3300044683 | Bacteria | 2688 |
| 454 | Ga0466961_0103620 | 3300044693 | Bacteria | 1791 |
| 455 | Ga0466961_0149441 | 3300044693 | Bacteria | 1459 |
| 456 | Ga0466963_0056459 | 3300044694 | Bacteria | 2613 |
| 457 | Ga0453684_0257466 | 3300044712 | Bacteria | 2001 |
| 458 | Ga0466971_0061994 | 3300044719 | Bacteria | 1692 |
| 459 | Ga0466970_0008583 | 3300044765 | Bacteria | 5145 |
| 460 | Ga0466970_0056218 | 3300044765 | Bacteria | 2103 |
| 461 | Ga0466957_0146121 | 3300044842 | Bacteria | 1526 |
| 462 | Ga0466960_0012755 | 3300044901 | Bacteria | 3555 |
| 463 | Ga0466960_0044553 | 3300044901 | Bacteria | 2115 |
| 464 | Ga0466960_0083379 | 3300044901 | Bacteria | 1615 |
| 465 | Ga0451576_0000055 | 3300045051 | Bacteria | 304830 |
| 466 | Ga0451576_0019276 | 3300045051 | Bacteria | 7448 |
| 467 | Ga0466967_0404941 | 3300045976 | Bacteria | 1328 |
| 468 | Ga0495592_0033801 | 3300046454 | Bacteria | 3857 |
| 469 | Ga0495592_0083336 | 3300046454 | Bacteria | 2309 |
| 470 | Ga0495651_0170453 | 3300046462 | Bacteria | 1550 |
| 471 | Ga0495653_0017391 | 3300046463 | Bacteria | 5848 |
| 472 | Ga0495653_0145439 | 3300046463 | Bacteria | 1662 |
| 473 | Ga0495580_0029203 | 3300046472 | Bacteria | 4003 |
| 474 | Ga0495639_0028928 | 3300046475 | Bacteria | 2457 |
| 475 | Ga0495662_0096485 | 3300046476 | Bacteria | 1445 |
| 476 | Ga0495664_0026792 | 3300046477 | Bacteria | 3358 |
| 477 | Ga0495664_0125907 | 3300046477 | Bacteria | 1550 |
| 478 | Ga0495596_0147204 | 3300046500 | Bacteria | 915 |
| 479 | Ga0495608_0025697 | 3300046511 | Bacteria | 4020 |
| 480 | Ga0495610_0002336 | 3300046512 | Bacteria | 16035 |
| 481 | Ga0495628_0064752 | 3300046516 | Bacteria | 2861 |
| 482 | Ga0495628_0098948 | 3300046516 | Bacteria | 2253 |
| 483 | Ga0495630_0076639 | 3300046517 | Bacteria | 2520 |
| 484 | Ga0495630_0196254 | 3300046517 | Bacteria | 1540 |
| 485 | Ga0495631_0180668 | 3300046518 | Bacteria | 904 |
| 486 | Ga0495637_0052624 | 3300046520 | Bacteria | 1699 |
| 487 | Ga0495663_0035487 | 3300046525 | Bacteria | 1498 |
| 488 | Ga0495663_0093480 | 3300046525 | Bacteria | 983 |
| 489 | Ga0495642_0296072 | 3300046528 | Bacteria | 709 |
| 490 | Ga0495652_0011282 | 3300046529 | Bacteria | 8085 |
| 491 | Ga0495652_0154828 | 3300046529 | Bacteria | 1786 |
| 492 | Ga0495652_0202807 | 3300046529 | Bacteria | 1504 |
| 493 | Ga0495665_0196821 | 3300046531 | Bacteria | 1045 |
| 494 | Ga0495586_0119340 | 3300046535 | Bacteria | 1472 |
| 495 | Ga0495587_0006550 | 3300046536 | Bacteria | 7580 |
| 496 | Ga0495587_0013173 | 3300046536 | Bacteria | 5200 |
| 497 | Ga0495587_0048278 | 3300046536 | Bacteria | 2521 |
| 498 | Ga0495645_0006077 | 3300046543 | Bacteria | 8353 |
| 499 | Ga0495667_0033623 | 3300046559 | Bacteria | 3431 |
| 500 | Ga0495625_0081017 | 3300046660 | Bacteria | 2260 |
| 501 | Ga0495635_0066422 | 3300046663 | Bacteria | 2473 |
| 502 | Ga0495661_0047641 | 3300046665 | Bacteria | 2609 |
| 503 | Ga0495661_0195327 | 3300046665 | Bacteria | 1063 |
| 504 | Ga0495657_0157040 | 3300046675 | Bacteria | 1409 |
| 505 | Ga0495657_0197392 | 3300046675 | Bacteria | 1228 |
| 506 | Ga0495599_0053456 | 3300046678 | Bacteria | 2530 |
| 507 | Ga0495669_0015190 | 3300046684 | Bacteria | 3296 |
| 508 | Ga0495670_0052195 | 3300046691 | Bacteria | 2047 |
| 509 | Ga0495670_0070410 | 3300046691 | Bacteria | 1770 |
| 510 | Ga0495589_0081329 | 3300046794 | Bacteria | 1576 |
| 511 | Ga0495600_0068501 | 3300046809 | Bacteria | 2319 |
| 512 | Ga0495660_0085240 | 3300046810 | Bacteria | 1651 |
| 513 | Ga0495581_0176803 | 3300047315 | Bacteria | 1248 |
| 514 | Ga0495604_0071028 | 3300047317 | Bacteria | 2635 |
| 515 | Ga0495604_0214971 | 3300047317 | Bacteria | 1327 |
| 516 | Ga0495674_0229292 | 3300047319 | Bacteria | 1533 |
| 517 | Ga0495674_0234203 | 3300047319 | Bacteria | 1515 |
| 518 | Ga0495676_0121004 | 3300047321 | Bacteria | 1904 |
| 519 | Ga0495680_0225272 | 3300047322 | Bacteria | 1337 |
| 520 | Ga0495680_0249415 | 3300047322 | Bacteria | 1258 |
| 521 | Ga0495675_0014092 | 3300047444 | Bacteria | 5054 |
| 522 | Ga0495675_0196397 | 3300047444 | Bacteria | 1230 |
| 523 | Ga0495684_0089527 | 3300047471 | Bacteria | 2332 |
| 524 | Ga0495602_0000485 | 3300048088 | Bacteria | 36933 |
| 525 | Ga0495602_0019157 | 3300048088 | Bacteria | 6807 |
| 526 | Ga0495602_0076138 | 3300048088 | Bacteria | 2845 |
| 527 | Ga0496100_0217752 | 3300048903 | Bacteria | 1400 |
| 528 | Ga0496101_0089284 | 3300048904 | Bacteria | 2290 |
| 529 | Ga0496102_0058442 | 3300048905 | Bacteria | 3524 |
| 530 | Ga0496104_0106431 | 3300048907 | Bacteria | 2688 |
| 531 | Ga0496105_0163403 | 3300048908 | Bacteria | 1827 |
| 532 | Ga0496106_0153574 | 3300048909 | Bacteria | 1817 |
| 533 | Ga0496106_0170666 | 3300048909 | Bacteria | 1724 |
| 534 | Ga0496108_0005024 | 3300048911 | Bacteria | 10690 |
| 535 | Ga0496108_0388405 | 3300048911 | Bacteria | 1219 |
| 536 | Ga0496109_0011059 | 3300048912 | Bacteria | 7737 |
| 537 | Ga0496110_0076651 | 3300048913 | Bacteria | 2973 |
| 538 | Ga0496110_0275300 | 3300048913 | Bacteria | 1533 |
| 539 | Ga0496113_0141414 | 3300048916 | Bacteria | 1894 |
| 540 | Ga0496114_0020960 | 3300048917 | Bacteria | 5309 |
| 541 | Ga0496114_0033898 | 3300048917 | Bacteria | 4209 |
| 542 | Ga0496114_0046076 | 3300048917 | Bacteria | 3623 |
| 543 | Ga0496115_0020789 | 3300048918 | Bacteria | 5064 |
| 544 | Ga0496119_0014326 | 3300048922 | Bacteria | 6218 |
| 545 | Ga0501306_000335 | 3300049127 | Bacteria | 3401 |
| 546 | Ga0501306_006304 | 3300049127 | Bacteria | 1387 |
| 547 | Ga0501308_002475 | 3300049128 | Bacteria | 1623 |
| 548 | Ga0501309_000178 | 3300049129 | Bacteria | 4209 |
| 549 | Ga0501310_000304 | 3300049130 | Bacteria | 4547 |
| 550 | Ga0501310_006139 | 3300049130 | Bacteria | 1253 |
| 551 | Ga0501343_001193 | 3300049132 | Bacteria | 1718 |
| 552 | Ga0501307_002419 | 3300049162 | Bacteria | 1738 |
| 553 | Ga0501299_009671 | 3300049522 | Bacteria | 1595 |
| 554 | Ga0501311_000103 | 3300049527 | Bacteria | 4135 |
| 555 | Ga0501311_009391 | 3300049527 | Bacteria | 1167 |
| 556 | Ga0501315_000132 | 3300049531 | Bacteria | 4114 |
| 557 | Ga0501316_001182 | 3300049532 | Bacteria | 2139 |
| 558 | Ga0501318_000232 | 3300049534 | Bacteria | 3094 |
| 559 | Ga0501319_000044 | 3300049535 | Bacteria | 3984 |
| 560 | Ga0501319_000062 | 3300049535 | Bacteria | 3621 |
| 561 | Ga0501320_000195 | 3300049536 | Bacteria | 3108 |
| 562 | Ga0501321_001182 | 3300049537 | Bacteria | 2003 |
| 563 | Ga0501323_001180 | 3300049539 | Bacteria | 2235 |
| 564 | Ga0501324_000812 | 3300049540 | Bacteria | 1882 |
| 565 | Ga0501325_000185 | 3300049541 | Bacteria | 2457 |
| 566 | Ga0501340_000481 | 3300049556 | Bacteria | 1772 |
| 567 | Ga0501031_0000651 | 3300049568 | Bacteria | 20547 |
| 568 | Ga0501031_0002157 | 3300049568 | Bacteria | 12414 |
| 569 | Ga0501031_0026812 | 3300049568 | Bacteria | 3756 |
| 570 | Ga0501032_0000111 | 3300049569 | Bacteria | 69802 |
| 571 | Ga0501032_0000438 | 3300049569 | Bacteria | 34232 |
| 572 | Ga0501032_0000512 | 3300049569 | Bacteria | 31496 |
| 573 | Ga0501032_0003488 | 3300049569 | Bacteria | 12021 |
| 574 | Ga0501033_0000121 | 3300049570 | Bacteria | 75242 |
| 575 | Ga0501033_0001612 | 3300049570 | Bacteria | 19830 |
| 576 | Ga0501033_0001877 | 3300049570 | Bacteria | 18276 |
| 577 | Ga0501034_0000298 | 3300049571 | Bacteria | 88154 |
| 578 | Ga0501034_0001245 | 3300049571 | Bacteria | 34615 |
| 579 | Ga0501034_0008844 | 3300049571 | Bacteria | 10590 |
| 580 | Ga0501034_0026519 | 3300049571 | Bacteria | 5901 |
| 581 | Ga0501034_0064759 | 3300049571 | Bacteria | 3669 |
| 582 | Ga0501036_0000724 | 3300049572 | Bacteria | 24360 |
| 583 | Ga0501036_0002605 | 3300049572 | Bacteria | 14223 |
| 584 | Ga0501036_0003863 | 3300049572 | Bacteria | 12020 |
| 585 | Ga0501036_0039645 | 3300049572 | Bacteria | 3986 |
| 586 | Ga0501037_0000131 | 3300049573 | Bacteria | 69802 |
| 587 | Ga0501037_0000998 | 3300049573 | Bacteria | 20981 |
| 588 | Ga0501037_0030444 | 3300049573 | Bacteria | 3988 |
| 589 | Ga0501038_0000109 | 3300049574 | Bacteria | 69802 |
| 590 | Ga0501038_0000265 | 3300049574 | Bacteria | 44237 |
| 591 | Ga0501038_0005274 | 3300049574 | Bacteria | 12021 |
| 592 | Ga0501038_0080319 | 3300049574 | Bacteria | 2749 |
| 593 | Ga0501038_0230739 | 3300049574 | Bacteria | 1473 |
| 594 | Ga0501039_0000080 | 3300049575 | Bacteria | 72519 |
| 595 | Ga0501039_0000814 | 3300049575 | Bacteria | 22509 |
| 596 | Ga0501039_0002279 | 3300049575 | Bacteria | 14235 |
| 597 | Ga0501039_0209224 | 3300049575 | Bacteria | 1534 |
| 598 | Ga0501039_0489187 | 3300049575 | Bacteria | 966 |
| 599 | Ga0501040_0138951 | 3300049576 | Bacteria | 1710 |
| 600 | Ga0501042_0334874 | 3300049578 | Bacteria | 1094 |
| 601 | Ga0501043_0001438 | 3300049579 | Bacteria | 20808 |
| 602 | Ga0501043_0004023 | 3300049579 | Bacteria | 12021 |
| 603 | Ga0501043_0034474 | 3300049579 | Bacteria | 3980 |
| 604 | Ga0501043_0380594 | 3300049579 | Bacteria | 1068 |
| 605 | Ga0501046_0001551 | 3300049580 | Bacteria | 21926 |
| 606 | Ga0501046_0111284 | 3300049580 | Bacteria | 2091 |
| 607 | Ga0501046_0125633 | 3300049580 | Bacteria | 1949 |
| 608 | Ga0501047_0000855 | 3300049581 | Bacteria | 31151 |
| 609 | Ga0501047_0045646 | 3300049581 | Bacteria | 4236 |
| 610 | Ga0501047_0193542 | 3300049581 | Bacteria | 1896 |
| 611 | Ga0501048_0000857 | 3300049582 | Bacteria | 22424 |
| 612 | Ga0501067_0004323 | 3300049583 | Bacteria | 7825 |
| 613 | Ga0501068_0042645 | 3300049584 | Bacteria | 2728 |
| 614 | Ga0501069_0000702 | 3300049585 | Bacteria | 15604 |
| 615 | Ga0501070_0001773 | 3300049586 | Bacteria | 19097 |
| 616 | Ga0501070_0119781 | 3300049586 | Bacteria | 2175 |
| 617 | Ga0501071_0073586 | 3300049587 | Bacteria | 2493 |
| 618 | Ga0501071_0098554 | 3300049587 | Bacteria | 2153 |
| 619 | Ga0501072_0063471 | 3300049588 | Bacteria | 2914 |
| 620 | Ga0501073_0002543 | 3300049589 | Bacteria | 13627 |
| 621 | Ga0501073_0135900 | 3300049589 | Bacteria | 1704 |
| 622 | Ga0501074_0000257 | 3300049590 | Bacteria | 30059 |
| 623 | Ga0501074_0304899 | 3300049590 | Bacteria | 1131 |
| 624 | Ga0501075_0085597 | 3300049591 | Bacteria | 2388 |
| 625 | Ga0501075_0414557 | 3300049591 | Bacteria | 1027 |
| 626 | Ga0501076_0028034 | 3300049592 | Bacteria | 4370 |
| 627 | Ga0501202_021135 | 3300049652 | Bacteria | 1298 |
| 628 | Ga0501208_006843 | 3300049655 | Bacteria | 1472 |
| 629 | Ga0501243_008476 | 3300049675 | Bacteria | 1585 |
| 630 | Ga0501079_0082673 | 3300049741 | Bacteria | 2484 |
| 631 | Ga0501080_0002067 | 3300049742 | Bacteria | 17401 |
| 632 | Ga0501080_0371323 | 3300049742 | Bacteria | 1290 |
| 633 | Ga0501083_0000801 | 3300049744 | Bacteria | 20607 |
| 634 | Ga0501035_0000160 | 3300049822 | Bacteria | 82214 |
| 635 | Ga0501035_0001522 | 3300049822 | Bacteria | 23684 |
| 636 | Ga0501035_0043204 | 3300049822 | Bacteria | 4062 |
| 637 | Ga0501035_0130044 | 3300049822 | Bacteria | 2195 |
| 638 | Ga0501035_0436587 | 3300049822 | Bacteria | 1085 |
| 639 | Ga0501044_0000188 | 3300049823 | Bacteria | 77610 |
| 640 | Ga0501044_0000234 | 3300049823 | Bacteria | 69802 |
| 641 | Ga0501044_0002854 | 3300049823 | Bacteria | 19664 |
| 642 | Ga0501044_0158981 | 3300049823 | Bacteria | 2238 |
| 643 | Ga0501044_0174932 | 3300049823 | Bacteria | 2116 |
| 644 | Ga0501044_0240652 | 3300049823 | Bacteria | 1754 |
| 645 | Ga0501045_0012622 | 3300049824 | Bacteria | 5949 |
| 646 | Ga0501212_006277 | 3300049851 | Bacteria | 1599 |
| 647 | nmdc:mga05p37_1182_c1 | 3300050507 | Bacteria | 30133 |
| 648 | nmdc:mga05p37_2785_c1 | 3300050507 | Bacteria | 20326 |
| 649 | nmdc:mga05p37_43946_c1 | 3300050507 | Bacteria | 5496 |
| 650 | nmdc:mga05p37_64020_c1 | 3300050507 | Bacteria | 4524 |
| 651 | nmdc:mga09592_120860_c1 | 3300050508 | Bacteria | 2250 |
| 652 | nmdc:mga09592_150406_c1 | 3300050508 | Bacteria | 2008 |
| 653 | nmdc:mga09592_159868_c1 | 3300050508 | Bacteria | 1946 |
| 654 | nmdc:mga09592_1799_c1 | 3300050508 | Bacteria | 17199 |
| 655 | nmdc:mga09592_404123_c1 | 3300050508 | Bacteria | 1180 |
| 656 | nmdc:mga09592_79290_c1 | 3300050508 | Bacteria | 2795 |
| 657 | nmdc:mga0qj67_230128_c1 | 3300050509 | Bacteria | 1504 |
| 658 | nmdc:mga0qj67_591_c1 | 3300050509 | Bacteria | 24706 |
| 659 | nmdc:mga06r32_12774_c1 | 3300050510 | Bacteria | 7592 |
| 660 | nmdc:mga06r32_4895_c1 | 3300050510 | Bacteria | 12063 |
| 661 | nmdc:mga08y16_10_c1 | 3300050511 | Bacteria | 470512 |
| 662 | nmdc:mga08y16_14815_c1 | 3300050511 | Bacteria | 8199 |
| 663 | nmdc:mga08y16_7477_c1 | 3300050511 | Bacteria | 11442 |
| 664 | nmdc:mga08y16_97083_c1 | 3300050511 | Bacteria | 3069 |
| 665 | nmdc:mga0n895_113612_c1 | 3300050512 | Bacteria | 2726 |
| 666 | nmdc:mga0n895_1321_c1 | 3300050512 | Bacteria | 18347 |
| 667 | nmdc:mga0n895_1534_c1 | 3300050512 | Bacteria | 17352 |
| 668 | nmdc:mga0rr50_1290_c2 | 3300050513 | Bacteria | 9760 |
| 669 | nmdc:mga0rr50_6615_c1 | 3300050513 | Bacteria | 7082 |
| 670 | nmdc:mga08x19_10642_c1 | 3300050514 | Bacteria | 5531 |
| 671 | nmdc:mga08x19_217303_c1 | 3300050514 | Bacteria | 1313 |
| 672 | nmdc:mga0a205_226583_c1 | 3300050515 | Bacteria | 1754 |
| 673 | nmdc:mga0a205_5430_c1 | 3300050515 | Bacteria | 11488 |
| 674 | nmdc:mga0a205_890_c1 | 3300050515 | Bacteria | 24549 |
| 675 | Ga0495601_0113669 | 3300053077 | Bacteria | 1755 |
| 676 | Ga0495601_0120923 | 3300053077 | Bacteria | 1700 |
| 677 | Ga0495601_0127230 | 3300053077 | Bacteria | 1658 |
| 678 | Ga0495612_0064158 | 3300053078 | Bacteria | 1524 |
| 679 | Ga0495655_0053186 | 3300053083 | Bacteria | 1079 |
| 680 | Ga0495595_0028363 | 3300053084 | Bacteria | 2500 |
| 681 | Ga0495595_0115885 | 3300053084 | Bacteria | 1302 |
| 682 | Ga0495619_0004308 | 3300053085 | Bacteria | 9078 |
| 683 | Ga0495619_0008993 | 3300053085 | Bacteria | 6303 |
| 684 | Ga0500568_0000001 | 3300053139 | Bacteria | 988705 |
| 685 | Ga0500620_107972 | 3300053155 | Bacteria | 974 |
| 686 | Ga0500622_0005115 | 3300053156 | Bacteria | 7960 |
| 687 | Ga0501084_0000487 | 3300054114 | Bacteria | 30390 |
| 688 | Ga0587070_005110 | 3300059491 | Bacteria | 1702 |
| 689 | Ga0587070_019379 | 3300059491 | Bacteria | 1126 |
| 690 | Ga0587077_003683 | 3300059493 | Bacteria | 1950 |
| 691 | Ga0587125_000437 | 3300059607 | Bacteria | 2426 |
| 692 | Ga0587109_003270 | 3300059624 | Bacteria | 2146 |
| 693 | Ga0587109_008626 | 3300059624 | Bacteria | 1579 |
| 694 | Ga0587062_000275 | 3300059639 | Bacteria | 3263 |
| 695 | Ga0587068_004016 | 3300059641 | Bacteria | 1921 |
| 696 | Ga0587079_015422 | 3300059647 | Bacteria | 1297 |
| 697 | Ga0587124_002532 | 3300059660 | Bacteria | 1296 |
| 698 | Ga0587111_0005171 | 3300060346 | Bacteria | 1991 |
| 699 | Ga0501082_0121129 | 3300060353 | Bacteria | 2268 |
| 700 | Ga0466962_0013172 | 3300061719 | Bacteria | 3978 |
| 701 | Ga0530510_0040074 | 3300061734 | Bacteria | 3381 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300013308 | Ga0157375_11593496 | Ga0157375_115934961 | 218 |
| 2 | 3300042438 | Ga0439459_0001406 | Ga0439459_0001406_63_737 | 221 |
| 3 | 3300046528 | Ga0495642_0296072 | Ga0495642_0296072_12_695 | 223 |
| 4 | 3300049575 | Ga0501039_0209224 | Ga0501039_0209224_25_714 | 223 |
| 5 | 3300046794 | Ga0495589_0081329 | Ga0495589_0081329_17_748 | 237 |
| 6 | 3300039450 | Ga0436363_0517643 | Ga0436363_0517643_289_1023 | 240 |
| 7 | 3300053155 | Ga0500620_107972 | Ga0500620_107972_29_814 | 243 |
| 8 | 3300036401 | Ga0373937_0125512 | Ga0373937_0125512_580_1410 | 249 |
| 9 | 3300028800 | Ga0265338_10307724 | Ga0265338_103077242 | 250 |
| 10 | 3300031595 | Ga0265313_10003503 | Ga0265313_1000350318 | 250 |
| 11 | 3300031711 | Ga0265314_10000833 | Ga0265314_1000083343 | 250 |
| 12 | 3300036401 | Ga0373937_0084294 | Ga0373937_0084294_1403_2233 | 250 |
| 13 | 3300046454 | Ga0495592_0033801 | Ga0495592_0033801_2927_3757 | 250 |
| 14 | 3300046529 | Ga0495652_0154828 | Ga0495652_0154828_854_1684 | 250 |
| 15 | 3300046536 | Ga0495587_0013173 | Ga0495587_0013173_2975_3805 | 250 |
| 16 | 3300048088 | Ga0495602_0019157 | Ga0495602_0019157_2932_3762 | 250 |
| 17 | 3300005327 | Ga0070658_10453883 | Ga0070658_104538831 | 252 |
| 18 | 3300025904 | Ga0207647_10177936 | Ga0207647_101779361 | 252 |
| 19 | 3300009101 | Ga0105247_10144028 | Ga0105247_101440282 | 253 |
| 20 | 3300026035 | Ga0207703_10125321 | Ga0207703_101253213 | 253 |
| 21 | 3300036401 | Ga0373937_0168158 | Ga0373937_0168158_1013_1873 | 253 |
| 22 | 3300053077 | Ga0495601_0127230 | Ga0495601_0127230_226_1086 | 253 |
| 23 | 3300036401 | Ga0373937_0247931 | Ga0373937_0247931_764_1537 | 254 |
| 24 | 3300005468 | Ga0070707_100135302 | Ga0070707_1001353023 | 255 |
| 25 | 3300009093 | Ga0105240_10114469 | Ga0105240_101144692 | 255 |
| 26 | 3300014325 | Ga0163163_10142252 | Ga0163163_101422524 | 255 |
| 27 | 3300035085 | Ga0373929_0012321 | Ga0373929_0012321_213_1052 | 255 |
| 28 | 3300009093 | Ga0105240_10122115 | Ga0105240_101221151 | 256 |
| 29 | 3300013296 | Ga0157374_10106962 | Ga0157374_101069624 | 256 |
| 30 | 3300049574 | Ga0501038_0080319 | Ga0501038_0080319_1945_2730 | 256 |
| 31 | 3300035724 | Ga0373933_0019715 | Ga0373933_0019715_1743_2609 | 258 |
| 32 | 3300049591 | Ga0501075_0414557 | Ga0501075_0414557_176_1012 | 258 |
| 33 | 3300035207 | Ga0373942_0014525 | Ga0373942_0014525_801_1640 | 259 |
| 34 | 3300027876 | Ga0209974_10004194 | Ga0209974_100041945 | 260 |
| 35 | 3300049130 | Ga0501310_000304 | Ga0501310_000304_2205_3041 | 260 |
| 36 | 3300033524 | Ga0316592_1000022 | Ga0316592_100002217 | 263 |
| 37 | 3300033528 | Ga0316588_1021223 | Ga0316588_10212232 | 263 |
| 38 | 3300049568 | Ga0501031_0026812 | Ga0501031_0026812_1914_2747 | 264 |
| 39 | 3300049569 | Ga0501032_0003488 | Ga0501032_0003488_8993_9826 | 264 |
| 40 | 3300049570 | Ga0501033_0000121 | Ga0501033_0000121_40559_41392 | 264 |
| 41 | 3300049571 | Ga0501034_0000298 | Ga0501034_0000298_85126_85959 | 264 |
| 42 | 3300049572 | Ga0501036_0000724 | Ga0501036_0000724_21718_22551 | 264 |
| 43 | 3300049573 | Ga0501037_0030444 | Ga0501037_0030444_960_1793 | 264 |
| 44 | 3300049574 | Ga0501038_0005274 | Ga0501038_0005274_8993_9826 | 264 |
| 45 | 3300049575 | Ga0501039_0000080 | Ga0501039_0000080_69491_70324 | 264 |
| 46 | 3300049579 | Ga0501043_0004023 | Ga0501043_0004023_2196_3029 | 264 |
| 47 | 3300049822 | Ga0501035_0000160 | Ga0501035_0000160_2186_3019 | 264 |
| 48 | 3300049823 | Ga0501044_0174932 | Ga0501044_0174932_395_1228 | 264 |
| 49 | 3300028563 | Ga0265319_1000011 | Ga0265319_100001141 | 265 |
| 50 | 3300028577 | Ga0265318_10001100 | Ga0265318_1000110010 | 265 |
| 51 | 3300031595 | Ga0265313_10014640 | Ga0265313_100146406 | 265 |
| 52 | 3300031711 | Ga0265314_10000612 | Ga0265314_100006128 | 265 |
| 53 | 3300046529 | Ga0495652_0202807 | Ga0495652_0202807_628_1485 | 265 |
| 54 | 3300049742 | Ga0501080_0371323 | Ga0501080_0371323_367_1194 | 265 |
| 55 | 3300005356 | Ga0070674_100002048 | Ga0070674_10000204818 | 266 |
| 56 | 3300005438 | Ga0070701_10380530 | Ga0070701_103805301 | 266 |
| 57 | 3300005441 | Ga0070700_100147284 | Ga0070700_1001472842 | 266 |
| 58 | 3300005459 | Ga0068867_100213734 | Ga0068867_1002137341 | 266 |
| 59 | 3300025937 | Ga0207669_10091444 | Ga0207669_100914442 | 266 |
| 60 | 3300031852 | Ga0307410_10144730 | Ga0307410_101447302 | 266 |
| 61 | 3300013308 | Ga0157375_10446902 | Ga0157375_104469022 | 267 |
| 62 | 3300046500 | Ga0495596_0147204 | Ga0495596_0147204_14_841 | 267 |
| 63 | 3300048907 | Ga0496104_0106431 | Ga0496104_0106431_793_1650 | 267 |
| 64 | 3300049823 | Ga0501044_0240652 | Ga0501044_0240652_139_975 | 267 |
| 65 | iso_pu_bacteria | 2643221576 | 2643890023 | 267 |
| 66 | iso_pu_bacteria | 2643221590 | 2643959079 | 267 |
| 67 | iso_pu_bacteria | 2643221615 | 2644091090 | 267 |
| 68 | iso_pu_bacteria | 2643221617 | 2644099743 | 267 |
| 69 | iso_pu_bacteria | 2643221620 | 2644116629 | 267 |
| 70 | iso_pu_bacteria | 2643221657 | 2644320893 | 267 |
| 71 | iso_pu_bacteria | 2738541305 | 2738870336 | 267 |
| 72 | iso_pu_bacteria | 2811994874 | 2812331443 | 267 |
| 73 | iso_pu_bacteria | 2816332119 | 2816421165 | 267 |
| 74 | iso_pu_bacteria | 2857481737 | 2857485189 | 267 |
| 75 | 3300047317 | Ga0495604_0214971 | Ga0495604_0214971_80_919 | 268 |
| 76 | 3300047321 | Ga0495676_0121004 | Ga0495676_0121004_1036_1875 | 268 |
| 77 | iso_pu_bacteria | 2513237351 | 2514589865 | 268 |
| 78 | iso_pu_bacteria | 2537561592 | 2537898399 | 268 |
| 79 | iso_pu_bacteria | 2643221623 | 2644131927 | 268 |
| 80 | iso_pu_bacteria | 2728369276 | 2729906678 | 268 |
| 81 | iso_pu_bacteria | 2738543024 | 2739309045 | 268 |
| 82 | iso_pu_bacteria | 2848551377 | 2848553265 | 268 |
| 83 | iso_pu_bacteria | 2854911287 | 2854912166 | 268 |
| 84 | iso_pu_bacteria | 2883821847 | 2883823109 | 268 |
| 85 | iso_pu_bacteria | 2889790730 | 2889793669 | 268 |
| 86 | iso_pu_bacteria | 2889914905 | 2889919533 | 268 |
| 87 | iso_pu_bacteria | 2894817345 | 2894818628 | 268 |
| 88 | iso_pu_bacteria | 2909399089 | 2909399537 | 268 |
| 89 | iso_pu_bacteria | 2929199973 | 2929200706 | 268 |
| 90 | iso_pu_bacteria | 2937843397 | 2937845873 | 268 |
| 91 | iso_pu_bacteria | 2996336353 | 2996340575 | 268 |
| 92 | iso_pu_bacteria | 641228493 | 641337359 | 268 |
| 93 | iso_pu_bacteria | 643348555 | 643392477 | 268 |
| 94 | iso_pu_bacteria | 8002285264 | 8002285918 | 268 |
| 95 | iso_pu_bacteria | 8055909800 | 8055913923 | 268 |
| 96 | iso_pu_bacteria | 8056579771 | 8056583175 | 268 |
| 97 | 3300005444 | Ga0070694_100041677 | Ga0070694_1000416771 | 269 |
| 98 | 3300005549 | Ga0070704_100037541 | Ga0070704_1000375414 | 269 |
| 99 | 3300025917 | Ga0207660_10278872 | Ga0207660_102788722 | 269 |
| 100 | 3300032133 | Ga0316583_10003862 | Ga0316583_100038624 | 269 |
| 101 | 3300032133 | Ga0316583_10041645 | Ga0316583_100416453 | 269 |
| 102 | 3300032168 | Ga0316593_10033258 | Ga0316593_100332583 | 269 |
| 103 | 3300039450 | Ga0436363_0590019 | Ga0436363_0590019_13_837 | 269 |
| 104 | 3300046516 | Ga0495628_0098948 | Ga0495628_0098948_448_1275 | 269 |
| 105 | 3300046517 | Ga0495630_0076639 | Ga0495630_0076639_511_1338 | 269 |
| 106 | 3300046517 | Ga0495630_0196254 | Ga0495630_0196254_679_1506 | 269 |
| 107 | 3300049587 | Ga0501071_0098554 | Ga0501071_0098554_1124_1957 | 269 |
| 108 | 3300049823 | Ga0501044_0158981 | Ga0501044_0158981_1306_2139 | 269 |
| 109 | iso_pu_bacteria | 2858438669 | 2858440287 | 269 |
| 110 | iso_pu_bacteria | 2910245624 | 2910249758 | 269 |
| 111 | iso_pu_bacteria | 2928519762 | 2928521457 | 269 |
| 112 | 3300033541 | Ga0316596_1006644 | Ga0316596_10066443 | 270 |
| 113 | 3300033541 | Ga0316596_1041000 | Ga0316596_10410002 | 270 |
| 114 | 3300039437 | Ga0436365_0743626 | Ga0436365_0743626_223_1047 | 270 |
| 115 | iso_pu_bacteria | 2687453341 | 2688394937 | 270 |
| 116 | 3300000546 | LJNas_1009084 | LJNas_10090842 | 271 |
| 117 | 3300001989 | JGI24739J22299_10014413 | JGI24739J22299_100144134 | 271 |
| 118 | 3300005290 | Ga0065712_10001248 | Ga0065712_1000124818 | 271 |
| 119 | 3300005354 | Ga0070675_100076470 | Ga0070675_1000764703 | 271 |
| 120 | 3300005435 | Ga0070714_100049770 | Ga0070714_1000497705 | 271 |
| 121 | 3300005467 | Ga0070706_100200060 | Ga0070706_1002000603 | 271 |
| 122 | 3300005518 | Ga0070699_100237826 | Ga0070699_1002378261 | 271 |
| 123 | 3300005937 | Ga0081455_10009428 | Ga0081455_100094286 | 271 |
| 124 | 3300005981 | Ga0081538_10038576 | Ga0081538_100385763 | 271 |
| 125 | 3300006844 | Ga0075428_100280060 | Ga0075428_1002800602 | 271 |
| 126 | 3300006846 | Ga0075430_100005226 | Ga0075430_1000052264 | 271 |
| 127 | 3300006847 | Ga0075431_100001734 | Ga0075431_10000173411 | 271 |
| 128 | 3300009147 | Ga0114129_10000234 | Ga0114129_100002347 | 271 |
| 129 | 3300013307 | Ga0157372_10126193 | Ga0157372_101261934 | 271 |
| 130 | 3300021384 | Ga0213876_10029742 | Ga0213876_100297423 | 271 |
| 131 | 3300025926 | Ga0207659_10074709 | Ga0207659_100747094 | 271 |
| 132 | 3300025931 | Ga0207644_10055038 | Ga0207644_100550384 | 271 |
| 133 | 3300025941 | Ga0207711_10256587 | Ga0207711_102565871 | 271 |
| 134 | 3300026075 | Ga0207708_10297615 | Ga0207708_102976152 | 271 |
| 135 | 3300031090 | Ga0265760_10089938 | Ga0265760_100899381 | 271 |
| 136 | 3300037418 | Ga0395900_0042235 | Ga0395900_0042235_3286_4122 | 271 |
| 137 | 3300037466 | Ga0395898_0054594 | Ga0395898_0054594_2429_3445 | 271 |
| 138 | 3300037471 | Ga0395905_0141225 | Ga0395905_0141225_1271_2107 | 271 |
| 139 | 3300038443 | Ga0395901_0149529 | Ga0395901_0149529_1365_2201 | 271 |
| 140 | 3300038443 | Ga0395901_0440359 | Ga0395901_0440359_46_882 | 271 |
| 141 | 3300039453 | Ga0436362_0192210 | Ga0436362_0192210_212_1039 | 271 |
| 142 | 3300042012 | Ga0439455_0039210 | Ga0439455_0039210_233_1066 | 271 |
| 143 | 3300044901 | Ga0466960_0083379 | Ga0466960_0083379_197_1033 | 271 |
| 144 | 3300048909 | Ga0496106_0153574 | Ga0496106_0153574_145_969 | 271 |
| 145 | 3300049127 | Ga0501306_000335 | Ga0501306_000335_2269_3102 | 271 |
| 146 | 3300049129 | Ga0501309_000178 | Ga0501309_000178_2551_3384 | 271 |
| 147 | 3300049130 | Ga0501310_006139 | Ga0501310_006139_15_848 | 271 |
| 148 | 3300049527 | Ga0501311_000103 | Ga0501311_000103_2482_3315 | 271 |
| 149 | 3300049531 | Ga0501315_000132 | Ga0501315_000132_794_1627 | 271 |
| 150 | 3300049534 | Ga0501318_000232 | Ga0501318_000232_2028_2861 | 271 |
| 151 | 3300049535 | Ga0501319_000044 | Ga0501319_000044_257_1093 | 271 |
| 152 | 3300049536 | Ga0501320_000195 | Ga0501320_000195_1450_2283 | 271 |
| 153 | 3300049537 | Ga0501321_001182 | Ga0501321_001182_282_1115 | 271 |
| 154 | 3300049541 | Ga0501325_000185 | Ga0501325_000185_854_1687 | 271 |
| 155 | 3300049571 | Ga0501034_0064759 | Ga0501034_0064759_1974_2807 | 271 |
| 156 | 3300049589 | Ga0501073_0135900 | Ga0501073_0135900_457_1281 | 271 |
| 157 | 3300049590 | Ga0501074_0304899 | Ga0501074_0304899_87_983 | 271 |
| 158 | 3300049822 | Ga0501035_0436587 | Ga0501035_0436587_134_970 | 271 |
| 159 | 3300050507 | nmdc:mga05p37_2785_c1 | nmdc:mga05p37_2785_c1_9384_10217 | 271 |
| 160 | 3300050508 | nmdc:mga09592_159868_c1 | nmdc:mga09592_159868_c1_966_1796 | 271 |
| 161 | 3300050508 | nmdc:mga09592_1799_c1 | nmdc:mga09592_1799_c1_9747_10580 | 271 |
| 162 | 3300050509 | nmdc:mga0qj67_591_c1 | nmdc:mga0qj67_591_c1_879_1712 | 271 |
| 163 | 3300050510 | nmdc:mga06r32_4895_c1 | nmdc:mga06r32_4895_c1_9875_10708 | 271 |
| 164 | 3300053084 | Ga0495595_0115885 | Ga0495595_0115885_163_999 | 271 |
| 165 | 3300060353 | Ga0501082_0121129 | Ga0501082_0121129_38_874 | 271 |
| 166 | 3300001989 | JGI24739J22299_10028557 | JGI24739J22299_100285573 | 272 |
| 167 | 3300001990 | JGI24737J22298_10001920 | JGI24737J22298_100019207 | 272 |
| 168 | 3300002738 | JGI25154J39366_1006883 | JGI25154J39366_10068832 | 272 |
| 169 | 3300002773 | JGI25152J39213_1000684 | JGI25152J39213_10006848 | 272 |
| 170 | 3300002773 | JGI25152J39213_1012216 | JGI25152J39213_10122161 | 272 |
| 171 | 3300003162 | Ga0006778J45830_1021879 | Ga0006778J45830_10218793 | 272 |
| 172 | 3300003203 | JGI25406J46586_10025734 | JGI25406J46586_100257343 | 272 |
| 173 | 3300003578 | Ga0006562J51391_1004293 | Ga0006562J51391_10042936 | 272 |
| 174 | 3300005327 | Ga0070658_10006748 | Ga0070658_1000674815 | 272 |
| 175 | 3300005329 | Ga0070683_100198008 | Ga0070683_1001980083 | 272 |
| 176 | 3300005329 | Ga0070683_100498931 | Ga0070683_1004989311 | 272 |
| 177 | 3300005331 | Ga0070670_100152576 | Ga0070670_1001525763 | 272 |
| 178 | 3300005334 | Ga0068869_100219093 | Ga0068869_1002190931 | 272 |
| 179 | 3300005338 | Ga0068868_100346771 | Ga0068868_1003467712 | 272 |
| 180 | 3300005339 | Ga0070660_100101675 | Ga0070660_1001016752 | 272 |
| 181 | 3300005340 | Ga0070689_100124088 | Ga0070689_1001240882 | 272 |
| 182 | 3300005341 | Ga0070691_10051030 | Ga0070691_100510302 | 272 |
| 183 | 3300005347 | Ga0070668_100042683 | Ga0070668_1000426834 | 272 |
| 184 | 3300005347 | Ga0070668_100062064 | Ga0070668_1000620644 | 272 |
| 185 | 3300005353 | Ga0070669_100100198 | Ga0070669_1001001982 | 272 |
| 186 | 3300005353 | Ga0070669_100221540 | Ga0070669_1002215403 | 272 |
| 187 | 3300005356 | Ga0070674_100595200 | Ga0070674_1005952001 | 272 |
| 188 | 3300005366 | Ga0070659_100054114 | Ga0070659_1000541143 | 272 |
| 189 | 3300005367 | Ga0070667_100313417 | Ga0070667_1003134173 | 272 |
| 190 | 3300005435 | Ga0070714_100001163 | Ga0070714_10000116310 | 272 |
| 191 | 3300005436 | Ga0070713_100001675 | Ga0070713_10000167522 | 272 |
| 192 | 3300005436 | Ga0070713_100061709 | Ga0070713_1000617094 | 272 |
| 193 | 3300005436 | Ga0070713_100070192 | Ga0070713_1000701922 | 272 |
| 194 | 3300005436 | Ga0070713_100464287 | Ga0070713_1004642872 | 272 |
| 195 | 3300005437 | Ga0070710_10218754 | Ga0070710_102187542 | 272 |
| 196 | 3300005439 | Ga0070711_100153181 | Ga0070711_1001531813 | 272 |
| 197 | 3300005457 | Ga0070662_100029774 | Ga0070662_1000297743 | 272 |
| 198 | 3300005457 | Ga0070662_100056709 | Ga0070662_1000567093 | 272 |
| 199 | 3300005458 | Ga0070681_10401460 | Ga0070681_104014602 | 272 |
| 200 | 3300005459 | Ga0068867_100178803 | Ga0068867_1001788033 | 272 |
| 201 | 3300005459 | Ga0068867_100319634 | Ga0068867_1003196341 | 272 |
| 202 | 3300005539 | Ga0068853_100164124 | Ga0068853_1001641242 | 272 |
| 203 | 3300005616 | Ga0068852_100120419 | Ga0068852_1001204194 | 272 |
| 204 | 3300005719 | Ga0068861_100039191 | Ga0068861_1000391914 | 272 |
| 205 | 3300005844 | Ga0068862_100238340 | Ga0068862_1002383403 | 272 |
| 206 | 3300005937 | Ga0081455_10022468 | Ga0081455_100224688 | 272 |
| 207 | 3300005937 | Ga0081455_10061103 | Ga0081455_100611035 | 272 |
| 208 | 3300005937 | Ga0081455_10062816 | Ga0081455_100628161 | 272 |
| 209 | 3300005937 | Ga0081455_10095013 | Ga0081455_100950131 | 272 |
| 210 | 3300005937 | Ga0081455_10108833 | Ga0081455_101088334 | 272 |
| 211 | 3300005981 | Ga0081538_10010547 | Ga0081538_100105472 | 272 |
| 212 | 3300005983 | Ga0081540_1006273 | Ga0081540_10062738 | 272 |
| 213 | 3300005985 | Ga0081539_10001286 | Ga0081539_1000128632 | 272 |
| 214 | 3300006028 | Ga0070717_10085206 | Ga0070717_100852064 | 272 |
| 215 | 3300006028 | Ga0070717_10107179 | Ga0070717_101071793 | 272 |
| 216 | 3300006048 | Ga0075363_100232164 | Ga0075363_1002321642 | 272 |
| 217 | 3300006058 | Ga0075432_10002369 | Ga0075432_100023694 | 272 |
| 218 | 3300006058 | Ga0075432_10005901 | Ga0075432_100059017 | 272 |
| 219 | 3300006175 | Ga0070712_100004619 | Ga0070712_1000046194 | 272 |
| 220 | 3300006175 | Ga0070712_100010110 | Ga0070712_1000101109 | 272 |
| 221 | 3300006844 | Ga0075428_100017186 | Ga0075428_10001718614 | 272 |
| 222 | 3300006844 | Ga0075428_100027125 | Ga0075428_1000271256 | 272 |
| 223 | 3300006844 | Ga0075428_100089387 | Ga0075428_1000893875 | 272 |
| 224 | 3300006844 | Ga0075428_100201398 | Ga0075428_1002013983 | 272 |
| 225 | 3300006846 | Ga0075430_100252224 | Ga0075430_1002522242 | 272 |
| 226 | 3300006847 | Ga0075431_100014269 | Ga0075431_10001426910 | 272 |
| 227 | 3300006852 | Ga0075433_10000978 | Ga0075433_100009789 | 272 |
| 228 | 3300006852 | Ga0075433_10006179 | Ga0075433_100061796 | 272 |
| 229 | 3300006852 | Ga0075433_10032299 | Ga0075433_100322994 | 272 |
| 230 | 3300006871 | Ga0075434_100003203 | Ga0075434_10000320313 | 272 |
| 231 | 3300006871 | Ga0075434_100003585 | Ga0075434_1000035854 | 272 |
| 232 | 3300006871 | Ga0075434_100011038 | Ga0075434_10001103814 | 272 |
| 233 | 3300006880 | Ga0075429_100169067 | Ga0075429_1001690671 | 272 |
| 234 | 3300006880 | Ga0075429_100661484 | Ga0075429_1006614841 | 272 |
| 235 | 3300006881 | Ga0068865_100159615 | Ga0068865_1001596153 | 272 |
| 236 | 3300006914 | Ga0075436_100004373 | Ga0075436_10000437310 | 272 |
| 237 | 3300007076 | Ga0075435_100002118 | Ga0075435_1000021183 | 272 |
| 238 | 3300007076 | Ga0075435_100027841 | Ga0075435_1000278418 | 272 |
| 239 | 3300007076 | Ga0075435_100115827 | Ga0075435_1001158274 | 272 |
| 240 | 3300009094 | Ga0111539_10005852 | Ga0111539_100058524 | 272 |
| 241 | 3300009094 | Ga0111539_10023680 | Ga0111539_100236806 | 272 |
| 242 | 3300009094 | Ga0111539_10042172 | Ga0111539_100421724 | 272 |
| 243 | 3300009098 | Ga0105245_10061281 | Ga0105245_100612811 | 272 |
| 244 | 3300009098 | Ga0105245_10086439 | Ga0105245_100864393 | 272 |
| 245 | 3300009147 | Ga0114129_10001031 | Ga0114129_1000103125 | 272 |
| 246 | 3300009148 | Ga0105243_10006200 | Ga0105243_100062009 | 272 |
| 247 | 3300009148 | Ga0105243_10018664 | Ga0105243_100186644 | 272 |
| 248 | 3300009553 | Ga0105249_10006301 | Ga0105249_100063019 | 272 |
| 249 | 3300010375 | Ga0105239_10427731 | Ga0105239_104277312 | 272 |
| 250 | 3300013297 | Ga0157378_10723981 | Ga0157378_107239811 | 272 |
| 251 | 3300013306 | Ga0163162_10018828 | Ga0163162_100188288 | 272 |
| 252 | 3300013306 | Ga0163162_10032281 | Ga0163162_100322819 | 272 |
| 253 | 3300013306 | Ga0163162_10434103 | Ga0163162_104341032 | 272 |
| 254 | 3300013307 | Ga0157372_10064662 | Ga0157372_100646626 | 272 |
| 255 | 3300013307 | Ga0157372_10550984 | Ga0157372_105509841 | 272 |
| 256 | 3300014325 | Ga0163163_10151103 | Ga0163163_101511034 | 272 |
| 257 | 3300014326 | Ga0157380_10119197 | Ga0157380_101191973 | 272 |
| 258 | 3300014969 | Ga0157376_10258266 | Ga0157376_102582662 | 272 |
| 259 | 3300017792 | Ga0163161_10149335 | Ga0163161_101493351 | 272 |
| 260 | 3300017792 | Ga0163161_10152796 | Ga0163161_101527961 | 272 |
| 261 | 3300020081 | Ga0206354_10115950 | Ga0206354_101159501 | 272 |
| 262 | 3300020081 | Ga0206354_10954251 | Ga0206354_109542514 | 272 |
| 263 | 3300020610 | Ga0154015_1213429 | Ga0154015_12134294 | 272 |
| 264 | 3300021388 | Ga0213875_10008279 | Ga0213875_100082794 | 272 |
| 265 | 3300021388 | Ga0213875_10028865 | Ga0213875_100288654 | 272 |
| 266 | 3300021388 | Ga0213875_10039023 | Ga0213875_100390232 | 272 |
| 267 | 3300021441 | Ga0213871_10009852 | Ga0213871_100098522 | 272 |
| 268 | 3300021441 | Ga0213871_10016668 | Ga0213871_100166681 | 272 |
| 269 | 3300021441 | Ga0213871_10018399 | Ga0213871_100183992 | 272 |
| 270 | 3300022467 | Ga0224712_10003182 | Ga0224712_100031824 | 272 |
| 271 | 3300025294 | Ga0209025_1052425 | Ga0209025_10524253 | 272 |
| 272 | 3300025901 | Ga0207688_10009707 | Ga0207688_100097075 | 272 |
| 273 | 3300025901 | Ga0207688_10090599 | Ga0207688_100905991 | 272 |
| 274 | 3300025912 | Ga0207707_10145067 | Ga0207707_101450674 | 272 |
| 275 | 3300025912 | Ga0207707_10242136 | Ga0207707_102421362 | 272 |
| 276 | 3300025915 | Ga0207693_10014094 | Ga0207693_100140942 | 272 |
| 277 | 3300025915 | Ga0207693_10029783 | Ga0207693_100297836 | 272 |
| 278 | 3300025915 | Ga0207693_10484244 | Ga0207693_104842441 | 272 |
| 279 | 3300025916 | Ga0207663_10094109 | Ga0207663_100941094 | 272 |
| 280 | 3300025919 | Ga0207657_10152434 | Ga0207657_101524342 | 272 |
| 281 | 3300025923 | Ga0207681_10084898 | Ga0207681_100848982 | 272 |
| 282 | 3300025927 | Ga0207687_10258199 | Ga0207687_102581992 | 272 |
| 283 | 3300025927 | Ga0207687_10275367 | Ga0207687_102753672 | 272 |
| 284 | 3300025928 | Ga0207700_10225655 | Ga0207700_102256551 | 272 |
| 285 | 3300025929 | Ga0207664_10006241 | Ga0207664_1000624114 | 272 |
| 286 | 3300025929 | Ga0207664_10075173 | Ga0207664_100751732 | 272 |
| 287 | 3300025932 | Ga0207690_10069348 | Ga0207690_100693484 | 272 |
| 288 | 3300025933 | Ga0207706_10016355 | Ga0207706_100163552 | 272 |
| 289 | 3300025933 | Ga0207706_10021255 | Ga0207706_100212554 | 272 |
| 290 | 3300025935 | Ga0207709_10051484 | Ga0207709_100514844 | 272 |
| 291 | 3300025935 | Ga0207709_10158366 | Ga0207709_101583661 | 272 |
| 292 | 3300025937 | Ga0207669_10029404 | Ga0207669_100294043 | 272 |
| 293 | 3300025938 | Ga0207704_10310871 | Ga0207704_103108712 | 272 |
| 294 | 3300025944 | Ga0207661_10150275 | Ga0207661_101502752 | 272 |
| 295 | 3300025949 | Ga0207667_10145375 | Ga0207667_101453755 | 272 |
| 296 | 3300025961 | Ga0207712_10025609 | Ga0207712_100256094 | 272 |
| 297 | 3300025961 | Ga0207712_10131354 | Ga0207712_101313542 | 272 |
| 298 | 3300025972 | Ga0207668_10030370 | Ga0207668_100303703 | 272 |
| 299 | 3300025972 | Ga0207668_10358872 | Ga0207668_103588722 | 272 |
| 300 | 3300026035 | Ga0207703_10129650 | Ga0207703_101296503 | 272 |
| 301 | 3300026075 | Ga0207708_10073277 | Ga0207708_100732773 | 272 |
| 302 | 3300026089 | Ga0207648_10078394 | Ga0207648_100783944 | 272 |
| 303 | 3300026118 | Ga0207675_100033691 | Ga0207675_1000336914 | 272 |
| 304 | 3300027907 | Ga0207428_10001294 | Ga0207428_1000129434 | 272 |
| 305 | 3300027907 | Ga0207428_10001309 | Ga0207428_1000130916 | 272 |
| 306 | 3300028800 | Ga0265338_10008853 | Ga0265338_100088536 | 272 |
| 307 | 3300028800 | Ga0265338_10199692 | Ga0265338_101996923 | 272 |
| 308 | 3300030733 | Ga0314311_1038998 | Ga0314311_10389984 | 272 |
| 309 | 3300031251 | Ga0265327_10024399 | Ga0265327_100243996 | 272 |
| 310 | 3300031548 | Ga0307408_100010829 | Ga0307408_10001082910 | 272 |
| 311 | 3300031548 | Ga0307408_100063904 | Ga0307408_1000639043 | 272 |
| 312 | 3300031548 | Ga0307408_100193251 | Ga0307408_1001932513 | 272 |
| 313 | 3300031728 | Ga0316578_10317608 | Ga0316578_103176081 | 272 |
| 314 | 3300031731 | Ga0307405_10002221 | Ga0307405_100022215 | 272 |
| 315 | 3300031731 | Ga0307405_10023768 | Ga0307405_100237685 | 272 |
| 316 | 3300031824 | Ga0307413_10005596 | Ga0307413_100055968 | 272 |
| 317 | 3300031824 | Ga0307413_10345954 | Ga0307413_103459542 | 272 |
| 318 | 3300031852 | Ga0307410_10003149 | Ga0307410_100031495 | 272 |
| 319 | 3300031852 | Ga0307410_10028825 | Ga0307410_100288251 | 272 |
| 320 | 3300031852 | Ga0307410_10466457 | Ga0307410_104664571 | 272 |
| 321 | 3300031901 | Ga0307406_10000352 | Ga0307406_100003528 | 272 |
| 322 | 3300031901 | Ga0307406_10006213 | Ga0307406_100062135 | 272 |
| 323 | 3300031901 | Ga0307406_10012506 | Ga0307406_100125063 | 272 |
| 324 | 3300031903 | Ga0307407_10001962 | Ga0307407_100019629 | 272 |
| 325 | 3300031903 | Ga0307407_10076278 | Ga0307407_100762781 | 272 |
| 326 | 3300031911 | Ga0307412_10011241 | Ga0307412_1001124110 | 272 |
| 327 | 3300031995 | Ga0307409_100018091 | Ga0307409_1000180914 | 272 |
| 328 | 3300031995 | Ga0307409_100043245 | Ga0307409_1000432454 | 272 |
| 329 | 3300032002 | Ga0307416_100000084 | Ga0307416_10000008444 | 272 |
| 330 | 3300032002 | Ga0307416_100043820 | Ga0307416_1000438202 | 272 |
| 331 | 3300032002 | Ga0307416_100128536 | Ga0307416_1001285362 | 272 |
| 332 | 3300032002 | Ga0307416_100156454 | Ga0307416_1001564543 | 272 |
| 333 | 3300032002 | Ga0307416_100421857 | Ga0307416_1004218573 | 272 |
| 334 | 3300032004 | Ga0307414_10014132 | Ga0307414_100141324 | 272 |
| 335 | 3300032004 | Ga0307414_10270892 | Ga0307414_102708922 | 272 |
| 336 | 3300032005 | Ga0307411_10001782 | Ga0307411_100017827 | 272 |
| 337 | 3300032005 | Ga0307411_10145028 | Ga0307411_101450283 | 272 |
| 338 | 3300032126 | Ga0307415_100039636 | Ga0307415_1000396365 | 272 |
| 339 | 3300032126 | Ga0307415_100091820 | Ga0307415_1000918204 | 272 |
| 340 | 3300032126 | Ga0307415_100132154 | Ga0307415_1001321544 | 272 |
| 341 | 3300032168 | Ga0316593_10000765 | Ga0316593_100007652 | 272 |
| 342 | 3300033528 | Ga0316588_1001826 | Ga0316588_10018266 | 272 |
| 343 | 3300035083 | Ga0373926_0029697 | Ga0373926_0029697_289_1119 | 272 |
| 344 | 3300035090 | Ga0373949_0031199 | Ga0373949_0031199_99_935 | 272 |
| 345 | 3300035111 | Ga0373923_0044734 | Ga0373923_0044734_230_1060 | 272 |
| 346 | 3300035117 | Ga0373953_0004557 | Ga0373953_0004557_1996_2826 | 272 |
| 347 | 3300035118 | Ga0373954_0074868 | Ga0373954_0074868_715_1545 | 272 |
| 348 | 3300035120 | Ga0373957_0016069 | Ga0373957_0016069_669_1499 | 272 |
| 349 | 3300035172 | Ga0373955_0102640 | Ga0373955_0102640_563_1393 | 272 |
| 350 | 3300035172 | Ga0373955_0143743 | Ga0373955_0143743_270_1100 | 272 |
| 351 | 3300035691 | Ga0373931_0030612 | Ga0373931_0030612_757_1593 | 272 |
| 352 | 3300035724 | Ga0373933_0072510 | Ga0373933_0072510_535_1365 | 272 |
| 353 | 3300036401 | Ga0373937_0000922 | Ga0373937_0000922_18364_19194 | 272 |
| 354 | 3300036401 | Ga0373937_0015501 | Ga0373937_0015501_2242_3072 | 272 |
| 355 | 3300036401 | Ga0373937_0041143 | Ga0373937_0041143_1191_2021 | 272 |
| 356 | 3300036401 | Ga0373937_0058846 | Ga0373937_0058846_2431_3261 | 272 |
| 357 | 3300036401 | Ga0373937_0061124 | Ga0373937_0061124_1876_2706 | 272 |
| 358 | 3300036401 | Ga0373937_0074325 | Ga0373937_0074325_107_937 | 272 |
| 359 | 3300036401 | Ga0373937_0138314 | Ga0373937_0138314_1410_2240 | 272 |
| 360 | 3300037068 | Ga0373925_0008231 | Ga0373925_0008231_5099_5929 | 272 |
| 361 | 3300037418 | Ga0395900_0050861 | Ga0395900_0050861_1132_1968 | 272 |
| 362 | 3300037853 | Ga0436364_0000682 | Ga0436364_0000682_1174_2004 | 272 |
| 363 | 3300037853 | Ga0436364_0389284 | Ga0436364_0389284_211_1041 | 272 |
| 364 | 3300037853 | Ga0436364_0554982 | Ga0436364_0554982_4644_5477 | 272 |
| 365 | 3300037853 | Ga0436364_1053341 | Ga0436364_1053341_1869_2699 | 272 |
| 366 | 3300037853 | Ga0436364_1266987 | Ga0436364_1266987_17_847 | 272 |
| 367 | 3300039437 | Ga0436365_0045604 | Ga0436365_0045604_14_844 | 272 |
| 368 | 3300039437 | Ga0436365_0615041 | Ga0436365_0615041_177_1007 | 272 |
| 369 | 3300039438 | Ga0436360_0333232 | Ga0436360_0333232_3610_4440 | 272 |
| 370 | 3300039438 | Ga0436360_0432234 | Ga0436360_0432234_276_1106 | 272 |
| 371 | 3300039438 | Ga0436360_0558978 | Ga0436360_0558978_1859_2689 | 272 |
| 372 | 3300039438 | Ga0436360_0651402 | Ga0436360_0651402_131_961 | 272 |
| 373 | 3300039438 | Ga0436360_0902642 | Ga0436360_0902642_991_1824 | 272 |
| 374 | 3300039438 | Ga0436360_1031006 | Ga0436360_1031006_115_945 | 272 |
| 375 | 3300039438 | Ga0436360_1332781 | Ga0436360_1332781_462_1295 | 272 |
| 376 | 3300039447 | Ga0436361_0278088 | Ga0436361_0278088_2096_2926 | 272 |
| 377 | 3300039453 | Ga0436362_0446646 | Ga0436362_0446646_1381_2211 | 272 |
| 378 | 3300039453 | Ga0436362_0632372 | Ga0436362_0632372_14_847 | 272 |
| 379 | 3300039453 | Ga0436362_1298757 | Ga0436362_1298757_927_1757 | 272 |
| 380 | 3300041413 | Ga0439465_0016498 | Ga0439465_0016498_523_1356 | 272 |
| 381 | 3300041453 | Ga0451797_1211872 | Ga0451797_1211872_27_863 | 272 |
| 382 | 3300041491 | Ga0451833_0393181 | Ga0451833_0393181_583_1419 | 272 |
| 383 | 3300041509 | Ga0451843_0866875 | Ga0451843_0866875_835_1671 | 272 |
| 384 | 3300041511 | Ga0451855_1581117 | Ga0451855_1581117_204_1028 | 272 |
| 385 | 3300041511 | Ga0451855_1660956 | Ga0451855_1660956_22_846 | 272 |
| 386 | 3300042005 | Ga0439448_0078783 | Ga0439448_0078783_209_1045 | 272 |
| 387 | 3300042016 | Ga0439463_009011 | Ga0439463_009011_178_1014 | 272 |
| 388 | 3300042156 | Ga0439446_0066691 | Ga0439446_0066691_17_850 | 272 |
| 389 | 3300042437 | Ga0439444_0006030 | Ga0439444_0006030_247_1083 | 272 |
| 390 | 3300042437 | Ga0439444_0013747 | Ga0439444_0013747_31_867 | 272 |
| 391 | 3300042439 | Ga0439464_0007832 | Ga0439464_0007832_1879_2715 | 272 |
| 392 | 3300042876 | Ga0451577_0003056 | Ga0451577_0003056_8653_9492 | 272 |
| 393 | 3300042876 | Ga0451577_0038846 | Ga0451577_0038846_27_851 | 272 |
| 394 | 3300042993 | Ga0439440_0029912 | Ga0439440_0029912_200_1036 | 272 |
| 395 | 3300044673 | Ga0453683_0041549 | Ga0453683_0041549_1600_2424 | 272 |
| 396 | 3300044683 | Ga0466965_0029069 | Ga0466965_0029069_1053_1889 | 272 |
| 397 | 3300044693 | Ga0466961_0103620 | Ga0466961_0103620_643_1482 | 272 |
| 398 | 3300044693 | Ga0466961_0149441 | Ga0466961_0149441_584_1420 | 272 |
| 399 | 3300044694 | Ga0466963_0056459 | Ga0466963_0056459_696_1532 | 272 |
| 400 | 3300044712 | Ga0453684_0257466 | Ga0453684_0257466_304_1140 | 272 |
| 401 | 3300044719 | Ga0466971_0061994 | Ga0466971_0061994_272_1108 | 272 |
| 402 | 3300044765 | Ga0466970_0008583 | Ga0466970_0008583_692_1528 | 272 |
| 403 | 3300044765 | Ga0466970_0056218 | Ga0466970_0056218_898_1734 | 272 |
| 404 | 3300044842 | Ga0466957_0146121 | Ga0466957_0146121_231_1070 | 272 |
| 405 | 3300044901 | Ga0466960_0012755 | Ga0466960_0012755_1102_1938 | 272 |
| 406 | 3300044901 | Ga0466960_0044553 | Ga0466960_0044553_220_1059 | 272 |
| 407 | 3300045051 | Ga0451576_0019276 | Ga0451576_0019276_4351_5175 | 272 |
| 408 | 3300045976 | Ga0466967_0404941 | Ga0466967_0404941_322_1155 | 272 |
| 409 | 3300046454 | Ga0495592_0083336 | Ga0495592_0083336_1306_2136 | 272 |
| 410 | 3300046462 | Ga0495651_0170453 | Ga0495651_0170453_449_1279 | 272 |
| 411 | 3300046463 | Ga0495653_0017391 | Ga0495653_0017391_1672_2508 | 272 |
| 412 | 3300046463 | Ga0495653_0145439 | Ga0495653_0145439_50_886 | 272 |
| 413 | 3300046475 | Ga0495639_0028928 | Ga0495639_0028928_1320_2150 | 272 |
| 414 | 3300046476 | Ga0495662_0096485 | Ga0495662_0096485_328_1158 | 272 |
| 415 | 3300046477 | Ga0495664_0026792 | Ga0495664_0026792_2509_3339 | 272 |
| 416 | 3300046477 | Ga0495664_0125907 | Ga0495664_0125907_710_1540 | 272 |
| 417 | 3300046511 | Ga0495608_0025697 | Ga0495608_0025697_1027_1857 | 272 |
| 418 | 3300046512 | Ga0495610_0002336 | Ga0495610_0002336_1387_2223 | 272 |
| 419 | 3300046516 | Ga0495628_0064752 | Ga0495628_0064752_654_1484 | 272 |
| 420 | 3300046518 | Ga0495631_0180668 | Ga0495631_0180668_47_883 | 272 |
| 421 | 3300046520 | Ga0495637_0052624 | Ga0495637_0052624_356_1192 | 272 |
| 422 | 3300046525 | Ga0495663_0035487 | Ga0495663_0035487_240_1076 | 272 |
| 423 | 3300046535 | Ga0495586_0119340 | Ga0495586_0119340_194_1024 | 272 |
| 424 | 3300046536 | Ga0495587_0006550 | Ga0495587_0006550_6558_7388 | 272 |
| 425 | 3300046536 | Ga0495587_0048278 | Ga0495587_0048278_1651_2481 | 272 |
| 426 | 3300046543 | Ga0495645_0006077 | Ga0495645_0006077_5094_5924 | 272 |
| 427 | 3300046559 | Ga0495667_0033623 | Ga0495667_0033623_2244_3074 | 272 |
| 428 | 3300046660 | Ga0495625_0081017 | Ga0495625_0081017_387_1220 | 272 |
| 429 | 3300046663 | Ga0495635_0066422 | Ga0495635_0066422_680_1510 | 272 |
| 430 | 3300046665 | Ga0495661_0047641 | Ga0495661_0047641_934_1770 | 272 |
| 431 | 3300046665 | Ga0495661_0195327 | Ga0495661_0195327_77_901 | 272 |
| 432 | 3300046675 | Ga0495657_0157040 | Ga0495657_0157040_538_1368 | 272 |
| 433 | 3300046675 | Ga0495657_0197392 | Ga0495657_0197392_362_1192 | 272 |
| 434 | 3300046678 | Ga0495599_0053456 | Ga0495599_0053456_652_1482 | 272 |
| 435 | 3300046691 | Ga0495670_0052195 | Ga0495670_0052195_947_1783 | 272 |
| 436 | 3300046691 | Ga0495670_0070410 | Ga0495670_0070410_133_957 | 272 |
| 437 | 3300046809 | Ga0495600_0068501 | Ga0495600_0068501_331_1161 | 272 |
| 438 | 3300046810 | Ga0495660_0085240 | Ga0495660_0085240_264_1100 | 272 |
| 439 | 3300047315 | Ga0495581_0176803 | Ga0495581_0176803_222_1052 | 272 |
| 440 | 3300047317 | Ga0495604_0071028 | Ga0495604_0071028_617_1447 | 272 |
| 441 | 3300047319 | Ga0495674_0229292 | Ga0495674_0229292_476_1315 | 272 |
| 442 | 3300047322 | Ga0495680_0225272 | Ga0495680_0225272_170_1006 | 272 |
| 443 | 3300047322 | Ga0495680_0249415 | Ga0495680_0249415_116_946 | 272 |
| 444 | 3300047444 | Ga0495675_0014092 | Ga0495675_0014092_3400_4230 | 272 |
| 445 | 3300047444 | Ga0495675_0196397 | Ga0495675_0196397_200_1030 | 272 |
| 446 | 3300047471 | Ga0495684_0089527 | Ga0495684_0089527_929_1759 | 272 |
| 447 | 3300048088 | Ga0495602_0000485 | Ga0495602_0000485_25136_25966 | 272 |
| 448 | 3300048088 | Ga0495602_0076138 | Ga0495602_0076138_1359_2189 | 272 |
| 449 | 3300048903 | Ga0496100_0217752 | Ga0496100_0217752_181_1020 | 272 |
| 450 | 3300048904 | Ga0496101_0089284 | Ga0496101_0089284_728_1567 | 272 |
| 451 | 3300048905 | Ga0496102_0058442 | Ga0496102_0058442_1086_1925 | 272 |
| 452 | 3300048908 | Ga0496105_0163403 | Ga0496105_0163403_353_1192 | 272 |
| 453 | 3300048909 | Ga0496106_0170666 | Ga0496106_0170666_811_1650 | 272 |
| 454 | 3300048911 | Ga0496108_0005024 | Ga0496108_0005024_3104_3940 | 272 |
| 455 | 3300048911 | Ga0496108_0388405 | Ga0496108_0388405_132_968 | 272 |
| 456 | 3300048912 | Ga0496109_0011059 | Ga0496109_0011059_3976_4812 | 272 |
| 457 | 3300048913 | Ga0496110_0076651 | Ga0496110_0076651_1280_2116 | 272 |
| 458 | 3300048913 | Ga0496110_0275300 | Ga0496110_0275300_466_1302 | 272 |
| 459 | 3300048916 | Ga0496113_0141414 | Ga0496113_0141414_520_1356 | 272 |
| 460 | 3300048917 | Ga0496114_0020960 | Ga0496114_0020960_2314_3150 | 272 |
| 461 | 3300048917 | Ga0496114_0033898 | Ga0496114_0033898_122_961 | 272 |
| 462 | 3300048917 | Ga0496114_0046076 | Ga0496114_0046076_218_1054 | 272 |
| 463 | 3300048918 | Ga0496115_0020789 | Ga0496115_0020789_3852_4691 | 272 |
| 464 | 3300048922 | Ga0496119_0014326 | Ga0496119_0014326_30_860 | 272 |
| 465 | 3300049127 | Ga0501306_006304 | Ga0501306_006304_502_1326 | 272 |
| 466 | 3300049128 | Ga0501308_002475 | Ga0501308_002475_15_839 | 272 |
| 467 | 3300049132 | Ga0501343_001193 | Ga0501343_001193_674_1498 | 272 |
| 468 | 3300049162 | Ga0501307_002419 | Ga0501307_002419_875_1714 | 272 |
| 469 | 3300049522 | Ga0501299_009671 | Ga0501299_009671_160_996 | 272 |
| 470 | 3300049527 | Ga0501311_009391 | Ga0501311_009391_317_1141 | 272 |
| 471 | 3300049532 | Ga0501316_001182 | Ga0501316_001182_328_1152 | 272 |
| 472 | 3300049535 | Ga0501319_000062 | Ga0501319_000062_1868_2704 | 272 |
| 473 | 3300049539 | Ga0501323_001180 | Ga0501323_001180_624_1448 | 272 |
| 474 | 3300049540 | Ga0501324_000812 | Ga0501324_000812_675_1499 | 272 |
| 475 | 3300049556 | Ga0501340_000481 | Ga0501340_000481_261_1085 | 272 |
| 476 | 3300049568 | Ga0501031_0000651 | Ga0501031_0000651_17452_18285 | 272 |
| 477 | 3300049568 | Ga0501031_0002157 | Ga0501031_0002157_10430_11266 | 272 |
| 478 | 3300049569 | Ga0501032_0000111 | Ga0501032_0000111_2263_3096 | 272 |
| 479 | 3300049569 | Ga0501032_0000438 | Ga0501032_0000438_12782_13618 | 272 |
| 480 | 3300049570 | Ga0501033_0001612 | Ga0501033_0001612_9432_10268 | 272 |
| 481 | 3300049570 | Ga0501033_0001877 | Ga0501033_0001877_859_1692 | 272 |
| 482 | 3300049571 | Ga0501034_0001245 | Ga0501034_0001245_10009_10845 | 272 |
| 483 | 3300049571 | Ga0501034_0026519 | Ga0501034_0026519_2263_3096 | 272 |
| 484 | 3300049572 | Ga0501036_0002605 | Ga0501036_0002605_11128_11961 | 272 |
| 485 | 3300049572 | Ga0501036_0003863 | Ga0501036_0003863_862_1698 | 272 |
| 486 | 3300049573 | Ga0501037_0000131 | Ga0501037_0000131_66707_67540 | 272 |
| 487 | 3300049573 | Ga0501037_0000998 | Ga0501037_0000998_10617_11453 | 272 |
| 488 | 3300049574 | Ga0501038_0000109 | Ga0501038_0000109_66707_67540 | 272 |
| 489 | 3300049574 | Ga0501038_0000265 | Ga0501038_0000265_23684_24520 | 272 |
| 490 | 3300049575 | Ga0501039_0000814 | Ga0501039_0000814_9270_10106 | 272 |
| 491 | 3300049575 | Ga0501039_0002279 | Ga0501039_0002279_2263_3096 | 272 |
| 492 | 3300049576 | Ga0501040_0138951 | Ga0501040_0138951_314_1147 | 272 |
| 493 | 3300049578 | Ga0501042_0334874 | Ga0501042_0334874_178_1014 | 272 |
| 494 | 3300049579 | Ga0501043_0001438 | Ga0501043_0001438_9356_10192 | 272 |
| 495 | 3300049579 | Ga0501043_0034474 | Ga0501043_0034474_2310_3143 | 272 |
| 496 | 3300049580 | Ga0501046_0001551 | Ga0501046_0001551_11774_12610 | 272 |
| 497 | 3300049580 | Ga0501046_0125633 | Ga0501046_0125633_150_983 | 272 |
| 498 | 3300049581 | Ga0501047_0000855 | Ga0501047_0000855_10617_11453 | 272 |
| 499 | 3300049581 | Ga0501047_0193542 | Ga0501047_0193542_389_1222 | 272 |
| 500 | 3300049582 | Ga0501048_0000857 | Ga0501048_0000857_11975_12811 | 272 |
| 501 | 3300049583 | Ga0501067_0004323 | Ga0501067_0004323_6676_7512 | 272 |
| 502 | 3300049584 | Ga0501068_0042645 | Ga0501068_0042645_1855_2691 | 272 |
| 503 | 3300049585 | Ga0501069_0000702 | Ga0501069_0000702_1664_2500 | 272 |
| 504 | 3300049586 | Ga0501070_0001773 | Ga0501070_0001773_9331_10167 | 272 |
| 505 | 3300049586 | Ga0501070_0119781 | Ga0501070_0119781_221_1054 | 272 |
| 506 | 3300049589 | Ga0501073_0002543 | Ga0501073_0002543_8986_9822 | 272 |
| 507 | 3300049590 | Ga0501074_0000257 | Ga0501074_0000257_22912_23748 | 272 |
| 508 | 3300049652 | Ga0501202_021135 | Ga0501202_021135_322_1158 | 272 |
| 509 | 3300049655 | Ga0501208_006843 | Ga0501208_006843_100_936 | 272 |
| 510 | 3300049675 | Ga0501243_008476 | Ga0501243_008476_561_1397 | 272 |
| 511 | 3300049742 | Ga0501080_0002067 | Ga0501080_0002067_6813_7649 | 272 |
| 512 | 3300049744 | Ga0501083_0000801 | Ga0501083_0000801_9594_10430 | 272 |
| 513 | 3300049822 | Ga0501035_0001522 | Ga0501035_0001522_9563_10399 | 272 |
| 514 | 3300049822 | Ga0501035_0043204 | Ga0501035_0043204_424_1257 | 272 |
| 515 | 3300049823 | Ga0501044_0000234 | Ga0501044_0000234_66707_67540 | 272 |
| 516 | 3300049823 | Ga0501044_0002854 | Ga0501044_0002854_9266_10102 | 272 |
| 517 | 3300049851 | Ga0501212_006277 | Ga0501212_006277_289_1125 | 272 |
| 518 | 3300050507 | nmdc:mga05p37_1182_c1 | nmdc:mga05p37_1182_c1_6602_7438 | 272 |
| 519 | 3300050507 | nmdc:mga05p37_64020_c1 | nmdc:mga05p37_64020_c1_1054_1890 | 272 |
| 520 | 3300050508 | nmdc:mga09592_120860_c1 | nmdc:mga09592_120860_c1_923_1759 | 272 |
| 521 | 3300050508 | nmdc:mga09592_404123_c1 | nmdc:mga09592_404123_c1_307_1131 | 272 |
| 522 | 3300050508 | nmdc:mga09592_79290_c1 | nmdc:mga09592_79290_c1_761_1597 | 272 |
| 523 | 3300050509 | nmdc:mga0qj67_230128_c1 | nmdc:mga0qj67_230128_c1_285_1121 | 272 |
| 524 | 3300050510 | nmdc:mga06r32_12774_c1 | nmdc:mga06r32_12774_c1_2037_2873 | 272 |
| 525 | 3300050511 | nmdc:mga08y16_14815_c1 | nmdc:mga08y16_14815_c1_214_1050 | 272 |
| 526 | 3300050511 | nmdc:mga08y16_97083_c1 | nmdc:mga08y16_97083_c1_1741_2577 | 272 |
| 527 | 3300050512 | nmdc:mga0n895_113612_c1 | nmdc:mga0n895_113612_c1_725_1561 | 272 |
| 528 | 3300050512 | nmdc:mga0n895_1321_c1 | nmdc:mga0n895_1321_c1_6561_7397 | 272 |
| 529 | 3300050512 | nmdc:mga0n895_1534_c1 | nmdc:mga0n895_1534_c1_7457_8299 | 272 |
| 530 | 3300050513 | nmdc:mga0rr50_1290_c2 | nmdc:mga0rr50_1290_c2_3603_4439 | 272 |
| 531 | 3300050513 | nmdc:mga0rr50_6615_c1 | nmdc:mga0rr50_6615_c1_545_1381 | 272 |
| 532 | 3300050514 | nmdc:mga08x19_10642_c1 | nmdc:mga08x19_10642_c1_3156_3998 | 272 |
| 533 | 3300050514 | nmdc:mga08x19_217303_c1 | nmdc:mga08x19_217303_c1_106_942 | 272 |
| 534 | 3300050515 | nmdc:mga0a205_226583_c1 | nmdc:mga0a205_226583_c1_106_942 | 272 |
| 535 | 3300050515 | nmdc:mga0a205_5430_c1 | nmdc:mga0a205_5430_c1_1759_2595 | 272 |
| 536 | 3300050515 | nmdc:mga0a205_890_c1 | nmdc:mga0a205_890_c1_6593_7435 | 272 |
| 537 | 3300053077 | Ga0495601_0113669 | Ga0495601_0113669_232_1062 | 272 |
| 538 | 3300053077 | Ga0495601_0120923 | Ga0495601_0120923_754_1584 | 272 |
| 539 | 3300053078 | Ga0495612_0064158 | Ga0495612_0064158_586_1422 | 272 |
| 540 | 3300053083 | Ga0495655_0053186 | Ga0495655_0053186_77_913 | 272 |
| 541 | 3300053084 | Ga0495595_0028363 | Ga0495595_0028363_1137_1967 | 272 |
| 542 | 3300053085 | Ga0495619_0004308 | Ga0495619_0004308_6557_7387 | 272 |
| 543 | 3300053085 | Ga0495619_0008993 | Ga0495619_0008993_2616_3446 | 272 |
| 544 | 3300053139 | Ga0500568_0000001 | Ga0500568_0000001_2962_3795 | 272 |
| 545 | 3300054114 | Ga0501084_0000487 | Ga0501084_0000487_25059_25895 | 272 |
| 546 | 3300059491 | Ga0587070_005110 | Ga0587070_005110_231_1061 | 272 |
| 547 | 3300059491 | Ga0587070_019379 | Ga0587070_019379_271_1107 | 272 |
| 548 | 3300059493 | Ga0587077_003683 | Ga0587077_003683_390_1214 | 272 |
| 549 | 3300059607 | Ga0587125_000437 | Ga0587125_000437_1055_1927 | 272 |
| 550 | 3300059624 | Ga0587109_003270 | Ga0587109_003270_183_1007 | 272 |
| 551 | 3300059624 | Ga0587109_008626 | Ga0587109_008626_148_981 | 272 |
| 552 | 3300059639 | Ga0587062_000275 | Ga0587062_000275_1366_2190 | 272 |
| 553 | 3300059641 | Ga0587068_004016 | Ga0587068_004016_366_1202 | 272 |
| 554 | 3300059647 | Ga0587079_015422 | Ga0587079_015422_155_988 | 272 |
| 555 | 3300059660 | Ga0587124_002532 | Ga0587124_002532_41_880 | 272 |
| 556 | 3300060346 | Ga0587111_0005171 | Ga0587111_0005171_399_1223 | 272 |
| 557 | 3300061719 | Ga0466962_0013172 | Ga0466962_0013172_1422_2258 | 272 |
| 558 | 3300003203 | JGI25406J46586_10001890 | JGI25406J46586_1000189017 | 273 |
| 559 | 3300003373 | JGI25407J50210_10046065 | JGI25407J50210_100460651 | 273 |
| 560 | 3300005293 | Ga0065715_10158979 | Ga0065715_101589792 | 273 |
| 561 | 3300005295 | Ga0065707_10088640 | Ga0065707_100886406 | 273 |
| 562 | 3300005327 | Ga0070658_10095168 | Ga0070658_100951682 | 273 |
| 563 | 3300005329 | Ga0070683_100033140 | Ga0070683_1000331405 | 273 |
| 564 | 3300005335 | Ga0070666_10036702 | Ga0070666_100367024 | 273 |
| 565 | 3300005336 | Ga0070680_100002147 | Ga0070680_10000214723 | 273 |
| 566 | 3300005337 | Ga0070682_100031259 | Ga0070682_1000312594 | 273 |
| 567 | 3300005338 | Ga0068868_100024919 | Ga0068868_1000249196 | 273 |
| 568 | 3300005341 | Ga0070691_10023324 | Ga0070691_100233244 | 273 |
| 569 | 3300005367 | Ga0070667_100106316 | Ga0070667_1001063164 | 273 |
| 570 | 3300005436 | Ga0070713_100096238 | Ga0070713_1000962384 | 273 |
| 571 | 3300005458 | Ga0070681_10012326 | Ga0070681_1001232614 | 273 |
| 572 | 3300005530 | Ga0070679_100002074 | Ga0070679_10000207428 | 273 |
| 573 | 3300005539 | Ga0068853_100079767 | Ga0068853_1000797672 | 273 |
| 574 | 3300005539 | Ga0068853_100151119 | Ga0068853_1001511193 | 273 |
| 575 | 3300005548 | Ga0070665_100015455 | Ga0070665_1000154556 | 273 |
| 576 | 3300005563 | Ga0068855_100106565 | Ga0068855_1001065656 | 273 |
| 577 | 3300005563 | Ga0068855_100107969 | Ga0068855_1001079692 | 273 |
| 578 | 3300005563 | Ga0068855_100169574 | Ga0068855_1001695743 | 273 |
| 579 | 3300005563 | Ga0068855_100257885 | Ga0068855_1002578852 | 273 |
| 580 | 3300005577 | Ga0068857_100001770 | Ga0068857_1000017706 | 273 |
| 581 | 3300005614 | Ga0068856_100012640 | Ga0068856_10001264013 | 273 |
| 582 | 3300005614 | Ga0068856_100153031 | Ga0068856_1001530314 | 273 |
| 583 | 3300005614 | Ga0068856_100160364 | Ga0068856_1001603644 | 273 |
| 584 | 3300005616 | Ga0068852_100382228 | Ga0068852_1003822282 | 273 |
| 585 | 3300005617 | Ga0068859_100081864 | Ga0068859_1000818644 | 273 |
| 586 | 3300005842 | Ga0068858_100141406 | Ga0068858_1001414061 | 273 |
| 587 | 3300006237 | Ga0097621_100068382 | Ga0097621_1000683821 | 273 |
| 588 | 3300006237 | Ga0097621_100231168 | Ga0097621_1002311681 | 273 |
| 589 | 3300006358 | Ga0068871_100063920 | Ga0068871_1000639205 | 273 |
| 590 | 3300006358 | Ga0068871_100092414 | Ga0068871_1000924145 | 273 |
| 591 | 3300006844 | Ga0075428_100000009 | Ga0075428_100000009189 | 273 |
| 592 | 3300006880 | Ga0075429_100201226 | Ga0075429_1002012263 | 273 |
| 593 | 3300006931 | Ga0097620_100081865 | Ga0097620_1000818654 | 273 |
| 594 | 3300009093 | Ga0105240_10188196 | Ga0105240_101881964 | 273 |
| 595 | 3300009093 | Ga0105240_10380517 | Ga0105240_103805172 | 273 |
| 596 | 3300009094 | Ga0111539_10000010 | Ga0111539_1000001049 | 273 |
| 597 | 3300009174 | Ga0105241_10088531 | Ga0105241_100885314 | 273 |
| 598 | 3300009176 | Ga0105242_10714606 | Ga0105242_107146062 | 273 |
| 599 | 3300009177 | Ga0105248_10284388 | Ga0105248_102843882 | 273 |
| 600 | 3300009551 | Ga0105238_10002481 | Ga0105238_100024816 | 273 |
| 601 | 3300010375 | Ga0105239_10006176 | Ga0105239_100061766 | 273 |
| 602 | 3300010375 | Ga0105239_10291478 | Ga0105239_102914783 | 273 |
| 603 | 3300013105 | Ga0157369_10004249 | Ga0157369_100042494 | 273 |
| 604 | 3300013105 | Ga0157369_10375546 | Ga0157369_103755463 | 273 |
| 605 | 3300013306 | Ga0163162_10712235 | Ga0163162_107122352 | 273 |
| 606 | 3300013307 | Ga0157372_10003029 | Ga0157372_1000302929 | 273 |
| 607 | 3300013308 | Ga0157375_10079983 | Ga0157375_100799833 | 273 |
| 608 | 3300014325 | Ga0163163_10007538 | Ga0163163_100075383 | 273 |
| 609 | 3300014325 | Ga0163163_10919796 | Ga0163163_109197961 | 273 |
| 610 | 3300014969 | Ga0157376_10223096 | Ga0157376_102230963 | 273 |
| 611 | 3300021384 | Ga0213876_10135683 | Ga0213876_101356833 | 273 |
| 612 | 3300021388 | Ga0213875_10063969 | Ga0213875_100639693 | 273 |
| 613 | 3300021388 | Ga0213875_10117849 | Ga0213875_101178492 | 273 |
| 614 | 3300025903 | Ga0207680_10250809 | Ga0207680_102508092 | 273 |
| 615 | 3300025911 | Ga0207654_10045892 | Ga0207654_100458924 | 273 |
| 616 | 3300025912 | Ga0207707_10004150 | Ga0207707_1000415016 | 273 |
| 617 | 3300025912 | Ga0207707_10182209 | Ga0207707_101822093 | 273 |
| 618 | 3300025913 | Ga0207695_10004731 | Ga0207695_100047316 | 273 |
| 619 | 3300025913 | Ga0207695_10150035 | Ga0207695_101500352 | 273 |
| 620 | 3300025917 | Ga0207660_10006183 | Ga0207660_100061836 | 273 |
| 621 | 3300025921 | Ga0207652_10266259 | Ga0207652_102662591 | 273 |
| 622 | 3300025924 | Ga0207694_10005630 | Ga0207694_100056306 | 273 |
| 623 | 3300025924 | Ga0207694_10010354 | Ga0207694_100103545 | 273 |
| 624 | 3300025924 | Ga0207694_10356163 | Ga0207694_103561631 | 273 |
| 625 | 3300025928 | Ga0207700_10033174 | Ga0207700_100331746 | 273 |
| 626 | 3300025941 | Ga0207711_10189269 | Ga0207711_101892693 | 273 |
| 627 | 3300025944 | Ga0207661_10026560 | Ga0207661_100265604 | 273 |
| 628 | 3300025949 | Ga0207667_10003860 | Ga0207667_100038606 | 273 |
| 629 | 3300025949 | Ga0207667_10014395 | Ga0207667_1001439514 | 273 |
| 630 | 3300025949 | Ga0207667_10107977 | Ga0207667_101079775 | 273 |
| 631 | 3300025986 | Ga0207658_10083039 | Ga0207658_100830394 | 273 |
| 632 | 3300026023 | Ga0207677_10005586 | Ga0207677_100055866 | 273 |
| 633 | 3300026035 | Ga0207703_10030380 | Ga0207703_100303804 | 273 |
| 634 | 3300026035 | Ga0207703_10057141 | Ga0207703_100571415 | 273 |
| 635 | 3300026041 | Ga0207639_10039754 | Ga0207639_100397545 | 273 |
| 636 | 3300026041 | Ga0207639_10292678 | Ga0207639_102926782 | 273 |
| 637 | 3300026041 | Ga0207639_10648943 | Ga0207639_106489432 | 273 |
| 638 | 3300026078 | Ga0207702_10002606 | Ga0207702_100026066 | 273 |
| 639 | 3300026078 | Ga0207702_10227978 | Ga0207702_102279782 | 273 |
| 640 | 3300026078 | Ga0207702_10563353 | Ga0207702_105633531 | 273 |
| 641 | 3300026088 | Ga0207641_10024102 | Ga0207641_100241026 | 273 |
| 642 | 3300026116 | Ga0207674_10003800 | Ga0207674_1000380029 | 273 |
| 643 | 3300026142 | Ga0207698_10009516 | Ga0207698_100095161 | 273 |
| 644 | 3300026142 | Ga0207698_10480465 | Ga0207698_104804652 | 273 |
| 645 | 3300026142 | Ga0207698_10501858 | Ga0207698_105018582 | 273 |
| 646 | 3300027907 | Ga0207428_10000034 | Ga0207428_10000034171 | 273 |
| 647 | 3300028379 | Ga0268266_10011799 | Ga0268266_1001179912 | 273 |
| 648 | 3300031240 | Ga0265320_10002219 | Ga0265320_1000221919 | 273 |
| 649 | 3300031249 | Ga0265339_10061008 | Ga0265339_100610082 | 273 |
| 650 | 3300031711 | Ga0265314_10009286 | Ga0265314_1000928618 | 273 |
| 651 | 3300031712 | Ga0265342_10066802 | Ga0265342_100668023 | 273 |
| 652 | 3300031901 | Ga0307406_10040541 | Ga0307406_100405413 | 273 |
| 653 | 3300032002 | Ga0307416_100082529 | Ga0307416_1000825293 | 273 |
| 654 | 3300032004 | Ga0307414_10018122 | Ga0307414_100181226 | 273 |
| 655 | 3300032005 | Ga0307411_10091805 | Ga0307411_100918053 | 273 |
| 656 | 3300032126 | Ga0307415_100213867 | Ga0307415_1002138672 | 273 |
| 657 | 3300035692 | Ga0373935_0203768 | Ga0373935_0203768_111_944 | 273 |
| 658 | 3300037418 | Ga0395900_0003432 | Ga0395900_0003432_6960_7802 | 273 |
| 659 | 3300037466 | Ga0395898_0130984 | Ga0395898_0130984_134_976 | 273 |
| 660 | 3300037471 | Ga0395905_0003848 | Ga0395905_0003848_5291_6133 | 273 |
| 661 | 3300037853 | Ga0436364_0052675 | Ga0436364_0052675_1586_2431 | 273 |
| 662 | 3300037853 | Ga0436364_0171064 | Ga0436364_0171064_331_1167 | 273 |
| 663 | 3300038443 | Ga0395901_0006624 | Ga0395901_0006624_2129_2971 | 273 |
| 664 | 3300039093 | Ga0400489_47982 | Ga0400489_47982_4626_5489 | 273 |
| 665 | 3300039437 | Ga0436365_0334948 | Ga0436365_0334948_120_956 | 273 |
| 666 | 3300044673 | Ga0453683_0012218 | Ga0453683_0012218_4504_5340 | 273 |
| 667 | 3300045051 | Ga0451576_0000055 | Ga0451576_0000055_249784_250620 | 273 |
| 668 | 3300046529 | Ga0495652_0011282 | Ga0495652_0011282_4151_4981 | 273 |
| 669 | 3300046531 | Ga0495665_0196821 | Ga0495665_0196821_193_1023 | 273 |
| 670 | 3300049574 | Ga0501038_0230739 | Ga0501038_0230739_603_1436 | 273 |
| 671 | 3300049575 | Ga0501039_0489187 | Ga0501039_0489187_76_909 | 273 |
| 672 | 3300049587 | Ga0501071_0073586 | Ga0501071_0073586_789_1622 | 273 |
| 673 | 3300049588 | Ga0501072_0063471 | Ga0501072_0063471_135_968 | 273 |
| 674 | 3300049591 | Ga0501075_0085597 | Ga0501075_0085597_508_1341 | 273 |
| 675 | 3300049592 | Ga0501076_0028034 | Ga0501076_0028034_2280_3113 | 273 |
| 676 | 3300049741 | Ga0501079_0082673 | Ga0501079_0082673_1448_2281 | 273 |
| 677 | 3300049824 | Ga0501045_0012622 | Ga0501045_0012622_152_985 | 273 |
| 678 | 3300050508 | nmdc:mga09592_150406_c1 | nmdc:mga09592_150406_c1_868_1701 | 273 |
| 679 | 3300050511 | nmdc:mga08y16_10_c1 | nmdc:mga08y16_10_c1_428869_429702 | 273 |
| 680 | 3300061734 | Ga0530510_0040074 | Ga0530510_0040074_2440_3273 | 273 |
| 681 | 3300005329 | Ga0070683_100099873 | Ga0070683_1000998735 | 274 |
| 682 | 3300005844 | Ga0068862_100226636 | Ga0068862_1002266363 | 274 |
| 683 | 3300025944 | Ga0207661_10100411 | Ga0207661_101004114 | 274 |
| 684 | 3300028573 | Ga0265334_10004519 | Ga0265334_100045195 | 274 |
| 685 | 3300028577 | Ga0265318_10000003 | Ga0265318_10000003189 | 274 |
| 686 | 3300028794 | Ga0307515_10043659 | Ga0307515_100436594 | 274 |
| 687 | 3300029957 | Ga0265324_10013735 | Ga0265324_100137354 | 274 |
| 688 | 3300031250 | Ga0265331_10008339 | Ga0265331_100083399 | 274 |
| 689 | 3300031251 | Ga0265327_10000318 | Ga0265327_1000031848 | 274 |
| 690 | 3300031595 | Ga0265313_10007926 | Ga0265313_1000792611 | 274 |
| 691 | 3300031616 | Ga0307508_10000276 | Ga0307508_1000027613 | 274 |
| 692 | 3300031665 | Ga0316575_10033954 | Ga0316575_100339544 | 274 |
| 693 | 3300031691 | Ga0316579_10026903 | Ga0316579_100269034 | 274 |
| 694 | 3300031727 | Ga0316576_10001965 | Ga0316576_100019659 | 274 |
| 695 | 3300031727 | Ga0316576_10038621 | Ga0316576_100386213 | 274 |
| 696 | 3300031728 | Ga0316578_10019064 | Ga0316578_100190647 | 274 |
| 697 | 3300032139 | Ga0316580_10011148 | Ga0316580_100111483 | 274 |
| 698 | 3300033541 | Ga0316596_1003568 | Ga0316596_10035686 | 274 |
| 699 | 3300036647 | Ga0316582_0055389 | Ga0316582_0055389_478_1311 | 274 |
| 700 | 3300049569 | Ga0501032_0000512 | Ga0501032_0000512_2053_2919 | 274 |
| 701 | 3300049571 | Ga0501034_0008844 | Ga0501034_0008844_9354_10211 | 274 |
| 702 | 3300049572 | Ga0501036_0039645 | Ga0501036_0039645_1139_2005 | 274 |
| 703 | 3300049579 | Ga0501043_0380594 | Ga0501043_0380594_104_970 | 274 |
| 704 | 3300049580 | Ga0501046_0111284 | Ga0501046_0111284_1191_2057 | 274 |
| 705 | 3300049581 | Ga0501047_0045646 | Ga0501047_0045646_1209_2075 | 274 |
| 706 | 3300049822 | Ga0501035_0130044 | Ga0501035_0130044_773_1639 | 274 |
| 707 | 3300049823 | Ga0501044_0000188 | Ga0501044_0000188_71115_71981 | 274 |
| 708 | 3300053156 | Ga0500622_0005115 | Ga0500622_0005115_681_1547 | 274 |
| 709 | 3300000041 | ARcpr5oldR_c005287 | ARcpr5oldR_0052871 | 275 |
| 710 | 3300000044 | ARSoilOldRDRAFT_c004574 | ARSoilOldRDRAFT_0045742 | 275 |
| 711 | 3300000652 | ARCol0yngRDRAFT_1002500 | ARCol0yngRDRAFT_10025002 | 275 |
| 712 | 3300005295 | Ga0065707_10133633 | Ga0065707_101336333 | 275 |
| 713 | 3300005347 | Ga0070668_100045508 | Ga0070668_1000455084 | 275 |
| 714 | 3300005353 | Ga0070669_100191891 | Ga0070669_1001918913 | 275 |
| 715 | 3300005457 | Ga0070662_100100806 | Ga0070662_1001008064 | 275 |
| 716 | 3300006914 | Ga0075436_100004891 | Ga0075436_10000489115 | 275 |
| 717 | 3300009147 | Ga0114129_10064618 | Ga0114129_100646185 | 275 |
| 718 | 3300009176 | Ga0105242_10043876 | Ga0105242_100438764 | 275 |
| 719 | 3300013297 | Ga0157378_10005119 | Ga0157378_1000511916 | 275 |
| 720 | 3300026075 | Ga0207708_10212591 | Ga0207708_102125912 | 275 |
| 721 | 3300031242 | Ga0265329_10030032 | Ga0265329_100300322 | 275 |
| 722 | 3300031247 | Ga0265340_10021103 | Ga0265340_100211035 | 275 |
| 723 | 3300031249 | Ga0265339_10018439 | Ga0265339_1001843910 | 275 |
| 724 | 3300031344 | Ga0265316_10009231 | Ga0265316_100092319 | 275 |
| 725 | 3300031344 | Ga0265316_10078086 | Ga0265316_100780862 | 275 |
| 726 | 3300031344 | Ga0265316_10262348 | Ga0265316_102623482 | 275 |
| 727 | 3300031712 | Ga0265342_10000111 | Ga0265342_1000011163 | 275 |
| 728 | 3300035089 | Ga0373944_0002105 | Ga0373944_0002105_3473_4300 | 275 |
| 729 | 3300035171 | Ga0373946_0012800 | Ga0373946_0012800_1812_2639 | 275 |
| 730 | 3300046472 | Ga0495580_0029203 | Ga0495580_0029203_3118_3945 | 275 |
| 731 | 3300046525 | Ga0495663_0093480 | Ga0495663_0093480_130_957 | 275 |
| 732 | 3300046684 | Ga0495669_0015190 | Ga0495669_0015190_2407_3234 | 275 |
| 733 | 3300047319 | Ga0495674_0234203 | Ga0495674_0234203_205_1032 | 275 |
| 734 | 3300050507 | nmdc:mga05p37_43946_c1 | nmdc:mga05p37_43946_c1_2117_2944 | 275 |
| 735 | 3300050511 | nmdc:mga08y16_7477_c1 | nmdc:mga08y16_7477_c1_1705_2532 | 275 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1c04-assembly1.cif.gz_A | identification of known protein and rna structures in a 5 a map of the large ribosomal subunit from haloarcula marismortui | 0.9508 | 62 | 192 |
| 1c04-assembly1.cif.gz_A | identification of known protein and rna structures in a 5 a map of the large ribosomal subunit from haloarcula marismortui | 0.9168 | 62 | 192 |
| 8c91-assembly1.cif.gz_C | cryo-em captures early ribosome assembly in action | 0.9131 | 20 | 198 |
| 4ce4-assembly1.cif.gz_D | 39s large subunit of the porcine mitochondrial ribosome | 0.9047 | 33 | 220 |
| 8c91-assembly1.cif.gz_C | cryo-em captures early ribosome assembly in action | 0.9019 | 20 | 198 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q6R9C6_19_86_2.30.30.30 | Mainly Beta;Roll;SH3 type barrels.; | 0.9913 | 132 | 195 | 2.30.30.30 |
| 1rl2B01 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.9774 | 62 | 113 | 2.40.50.140 |
| af_Q23888_102_178_2.30.30.30 | Mainly Beta;Roll;SH3 type barrels.; | 0.9733 | 124 | 194 | 2.30.30.30 |
| af_Q25807_101_178_2.30.30.30 | Mainly Beta;Roll;SH3 type barrels.; | 0.9664 | 124 | 192 | 2.30.30.30 |
| af_E7F8R3_156_236_2.30.30.30 | Mainly Beta;Roll;SH3 type barrels.; | 0.966 | 123 | 194 | 2.30.30.30 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-E0Z4E7-F1-model_v4 | 50S ribosomal protein L2 | 0.954 | 33 | 198 |
GO:0002181
GO:0003723 GO:0003735 GO:0015934 GO:0016740 |
| AF-X1NK91-F1-model_v4 | Large ribosomal subunit protein uL2 C-terminal domain-containing protein | 0.9485 | 20 | 195 |
GO:0002181
GO:0003723 GO:0003735 GO:0015934 GO:0016740 |
| AF-A0A1Q9ER84-F1-model_v4 | 50S ribosomal protein L2 | 0.945 | 24 | 206 |
GO:0003723
GO:0003735 GO:0005762 GO:0016740 GO:0032543 |
| AF-A0A2M7TJ93-F1-model_v4 | 50S ribosomal protein L2 | 0.9392 | 33 | 152 |
GO:0002181
GO:0003723 GO:0003735 GO:0015934 GO:0016740 |
| AF-A0A350QRB4-F1-model_v4 | 50S ribosomal protein L2 | 0.9383 | 44 | 208 |
GO:0003723
GO:0003735 GO:0006412 GO:0015934 GO:0016740 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar