F478105
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 733 | 362 | 733 | 163 |
Family's Representative Sequence
| Representative Sequence | 3300048918|Ga0496115_0148508|Ga0496115_0148508_921_1505 |
| Length | 194 |
| Sequence | MPKKRHTFTKAGTARAYKRCGPAPRPAQPEDKMLEFHVGDKAVYPAQGVAEVVGIDAKEISGTVHKFYVLRVLDSDMRILVPIDKAEQVGLREVAKEDQIKEVYDILKEKELHIDKQTWNRRYRGFMEKIKTGSLFEVAEVFRDLYRLKNQKTLSFGERRMLDTAKNLIVKELSVAKNTTEAKVEKDLEKIFSC |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300002868 | Avena fatua rhizosphere microbial communities - H2_Bulk_Litter_10 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 2 | 3300002870 | Avena fatua rhizosphere microbial communities - H1_Bulk_Litter_6 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 3 | 3300003162 | Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 4 | 3300003163 | Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 5 | 3300003300 | Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_1 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 6 | 3300003305 | Avena fatua rhizosphere microbial communities - H3_Rhizo_Litter_13 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 7 | 3300003308 | Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 8 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 9 | 3300003544 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 10 | 3300003693 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 11 | 3300003735 | Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_23 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 12 | 3300004785 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-1 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 13 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 14 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 15 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 16 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 17 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 18 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 19 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 20 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 24 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 27 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 28 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 30 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 31 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 40 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 54 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 55 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 60 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 61 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 62 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 64 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 69 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 70 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 72 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 73 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 75 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 76 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 77 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 78 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 79 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 80 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 81 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 82 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 84 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 85 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 86 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 87 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 88 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 89 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 90 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 92 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 93 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 117 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 118 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 119 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 120 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 121 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 122 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 123 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 124 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 175 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 179 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 180 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 181 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 182 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 183 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 184 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 185 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 186 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 187 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 188 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 189 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 190 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 191 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 192 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 193 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 194 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 195 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 196 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 197 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 198 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 199 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 200 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 201 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 202 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 203 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 204 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 205 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 206 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 207 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 208 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 209 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 210 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 211 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 212 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 213 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 214 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 215 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 216 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 217 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 218 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 219 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 220 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 221 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 222 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 223 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 224 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 225 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 226 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 227 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 228 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 229 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 230 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 231 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 232 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 233 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 234 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 235 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 236 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 237 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 238 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 239 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 240 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 241 | 3300041446 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaT | Metatranscriptome | Rhizoplane |
| 242 | 3300041455 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaT | Metatranscriptome | Rhizoplane |
| 243 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 244 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 245 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 246 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 247 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 248 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 249 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 250 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 251 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 252 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 253 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 254 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 255 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 275 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 276 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 277 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 278 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 279 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 280 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 281 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 282 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 283 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 284 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 285 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 286 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 287 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 288 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 289 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 290 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 291 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 292 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 293 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 294 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 295 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 296 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 297 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 298 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 299 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 300 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 301 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 302 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 303 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 304 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 305 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 306 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 307 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 308 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 309 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 310 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 311 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 312 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 313 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 314 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 315 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 316 | 3300049667 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control | Metagenome | Rhizosphere |
| 317 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 318 | 3300049706 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control | Metagenome | Rhizosphere |
| 319 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 320 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 321 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 322 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 323 | 3300049764 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control | Metagenome | Rhizosphere |
| 324 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 325 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 326 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 327 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 328 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 329 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 330 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 331 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 332 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 333 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 336 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 337 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 338 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 339 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 340 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 341 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 342 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 343 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 344 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 345 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 346 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 347 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 348 | 3300053144 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 endosphere | Metagenome | Endosphere |
| 349 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 350 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 351 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 352 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 353 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 354 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 355 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 356 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 357 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 358 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 359 | 3300059512 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 360 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 361 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 362 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.18 |
| Metatranscriptomes | 6.82 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.68 |
| Nodule | 0 |
| Rhizoplane | 3.68 |
| Rhizosphere | 87.59 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.05 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0006767J43181_103406 | 3300002868 | Bacteria | 753 |
| 2 | Ga0006763J43179_104556 | 3300002870 | Bacteria | 735 |
| 3 | Ga0006778J45830_1019747 | 3300003162 | Bacteria | 927 |
| 4 | Ga0006759J45824_1009006 | 3300003163 | Bacteria | 3640 |
| 5 | Ga0006758J48902_1010140 | 3300003300 | Bacteria | 742 |
| 6 | Ga0006770J48903_1020700 | 3300003305 | Bacteria | 681 |
| 7 | Ga0006777J48905_1063988 | 3300003308 | Bacteria | 921 |
| 8 | rootH1_10017798 | 3300003323 | Bacteria | 8997 |
| 9 | Ga0007417J51691_1062475 | 3300003544 | Bacteria | 735 |
| 10 | Ga0032354_1024924 | 3300003693 | Bacteria | 3788 |
| 11 | Ga0006780_1012978 | 3300003735 | Bacteria | 794 |
| 12 | Ga0058858_1001068 | 3300004785 | Bacteria | 609 |
| 13 | Ga0058859_10037633 | 3300004798 | Bacteria | 789 |
| 14 | Ga0058859_10058200 | 3300004798 | Bacteria | 723 |
| 15 | Ga0058859_11799976 | 3300004798 | Bacteria | 892 |
| 16 | Ga0058859_11807595 | 3300004798 | Unclassified | 897 |
| 17 | Ga0058863_11731370 | 3300004799 | Unclassified | 917 |
| 18 | Ga0058863_11858214 | 3300004799 | Bacteria | 580 |
| 19 | Ga0058863_11948672 | 3300004799 | Bacteria | 742 |
| 20 | Ga0058861_10028637 | 3300004800 | Bacteria | 781 |
| 21 | Ga0058861_10044879 | 3300004800 | Bacteria | 750 |
| 22 | Ga0058861_10072934 | 3300004800 | Bacteria | 676 |
| 23 | Ga0058861_11912080 | 3300004800 | Bacteria | 634 |
| 24 | Ga0058860_10120307 | 3300004801 | Bacteria | 812 |
| 25 | Ga0058860_12053824 | 3300004801 | Bacteria | 621 |
| 26 | Ga0058860_12103954 | 3300004801 | Bacteria | 911 |
| 27 | Ga0058860_12209524 | 3300004801 | Bacteria | 773 |
| 28 | Ga0058862_10089401 | 3300004803 | Bacteria | 691 |
| 29 | Ga0058862_12606125 | 3300004803 | Bacteria | 619 |
| 30 | Ga0058862_12795608 | 3300004803 | Bacteria | 807 |
| 31 | Ga0058862_12802071 | 3300004803 | Unclassified | 594 |
| 32 | Ga0065712_10235307 | 3300005290 | Bacteria | 993 |
| 33 | Ga0065715_10446724 | 3300005293 | Unclassified | 830 |
| 34 | Ga0070658_10005201 | 3300005327 | Bacteria | 10587 |
| 35 | Ga0070658_10039648 | 3300005327 | Bacteria | 3799 |
| 36 | Ga0070658_10151981 | 3300005327 | Bacteria | 1939 |
| 37 | Ga0070676_10010598 | 3300005328 | Bacteria | 5001 |
| 38 | Ga0070683_100007795 | 3300005329 | Bacteria | 9067 |
| 39 | Ga0070683_100095265 | 3300005329 | Bacteria | 2799 |
| 40 | Ga0070683_100145389 | 3300005329 | Bacteria | 2246 |
| 41 | Ga0070683_100245232 | 3300005329 | Bacteria | 1704 |
| 42 | Ga0070683_100486418 | 3300005329 | Unclassified | 1178 |
| 43 | Ga0070683_101498062 | 3300005329 | Bacteria | 648 |
| 44 | Ga0070690_100005437 | 3300005330 | Bacteria | 7157 |
| 45 | Ga0070690_100018706 | 3300005330 | Bacteria | 4189 |
| 46 | Ga0070690_100071796 | 3300005330 | Bacteria | 2249 |
| 47 | Ga0070690_100210387 | 3300005330 | Bacteria | 1358 |
| 48 | Ga0070670_100249953 | 3300005331 | Bacteria | 1545 |
| 49 | Ga0070670_100336200 | 3300005331 | Bacteria | 1325 |
| 50 | Ga0070677_10155161 | 3300005333 | Bacteria | 1069 |
| 51 | Ga0068869_100086742 | 3300005334 | Unclassified | 2347 |
| 52 | Ga0068869_100184302 | 3300005334 | Bacteria | 1638 |
| 53 | Ga0068869_100219777 | 3300005334 | Bacteria | 1505 |
| 54 | Ga0068869_100862082 | 3300005334 | Bacteria | 782 |
| 55 | Ga0068869_101075749 | 3300005334 | Bacteria | 703 |
| 56 | Ga0070680_100119345 | 3300005336 | Bacteria | 2200 |
| 57 | Ga0070680_100230372 | 3300005336 | Bacteria | 1564 |
| 58 | Ga0070680_101040631 | 3300005336 | Bacteria | 707 |
| 59 | Ga0070682_100004298 | 3300005337 | Bacteria | 7911 |
| 60 | Ga0070682_100171913 | 3300005337 | Bacteria | 1507 |
| 61 | Ga0070682_100429614 | 3300005337 | Bacteria | 1006 |
| 62 | Ga0070682_100779355 | 3300005337 | Bacteria | 775 |
| 63 | Ga0068868_100127115 | 3300005338 | Unclassified | 2083 |
| 64 | Ga0068868_100146484 | 3300005338 | Bacteria | 1942 |
| 65 | Ga0068868_100270410 | 3300005338 | Bacteria | 1436 |
| 66 | Ga0070689_100000014 | 3300005340 | Bacteria | 185640 |
| 67 | Ga0070689_100037336 | 3300005340 | Bacteria | 3714 |
| 68 | Ga0070689_100046691 | 3300005340 | Bacteria | 3338 |
| 69 | Ga0070689_100092152 | 3300005340 | Bacteria | 2390 |
| 70 | Ga0070689_100286957 | 3300005340 | Unclassified | 1367 |
| 71 | Ga0070689_100490444 | 3300005340 | Bacteria | 1051 |
| 72 | Ga0070689_100537387 | 3300005340 | Bacteria | 1006 |
| 73 | Ga0070687_100000637 | 3300005343 | Bacteria | 11614 |
| 74 | Ga0070687_100149715 | 3300005343 | Bacteria | 1368 |
| 75 | Ga0070692_10171243 | 3300005345 | Bacteria | 1252 |
| 76 | Ga0070692_10213450 | 3300005345 | Bacteria | 1137 |
| 77 | Ga0070692_10905992 | 3300005345 | Bacteria | 610 |
| 78 | Ga0070668_100011396 | 3300005347 | Bacteria | 6624 |
| 79 | Ga0070669_100022080 | 3300005353 | Bacteria | 4552 |
| 80 | Ga0070675_100069692 | 3300005354 | Bacteria | 2914 |
| 81 | Ga0070675_100142301 | 3300005354 | Bacteria | 2051 |
| 82 | Ga0070671_101093360 | 3300005355 | Unclassified | 700 |
| 83 | Ga0070674_100078018 | 3300005356 | Bacteria | 2360 |
| 84 | Ga0070674_100235237 | 3300005356 | Bacteria | 1432 |
| 85 | Ga0070673_100000555 | 3300005364 | Bacteria | 20114 |
| 86 | Ga0070673_100034675 | 3300005364 | Bacteria | 3821 |
| 87 | Ga0070673_100161161 | 3300005364 | Bacteria | 1908 |
| 88 | Ga0070673_100212906 | 3300005364 | Bacteria | 1670 |
| 89 | Ga0070673_101872717 | 3300005364 | Unclassified | 569 |
| 90 | Ga0070688_100031115 | 3300005365 | Bacteria | 3208 |
| 91 | Ga0070688_100204884 | 3300005365 | Bacteria | 1382 |
| 92 | Ga0070688_100206470 | 3300005365 | Unclassified | 1377 |
| 93 | Ga0070688_100375360 | 3300005365 | Bacteria | 1047 |
| 94 | Ga0070659_100358206 | 3300005366 | Bacteria | 1225 |
| 95 | Ga0070667_100397437 | 3300005367 | Bacteria | 1254 |
| 96 | Ga0070667_100562141 | 3300005367 | Bacteria | 1049 |
| 97 | Ga0070709_10343786 | 3300005434 | Unclassified | 1101 |
| 98 | Ga0070714_101194858 | 3300005435 | Bacteria | 742 |
| 99 | Ga0070713_100308105 | 3300005436 | Bacteria | 1460 |
| 100 | Ga0070713_100455194 | 3300005436 | Unclassified | 1202 |
| 101 | Ga0070710_10107256 | 3300005437 | Unclassified | 1673 |
| 102 | Ga0070710_10313822 | 3300005437 | Unclassified | 1027 |
| 103 | Ga0070701_10012877 | 3300005438 | Bacteria | 3787 |
| 104 | Ga0070701_10233544 | 3300005438 | Unclassified | 1103 |
| 105 | Ga0070701_10248081 | 3300005438 | Bacteria | 1074 |
| 106 | Ga0070711_100251259 | 3300005439 | Unclassified | 1387 |
| 107 | Ga0070705_100064679 | 3300005440 | Bacteria | 2186 |
| 108 | Ga0070705_100458562 | 3300005440 | Bacteria | 958 |
| 109 | Ga0070705_100505838 | 3300005440 | Bacteria | 918 |
| 110 | Ga0070700_100056685 | 3300005441 | Bacteria | 2457 |
| 111 | Ga0070700_101081596 | 3300005441 | Bacteria | 664 |
| 112 | Ga0070708_100239897 | 3300005445 | Bacteria | 1702 |
| 113 | Ga0070708_100307439 | 3300005445 | Bacteria | 1493 |
| 114 | Ga0070678_100017410 | 3300005456 | Bacteria | 4626 |
| 115 | Ga0070662_100678156 | 3300005457 | Bacteria | 871 |
| 116 | Ga0070681_10039022 | 3300005458 | Bacteria | 4761 |
| 117 | Ga0070681_10089395 | 3300005458 | Bacteria | 3032 |
| 118 | Ga0070681_10255727 | 3300005458 | Bacteria | 1664 |
| 119 | Ga0070681_10374590 | 3300005458 | Bacteria | 1334 |
| 120 | Ga0070681_10687205 | 3300005458 | Unclassified | 939 |
| 121 | Ga0068867_100036835 | 3300005459 | Bacteria | 3553 |
| 122 | Ga0068867_100644592 | 3300005459 | Bacteria | 929 |
| 123 | Ga0070685_10036407 | 3300005466 | Unclassified | 2782 |
| 124 | Ga0070685_10405878 | 3300005466 | Bacteria | 945 |
| 125 | Ga0070685_10446920 | 3300005466 | Bacteria | 905 |
| 126 | Ga0070685_10535699 | 3300005466 | Unclassified | 834 |
| 127 | Ga0070706_100044331 | 3300005467 | Bacteria | 4109 |
| 128 | Ga0070706_100053704 | 3300005467 | Bacteria | 3719 |
| 129 | Ga0070706_100502678 | 3300005467 | Bacteria | 1128 |
| 130 | Ga0070706_101069847 | 3300005467 | Unclassified | 743 |
| 131 | Ga0070706_101164673 | 3300005467 | Bacteria | 709 |
| 132 | Ga0070698_100001555 | 3300005471 | Bacteria | 25472 |
| 133 | Ga0070698_100031473 | 3300005471 | Bacteria | 5501 |
| 134 | Ga0070698_100378060 | 3300005471 | Bacteria | 1349 |
| 135 | Ga0070699_100130956 | 3300005518 | Bacteria | 2211 |
| 136 | Ga0070679_100024718 | 3300005530 | Bacteria | 5887 |
| 137 | Ga0070679_100046846 | 3300005530 | Bacteria | 4310 |
| 138 | Ga0070679_100123082 | 3300005530 | Bacteria | 2577 |
| 139 | Ga0070684_100020180 | 3300005535 | Bacteria | 5529 |
| 140 | Ga0070684_100126031 | 3300005535 | Bacteria | 2307 |
| 141 | Ga0070684_100310446 | 3300005535 | Bacteria | 1448 |
| 142 | Ga0070684_100311799 | 3300005535 | Bacteria | 1445 |
| 143 | Ga0070684_100394316 | 3300005535 | Unclassified | 1276 |
| 144 | Ga0070684_100665791 | 3300005535 | Bacteria | 969 |
| 145 | Ga0068853_100868153 | 3300005539 | Bacteria | 866 |
| 146 | Ga0070672_100021741 | 3300005543 | Bacteria | 4698 |
| 147 | Ga0070672_100120858 | 3300005543 | Unclassified | 2144 |
| 148 | Ga0070686_100102762 | 3300005544 | Bacteria | 1933 |
| 149 | Ga0070686_100179626 | 3300005544 | Bacteria | 1503 |
| 150 | Ga0070695_100794347 | 3300005545 | Unclassified | 758 |
| 151 | Ga0070696_100572343 | 3300005546 | Bacteria | 908 |
| 152 | Ga0070693_100431066 | 3300005547 | Unclassified | 921 |
| 153 | Ga0070665_100017791 | 3300005548 | Bacteria | 7135 |
| 154 | Ga0070665_100553430 | 3300005548 | Unclassified | 1163 |
| 155 | Ga0070665_100737658 | 3300005548 | Unclassified | 998 |
| 156 | Ga0070665_100899637 | 3300005548 | Bacteria | 898 |
| 157 | Ga0070665_101056925 | 3300005548 | Bacteria | 824 |
| 158 | Ga0070704_100280151 | 3300005549 | Bacteria | 1381 |
| 159 | Ga0070704_100436241 | 3300005549 | Bacteria | 1125 |
| 160 | Ga0068855_100022861 | 3300005563 | Bacteria | 7494 |
| 161 | Ga0068855_100377664 | 3300005563 | Bacteria | 1557 |
| 162 | Ga0068855_101414345 | 3300005563 | Bacteria | 716 |
| 163 | Ga0070664_100335725 | 3300005564 | Bacteria | 1372 |
| 164 | Ga0070664_101359286 | 3300005564 | Bacteria | 671 |
| 165 | Ga0068857_100210635 | 3300005577 | Bacteria | 1773 |
| 166 | Ga0068857_100983401 | 3300005577 | Bacteria | 812 |
| 167 | Ga0068856_100033363 | 3300005614 | Bacteria | 5040 |
| 168 | Ga0068856_100124689 | 3300005614 | Bacteria | 2579 |
| 169 | Ga0068856_100138125 | 3300005614 | Bacteria | 2443 |
| 170 | Ga0068856_100619911 | 3300005614 | Bacteria | 1103 |
| 171 | Ga0068856_100732906 | 3300005614 | Bacteria | 1009 |
| 172 | Ga0070702_100030529 | 3300005615 | Bacteria | 2939 |
| 173 | Ga0070702_100842071 | 3300005615 | Unclassified | 713 |
| 174 | Ga0068852_100327667 | 3300005616 | Bacteria | 1489 |
| 175 | Ga0068859_100175781 | 3300005617 | Bacteria | 2223 |
| 176 | Ga0068864_100189684 | 3300005618 | Bacteria | 1884 |
| 177 | Ga0068861_100181385 | 3300005719 | Unclassified | 1753 |
| 178 | Ga0068861_100288465 | 3300005719 | Unclassified | 1416 |
| 179 | Ga0068863_100060378 | 3300005841 | Bacteria | 3586 |
| 180 | Ga0068863_100060693 | 3300005841 | Bacteria | 3576 |
| 181 | Ga0068863_101108776 | 3300005841 | Bacteria | 796 |
| 182 | Ga0068858_101460560 | 3300005842 | Bacteria | 674 |
| 183 | Ga0068860_101010563 | 3300005843 | Bacteria | 850 |
| 184 | Ga0068860_101181934 | 3300005843 | Unclassified | 785 |
| 185 | Ga0068862_100051189 | 3300005844 | Bacteria | 3531 |
| 186 | Ga0068862_100986125 | 3300005844 | Bacteria | 833 |
| 187 | Ga0097621_100269462 | 3300006237 | Bacteria | 1496 |
| 188 | Ga0068871_100186909 | 3300006358 | Bacteria | 1783 |
| 189 | Ga0068871_100236550 | 3300006358 | Bacteria | 1587 |
| 190 | Ga0068871_100378155 | 3300006358 | Bacteria | 1258 |
| 191 | Ga0068871_100432700 | 3300006358 | Bacteria | 1177 |
| 192 | Ga0075428_100099931 | 3300006844 | Bacteria | 3164 |
| 193 | Ga0075428_100409091 | 3300006844 | Bacteria | 1454 |
| 194 | Ga0075428_100496197 | 3300006844 | Bacteria | 1306 |
| 195 | Ga0075428_101993830 | 3300006844 | Unclassified | 602 |
| 196 | Ga0075428_102148790 | 3300006844 | Bacteria | 577 |
| 197 | Ga0075430_100468418 | 3300006846 | Bacteria | 1040 |
| 198 | Ga0075430_100604573 | 3300006846 | Bacteria | 905 |
| 199 | Ga0075430_101005690 | 3300006846 | Bacteria | 687 |
| 200 | Ga0075431_100673859 | 3300006847 | Bacteria | 1013 |
| 201 | Ga0075434_101269391 | 3300006871 | Bacteria | 748 |
| 202 | Ga0075429_100016106 | 3300006880 | Bacteria | 6476 |
| 203 | Ga0075429_100025611 | 3300006880 | Bacteria | 5120 |
| 204 | Ga0075429_100120669 | 3300006880 | Bacteria | 2292 |
| 205 | Ga0068865_100021367 | 3300006881 | Bacteria | 4207 |
| 206 | Ga0097620_100175774 | 3300006931 | Bacteria | 2223 |
| 207 | Ga0075435_100052581 | 3300007076 | Bacteria | 3282 |
| 208 | Ga0075435_100251661 | 3300007076 | Unclassified | 1504 |
| 209 | Ga0099795_10026665 | 3300007788 | Unclassified | 1948 |
| 210 | Ga0105250_10249548 | 3300009092 | Bacteria | 758 |
| 211 | Ga0105240_10000261 | 3300009093 | Bacteria | 104567 |
| 212 | Ga0105240_10056624 | 3300009093 | Unclassified | 4905 |
| 213 | Ga0105240_10413916 | 3300009093 | Bacteria | 1516 |
| 214 | Ga0105240_10567824 | 3300009093 | Bacteria | 1253 |
| 215 | Ga0105240_10674777 | 3300009093 | Bacteria | 1130 |
| 216 | Ga0111539_10010727 | 3300009094 | Bacteria | 11532 |
| 217 | Ga0111539_10027557 | 3300009094 | Bacteria | 6940 |
| 218 | Ga0111539_11247359 | 3300009094 | Bacteria | 863 |
| 219 | Ga0111539_11710388 | 3300009094 | Bacteria | 729 |
| 220 | Ga0105245_10000149 | 3300009098 | Bacteria | 66131 |
| 221 | Ga0105245_10386618 | 3300009098 | Bacteria | 1395 |
| 222 | Ga0105245_10833426 | 3300009098 | Bacteria | 962 |
| 223 | Ga0114129_10911327 | 3300009147 | Unclassified | 1113 |
| 224 | Ga0114129_12832497 | 3300009147 | Bacteria | 575 |
| 225 | Ga0105243_10266489 | 3300009148 | Bacteria | 1536 |
| 226 | Ga0105243_10288692 | 3300009148 | Bacteria | 1481 |
| 227 | Ga0105241_11624293 | 3300009174 | Bacteria | 626 |
| 228 | Ga0105248_10524001 | 3300009177 | Bacteria | 1336 |
| 229 | Ga0105248_11198455 | 3300009177 | Unclassified | 858 |
| 230 | Ga0105248_11277189 | 3300009177 | Bacteria | 830 |
| 231 | Ga0105248_12154383 | 3300009177 | Bacteria | 634 |
| 232 | Ga0105237_10000062 | 3300009545 | Bacteria | 144236 |
| 233 | Ga0105237_10126013 | 3300009545 | Bacteria | 2555 |
| 234 | Ga0105237_10233412 | 3300009545 | Bacteria | 1841 |
| 235 | Ga0105238_10018097 | 3300009551 | Bacteria | 7164 |
| 236 | Ga0105238_10339966 | 3300009551 | Bacteria | 1489 |
| 237 | Ga0105238_10608562 | 3300009551 | Bacteria | 1101 |
| 238 | Ga0105238_10924681 | 3300009551 | Unclassified | 891 |
| 239 | Ga0105238_11022354 | 3300009551 | Bacteria | 848 |
| 240 | Ga0105238_11134594 | 3300009551 | Bacteria | 805 |
| 241 | Ga0105238_11374055 | 3300009551 | Bacteria | 733 |
| 242 | Ga0105249_10028685 | 3300009553 | Bacteria | 5023 |
| 243 | Ga0105249_10034840 | 3300009553 | Bacteria | 4563 |
| 244 | Ga0105249_10282279 | 3300009553 | Bacteria | 1659 |
| 245 | Ga0105249_11011169 | 3300009553 | Bacteria | 900 |
| 246 | Ga0105239_10149195 | 3300010375 | Bacteria | 2609 |
| 247 | Ga0105239_10446986 | 3300010375 | Unclassified | 1466 |
| 248 | Ga0105239_12347512 | 3300010375 | Bacteria | 621 |
| 249 | Ga0157371_10482225 | 3300013102 | Bacteria | 914 |
| 250 | Ga0157369_10139736 | 3300013105 | Bacteria | 2563 |
| 251 | Ga0157374_10031333 | 3300013296 | Bacteria | 4833 |
| 252 | Ga0157374_10237419 | 3300013296 | Unclassified | 1792 |
| 253 | Ga0157374_10321406 | 3300013296 | Bacteria | 1533 |
| 254 | Ga0157374_10500330 | 3300013296 | Bacteria | 1220 |
| 255 | Ga0157374_10614906 | 3300013296 | Bacteria | 1097 |
| 256 | Ga0157374_10878055 | 3300013296 | Bacteria | 914 |
| 257 | Ga0157378_10092416 | 3300013297 | Bacteria | 2753 |
| 258 | Ga0157378_10094569 | 3300013297 | Bacteria | 2721 |
| 259 | Ga0157378_10127395 | 3300013297 | Bacteria | 2353 |
| 260 | Ga0157378_10299314 | 3300013297 | Bacteria | 1556 |
| 261 | Ga0157378_10371988 | 3300013297 | Bacteria | 1401 |
| 262 | Ga0163162_10481773 | 3300013306 | Bacteria | 1372 |
| 263 | Ga0163162_11418384 | 3300013306 | Bacteria | 790 |
| 264 | Ga0163162_12230965 | 3300013306 | Bacteria | 629 |
| 265 | Ga0157372_10419594 | 3300013307 | Bacteria | 1559 |
| 266 | Ga0157372_11228119 | 3300013307 | Bacteria | 866 |
| 267 | Ga0157372_11954574 | 3300013307 | Bacteria | 674 |
| 268 | Ga0157375_10521241 | 3300013308 | Bacteria | 1352 |
| 269 | Ga0157375_11017422 | 3300013308 | Bacteria | 968 |
| 270 | Ga0163163_10247634 | 3300014325 | Bacteria | 1832 |
| 271 | Ga0163163_10266392 | 3300014325 | Bacteria | 1764 |
| 272 | Ga0157380_10191869 | 3300014326 | Bacteria | 1805 |
| 273 | Ga0157380_10969772 | 3300014326 | Bacteria | 881 |
| 274 | Ga0157377_10306998 | 3300014745 | Bacteria | 1049 |
| 275 | Ga0157376_10150460 | 3300014969 | Bacteria | 2098 |
| 276 | Ga0157376_10352311 | 3300014969 | Bacteria | 1409 |
| 277 | Ga0157376_10585612 | 3300014969 | Unclassified | 1108 |
| 278 | Ga0157376_10970374 | 3300014969 | Unclassified | 871 |
| 279 | Ga0157376_12122341 | 3300014969 | Unclassified | 600 |
| 280 | Ga0206356_10416233 | 3300020070 | Unclassified | 796 |
| 281 | Ga0206352_10930255 | 3300020078 | Bacteria | 527 |
| 282 | Ga0206352_11231561 | 3300020078 | Bacteria | 565 |
| 283 | Ga0206352_11250444 | 3300020078 | Unclassified | 638 |
| 284 | Ga0206350_11425950 | 3300020080 | Unclassified | 554 |
| 285 | Ga0206353_10934020 | 3300020082 | Bacteria | 558 |
| 286 | Ga0206353_11912490 | 3300020082 | Bacteria | 920 |
| 287 | Ga0206353_12007426 | 3300020082 | Bacteria | 574 |
| 288 | Ga0213872_10091065 | 3300021361 | Bacteria | 1365 |
| 289 | Ga0213874_10099193 | 3300021377 | Bacteria | 966 |
| 290 | Ga0213876_10103309 | 3300021384 | Bacteria | 1511 |
| 291 | Ga0213876_10264700 | 3300021384 | Bacteria | 914 |
| 292 | Ga0224712_10362701 | 3300022467 | Bacteria | 686 |
| 293 | Ga0207697_10065641 | 3300025315 | Bacteria | 1515 |
| 294 | Ga0207653_10072387 | 3300025885 | Bacteria | 1180 |
| 295 | Ga0207692_10085877 | 3300025898 | Unclassified | 1694 |
| 296 | Ga0207688_10081808 | 3300025901 | Bacteria | 1845 |
| 297 | Ga0207699_10311250 | 3300025906 | Unclassified | 1102 |
| 298 | Ga0207645_10003612 | 3300025907 | Bacteria | 11702 |
| 299 | Ga0207705_10018431 | 3300025909 | Bacteria | 4992 |
| 300 | Ga0207705_10040703 | 3300025909 | Bacteria | 3334 |
| 301 | Ga0207705_10353530 | 3300025909 | Bacteria | 1132 |
| 302 | Ga0207684_10040963 | 3300025910 | Bacteria | 3928 |
| 303 | Ga0207707_10335988 | 3300025912 | Unclassified | 1303 |
| 304 | Ga0207707_10600145 | 3300025912 | Unclassified | 932 |
| 305 | Ga0207707_10690862 | 3300025912 | Unclassified | 857 |
| 306 | Ga0207695_10001635 | 3300025913 | Bacteria | 36218 |
| 307 | Ga0207695_10161010 | 3300025913 | Bacteria | 2176 |
| 308 | Ga0207695_10286807 | 3300025913 | Bacteria | 1539 |
| 309 | Ga0207671_10000140 | 3300025914 | Bacteria | 111643 |
| 310 | Ga0207671_10081202 | 3300025914 | Bacteria | 2431 |
| 311 | Ga0207671_10260767 | 3300025914 | Bacteria | 1364 |
| 312 | Ga0207671_10928554 | 3300025914 | Bacteria | 687 |
| 313 | Ga0207693_10165904 | 3300025915 | Bacteria | 1738 |
| 314 | Ga0207660_10052199 | 3300025917 | Bacteria | 2910 |
| 315 | Ga0207660_10215820 | 3300025917 | Bacteria | 1504 |
| 316 | Ga0207660_10399731 | 3300025917 | Bacteria | 1106 |
| 317 | Ga0207662_10001434 | 3300025918 | Bacteria | 11559 |
| 318 | Ga0207662_10019856 | 3300025918 | Bacteria | 3829 |
| 319 | Ga0207662_10022717 | 3300025918 | Bacteria | 3599 |
| 320 | Ga0207662_10336348 | 3300025918 | Bacteria | 1011 |
| 321 | Ga0207662_10426201 | 3300025918 | Unclassified | 903 |
| 322 | Ga0207652_10002792 | 3300025921 | Bacteria | 14648 |
| 323 | Ga0207652_10006188 | 3300025921 | Bacteria | 9670 |
| 324 | Ga0207652_10013232 | 3300025921 | Bacteria | 6683 |
| 325 | Ga0207652_10020065 | 3300025921 | Bacteria | 5504 |
| 326 | Ga0207652_10046132 | 3300025921 | Bacteria | 3717 |
| 327 | Ga0207652_10085864 | 3300025921 | Bacteria | 2758 |
| 328 | Ga0207652_10089290 | 3300025921 | Bacteria | 2706 |
| 329 | Ga0207681_10019671 | 3300025923 | Bacteria | 4269 |
| 330 | Ga0207694_10301344 | 3300025924 | Bacteria | 1320 |
| 331 | Ga0207694_10697357 | 3300025924 | Unclassified | 856 |
| 332 | Ga0207694_10874358 | 3300025924 | Unclassified | 760 |
| 333 | Ga0207694_10889563 | 3300025924 | Bacteria | 753 |
| 334 | Ga0207650_10202670 | 3300025925 | Bacteria | 1590 |
| 335 | Ga0207650_10295477 | 3300025925 | Unclassified | 1322 |
| 336 | Ga0207650_10625559 | 3300025925 | Bacteria | 906 |
| 337 | Ga0207659_10051985 | 3300025926 | Bacteria | 2917 |
| 338 | Ga0207659_10082026 | 3300025926 | Bacteria | 2386 |
| 339 | Ga0207659_10505329 | 3300025926 | Bacteria | 1024 |
| 340 | Ga0207659_10915494 | 3300025926 | Bacteria | 754 |
| 341 | Ga0207687_10000526 | 3300025927 | Bacteria | 25654 |
| 342 | Ga0207687_10175271 | 3300025927 | Unclassified | 1657 |
| 343 | Ga0207687_10184076 | 3300025927 | Bacteria | 1620 |
| 344 | Ga0207687_10316616 | 3300025927 | Bacteria | 1262 |
| 345 | Ga0207700_10419432 | 3300025928 | Unclassified | 1175 |
| 346 | Ga0207690_10336023 | 3300025932 | Bacteria | 1191 |
| 347 | Ga0207706_10074130 | 3300025933 | Bacteria | 2993 |
| 348 | Ga0207686_10455862 | 3300025934 | Bacteria | 984 |
| 349 | Ga0207709_10131077 | 3300025935 | Bacteria | 1709 |
| 350 | Ga0207709_10175998 | 3300025935 | Bacteria | 1506 |
| 351 | Ga0207670_10000003 | 3300025936 | Bacteria | 760449 |
| 352 | Ga0207670_10002754 | 3300025936 | Bacteria | 9256 |
| 353 | Ga0207670_10013353 | 3300025936 | Bacteria | 4839 |
| 354 | Ga0207670_10024078 | 3300025936 | Bacteria | 3801 |
| 355 | Ga0207670_10030666 | 3300025936 | Bacteria | 3436 |
| 356 | Ga0207670_10076250 | 3300025936 | Bacteria | 2333 |
| 357 | Ga0207670_10709534 | 3300025936 | Unclassified | 833 |
| 358 | Ga0207704_10009349 | 3300025938 | Bacteria | 4726 |
| 359 | Ga0207704_10012288 | 3300025938 | Bacteria | 4248 |
| 360 | Ga0207691_10120325 | 3300025940 | Unclassified | 2328 |
| 361 | Ga0207711_10369105 | 3300025941 | Bacteria | 1331 |
| 362 | Ga0207689_10459039 | 3300025942 | Bacteria | 1065 |
| 363 | Ga0207661_10035952 | 3300025944 | Bacteria | 3863 |
| 364 | Ga0207661_10241825 | 3300025944 | Bacteria | 1602 |
| 365 | Ga0207661_10701172 | 3300025944 | Bacteria | 931 |
| 366 | Ga0207661_11205822 | 3300025944 | Bacteria | 696 |
| 367 | Ga0207661_11727273 | 3300025944 | Bacteria | 571 |
| 368 | Ga0207679_10809071 | 3300025945 | Bacteria | 855 |
| 369 | Ga0207667_10049364 | 3300025949 | Bacteria | 4444 |
| 370 | Ga0207667_10433651 | 3300025949 | Bacteria | 1336 |
| 371 | Ga0207651_10001985 | 3300025960 | Bacteria | 9618 |
| 372 | Ga0207651_10060180 | 3300025960 | Bacteria | 2635 |
| 373 | Ga0207651_10564354 | 3300025960 | Bacteria | 991 |
| 374 | Ga0207712_10117111 | 3300025961 | Bacteria | 2009 |
| 375 | Ga0207712_10204728 | 3300025961 | Bacteria | 1567 |
| 376 | Ga0207712_10992524 | 3300025961 | Bacteria | 745 |
| 377 | Ga0207668_10107941 | 3300025972 | Bacteria | 2082 |
| 378 | Ga0207640_10950790 | 3300025981 | Bacteria | 753 |
| 379 | Ga0207658_10779427 | 3300025986 | Bacteria | 867 |
| 380 | Ga0207658_11678133 | 3300025986 | Bacteria | 580 |
| 381 | Ga0207677_10037003 | 3300026023 | Bacteria | 3186 |
| 382 | Ga0207677_10188314 | 3300026023 | Bacteria | 1630 |
| 383 | Ga0207677_10870869 | 3300026023 | Bacteria | 810 |
| 384 | Ga0207703_10032822 | 3300026035 | Bacteria | 4112 |
| 385 | Ga0207703_10864716 | 3300026035 | Unclassified | 865 |
| 386 | Ga0207703_11396313 | 3300026035 | Bacteria | 674 |
| 387 | Ga0207678_11094763 | 3300026067 | Bacteria | 705 |
| 388 | Ga0207708_10004519 | 3300026075 | Bacteria | 10237 |
| 389 | Ga0207702_10024695 | 3300026078 | Bacteria | 4987 |
| 390 | Ga0207702_10146425 | 3300026078 | Bacteria | 2144 |
| 391 | Ga0207702_10166958 | 3300026078 | Bacteria | 2015 |
| 392 | Ga0207702_10171046 | 3300026078 | Bacteria | 1992 |
| 393 | Ga0207702_10187462 | 3300026078 | Bacteria | 1909 |
| 394 | Ga0207641_10233486 | 3300026088 | Bacteria | 1710 |
| 395 | Ga0207641_11371555 | 3300026088 | Unclassified | 708 |
| 396 | Ga0207648_10052397 | 3300026089 | Bacteria | 3567 |
| 397 | Ga0207676_10121380 | 3300026095 | Bacteria | 2205 |
| 398 | Ga0207676_10192480 | 3300026095 | Bacteria | 1796 |
| 399 | Ga0207676_10960686 | 3300026095 | Bacteria | 840 |
| 400 | Ga0207674_10093047 | 3300026116 | Bacteria | 3004 |
| 401 | Ga0207674_10298608 | 3300026116 | Bacteria | 1560 |
| 402 | Ga0207674_10457219 | 3300026116 | Bacteria | 1234 |
| 403 | Ga0207674_10912614 | 3300026116 | Bacteria | 847 |
| 404 | Ga0207675_100086590 | 3300026118 | Bacteria | 2942 |
| 405 | Ga0207683_10010985 | 3300026121 | Bacteria | 7721 |
| 406 | Ga0207683_10031446 | 3300026121 | Bacteria | 4607 |
| 407 | Ga0207683_10578615 | 3300026121 | Unclassified | 1039 |
| 408 | Ga0207698_10205230 | 3300026142 | Bacteria | 1768 |
| 409 | Ga0207698_10517355 | 3300026142 | Bacteria | 1164 |
| 410 | Ga0207698_10877910 | 3300026142 | Bacteria | 903 |
| 411 | Ga0207428_10031981 | 3300027907 | Bacteria | 4333 |
| 412 | Ga0268266_10017339 | 3300028379 | Bacteria | 6145 |
| 413 | Ga0268266_11013872 | 3300028379 | Unclassified | 803 |
| 414 | Ga0268266_11971810 | 3300028379 | Bacteria | 557 |
| 415 | Ga0268265_10127206 | 3300028380 | Bacteria | 2111 |
| 416 | Ga0268264_10707640 | 3300028381 | Bacteria | 1001 |
| 417 | Ga0265326_10033289 | 3300028558 | Bacteria | 1467 |
| 418 | Ga0265319_1090029 | 3300028563 | Unclassified | 969 |
| 419 | Ga0265319_1118774 | 3300028563 | Bacteria | 825 |
| 420 | Ga0265318_10000110 | 3300028577 | Bacteria | 75921 |
| 421 | Ga0265318_10000678 | 3300028577 | Bacteria | 23115 |
| 422 | Ga0265336_10008055 | 3300028666 | Bacteria | 3715 |
| 423 | Ga0307517_10048705 | 3300028786 | Bacteria | 4354 |
| 424 | Ga0307515_10034085 | 3300028794 | Bacteria | 8355 |
| 425 | Ga0265338_10001473 | 3300028800 | Bacteria | 38143 |
| 426 | Ga0265338_10198104 | 3300028800 | Bacteria | 1516 |
| 427 | Ga0265338_10705035 | 3300028800 | Unclassified | 696 |
| 428 | Ga0265330_10001283 | 3300031235 | Bacteria | 14689 |
| 429 | Ga0265330_10001591 | 3300031235 | Bacteria | 13037 |
| 430 | Ga0265332_10000070 | 3300031238 | Bacteria | 86771 |
| 431 | Ga0265332_10003169 | 3300031238 | Bacteria | 8006 |
| 432 | Ga0265332_10007480 | 3300031238 | Bacteria | 4938 |
| 433 | Ga0265332_10127037 | 3300031238 | Unclassified | 1070 |
| 434 | Ga0265328_10001530 | 3300031239 | Bacteria | 10677 |
| 435 | Ga0265328_10002763 | 3300031239 | Bacteria | 7857 |
| 436 | Ga0265328_10002834 | 3300031239 | Bacteria | 7745 |
| 437 | Ga0265320_10000040 | 3300031240 | Bacteria | 131841 |
| 438 | Ga0265320_10028248 | 3300031240 | Bacteria | 2915 |
| 439 | Ga0265320_10053692 | 3300031240 | Bacteria | 1946 |
| 440 | Ga0265325_10060051 | 3300031241 | Bacteria | 1933 |
| 441 | Ga0265329_10000562 | 3300031242 | Bacteria | 19213 |
| 442 | Ga0265329_10005698 | 3300031242 | Bacteria | 5007 |
| 443 | Ga0265340_10104943 | 3300031247 | Bacteria | 1311 |
| 444 | Ga0265339_10000504 | 3300031249 | Bacteria | 30429 |
| 445 | Ga0265339_10005031 | 3300031249 | Bacteria | 8892 |
| 446 | Ga0265339_10012768 | 3300031249 | Bacteria | 5108 |
| 447 | Ga0265331_10000083 | 3300031250 | Bacteria | 131846 |
| 448 | Ga0265331_10001199 | 3300031250 | Bacteria | 19544 |
| 449 | Ga0265331_10310063 | 3300031250 | Unclassified | 707 |
| 450 | Ga0265316_10000532 | 3300031344 | Bacteria | 42948 |
| 451 | Ga0265316_10007776 | 3300031344 | Bacteria | 10038 |
| 452 | Ga0265316_10073174 | 3300031344 | Bacteria | 2640 |
| 453 | Ga0307513_10003393 | 3300031456 | Bacteria | 21651 |
| 454 | Ga0307509_10000039 | 3300031507 | Bacteria | 185329 |
| 455 | Ga0307509_10007659 | 3300031507 | Bacteria | 14033 |
| 456 | Ga0307509_10035298 | 3300031507 | Bacteria | 5490 |
| 457 | Ga0307509_10248233 | 3300031507 | Bacteria | 1566 |
| 458 | Ga0265313_10001169 | 3300031595 | Bacteria | 25109 |
| 459 | Ga0265313_10012957 | 3300031595 | Bacteria | 5047 |
| 460 | Ga0265313_10023987 | 3300031595 | Bacteria | 3271 |
| 461 | Ga0265313_10034747 | 3300031595 | Bacteria | 2546 |
| 462 | Ga0307508_10013069 | 3300031616 | Bacteria | 7592 |
| 463 | Ga0307508_10066437 | 3300031616 | Bacteria | 3175 |
| 464 | Ga0307508_10262111 | 3300031616 | Bacteria | 1323 |
| 465 | Ga0265314_10000099 | 3300031711 | Bacteria | 131848 |
| 466 | Ga0265314_10002880 | 3300031711 | Bacteria | 17079 |
| 467 | Ga0265314_10006401 | 3300031711 | Bacteria | 10433 |
| 468 | Ga0265314_10115351 | 3300031711 | Bacteria | 1700 |
| 469 | Ga0265314_10281018 | 3300031711 | Bacteria | 942 |
| 470 | Ga0265342_10001302 | 3300031712 | Bacteria | 23407 |
| 471 | Ga0265342_10004892 | 3300031712 | Bacteria | 10376 |
| 472 | Ga0265342_10008352 | 3300031712 | Bacteria | 7435 |
| 473 | Ga0265342_10259405 | 3300031712 | Unclassified | 925 |
| 474 | Ga0316576_10385674 | 3300031727 | Bacteria | 1040 |
| 475 | Ga0316578_10144825 | 3300031728 | Bacteria | 1431 |
| 476 | Ga0316578_10496947 | 3300031728 | Unclassified | 719 |
| 477 | Ga0307516_10075810 | 3300031730 | Bacteria | 3217 |
| 478 | Ga0307516_10267632 | 3300031730 | Bacteria | 1397 |
| 479 | Ga0307410_11300987 | 3300031852 | Bacteria | 636 |
| 480 | Ga0307406_10025561 | 3300031901 | Bacteria | 3536 |
| 481 | Ga0307406_10247327 | 3300031901 | Bacteria | 1341 |
| 482 | Ga0307415_100558722 | 3300032126 | Bacteria | 1011 |
| 483 | Ga0316583_10000564 | 3300032133 | Bacteria | 11232 |
| 484 | Ga0316588_1017041 | 3300033528 | Bacteria | 1616 |
| 485 | Ga0373950_0000007 | 3300034818 | Bacteria | 392070 |
| 486 | Ga0373950_0000025 | 3300034818 | Bacteria | 177524 |
| 487 | Ga0373949_0000089 | 3300035090 | Bacteria | 34401 |
| 488 | Ga0373936_0000051 | 3300035113 | Bacteria | 68197 |
| 489 | Ga0373939_0163340 | 3300035114 | Unclassified | 819 |
| 490 | Ga0373941_0090094 | 3300035115 | Bacteria | 1051 |
| 491 | Ga0373945_0023665 | 3300035116 | Bacteria | 2124 |
| 492 | Ga0373953_0004266 | 3300035117 | Bacteria | 4541 |
| 493 | Ga0373954_0002028 | 3300035118 | Bacteria | 8418 |
| 494 | Ga0373954_0040879 | 3300035118 | Bacteria | 2161 |
| 495 | Ga0373956_0022718 | 3300035119 | Bacteria | 2687 |
| 496 | Ga0373957_0061399 | 3300035120 | Unclassified | 1456 |
| 497 | Ga0373957_0231217 | 3300035120 | Bacteria | 775 |
| 498 | Ga0373943_0023787 | 3300035170 | Bacteria | 2851 |
| 499 | Ga0373943_0097141 | 3300035170 | Unclassified | 1534 |
| 500 | Ga0373943_0626134 | 3300035170 | Unclassified | 635 |
| 501 | Ga0373946_0227509 | 3300035171 | Unclassified | 903 |
| 502 | Ga0373946_0620171 | 3300035171 | Bacteria | 562 |
| 503 | Ga0373955_0009187 | 3300035172 | Bacteria | 4623 |
| 504 | Ga0373955_0140590 | 3300035172 | Bacteria | 1415 |
| 505 | Ga0373955_0316113 | 3300035172 | Bacteria | 943 |
| 506 | Ga0373961_0000224 | 3300035241 | Bacteria | 26575 |
| 507 | Ga0373931_0641585 | 3300035691 | Bacteria | 697 |
| 508 | Ga0373935_0131049 | 3300035692 | Bacteria | 1685 |
| 509 | Ga0373935_1211280 | 3300035692 | Bacteria | 563 |
| 510 | Ga0373933_0009700 | 3300035724 | Bacteria | 5267 |
| 511 | Ga0373933_0028117 | 3300035724 | Bacteria | 3242 |
| 512 | Ga0373933_0149311 | 3300035724 | Bacteria | 1480 |
| 513 | Ga0373947_0206087 | 3300035725 | Bacteria | 1288 |
| 514 | Ga0373947_0572081 | 3300035725 | Bacteria | 770 |
| 515 | Ga0373937_0007030 | 3300036401 | Bacteria | 9714 |
| 516 | Ga0373937_0030878 | 3300036401 | Bacteria | 4852 |
| 517 | Ga0373937_0059205 | 3300036401 | Bacteria | 3520 |
| 518 | Ga0373937_0392005 | 3300036401 | Bacteria | 1317 |
| 519 | Ga0373937_1098140 | 3300036401 | Bacteria | 744 |
| 520 | Ga0316582_0067945 | 3300036647 | Bacteria | 2300 |
| 521 | Ga0316582_0192459 | 3300036647 | Bacteria | 1390 |
| 522 | Ga0373925_0119200 | 3300037068 | Bacteria | 2047 |
| 523 | Ga0395899_0010207 | 3300037312 | Bacteria | 7196 |
| 524 | Ga0395899_0270864 | 3300037312 | Bacteria | 1158 |
| 525 | Ga0395900_0051544 | 3300037418 | Bacteria | 4238 |
| 526 | Ga0395898_0200046 | 3300037466 | Bacteria | 1908 |
| 527 | Ga0395901_0093973 | 3300038443 | Bacteria | 3140 |
| 528 | Ga0395901_1358719 | 3300038443 | Bacteria | 670 |
| 529 | Ga0400490_09742 | 3300038726 | Bacteria | 1104 |
| 530 | Ga0400486_26412 | 3300038742 | Bacteria | 1625 |
| 531 | Ga0400487_17411 | 3300039110 | Bacteria | 1020 |
| 532 | Ga0436365_0144452 | 3300039437 | Bacteria | 1765 |
| 533 | Ga0436365_1142460 | 3300039437 | Unclassified | 716 |
| 534 | Ga0436365_1374615 | 3300039437 | Bacteria | 954 |
| 535 | Ga0436361_1124647 | 3300039447 | Bacteria | 1411 |
| 536 | Ga0436363_0126406 | 3300039450 | Bacteria | 1424 |
| 537 | Ga0436363_0206308 | 3300039450 | Bacteria | 864 |
| 538 | Ga0436363_1191399 | 3300039450 | Bacteria | 1128 |
| 539 | Ga0436363_1532933 | 3300039450 | Bacteria | 877 |
| 540 | Ga0436362_0410859 | 3300039453 | Bacteria | 630 |
| 541 | Ga0451794_26880 | 3300041446 | Bacteria | 881 |
| 542 | Ga0451801_12450 | 3300041455 | Bacteria | 672 |
| 543 | Ga0451800_0653755 | 3300041459 | Bacteria | 941 |
| 544 | Ga0451802_0745752 | 3300041460 | Bacteria | 730 |
| 545 | Ga0451807_0331189 | 3300041486 | Bacteria | 1037 |
| 546 | Ga0451807_1082726 | 3300041486 | Bacteria | 1740 |
| 547 | Ga0451837_0610383 | 3300041494 | Unclassified | 1064 |
| 548 | Ga0451851_0662761 | 3300041507 | Bacteria | 812 |
| 549 | Ga0451577_0028049 | 3300042876 | Bacteria | 5094 |
| 550 | Ga0451577_0073767 | 3300042876 | Bacteria | 3044 |
| 551 | Ga0451577_0942138 | 3300042876 | Bacteria | 777 |
| 552 | Ga0466969_0005206 | 3300044656 | Bacteria | 6920 |
| 553 | Ga0466966_0008662 | 3300044684 | Bacteria | 6733 |
| 554 | Ga0453684_0258239 | 3300044712 | Bacteria | 1997 |
| 555 | Ga0453684_0401411 | 3300044712 | Bacteria | 1535 |
| 556 | Ga0453684_0852535 | 3300044712 | Unclassified | 979 |
| 557 | Ga0466959_0115533 | 3300045049 | Bacteria | 1912 |
| 558 | Ga0451576_0868193 | 3300045051 | Unclassified | 947 |
| 559 | Ga0466967_1369745 | 3300045976 | Bacteria | 705 |
| 560 | Ga0495641_0049030 | 3300046461 | Bacteria | 1935 |
| 561 | Ga0495651_0057249 | 3300046462 | Bacteria | 2993 |
| 562 | Ga0495651_0119138 | 3300046462 | Bacteria | 1942 |
| 563 | Ga0495650_0016574 | 3300046471 | Bacteria | 3727 |
| 564 | Ga0495652_0216038 | 3300046529 | Bacteria | 1444 |
| 565 | Ga0495640_0290109 | 3300046533 | Bacteria | 1018 |
| 566 | Ga0495586_0022639 | 3300046535 | Bacteria | 3353 |
| 567 | Ga0495634_0038740 | 3300046642 | Bacteria | 3248 |
| 568 | Ga0495599_0377960 | 3300046678 | Bacteria | 846 |
| 569 | Ga0495623_0059615 | 3300046679 | Bacteria | 2396 |
| 570 | Ga0495658_0692271 | 3300046683 | Bacteria | 653 |
| 571 | Ga0495613_0190191 | 3300046689 | Bacteria | 1451 |
| 572 | Ga0495649_0062956 | 3300046694 | Bacteria | 1994 |
| 573 | Ga0495600_0313483 | 3300046809 | Bacteria | 988 |
| 574 | Ga0495600_0469873 | 3300046809 | Bacteria | 776 |
| 575 | Ga0495636_0437317 | 3300047318 | Bacteria | 627 |
| 576 | Ga0495674_0005331 | 3300047319 | Bacteria | 12335 |
| 577 | Ga0495680_0639782 | 3300047322 | Unclassified | 708 |
| 578 | Ga0495675_0345440 | 3300047444 | Bacteria | 876 |
| 579 | Ga0495686_0003163 | 3300047472 | Bacteria | 14518 |
| 580 | Ga0495602_0148994 | 3300048088 | Bacteria | 1842 |
| 581 | Ga0495602_0991327 | 3300048088 | Bacteria | 555 |
| 582 | Ga0496100_0549764 | 3300048903 | Bacteria | 893 |
| 583 | Ga0496101_0108609 | 3300048904 | Unclassified | 2086 |
| 584 | Ga0496101_0276686 | 3300048904 | Bacteria | 1311 |
| 585 | Ga0496101_0435746 | 3300048904 | Unclassified | 1034 |
| 586 | Ga0496102_0986410 | 3300048905 | Bacteria | 763 |
| 587 | Ga0496104_0133170 | 3300048907 | Bacteria | 2388 |
| 588 | Ga0496104_0170460 | 3300048907 | Bacteria | 2087 |
| 589 | Ga0496106_0217159 | 3300048909 | Unclassified | 1524 |
| 590 | Ga0496106_0281010 | 3300048909 | Bacteria | 1334 |
| 591 | Ga0496107_0053449 | 3300048910 | Bacteria | 2914 |
| 592 | Ga0496108_0031085 | 3300048911 | Bacteria | 4428 |
| 593 | Ga0496109_0332703 | 3300048912 | Bacteria | 1434 |
| 594 | Ga0496112_0188973 | 3300048915 | Bacteria | 2022 |
| 595 | Ga0496112_0358087 | 3300048915 | Bacteria | 1401 |
| 596 | Ga0496114_0000221 | 3300048917 | Bacteria | 41396 |
| 597 | Ga0496114_0025157 | 3300048917 | Bacteria | 4863 |
| 598 | Ga0496114_0056185 | 3300048917 | Bacteria | 3284 |
| 599 | Ga0496114_0175248 | 3300048917 | Bacteria | 1871 |
| 600 | Ga0496114_0188085 | 3300048917 | Bacteria | 1805 |
| 601 | Ga0496115_0036453 | 3300048918 | Bacteria | 3894 |
| 602 | Ga0496115_0148508 | 3300048918 | Bacteria | 1935 |
| 603 | Ga0501309_082223 | 3300049129 | Bacteria | 541 |
| 604 | Ga0501305_072556 | 3300049161 | Bacteria | 607 |
| 605 | Ga0501292_005036 | 3300049515 | Bacteria | 1829 |
| 606 | Ga0501292_030382 | 3300049515 | Bacteria | 906 |
| 607 | Ga0501298_034645 | 3300049521 | Unclassified | 1005 |
| 608 | Ga0501299_005357 | 3300049522 | Bacteria | 1968 |
| 609 | Ga0501031_0245963 | 3300049568 | Bacteria | 1163 |
| 610 | Ga0501034_0000120 | 3300049571 | Bacteria | 144382 |
| 611 | Ga0501034_0205682 | 3300049571 | Bacteria | 1925 |
| 612 | Ga0501036_0019572 | 3300049572 | Bacteria | 5684 |
| 613 | Ga0501036_0028864 | 3300049572 | Bacteria | 4689 |
| 614 | Ga0501036_0958534 | 3300049572 | Bacteria | 701 |
| 615 | Ga0501037_0061101 | 3300049573 | Bacteria | 2748 |
| 616 | Ga0501038_0090462 | 3300049574 | Bacteria | 2565 |
| 617 | Ga0501039_0549923 | 3300049575 | Bacteria | 906 |
| 618 | Ga0501043_0004638 | 3300049579 | Bacteria | 11141 |
| 619 | Ga0501043_0202594 | 3300049579 | Bacteria | 1540 |
| 620 | Ga0501046_0002602 | 3300049580 | Bacteria | 16862 |
| 621 | Ga0501047_0000009 | 3300049581 | Bacteria | 436619 |
| 622 | Ga0501047_0010805 | 3300049581 | Bacteria | 8630 |
| 623 | Ga0501047_0040344 | 3300049581 | Bacteria | 4514 |
| 624 | Ga0501048_0001111 | 3300049582 | Bacteria | 20205 |
| 625 | Ga0501067_0000026 | 3300049583 | Bacteria | 90750 |
| 626 | Ga0501067_0001676 | 3300049583 | Bacteria | 12179 |
| 627 | Ga0501067_0002509 | 3300049583 | Bacteria | 10134 |
| 628 | Ga0501067_0093438 | 3300049583 | Bacteria | 1670 |
| 629 | Ga0501068_0004507 | 3300049584 | Bacteria | 7580 |
| 630 | Ga0501068_0007971 | 3300049584 | Bacteria | 5873 |
| 631 | Ga0501068_0102758 | 3300049584 | Unclassified | 1772 |
| 632 | Ga0501069_0113067 | 3300049585 | Bacteria | 1547 |
| 633 | Ga0501069_0595022 | 3300049585 | Bacteria | 663 |
| 634 | Ga0501069_0665764 | 3300049585 | Bacteria | 627 |
| 635 | Ga0501070_0000323 | 3300049586 | Bacteria | 43475 |
| 636 | Ga0501070_0007402 | 3300049586 | Bacteria | 9323 |
| 637 | Ga0501070_0121017 | 3300049586 | Bacteria | 2163 |
| 638 | Ga0501070_0164521 | 3300049586 | Bacteria | 1828 |
| 639 | Ga0501070_0352458 | 3300049586 | Bacteria | 1194 |
| 640 | Ga0501071_0359796 | 3300049587 | Bacteria | 1108 |
| 641 | Ga0501071_1022448 | 3300049587 | Unclassified | 638 |
| 642 | Ga0501072_0000100 | 3300049588 | Bacteria | 64147 |
| 643 | Ga0501072_0378468 | 3300049588 | Unclassified | 1123 |
| 644 | Ga0501073_0000179 | 3300049589 | Bacteria | 41581 |
| 645 | Ga0501073_0006633 | 3300049589 | Bacteria | 8619 |
| 646 | Ga0501073_0026312 | 3300049589 | Bacteria | 4169 |
| 647 | Ga0501073_0026634 | 3300049589 | Bacteria | 4140 |
| 648 | Ga0501073_1003457 | 3300049589 | Bacteria | 574 |
| 649 | Ga0501074_0006979 | 3300049590 | Bacteria | 8158 |
| 650 | Ga0501074_0070404 | 3300049590 | Bacteria | 2515 |
| 651 | Ga0501074_0123028 | 3300049590 | Bacteria | 1855 |
| 652 | Ga0501074_0397286 | 3300049590 | Unclassified | 978 |
| 653 | Ga0501076_0765097 | 3300049592 | Bacteria | 797 |
| 654 | Ga0501077_0286176 | 3300049593 | Bacteria | 1049 |
| 655 | Ga0501202_071090 | 3300049652 | Bacteria | 802 |
| 656 | Ga0501207_016274 | 3300049654 | Bacteria | 1152 |
| 657 | Ga0501216_002169 | 3300049660 | Bacteria | 2759 |
| 658 | Ga0501217_014693 | 3300049661 | Bacteria | 1772 |
| 659 | Ga0501223_030652 | 3300049663 | Bacteria | 1046 |
| 660 | Ga0501227_004086 | 3300049665 | Bacteria | 3140 |
| 661 | Ga0501227_025238 | 3300049665 | Bacteria | 1393 |
| 662 | Ga0501230_003894 | 3300049667 | Bacteria | 2016 |
| 663 | Ga0501233_003013 | 3300049668 | Bacteria | 3010 |
| 664 | Ga0501233_097967 | 3300049668 | Bacteria | 772 |
| 665 | Ga0501229_007702 | 3300049706 | Bacteria | 1342 |
| 666 | Ga0501079_0000231 | 3300049741 | Bacteria | 33351 |
| 667 | Ga0501079_0547243 | 3300049741 | Bacteria | 910 |
| 668 | Ga0501080_0169585 | 3300049742 | Bacteria | 2013 |
| 669 | Ga0501080_0494492 | 3300049742 | Bacteria | 1093 |
| 670 | Ga0501080_0604532 | 3300049742 | Bacteria | 973 |
| 671 | Ga0501080_0769943 | 3300049742 | Bacteria | 845 |
| 672 | Ga0501081_0049321 | 3300049743 | Bacteria | 2899 |
| 673 | Ga0501083_0000679 | 3300049744 | Bacteria | 22147 |
| 674 | Ga0501083_0005169 | 3300049744 | Bacteria | 9233 |
| 675 | Ga0501083_0030120 | 3300049744 | Bacteria | 3729 |
| 676 | Ga0501083_0099926 | 3300049744 | Bacteria | 1913 |
| 677 | Ga0501083_0572148 | 3300049744 | Bacteria | 735 |
| 678 | Ga0501267_006506 | 3300049764 | Bacteria | 1124 |
| 679 | Ga0501035_0360667 | 3300049822 | Bacteria | 1215 |
| 680 | Ga0501044_0084199 | 3300049823 | Bacteria | 3214 |
| 681 | Ga0501044_0532850 | 3300049823 | Bacteria | 1073 |
| 682 | nmdc:mga05p37_1275176_c1 | 3300050507 | Unclassified | 751 |
| 683 | nmdc:mga09592_11194_c1 | 3300050508 | Bacteria | 7299 |
| 684 | nmdc:mga09592_225222_c1 | 3300050508 | Bacteria | 1625 |
| 685 | nmdc:mga09592_49581_c1 | 3300050508 | Bacteria | 3540 |
| 686 | nmdc:mga0qj67_618341_c1 | 3300050509 | Bacteria | 866 |
| 687 | nmdc:mga06r32_780854_c1 | 3300050510 | Bacteria | 917 |
| 688 | nmdc:mga08y16_18519_c1 | 3300050511 | Bacteria | 7336 |
| 689 | nmdc:mga08y16_4304_c1 | 3300050511 | Bacteria | 14867 |
| 690 | nmdc:mga08y16_872549_c1 | 3300050511 | Bacteria | 888 |
| 691 | nmdc:mga0n895_531242_c1 | 3300050512 | Unclassified | 1183 |
| 692 | nmdc:mga0n895_566321_c1 | 3300050512 | Bacteria | 1141 |
| 693 | nmdc:mga0rr50_55729_c1 | 3300050513 | Bacteria | 2950 |
| 694 | nmdc:mga0rr50_745392_c1 | 3300050513 | Bacteria | 836 |
| 695 | Ga0495601_0006774 | 3300053077 | Bacteria | 6712 |
| 696 | Ga0495619_0282760 | 3300053085 | Bacteria | 1150 |
| 697 | Ga0500578_0332261 | 3300053086 | Unclassified | 893 |
| 698 | Ga0500578_0381990 | 3300053086 | Bacteria | 816 |
| 699 | Ga0500566_0000579 | 3300053094 | Bacteria | 20621 |
| 700 | Ga0500566_0003002 | 3300053094 | Bacteria | 10080 |
| 701 | Ga0500566_0121323 | 3300053094 | Bacteria | 1409 |
| 702 | Ga0500640_005031 | 3300053095 | Bacteria | 4877 |
| 703 | Ga0500554_000343 | 3300053102 | Bacteria | 9996 |
| 704 | Ga0500562_017858 | 3300053108 | Unclassified | 1831 |
| 705 | Ga0500595_000685 | 3300053119 | Bacteria | 20274 |
| 706 | Ga0500597_104467 | 3300053120 | Bacteria | 1231 |
| 707 | Ga0500607_107670 | 3300053121 | Bacteria | 1372 |
| 708 | Ga0500614_000877 | 3300053123 | Bacteria | 7604 |
| 709 | Ga0500614_004426 | 3300053123 | Bacteria | 2967 |
| 710 | Ga0500642_0006684 | 3300053130 | Bacteria | 3819 |
| 711 | Ga0500642_0012433 | 3300053130 | Bacteria | 3087 |
| 712 | Ga0500655_115102 | 3300053133 | Bacteria | 569 |
| 713 | Ga0500564_196995 | 3300053138 | Bacteria | 830 |
| 714 | Ga0500568_0007462 | 3300053139 | Bacteria | 5361 |
| 715 | Ga0500568_0021106 | 3300053139 | Bacteria | 2807 |
| 716 | Ga0500585_031417 | 3300053144 | Bacteria | 1829 |
| 717 | Ga0500588_0152870 | 3300053146 | Bacteria | 836 |
| 718 | Ga0500603_015209 | 3300053150 | Bacteria | 1809 |
| 719 | Ga0500603_023447 | 3300053150 | Bacteria | 1536 |
| 720 | Ga0500636_0058726 | 3300053177 | Bacteria | 2248 |
| 721 | Ga0500637_0050830 | 3300053178 | Bacteria | 2362 |
| 722 | Ga0500601_029908 | 3300053737 | Bacteria | 645 |
| 723 | Ga0501084_0000313 | 3300054114 | Bacteria | 36799 |
| 724 | Ga0501084_0832079 | 3300054114 | Bacteria | 777 |
| 725 | Ga0500661_020082 | 3300055283 | Bacteria | 1188 |
| 726 | Ga0587084_083633 | 3300059477 | Bacteria | 622 |
| 727 | Ga0587073_0262591 | 3300059492 | Bacteria | 546 |
| 728 | Ga0587082_090755 | 3300059504 | Bacteria | 651 |
| 729 | Ga0587092_063664 | 3300059512 | Bacteria | 695 |
| 730 | Ga0587072_100176 | 3300059643 | Bacteria | 649 |
| 731 | Ga0587111_0216772 | 3300060346 | Bacteria | 550 |
| 732 | Ga0501082_0000571 | 3300060353 | Bacteria | 32825 |
| 733 | Ga0501082_0008410 | 3300060353 | Bacteria | 8903 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300031728 | Ga0316578_10496947 | Ga0316578_104969471 | 159 |
| 2 | 3300032133 | Ga0316583_10000564 | Ga0316583_1000056410 | 159 |
| 3 | 3300033528 | Ga0316588_1017041 | Ga0316588_10170412 | 159 |
| 4 | 3300034818 | Ga0373950_0000025 | Ga0373950_0000025_96688_97254 | 159 |
| 5 | 3300036647 | Ga0316582_0067945 | Ga0316582_0067945_55_534 | 159 |
| 6 | 3300036647 | Ga0316582_0192459 | Ga0316582_0192459_110_589 | 159 |
| 7 | 3300042876 | Ga0451577_0073767 | Ga0451577_0073767_2428_2907 | 159 |
| 8 | 3300049571 | Ga0501034_0000120 | Ga0501034_0000120_85020_85586 | 159 |
| 9 | 3300049572 | Ga0501036_0028864 | Ga0501036_0028864_4073_4639 | 159 |
| 10 | 3300049574 | Ga0501038_0090462 | Ga0501038_0090462_1683_2249 | 159 |
| 11 | 3300049579 | Ga0501043_0004638 | Ga0501043_0004638_4306_4872 | 159 |
| 12 | 3300049580 | Ga0501046_0002602 | Ga0501046_0002602_5321_5887 | 159 |
| 13 | 3300049581 | Ga0501047_0000009 | Ga0501047_0000009_252973_253539 | 159 |
| 14 | 3300049582 | Ga0501048_0001111 | Ga0501048_0001111_8307_8873 | 159 |
| 15 | 3300049584 | Ga0501068_0004507 | Ga0501068_0004507_6178_6744 | 159 |
| 16 | 3300049588 | Ga0501072_0000100 | Ga0501072_0000100_38881_39447 | 159 |
| 17 | 3300049590 | Ga0501074_0006979 | Ga0501074_0006979_6027_6593 | 159 |
| 18 | 3300049593 | Ga0501077_0286176 | Ga0501077_0286176_239_805 | 159 |
| 19 | 3300049741 | Ga0501079_0000231 | Ga0501079_0000231_17565_18131 | 159 |
| 20 | 3300049742 | Ga0501080_0494492 | Ga0501080_0494492_137_703 | 159 |
| 21 | 3300049744 | Ga0501083_0000679 | Ga0501083_0000679_14390_14956 | 159 |
| 22 | 3300049823 | Ga0501044_0532850 | Ga0501044_0532850_408_974 | 159 |
| 23 | 3300054114 | Ga0501084_0000313 | Ga0501084_0000313_17175_17741 | 159 |
| 24 | 3300060353 | Ga0501082_0000571 | Ga0501082_0000571_31997_32563 | 159 |
| 25 | 3300003308 | Ga0006777J48905_1063988 | Ga0006777J48905_10639881 | 160 |
| 26 | 3300003544 | Ga0007417J51691_1062475 | Ga0007417J51691_10624752 | 160 |
| 27 | 3300003735 | Ga0006780_1012978 | Ga0006780_10129781 | 160 |
| 28 | 3300004785 | Ga0058858_1001068 | Ga0058858_10010681 | 160 |
| 29 | 3300004798 | Ga0058859_10037633 | Ga0058859_100376331 | 160 |
| 30 | 3300004798 | Ga0058859_10058200 | Ga0058859_100582001 | 160 |
| 31 | 3300004798 | Ga0058859_11799976 | Ga0058859_117999761 | 160 |
| 32 | 3300004798 | Ga0058859_11807595 | Ga0058859_118075952 | 160 |
| 33 | 3300004799 | Ga0058863_11731370 | Ga0058863_117313701 | 160 |
| 34 | 3300004799 | Ga0058863_11858214 | Ga0058863_118582141 | 160 |
| 35 | 3300004799 | Ga0058863_11948672 | Ga0058863_119486721 | 160 |
| 36 | 3300004800 | Ga0058861_10028637 | Ga0058861_100286372 | 160 |
| 37 | 3300004800 | Ga0058861_10072934 | Ga0058861_100729341 | 160 |
| 38 | 3300004800 | Ga0058861_11912080 | Ga0058861_119120801 | 160 |
| 39 | 3300004801 | Ga0058860_10120307 | Ga0058860_101203071 | 160 |
| 40 | 3300004801 | Ga0058860_12053824 | Ga0058860_120538241 | 160 |
| 41 | 3300004801 | Ga0058860_12103954 | Ga0058860_121039542 | 160 |
| 42 | 3300004801 | Ga0058860_12209524 | Ga0058860_122095241 | 160 |
| 43 | 3300004803 | Ga0058862_12606125 | Ga0058862_126061251 | 160 |
| 44 | 3300004803 | Ga0058862_12795608 | Ga0058862_127956081 | 160 |
| 45 | 3300004803 | Ga0058862_12802071 | Ga0058862_128020711 | 160 |
| 46 | 3300005290 | Ga0065712_10235307 | Ga0065712_102353072 | 160 |
| 47 | 3300005293 | Ga0065715_10446724 | Ga0065715_104467242 | 160 |
| 48 | 3300005327 | Ga0070658_10005201 | Ga0070658_100052014 | 160 |
| 49 | 3300005327 | Ga0070658_10151981 | Ga0070658_101519812 | 160 |
| 50 | 3300005328 | Ga0070676_10010598 | Ga0070676_100105984 | 160 |
| 51 | 3300005329 | Ga0070683_100007795 | Ga0070683_1000077958 | 160 |
| 52 | 3300005329 | Ga0070683_100145389 | Ga0070683_1001453894 | 160 |
| 53 | 3300005329 | Ga0070683_100245232 | Ga0070683_1002452323 | 160 |
| 54 | 3300005329 | Ga0070683_100486418 | Ga0070683_1004864181 | 160 |
| 55 | 3300005329 | Ga0070683_101498062 | Ga0070683_1014980621 | 160 |
| 56 | 3300005330 | Ga0070690_100005437 | Ga0070690_1000054376 | 160 |
| 57 | 3300005330 | Ga0070690_100018706 | Ga0070690_1000187063 | 160 |
| 58 | 3300005330 | Ga0070690_100071796 | Ga0070690_1000717964 | 160 |
| 59 | 3300005330 | Ga0070690_100210387 | Ga0070690_1002103872 | 160 |
| 60 | 3300005331 | Ga0070670_100249953 | Ga0070670_1002499532 | 160 |
| 61 | 3300005331 | Ga0070670_100336200 | Ga0070670_1003362002 | 160 |
| 62 | 3300005333 | Ga0070677_10155161 | Ga0070677_101551611 | 160 |
| 63 | 3300005334 | Ga0068869_100086742 | Ga0068869_1000867422 | 160 |
| 64 | 3300005334 | Ga0068869_100184302 | Ga0068869_1001843021 | 160 |
| 65 | 3300005334 | Ga0068869_100219777 | Ga0068869_1002197772 | 160 |
| 66 | 3300005334 | Ga0068869_100862082 | Ga0068869_1008620822 | 160 |
| 67 | 3300005336 | Ga0070680_100119345 | Ga0070680_1001193451 | 160 |
| 68 | 3300005336 | Ga0070680_101040631 | Ga0070680_1010406311 | 160 |
| 69 | 3300005337 | Ga0070682_100004298 | Ga0070682_1000042989 | 160 |
| 70 | 3300005337 | Ga0070682_100171913 | Ga0070682_1001719131 | 160 |
| 71 | 3300005337 | Ga0070682_100429614 | Ga0070682_1004296141 | 160 |
| 72 | 3300005337 | Ga0070682_100779355 | Ga0070682_1007793551 | 160 |
| 73 | 3300005338 | Ga0068868_100127115 | Ga0068868_1001271152 | 160 |
| 74 | 3300005338 | Ga0068868_100146484 | Ga0068868_1001464843 | 160 |
| 75 | 3300005340 | Ga0070689_100000014 | Ga0070689_10000001444 | 160 |
| 76 | 3300005340 | Ga0070689_100037336 | Ga0070689_1000373366 | 160 |
| 77 | 3300005340 | Ga0070689_100046691 | Ga0070689_1000466914 | 160 |
| 78 | 3300005340 | Ga0070689_100092152 | Ga0070689_1000921522 | 160 |
| 79 | 3300005340 | Ga0070689_100286957 | Ga0070689_1002869571 | 160 |
| 80 | 3300005340 | Ga0070689_100490444 | Ga0070689_1004904442 | 160 |
| 81 | 3300005340 | Ga0070689_100537387 | Ga0070689_1005373871 | 160 |
| 82 | 3300005343 | Ga0070687_100000637 | Ga0070687_10000063712 | 160 |
| 83 | 3300005343 | Ga0070687_100149715 | Ga0070687_1001497151 | 160 |
| 84 | 3300005345 | Ga0070692_10171243 | Ga0070692_101712432 | 160 |
| 85 | 3300005345 | Ga0070692_10905992 | Ga0070692_109059921 | 160 |
| 86 | 3300005347 | Ga0070668_100011396 | Ga0070668_1000113966 | 160 |
| 87 | 3300005353 | Ga0070669_100022080 | Ga0070669_1000220804 | 160 |
| 88 | 3300005354 | Ga0070675_100069692 | Ga0070675_1000696923 | 160 |
| 89 | 3300005354 | Ga0070675_100142301 | Ga0070675_1001423012 | 160 |
| 90 | 3300005355 | Ga0070671_101093360 | Ga0070671_1010933601 | 160 |
| 91 | 3300005356 | Ga0070674_100078018 | Ga0070674_1000780184 | 160 |
| 92 | 3300005356 | Ga0070674_100235237 | Ga0070674_1002352372 | 160 |
| 93 | 3300005364 | Ga0070673_100000555 | Ga0070673_10000055510 | 160 |
| 94 | 3300005364 | Ga0070673_100034675 | Ga0070673_1000346754 | 160 |
| 95 | 3300005364 | Ga0070673_100161161 | Ga0070673_1001611612 | 160 |
| 96 | 3300005364 | Ga0070673_100212906 | Ga0070673_1002129062 | 160 |
| 97 | 3300005365 | Ga0070688_100031115 | Ga0070688_1000311154 | 160 |
| 98 | 3300005365 | Ga0070688_100375360 | Ga0070688_1003753601 | 160 |
| 99 | 3300005366 | Ga0070659_100358206 | Ga0070659_1003582062 | 160 |
| 100 | 3300005367 | Ga0070667_100397437 | Ga0070667_1003974371 | 160 |
| 101 | 3300005367 | Ga0070667_100562141 | Ga0070667_1005621411 | 160 |
| 102 | 3300005434 | Ga0070709_10343786 | Ga0070709_103437861 | 160 |
| 103 | 3300005436 | Ga0070713_100308105 | Ga0070713_1003081053 | 160 |
| 104 | 3300005436 | Ga0070713_100455194 | Ga0070713_1004551941 | 160 |
| 105 | 3300005437 | Ga0070710_10107256 | Ga0070710_101072562 | 160 |
| 106 | 3300005437 | Ga0070710_10313822 | Ga0070710_103138222 | 160 |
| 107 | 3300005438 | Ga0070701_10012877 | Ga0070701_100128773 | 160 |
| 108 | 3300005438 | Ga0070701_10233544 | Ga0070701_102335441 | 160 |
| 109 | 3300005439 | Ga0070711_100251259 | Ga0070711_1002512592 | 160 |
| 110 | 3300005440 | Ga0070705_100064679 | Ga0070705_1000646792 | 160 |
| 111 | 3300005440 | Ga0070705_100458562 | Ga0070705_1004585621 | 160 |
| 112 | 3300005440 | Ga0070705_100505838 | Ga0070705_1005058382 | 160 |
| 113 | 3300005441 | Ga0070700_100056685 | Ga0070700_1000566851 | 160 |
| 114 | 3300005441 | Ga0070700_101081596 | Ga0070700_1010815961 | 160 |
| 115 | 3300005445 | Ga0070708_100239897 | Ga0070708_1002398972 | 160 |
| 116 | 3300005445 | Ga0070708_100307439 | Ga0070708_1003074392 | 160 |
| 117 | 3300005456 | Ga0070678_100017410 | Ga0070678_1000174106 | 160 |
| 118 | 3300005457 | Ga0070662_100678156 | Ga0070662_1006781561 | 160 |
| 119 | 3300005458 | Ga0070681_10255727 | Ga0070681_102557272 | 160 |
| 120 | 3300005458 | Ga0070681_10374590 | Ga0070681_103745902 | 160 |
| 121 | 3300005458 | Ga0070681_10687205 | Ga0070681_106872051 | 160 |
| 122 | 3300005459 | Ga0068867_100036835 | Ga0068867_1000368353 | 160 |
| 123 | 3300005459 | Ga0068867_100644592 | Ga0068867_1006445921 | 160 |
| 124 | 3300005466 | Ga0070685_10036407 | Ga0070685_100364071 | 160 |
| 125 | 3300005466 | Ga0070685_10405878 | Ga0070685_104058782 | 160 |
| 126 | 3300005466 | Ga0070685_10446920 | Ga0070685_104469201 | 160 |
| 127 | 3300005466 | Ga0070685_10535699 | Ga0070685_105356991 | 160 |
| 128 | 3300005467 | Ga0070706_100044331 | Ga0070706_1000443313 | 160 |
| 129 | 3300005467 | Ga0070706_100053704 | Ga0070706_1000537042 | 160 |
| 130 | 3300005467 | Ga0070706_101069847 | Ga0070706_1010698471 | 160 |
| 131 | 3300005471 | Ga0070698_100001555 | Ga0070698_10000155515 | 160 |
| 132 | 3300005471 | Ga0070698_100378060 | Ga0070698_1003780601 | 160 |
| 133 | 3300005518 | Ga0070699_100130956 | Ga0070699_1001309562 | 160 |
| 134 | 3300005530 | Ga0070679_100046846 | Ga0070679_1000468463 | 160 |
| 135 | 3300005535 | Ga0070684_100020180 | Ga0070684_1000201807 | 160 |
| 136 | 3300005535 | Ga0070684_100126031 | Ga0070684_1001260312 | 160 |
| 137 | 3300005535 | Ga0070684_100310446 | Ga0070684_1003104461 | 160 |
| 138 | 3300005535 | Ga0070684_100394316 | Ga0070684_1003943161 | 160 |
| 139 | 3300005535 | Ga0070684_100665791 | Ga0070684_1006657911 | 160 |
| 140 | 3300005539 | Ga0068853_100868153 | Ga0068853_1008681531 | 160 |
| 141 | 3300005543 | Ga0070672_100021741 | Ga0070672_1000217416 | 160 |
| 142 | 3300005543 | Ga0070672_100120858 | Ga0070672_1001208583 | 160 |
| 143 | 3300005544 | Ga0070686_100102762 | Ga0070686_1001027622 | 160 |
| 144 | 3300005544 | Ga0070686_100179626 | Ga0070686_1001796261 | 160 |
| 145 | 3300005545 | Ga0070695_100794347 | Ga0070695_1007943471 | 160 |
| 146 | 3300005546 | Ga0070696_100572343 | Ga0070696_1005723431 | 160 |
| 147 | 3300005547 | Ga0070693_100431066 | Ga0070693_1004310662 | 160 |
| 148 | 3300005548 | Ga0070665_100017791 | Ga0070665_1000177913 | 160 |
| 149 | 3300005548 | Ga0070665_100737658 | Ga0070665_1007376582 | 160 |
| 150 | 3300005548 | Ga0070665_100899637 | Ga0070665_1008996372 | 160 |
| 151 | 3300005548 | Ga0070665_101056925 | Ga0070665_1010569252 | 160 |
| 152 | 3300005549 | Ga0070704_100280151 | Ga0070704_1002801511 | 160 |
| 153 | 3300005549 | Ga0070704_100436241 | Ga0070704_1004362412 | 160 |
| 154 | 3300005563 | Ga0068855_100022861 | Ga0068855_1000228616 | 160 |
| 155 | 3300005563 | Ga0068855_100377664 | Ga0068855_1003776642 | 160 |
| 156 | 3300005563 | Ga0068855_101414345 | Ga0068855_1014143451 | 160 |
| 157 | 3300005564 | Ga0070664_100335725 | Ga0070664_1003357252 | 160 |
| 158 | 3300005564 | Ga0070664_101359286 | Ga0070664_1013592861 | 160 |
| 159 | 3300005577 | Ga0068857_100210635 | Ga0068857_1002106353 | 160 |
| 160 | 3300005577 | Ga0068857_100983401 | Ga0068857_1009834011 | 160 |
| 161 | 3300005614 | Ga0068856_100033363 | Ga0068856_1000333636 | 160 |
| 162 | 3300005614 | Ga0068856_100138125 | Ga0068856_1001381251 | 160 |
| 163 | 3300005614 | Ga0068856_100619911 | Ga0068856_1006199111 | 160 |
| 164 | 3300005615 | Ga0070702_100030529 | Ga0070702_1000305292 | 160 |
| 165 | 3300005615 | Ga0070702_100842071 | Ga0070702_1008420711 | 160 |
| 166 | 3300005616 | Ga0068852_100327667 | Ga0068852_1003276672 | 160 |
| 167 | 3300005617 | Ga0068859_100175781 | Ga0068859_1001757814 | 160 |
| 168 | 3300005618 | Ga0068864_100189684 | Ga0068864_1001896842 | 160 |
| 169 | 3300005719 | Ga0068861_100181385 | Ga0068861_1001813852 | 160 |
| 170 | 3300005719 | Ga0068861_100288465 | Ga0068861_1002884651 | 160 |
| 171 | 3300005841 | Ga0068863_100060378 | Ga0068863_1000603784 | 160 |
| 172 | 3300005841 | Ga0068863_100060693 | Ga0068863_1000606933 | 160 |
| 173 | 3300005841 | Ga0068863_101108776 | Ga0068863_1011087761 | 160 |
| 174 | 3300005842 | Ga0068858_101460560 | Ga0068858_1014605601 | 160 |
| 175 | 3300005843 | Ga0068860_101010563 | Ga0068860_1010105632 | 160 |
| 176 | 3300005843 | Ga0068860_101181934 | Ga0068860_1011819341 | 160 |
| 177 | 3300005844 | Ga0068862_100051189 | Ga0068862_1000511894 | 160 |
| 178 | 3300005844 | Ga0068862_100986125 | Ga0068862_1009861251 | 160 |
| 179 | 3300006358 | Ga0068871_100186909 | Ga0068871_1001869091 | 160 |
| 180 | 3300006358 | Ga0068871_100236550 | Ga0068871_1002365502 | 160 |
| 181 | 3300006358 | Ga0068871_100378155 | Ga0068871_1003781552 | 160 |
| 182 | 3300006358 | Ga0068871_100432700 | Ga0068871_1004327001 | 160 |
| 183 | 3300006846 | Ga0075430_101005690 | Ga0075430_1010056901 | 160 |
| 184 | 3300006871 | Ga0075434_101269391 | Ga0075434_1012693912 | 160 |
| 185 | 3300006880 | Ga0075429_100025611 | Ga0075429_1000256112 | 160 |
| 186 | 3300006880 | Ga0075429_100120669 | Ga0075429_1001206693 | 160 |
| 187 | 3300006881 | Ga0068865_100021367 | Ga0068865_1000213676 | 160 |
| 188 | 3300006931 | Ga0097620_100175774 | Ga0097620_1001757744 | 160 |
| 189 | 3300007076 | Ga0075435_100052581 | Ga0075435_1000525813 | 160 |
| 190 | 3300007788 | Ga0099795_10026665 | Ga0099795_100266652 | 160 |
| 191 | 3300009092 | Ga0105250_10249548 | Ga0105250_102495481 | 160 |
| 192 | 3300009093 | Ga0105240_10000261 | Ga0105240_1000026150 | 160 |
| 193 | 3300009093 | Ga0105240_10056624 | Ga0105240_100566244 | 160 |
| 194 | 3300009093 | Ga0105240_10413916 | Ga0105240_104139162 | 160 |
| 195 | 3300009093 | Ga0105240_10567824 | Ga0105240_105678242 | 160 |
| 196 | 3300009094 | Ga0111539_10027557 | Ga0111539_100275574 | 160 |
| 197 | 3300009098 | Ga0105245_10000149 | Ga0105245_1000014965 | 160 |
| 198 | 3300009098 | Ga0105245_10833426 | Ga0105245_108334262 | 160 |
| 199 | 3300009147 | Ga0114129_10911327 | Ga0114129_109113271 | 160 |
| 200 | 3300009148 | Ga0105243_10266489 | Ga0105243_102664892 | 160 |
| 201 | 3300009148 | Ga0105243_10288692 | Ga0105243_102886921 | 160 |
| 202 | 3300009177 | Ga0105248_10524001 | Ga0105248_105240012 | 160 |
| 203 | 3300009177 | Ga0105248_11277189 | Ga0105248_112771891 | 160 |
| 204 | 3300009177 | Ga0105248_12154383 | Ga0105248_121543831 | 160 |
| 205 | 3300009545 | Ga0105237_10000062 | Ga0105237_1000006293 | 160 |
| 206 | 3300009545 | Ga0105237_10233412 | Ga0105237_102334122 | 160 |
| 207 | 3300009551 | Ga0105238_10018097 | Ga0105238_100180973 | 160 |
| 208 | 3300009551 | Ga0105238_10339966 | Ga0105238_103399661 | 160 |
| 209 | 3300009551 | Ga0105238_10608562 | Ga0105238_106085622 | 160 |
| 210 | 3300009551 | Ga0105238_11134594 | Ga0105238_111345941 | 160 |
| 211 | 3300009553 | Ga0105249_10028685 | Ga0105249_100286856 | 160 |
| 212 | 3300009553 | Ga0105249_10034840 | Ga0105249_100348403 | 160 |
| 213 | 3300009553 | Ga0105249_10282279 | Ga0105249_102822792 | 160 |
| 214 | 3300009553 | Ga0105249_11011169 | Ga0105249_110111692 | 160 |
| 215 | 3300010375 | Ga0105239_10149195 | Ga0105239_101491952 | 160 |
| 216 | 3300010375 | Ga0105239_10446986 | Ga0105239_104469862 | 160 |
| 217 | 3300010375 | Ga0105239_12347512 | Ga0105239_123475121 | 160 |
| 218 | 3300013102 | Ga0157371_10482225 | Ga0157371_104822252 | 160 |
| 219 | 3300013105 | Ga0157369_10139736 | Ga0157369_101397362 | 160 |
| 220 | 3300013296 | Ga0157374_10031333 | Ga0157374_100313337 | 160 |
| 221 | 3300013296 | Ga0157374_10237419 | Ga0157374_102374193 | 160 |
| 222 | 3300013296 | Ga0157374_10321406 | Ga0157374_103214062 | 160 |
| 223 | 3300013296 | Ga0157374_10878055 | Ga0157374_108780551 | 160 |
| 224 | 3300013297 | Ga0157378_10092416 | Ga0157378_100924165 | 160 |
| 225 | 3300013297 | Ga0157378_10094569 | Ga0157378_100945693 | 160 |
| 226 | 3300013297 | Ga0157378_10299314 | Ga0157378_102993142 | 160 |
| 227 | 3300013297 | Ga0157378_10371988 | Ga0157378_103719882 | 160 |
| 228 | 3300013306 | Ga0163162_10481773 | Ga0163162_104817732 | 160 |
| 229 | 3300013306 | Ga0163162_11418384 | Ga0163162_114183841 | 160 |
| 230 | 3300013306 | Ga0163162_12230965 | Ga0163162_122309651 | 160 |
| 231 | 3300013307 | Ga0157372_11228119 | Ga0157372_112281191 | 160 |
| 232 | 3300013307 | Ga0157372_11954574 | Ga0157372_119545741 | 160 |
| 233 | 3300013308 | Ga0157375_10521241 | Ga0157375_105212412 | 160 |
| 234 | 3300013308 | Ga0157375_11017422 | Ga0157375_110174222 | 160 |
| 235 | 3300014325 | Ga0163163_10247634 | Ga0163163_102476342 | 160 |
| 236 | 3300014326 | Ga0157380_10191869 | Ga0157380_101918693 | 160 |
| 237 | 3300014326 | Ga0157380_10969772 | Ga0157380_109697721 | 160 |
| 238 | 3300014745 | Ga0157377_10306998 | Ga0157377_103069981 | 160 |
| 239 | 3300014969 | Ga0157376_10150460 | Ga0157376_101504602 | 160 |
| 240 | 3300014969 | Ga0157376_10585612 | Ga0157376_105856122 | 160 |
| 241 | 3300014969 | Ga0157376_10970374 | Ga0157376_109703741 | 160 |
| 242 | 3300014969 | Ga0157376_12122341 | Ga0157376_121223411 | 160 |
| 243 | 3300020070 | Ga0206356_10416233 | Ga0206356_104162332 | 160 |
| 244 | 3300020078 | Ga0206352_11250444 | Ga0206352_112504441 | 160 |
| 245 | 3300020082 | Ga0206353_11912490 | Ga0206353_119124902 | 160 |
| 246 | 3300020082 | Ga0206353_12007426 | Ga0206353_120074261 | 160 |
| 247 | 3300021377 | Ga0213874_10099193 | Ga0213874_100991931 | 160 |
| 248 | 3300021384 | Ga0213876_10103309 | Ga0213876_101033091 | 160 |
| 249 | 3300021384 | Ga0213876_10264700 | Ga0213876_102647001 | 160 |
| 250 | 3300022467 | Ga0224712_10362701 | Ga0224712_103627011 | 160 |
| 251 | 3300025315 | Ga0207697_10065641 | Ga0207697_100656412 | 160 |
| 252 | 3300025885 | Ga0207653_10072387 | Ga0207653_100723871 | 160 |
| 253 | 3300025898 | Ga0207692_10085877 | Ga0207692_100858773 | 160 |
| 254 | 3300025901 | Ga0207688_10081808 | Ga0207688_100818082 | 160 |
| 255 | 3300025906 | Ga0207699_10311250 | Ga0207699_103112501 | 160 |
| 256 | 3300025907 | Ga0207645_10003612 | Ga0207645_1000361210 | 160 |
| 257 | 3300025909 | Ga0207705_10018431 | Ga0207705_100184314 | 160 |
| 258 | 3300025909 | Ga0207705_10040703 | Ga0207705_100407032 | 160 |
| 259 | 3300025910 | Ga0207684_10040963 | Ga0207684_100409633 | 160 |
| 260 | 3300025912 | Ga0207707_10335988 | Ga0207707_103359881 | 160 |
| 261 | 3300025912 | Ga0207707_10600145 | Ga0207707_106001452 | 160 |
| 262 | 3300025912 | Ga0207707_10690862 | Ga0207707_106908621 | 160 |
| 263 | 3300025913 | Ga0207695_10001635 | Ga0207695_1000163510 | 160 |
| 264 | 3300025913 | Ga0207695_10161010 | Ga0207695_101610102 | 160 |
| 265 | 3300025913 | Ga0207695_10286807 | Ga0207695_102868072 | 160 |
| 266 | 3300025914 | Ga0207671_10000140 | Ga0207671_100001407 | 160 |
| 267 | 3300025914 | Ga0207671_10260767 | Ga0207671_102607672 | 160 |
| 268 | 3300025914 | Ga0207671_10928554 | Ga0207671_109285542 | 160 |
| 269 | 3300025915 | Ga0207693_10165904 | Ga0207693_101659042 | 160 |
| 270 | 3300025917 | Ga0207660_10052199 | Ga0207660_100521993 | 160 |
| 271 | 3300025917 | Ga0207660_10399731 | Ga0207660_103997311 | 160 |
| 272 | 3300025918 | Ga0207662_10001434 | Ga0207662_1000143412 | 160 |
| 273 | 3300025918 | Ga0207662_10019856 | Ga0207662_100198563 | 160 |
| 274 | 3300025918 | Ga0207662_10022717 | Ga0207662_100227173 | 160 |
| 275 | 3300025918 | Ga0207662_10336348 | Ga0207662_103363482 | 160 |
| 276 | 3300025918 | Ga0207662_10426201 | Ga0207662_104262011 | 160 |
| 277 | 3300025921 | Ga0207652_10002792 | Ga0207652_100027928 | 160 |
| 278 | 3300025921 | Ga0207652_10006188 | Ga0207652_100061888 | 160 |
| 279 | 3300025921 | Ga0207652_10013232 | Ga0207652_100132325 | 160 |
| 280 | 3300025921 | Ga0207652_10085864 | Ga0207652_100858643 | 160 |
| 281 | 3300025923 | Ga0207681_10019671 | Ga0207681_100196714 | 160 |
| 282 | 3300025924 | Ga0207694_10697357 | Ga0207694_106973572 | 160 |
| 283 | 3300025924 | Ga0207694_10889563 | Ga0207694_108895631 | 160 |
| 284 | 3300025925 | Ga0207650_10202670 | Ga0207650_102026702 | 160 |
| 285 | 3300025925 | Ga0207650_10295477 | Ga0207650_102954772 | 160 |
| 286 | 3300025925 | Ga0207650_10625559 | Ga0207650_106255591 | 160 |
| 287 | 3300025926 | Ga0207659_10051985 | Ga0207659_100519853 | 160 |
| 288 | 3300025926 | Ga0207659_10082026 | Ga0207659_100820262 | 160 |
| 289 | 3300025926 | Ga0207659_10505329 | Ga0207659_105053292 | 160 |
| 290 | 3300025926 | Ga0207659_10915494 | Ga0207659_109154941 | 160 |
| 291 | 3300025927 | Ga0207687_10000526 | Ga0207687_1000052611 | 160 |
| 292 | 3300025927 | Ga0207687_10175271 | Ga0207687_101752712 | 160 |
| 293 | 3300025927 | Ga0207687_10184076 | Ga0207687_101840762 | 160 |
| 294 | 3300025928 | Ga0207700_10419432 | Ga0207700_104194322 | 160 |
| 295 | 3300025932 | Ga0207690_10336023 | Ga0207690_103360231 | 160 |
| 296 | 3300025933 | Ga0207706_10074130 | Ga0207706_100741304 | 160 |
| 297 | 3300025934 | Ga0207686_10455862 | Ga0207686_104558622 | 160 |
| 298 | 3300025935 | Ga0207709_10131077 | Ga0207709_101310772 | 160 |
| 299 | 3300025935 | Ga0207709_10175998 | Ga0207709_101759982 | 160 |
| 300 | 3300025936 | Ga0207670_10000003 | Ga0207670_10000003109 | 160 |
| 301 | 3300025936 | Ga0207670_10002754 | Ga0207670_100027549 | 160 |
| 302 | 3300025936 | Ga0207670_10013353 | Ga0207670_100133536 | 160 |
| 303 | 3300025936 | Ga0207670_10024078 | Ga0207670_100240781 | 160 |
| 304 | 3300025936 | Ga0207670_10030666 | Ga0207670_100306661 | 160 |
| 305 | 3300025936 | Ga0207670_10076250 | Ga0207670_100762502 | 160 |
| 306 | 3300025936 | Ga0207670_10709534 | Ga0207670_107095341 | 160 |
| 307 | 3300025938 | Ga0207704_10009349 | Ga0207704_100093493 | 160 |
| 308 | 3300025938 | Ga0207704_10012288 | Ga0207704_100122886 | 160 |
| 309 | 3300025940 | Ga0207691_10120325 | Ga0207691_101203253 | 160 |
| 310 | 3300025941 | Ga0207711_10369105 | Ga0207711_103691051 | 160 |
| 311 | 3300025942 | Ga0207689_10459039 | Ga0207689_104590392 | 160 |
| 312 | 3300025944 | Ga0207661_10035952 | Ga0207661_100359522 | 160 |
| 313 | 3300025944 | Ga0207661_10241825 | Ga0207661_102418251 | 160 |
| 314 | 3300025944 | Ga0207661_10701172 | Ga0207661_107011722 | 160 |
| 315 | 3300025944 | Ga0207661_11727273 | Ga0207661_117272731 | 160 |
| 316 | 3300025945 | Ga0207679_10809071 | Ga0207679_108090712 | 160 |
| 317 | 3300025949 | Ga0207667_10049364 | Ga0207667_100493643 | 160 |
| 318 | 3300025949 | Ga0207667_10433651 | Ga0207667_104336512 | 160 |
| 319 | 3300025960 | Ga0207651_10001985 | Ga0207651_100019856 | 160 |
| 320 | 3300025960 | Ga0207651_10060180 | Ga0207651_100601803 | 160 |
| 321 | 3300025960 | Ga0207651_10564354 | Ga0207651_105643541 | 160 |
| 322 | 3300025961 | Ga0207712_10117111 | Ga0207712_101171114 | 160 |
| 323 | 3300025961 | Ga0207712_10204728 | Ga0207712_102047282 | 160 |
| 324 | 3300025972 | Ga0207668_10107941 | Ga0207668_101079413 | 160 |
| 325 | 3300025981 | Ga0207640_10950790 | Ga0207640_109507901 | 160 |
| 326 | 3300025986 | Ga0207658_10779427 | Ga0207658_107794271 | 160 |
| 327 | 3300025986 | Ga0207658_11678133 | Ga0207658_116781331 | 160 |
| 328 | 3300026023 | Ga0207677_10037003 | Ga0207677_100370033 | 160 |
| 329 | 3300026023 | Ga0207677_10870869 | Ga0207677_108708691 | 160 |
| 330 | 3300026035 | Ga0207703_10032822 | Ga0207703_100328224 | 160 |
| 331 | 3300026035 | Ga0207703_10864716 | Ga0207703_108647162 | 160 |
| 332 | 3300026035 | Ga0207703_11396313 | Ga0207703_113963131 | 160 |
| 333 | 3300026067 | Ga0207678_11094763 | Ga0207678_110947631 | 160 |
| 334 | 3300026075 | Ga0207708_10004519 | Ga0207708_100045193 | 160 |
| 335 | 3300026078 | Ga0207702_10024695 | Ga0207702_100246953 | 160 |
| 336 | 3300026078 | Ga0207702_10166958 | Ga0207702_101669581 | 160 |
| 337 | 3300026078 | Ga0207702_10171046 | Ga0207702_101710462 | 160 |
| 338 | 3300026078 | Ga0207702_10187462 | Ga0207702_101874622 | 160 |
| 339 | 3300026088 | Ga0207641_10233486 | Ga0207641_102334862 | 160 |
| 340 | 3300026088 | Ga0207641_11371555 | Ga0207641_113715552 | 160 |
| 341 | 3300026089 | Ga0207648_10052397 | Ga0207648_100523974 | 160 |
| 342 | 3300026095 | Ga0207676_10121380 | Ga0207676_101213802 | 160 |
| 343 | 3300026095 | Ga0207676_10192480 | Ga0207676_101924802 | 160 |
| 344 | 3300026095 | Ga0207676_10960686 | Ga0207676_109606861 | 160 |
| 345 | 3300026116 | Ga0207674_10093047 | Ga0207674_100930473 | 160 |
| 346 | 3300026116 | Ga0207674_10298608 | Ga0207674_102986082 | 160 |
| 347 | 3300026116 | Ga0207674_10457219 | Ga0207674_104572192 | 160 |
| 348 | 3300026116 | Ga0207674_10912614 | Ga0207674_109126142 | 160 |
| 349 | 3300026118 | Ga0207675_100086590 | Ga0207675_1000865902 | 160 |
| 350 | 3300026121 | Ga0207683_10010985 | Ga0207683_100109856 | 160 |
| 351 | 3300026121 | Ga0207683_10031446 | Ga0207683_100314463 | 160 |
| 352 | 3300026121 | Ga0207683_10578615 | Ga0207683_105786151 | 160 |
| 353 | 3300026142 | Ga0207698_10205230 | Ga0207698_102052302 | 160 |
| 354 | 3300026142 | Ga0207698_10877910 | Ga0207698_108779101 | 160 |
| 355 | 3300027907 | Ga0207428_10031981 | Ga0207428_100319814 | 160 |
| 356 | 3300028379 | Ga0268266_10017339 | Ga0268266_100173396 | 160 |
| 357 | 3300028379 | Ga0268266_11013872 | Ga0268266_110138721 | 160 |
| 358 | 3300028379 | Ga0268266_11971810 | Ga0268266_119718101 | 160 |
| 359 | 3300028380 | Ga0268265_10127206 | Ga0268265_101272062 | 160 |
| 360 | 3300028381 | Ga0268264_10707640 | Ga0268264_107076402 | 160 |
| 361 | 3300028558 | Ga0265326_10033289 | Ga0265326_100332892 | 160 |
| 362 | 3300028563 | Ga0265319_1090029 | Ga0265319_10900292 | 160 |
| 363 | 3300028563 | Ga0265319_1118774 | Ga0265319_11187741 | 160 |
| 364 | 3300028577 | Ga0265318_10000110 | Ga0265318_1000011053 | 160 |
| 365 | 3300028577 | Ga0265318_10000678 | Ga0265318_100006785 | 160 |
| 366 | 3300028666 | Ga0265336_10008055 | Ga0265336_100080555 | 160 |
| 367 | 3300028786 | Ga0307517_10048705 | Ga0307517_100487052 | 160 |
| 368 | 3300028794 | Ga0307515_10034085 | Ga0307515_100340858 | 160 |
| 369 | 3300028800 | Ga0265338_10001473 | Ga0265338_1000147320 | 160 |
| 370 | 3300028800 | Ga0265338_10198104 | Ga0265338_101981042 | 160 |
| 371 | 3300028800 | Ga0265338_10705035 | Ga0265338_107050351 | 160 |
| 372 | 3300031235 | Ga0265330_10001283 | Ga0265330_100012838 | 160 |
| 373 | 3300031235 | Ga0265330_10001591 | Ga0265330_100015914 | 160 |
| 374 | 3300031238 | Ga0265332_10000070 | Ga0265332_1000007060 | 160 |
| 375 | 3300031238 | Ga0265332_10003169 | Ga0265332_100031694 | 160 |
| 376 | 3300031238 | Ga0265332_10007480 | Ga0265332_100074802 | 160 |
| 377 | 3300031238 | Ga0265332_10127037 | Ga0265332_101270371 | 160 |
| 378 | 3300031239 | Ga0265328_10001530 | Ga0265328_100015304 | 160 |
| 379 | 3300031239 | Ga0265328_10002763 | Ga0265328_100027633 | 160 |
| 380 | 3300031239 | Ga0265328_10002834 | Ga0265328_100028344 | 160 |
| 381 | 3300031240 | Ga0265320_10000040 | Ga0265320_100000408 | 160 |
| 382 | 3300031240 | Ga0265320_10028248 | Ga0265320_100282484 | 160 |
| 383 | 3300031240 | Ga0265320_10053692 | Ga0265320_100536922 | 160 |
| 384 | 3300031241 | Ga0265325_10060051 | Ga0265325_100600512 | 160 |
| 385 | 3300031242 | Ga0265329_10000562 | Ga0265329_100005622 | 160 |
| 386 | 3300031242 | Ga0265329_10005698 | Ga0265329_100056982 | 160 |
| 387 | 3300031247 | Ga0265340_10104943 | Ga0265340_101049433 | 160 |
| 388 | 3300031249 | Ga0265339_10000504 | Ga0265339_100005048 | 160 |
| 389 | 3300031249 | Ga0265339_10005031 | Ga0265339_100050317 | 160 |
| 390 | 3300031249 | Ga0265339_10012768 | Ga0265339_100127682 | 160 |
| 391 | 3300031250 | Ga0265331_10000083 | Ga0265331_1000008394 | 160 |
| 392 | 3300031250 | Ga0265331_10001199 | Ga0265331_1000119912 | 160 |
| 393 | 3300031250 | Ga0265331_10310063 | Ga0265331_103100631 | 160 |
| 394 | 3300031344 | Ga0265316_10000532 | Ga0265316_1000053220 | 160 |
| 395 | 3300031344 | Ga0265316_10007776 | Ga0265316_100077763 | 160 |
| 396 | 3300031344 | Ga0265316_10073174 | Ga0265316_100731743 | 160 |
| 397 | 3300031456 | Ga0307513_10003393 | Ga0307513_100033933 | 160 |
| 398 | 3300031507 | Ga0307509_10000039 | Ga0307509_1000003950 | 160 |
| 399 | 3300031507 | Ga0307509_10007659 | Ga0307509_1000765912 | 160 |
| 400 | 3300031507 | Ga0307509_10035298 | Ga0307509_100352983 | 160 |
| 401 | 3300031507 | Ga0307509_10248233 | Ga0307509_102482332 | 160 |
| 402 | 3300031595 | Ga0265313_10001169 | Ga0265313_100011698 | 160 |
| 403 | 3300031595 | Ga0265313_10012957 | Ga0265313_100129572 | 160 |
| 404 | 3300031595 | Ga0265313_10023987 | Ga0265313_100239875 | 160 |
| 405 | 3300031595 | Ga0265313_10034747 | Ga0265313_100347472 | 160 |
| 406 | 3300031616 | Ga0307508_10013069 | Ga0307508_100130696 | 160 |
| 407 | 3300031616 | Ga0307508_10262111 | Ga0307508_102621112 | 160 |
| 408 | 3300031711 | Ga0265314_10000099 | Ga0265314_100000998 | 160 |
| 409 | 3300031711 | Ga0265314_10002880 | Ga0265314_100028806 | 160 |
| 410 | 3300031711 | Ga0265314_10006401 | Ga0265314_100064018 | 160 |
| 411 | 3300031711 | Ga0265314_10281018 | Ga0265314_102810182 | 160 |
| 412 | 3300031712 | Ga0265342_10001302 | Ga0265342_100013024 | 160 |
| 413 | 3300031712 | Ga0265342_10004892 | Ga0265342_100048923 | 160 |
| 414 | 3300031712 | Ga0265342_10008352 | Ga0265342_100083526 | 160 |
| 415 | 3300031712 | Ga0265342_10259405 | Ga0265342_102594052 | 160 |
| 416 | 3300031730 | Ga0307516_10075810 | Ga0307516_100758102 | 160 |
| 417 | 3300031852 | Ga0307410_11300987 | Ga0307410_113009871 | 160 |
| 418 | 3300031901 | Ga0307406_10025561 | Ga0307406_100255612 | 160 |
| 419 | 3300031901 | Ga0307406_10247327 | Ga0307406_102473272 | 160 |
| 420 | 3300032126 | Ga0307415_100558722 | Ga0307415_1005587222 | 160 |
| 421 | 3300034818 | Ga0373950_0000007 | Ga0373950_0000007_304069_304560 | 160 |
| 422 | 3300035090 | Ga0373949_0000089 | Ga0373949_0000089_19764_20252 | 160 |
| 423 | 3300035113 | Ga0373936_0000051 | Ga0373936_0000051_38612_39100 | 160 |
| 424 | 3300035114 | Ga0373939_0163340 | Ga0373939_0163340_201_689 | 160 |
| 425 | 3300035115 | Ga0373941_0090094 | Ga0373941_0090094_482_970 | 160 |
| 426 | 3300035116 | Ga0373945_0023665 | Ga0373945_0023665_1429_1926 | 160 |
| 427 | 3300035117 | Ga0373953_0004266 | Ga0373953_0004266_3457_3945 | 160 |
| 428 | 3300035118 | Ga0373954_0002028 | Ga0373954_0002028_7754_8242 | 160 |
| 429 | 3300035118 | Ga0373954_0040879 | Ga0373954_0040879_1364_1852 | 160 |
| 430 | 3300035119 | Ga0373956_0022718 | Ga0373956_0022718_2138_2626 | 160 |
| 431 | 3300035120 | Ga0373957_0061399 | Ga0373957_0061399_695_1186 | 160 |
| 432 | 3300035120 | Ga0373957_0231217 | Ga0373957_0231217_169_657 | 160 |
| 433 | 3300035170 | Ga0373943_0097141 | Ga0373943_0097141_515_1012 | 160 |
| 434 | 3300035170 | Ga0373943_0626134 | Ga0373943_0626134_34_522 | 160 |
| 435 | 3300035171 | Ga0373946_0227509 | Ga0373946_0227509_14_502 | 160 |
| 436 | 3300035171 | Ga0373946_0620171 | Ga0373946_0620171_37_525 | 160 |
| 437 | 3300035172 | Ga0373955_0009187 | Ga0373955_0009187_2583_3071 | 160 |
| 438 | 3300035172 | Ga0373955_0316113 | Ga0373955_0316113_47_535 | 160 |
| 439 | 3300035241 | Ga0373961_0000224 | Ga0373961_0000224_12244_12732 | 160 |
| 440 | 3300035691 | Ga0373931_0641585 | Ga0373931_0641585_196_684 | 160 |
| 441 | 3300035692 | Ga0373935_1211280 | Ga0373935_1211280_64_552 | 160 |
| 442 | 3300035724 | Ga0373933_0009700 | Ga0373933_0009700_835_1323 | 160 |
| 443 | 3300035724 | Ga0373933_0028117 | Ga0373933_0028117_1369_1860 | 160 |
| 444 | 3300035724 | Ga0373933_0149311 | Ga0373933_0149311_826_1314 | 160 |
| 445 | 3300035725 | Ga0373947_0206087 | Ga0373947_0206087_51_539 | 160 |
| 446 | 3300035725 | Ga0373947_0572081 | Ga0373947_0572081_74_571 | 160 |
| 447 | 3300036401 | Ga0373937_0007030 | Ga0373937_0007030_9193_9681 | 160 |
| 448 | 3300036401 | Ga0373937_0030878 | Ga0373937_0030878_157_645 | 160 |
| 449 | 3300036401 | Ga0373937_0392005 | Ga0373937_0392005_63_551 | 160 |
| 450 | 3300036401 | Ga0373937_1098140 | Ga0373937_1098140_139_627 | 160 |
| 451 | 3300037068 | Ga0373925_0119200 | Ga0373925_0119200_1400_1897 | 160 |
| 452 | 3300037312 | Ga0395899_0010207 | Ga0395899_0010207_2054_2539 | 160 |
| 453 | 3300037312 | Ga0395899_0270864 | Ga0395899_0270864_557_1042 | 160 |
| 454 | 3300037418 | Ga0395900_0051544 | Ga0395900_0051544_2644_3129 | 160 |
| 455 | 3300037466 | Ga0395898_0200046 | Ga0395898_0200046_559_1044 | 160 |
| 456 | 3300038443 | Ga0395901_0093973 | Ga0395901_0093973_2295_2780 | 160 |
| 457 | 3300038443 | Ga0395901_1358719 | Ga0395901_1358719_100_585 | 160 |
| 458 | 3300038726 | Ga0400490_09742 | Ga0400490_09742_188_709 | 160 |
| 459 | 3300038742 | Ga0400486_26412 | Ga0400486_26412_207_728 | 160 |
| 460 | 3300039110 | Ga0400487_17411 | Ga0400487_17411_429_950 | 160 |
| 461 | 3300039437 | Ga0436365_0144452 | Ga0436365_0144452_251_739 | 160 |
| 462 | 3300039437 | Ga0436365_1142460 | Ga0436365_1142460_24_512 | 160 |
| 463 | 3300039437 | Ga0436365_1374615 | Ga0436365_1374615_219_704 | 160 |
| 464 | 3300039450 | Ga0436363_1191399 | Ga0436363_1191399_360_848 | 160 |
| 465 | 3300039450 | Ga0436363_1532933 | Ga0436363_1532933_94_579 | 160 |
| 466 | 3300039453 | Ga0436362_0410859 | Ga0436362_0410859_76_564 | 160 |
| 467 | 3300041446 | Ga0451794_26880 | Ga0451794_26880_133_633 | 160 |
| 468 | 3300041455 | Ga0451801_12450 | Ga0451801_12450_144_659 | 160 |
| 469 | 3300041459 | Ga0451800_0653755 | Ga0451800_0653755_45_533 | 160 |
| 470 | 3300041460 | Ga0451802_0745752 | Ga0451802_0745752_125_622 | 160 |
| 471 | 3300041486 | Ga0451807_0331189 | Ga0451807_0331189_508_996 | 160 |
| 472 | 3300041494 | Ga0451837_0610383 | Ga0451837_0610383_178_663 | 160 |
| 473 | 3300042876 | Ga0451577_0028049 | Ga0451577_0028049_2488_2976 | 160 |
| 474 | 3300042876 | Ga0451577_0942138 | Ga0451577_0942138_45_530 | 160 |
| 475 | 3300044712 | Ga0453684_0258239 | Ga0453684_0258239_108_608 | 160 |
| 476 | 3300044712 | Ga0453684_0401411 | Ga0453684_0401411_747_1235 | 160 |
| 477 | 3300044712 | Ga0453684_0852535 | Ga0453684_0852535_446_940 | 160 |
| 478 | 3300046461 | Ga0495641_0049030 | Ga0495641_0049030_949_1437 | 160 |
| 479 | 3300046462 | Ga0495651_0119138 | Ga0495651_0119138_561_1049 | 160 |
| 480 | 3300046471 | Ga0495650_0016574 | Ga0495650_0016574_2236_2724 | 160 |
| 481 | 3300046533 | Ga0495640_0290109 | Ga0495640_0290109_385_873 | 160 |
| 482 | 3300046535 | Ga0495586_0022639 | Ga0495586_0022639_2710_3198 | 160 |
| 483 | 3300046642 | Ga0495634_0038740 | Ga0495634_0038740_2374_2862 | 160 |
| 484 | 3300046678 | Ga0495599_0377960 | Ga0495599_0377960_203_691 | 160 |
| 485 | 3300046694 | Ga0495649_0062956 | Ga0495649_0062956_380_868 | 160 |
| 486 | 3300046809 | Ga0495600_0313483 | Ga0495600_0313483_125_610 | 160 |
| 487 | 3300046809 | Ga0495600_0469873 | Ga0495600_0469873_159_647 | 160 |
| 488 | 3300047319 | Ga0495674_0005331 | Ga0495674_0005331_1757_2245 | 160 |
| 489 | 3300047322 | Ga0495680_0639782 | Ga0495680_0639782_120_608 | 160 |
| 490 | 3300047472 | Ga0495686_0003163 | Ga0495686_0003163_9339_9827 | 160 |
| 491 | 3300048088 | Ga0495602_0991327 | Ga0495602_0991327_46_534 | 160 |
| 492 | 3300048903 | Ga0496100_0549764 | Ga0496100_0549764_354_851 | 160 |
| 493 | 3300048904 | Ga0496101_0108609 | Ga0496101_0108609_718_1215 | 160 |
| 494 | 3300048904 | Ga0496101_0276686 | Ga0496101_0276686_285_773 | 160 |
| 495 | 3300048904 | Ga0496101_0435746 | Ga0496101_0435746_210_698 | 160 |
| 496 | 3300048905 | Ga0496102_0986410 | Ga0496102_0986410_72_569 | 160 |
| 497 | 3300048907 | Ga0496104_0133170 | Ga0496104_0133170_1465_1953 | 160 |
| 498 | 3300048907 | Ga0496104_0170460 | Ga0496104_0170460_836_1324 | 160 |
| 499 | 3300048909 | Ga0496106_0217159 | Ga0496106_0217159_398_895 | 160 |
| 500 | 3300048909 | Ga0496106_0281010 | Ga0496106_0281010_540_1028 | 160 |
| 501 | 3300048910 | Ga0496107_0053449 | Ga0496107_0053449_1528_2025 | 160 |
| 502 | 3300048911 | Ga0496108_0031085 | Ga0496108_0031085_2471_2968 | 160 |
| 503 | 3300048912 | Ga0496109_0332703 | Ga0496109_0332703_41_538 | 160 |
| 504 | 3300048915 | Ga0496112_0358087 | Ga0496112_0358087_12_509 | 160 |
| 505 | 3300048917 | Ga0496114_0000221 | Ga0496114_0000221_10344_10841 | 160 |
| 506 | 3300048917 | Ga0496114_0025157 | Ga0496114_0025157_1413_1901 | 160 |
| 507 | 3300048917 | Ga0496114_0056185 | Ga0496114_0056185_536_1087 | 160 |
| 508 | 3300048917 | Ga0496114_0175248 | Ga0496114_0175248_200_688 | 160 |
| 509 | 3300048917 | Ga0496114_0188085 | Ga0496114_0188085_159_653 | 160 |
| 510 | 3300048918 | Ga0496115_0036453 | Ga0496115_0036453_2506_3003 | 160 |
| 511 | 3300049515 | Ga0501292_005036 | Ga0501292_005036_352_840 | 160 |
| 512 | 3300049515 | Ga0501292_030382 | Ga0501292_030382_266_799 | 160 |
| 513 | 3300049521 | Ga0501298_034645 | Ga0501298_034645_405_890 | 160 |
| 514 | 3300049522 | Ga0501299_005357 | Ga0501299_005357_973_1461 | 160 |
| 515 | 3300049568 | Ga0501031_0245963 | Ga0501031_0245963_452_937 | 160 |
| 516 | 3300049571 | Ga0501034_0205682 | Ga0501034_0205682_65_550 | 160 |
| 517 | 3300049572 | Ga0501036_0019572 | Ga0501036_0019572_3399_3950 | 160 |
| 518 | 3300049572 | Ga0501036_0958534 | Ga0501036_0958534_117_602 | 160 |
| 519 | 3300049573 | Ga0501037_0061101 | Ga0501037_0061101_342_827 | 160 |
| 520 | 3300049575 | Ga0501039_0549923 | Ga0501039_0549923_18_509 | 160 |
| 521 | 3300049579 | Ga0501043_0202594 | Ga0501043_0202594_741_1226 | 160 |
| 522 | 3300049581 | Ga0501047_0010805 | Ga0501047_0010805_3136_3621 | 160 |
| 523 | 3300049581 | Ga0501047_0040344 | Ga0501047_0040344_1950_2435 | 160 |
| 524 | 3300049583 | Ga0501067_0000026 | Ga0501067_0000026_85961_86452 | 160 |
| 525 | 3300049583 | Ga0501067_0001676 | Ga0501067_0001676_6103_6600 | 160 |
| 526 | 3300049583 | Ga0501067_0093438 | Ga0501067_0093438_598_1086 | 160 |
| 527 | 3300049584 | Ga0501068_0007971 | Ga0501068_0007971_4822_5313 | 160 |
| 528 | 3300049584 | Ga0501068_0102758 | Ga0501068_0102758_11_499 | 160 |
| 529 | 3300049585 | Ga0501069_0113067 | Ga0501069_0113067_373_861 | 160 |
| 530 | 3300049585 | Ga0501069_0595022 | Ga0501069_0595022_154_645 | 160 |
| 531 | 3300049585 | Ga0501069_0665764 | Ga0501069_0665764_62_547 | 160 |
| 532 | 3300049586 | Ga0501070_0000323 | Ga0501070_0000323_42827_43318 | 160 |
| 533 | 3300049586 | Ga0501070_0007402 | Ga0501070_0007402_3196_3684 | 160 |
| 534 | 3300049586 | Ga0501070_0121017 | Ga0501070_0121017_41_526 | 160 |
| 535 | 3300049586 | Ga0501070_0164521 | Ga0501070_0164521_996_1487 | 160 |
| 536 | 3300049586 | Ga0501070_0352458 | Ga0501070_0352458_86_571 | 160 |
| 537 | 3300049587 | Ga0501071_0359796 | Ga0501071_0359796_570_1061 | 160 |
| 538 | 3300049587 | Ga0501071_1022448 | Ga0501071_1022448_28_513 | 160 |
| 539 | 3300049588 | Ga0501072_0378468 | Ga0501072_0378468_383_871 | 160 |
| 540 | 3300049589 | Ga0501073_0000179 | Ga0501073_0000179_35798_36289 | 160 |
| 541 | 3300049589 | Ga0501073_0006633 | Ga0501073_0006633_377_874 | 160 |
| 542 | 3300049589 | Ga0501073_0026312 | Ga0501073_0026312_136_627 | 160 |
| 543 | 3300049589 | Ga0501073_0026634 | Ga0501073_0026634_2992_3483 | 160 |
| 544 | 3300049589 | Ga0501073_1003457 | Ga0501073_1003457_78_563 | 160 |
| 545 | 3300049590 | Ga0501074_0070404 | Ga0501074_0070404_1310_1795 | 160 |
| 546 | 3300049590 | Ga0501074_0123028 | Ga0501074_0123028_713_1204 | 160 |
| 547 | 3300049590 | Ga0501074_0397286 | Ga0501074_0397286_41_529 | 160 |
| 548 | 3300049592 | Ga0501076_0765097 | Ga0501076_0765097_171_743 | 160 |
| 549 | 3300049652 | Ga0501202_071090 | Ga0501202_071090_222_710 | 160 |
| 550 | 3300049654 | Ga0501207_016274 | Ga0501207_016274_270_758 | 160 |
| 551 | 3300049660 | Ga0501216_002169 | Ga0501216_002169_182_670 | 160 |
| 552 | 3300049661 | Ga0501217_014693 | Ga0501217_014693_440_928 | 160 |
| 553 | 3300049663 | Ga0501223_030652 | Ga0501223_030652_425_913 | 160 |
| 554 | 3300049665 | Ga0501227_004086 | Ga0501227_004086_1484_1972 | 160 |
| 555 | 3300049665 | Ga0501227_025238 | Ga0501227_025238_589_1077 | 160 |
| 556 | 3300049667 | Ga0501230_003894 | Ga0501230_003894_805_1293 | 160 |
| 557 | 3300049668 | Ga0501233_003013 | Ga0501233_003013_1626_2114 | 160 |
| 558 | 3300049668 | Ga0501233_097967 | Ga0501233_097967_20_508 | 160 |
| 559 | 3300049706 | Ga0501229_007702 | Ga0501229_007702_527_1015 | 160 |
| 560 | 3300049741 | Ga0501079_0547243 | Ga0501079_0547243_349_840 | 160 |
| 561 | 3300049742 | Ga0501080_0169585 | Ga0501080_0169585_953_1444 | 160 |
| 562 | 3300049742 | Ga0501080_0769943 | Ga0501080_0769943_300_788 | 160 |
| 563 | 3300049743 | Ga0501081_0049321 | Ga0501081_0049321_2348_2839 | 160 |
| 564 | 3300049744 | Ga0501083_0005169 | Ga0501083_0005169_1204_1695 | 160 |
| 565 | 3300049744 | Ga0501083_0030120 | Ga0501083_0030120_3137_3628 | 160 |
| 566 | 3300049744 | Ga0501083_0099926 | Ga0501083_0099926_371_859 | 160 |
| 567 | 3300049744 | Ga0501083_0572148 | Ga0501083_0572148_89_580 | 160 |
| 568 | 3300049764 | Ga0501267_006506 | Ga0501267_006506_499_987 | 160 |
| 569 | 3300049822 | Ga0501035_0360667 | Ga0501035_0360667_469_954 | 160 |
| 570 | 3300049823 | Ga0501044_0084199 | Ga0501044_0084199_35_520 | 160 |
| 571 | 3300050507 | nmdc:mga05p37_1275176_c1 | nmdc:mga05p37_1275176_c1_67_552 | 160 |
| 572 | 3300050508 | nmdc:mga09592_11194_c1 | nmdc:mga09592_11194_c1_6622_7107 | 160 |
| 573 | 3300050508 | nmdc:mga09592_225222_c1 | nmdc:mga09592_225222_c1_627_1112 | 160 |
| 574 | 3300050511 | nmdc:mga08y16_18519_c1 | nmdc:mga08y16_18519_c1_4581_5078 | 160 |
| 575 | 3300050512 | nmdc:mga0n895_566321_c1 | nmdc:mga0n895_566321_c1_481_969 | 160 |
| 576 | 3300050513 | nmdc:mga0rr50_55729_c1 | nmdc:mga0rr50_55729_c1_517_1005 | 160 |
| 577 | 3300050513 | nmdc:mga0rr50_745392_c1 | nmdc:mga0rr50_745392_c1_222_710 | 160 |
| 578 | 3300053077 | Ga0495601_0006774 | Ga0495601_0006774_3378_3866 | 160 |
| 579 | 3300053086 | Ga0500578_0332261 | Ga0500578_0332261_138_626 | 160 |
| 580 | 3300053086 | Ga0500578_0381990 | Ga0500578_0381990_234_722 | 160 |
| 581 | 3300053094 | Ga0500566_0000579 | Ga0500566_0000579_7196_7684 | 160 |
| 582 | 3300053094 | Ga0500566_0003002 | Ga0500566_0003002_3828_4316 | 160 |
| 583 | 3300053094 | Ga0500566_0121323 | Ga0500566_0121323_309_848 | 160 |
| 584 | 3300053095 | Ga0500640_005031 | Ga0500640_005031_4087_4575 | 160 |
| 585 | 3300053102 | Ga0500554_000343 | Ga0500554_000343_7407_7895 | 160 |
| 586 | 3300053108 | Ga0500562_017858 | Ga0500562_017858_1168_1656 | 160 |
| 587 | 3300053119 | Ga0500595_000685 | Ga0500595_000685_8848_9336 | 160 |
| 588 | 3300053120 | Ga0500597_104467 | Ga0500597_104467_685_1173 | 160 |
| 589 | 3300053121 | Ga0500607_107670 | Ga0500607_107670_234_722 | 160 |
| 590 | 3300053123 | Ga0500614_000877 | Ga0500614_000877_1657_2145 | 160 |
| 591 | 3300053123 | Ga0500614_004426 | Ga0500614_004426_1826_2365 | 160 |
| 592 | 3300053130 | Ga0500642_0006684 | Ga0500642_0006684_2369_2857 | 160 |
| 593 | 3300053130 | Ga0500642_0012433 | Ga0500642_0012433_2007_2495 | 160 |
| 594 | 3300053133 | Ga0500655_115102 | Ga0500655_115102_68_556 | 160 |
| 595 | 3300053138 | Ga0500564_196995 | Ga0500564_196995_35_523 | 160 |
| 596 | 3300053139 | Ga0500568_0007462 | Ga0500568_0007462_1705_2193 | 160 |
| 597 | 3300053139 | Ga0500568_0021106 | Ga0500568_0021106_1985_2470 | 160 |
| 598 | 3300053144 | Ga0500585_031417 | Ga0500585_031417_1308_1796 | 160 |
| 599 | 3300053146 | Ga0500588_0152870 | Ga0500588_0152870_193_681 | 160 |
| 600 | 3300053150 | Ga0500603_015209 | Ga0500603_015209_992_1531 | 160 |
| 601 | 3300053150 | Ga0500603_023447 | Ga0500603_023447_976_1464 | 160 |
| 602 | 3300053177 | Ga0500636_0058726 | Ga0500636_0058726_1456_1995 | 160 |
| 603 | 3300053178 | Ga0500637_0050830 | Ga0500637_0050830_1322_1861 | 160 |
| 604 | 3300053737 | Ga0500601_029908 | Ga0500601_029908_41_529 | 160 |
| 605 | 3300054114 | Ga0501084_0832079 | Ga0501084_0832079_92_583 | 160 |
| 606 | 3300055283 | Ga0500661_020082 | Ga0500661_020082_334_873 | 160 |
| 607 | 3300059477 | Ga0587084_083633 | Ga0587084_083633_26_514 | 160 |
| 608 | 3300059504 | Ga0587082_090755 | Ga0587082_090755_65_553 | 160 |
| 609 | 3300059512 | Ga0587092_063664 | Ga0587092_063664_98_586 | 160 |
| 610 | 3300059643 | Ga0587072_100176 | Ga0587072_100176_80_568 | 160 |
| 611 | 3300060353 | Ga0501082_0008410 | Ga0501082_0008410_883_1374 | 160 |
| 612 | 3300003323 | rootH1_10017798 | rootH1_100177988 | 161 |
| 613 | 3300004800 | Ga0058861_10044879 | Ga0058861_100448791 | 161 |
| 614 | 3300004803 | Ga0058862_10089401 | Ga0058862_100894011 | 161 |
| 615 | 3300005327 | Ga0070658_10039648 | Ga0070658_100396485 | 161 |
| 616 | 3300005329 | Ga0070683_100095265 | Ga0070683_1000952651 | 161 |
| 617 | 3300005334 | Ga0068869_101075749 | Ga0068869_1010757491 | 161 |
| 618 | 3300005336 | Ga0070680_100230372 | Ga0070680_1002303722 | 161 |
| 619 | 3300005338 | Ga0068868_100270410 | Ga0068868_1002704102 | 161 |
| 620 | 3300005345 | Ga0070692_10213450 | Ga0070692_102134501 | 161 |
| 621 | 3300005364 | Ga0070673_101872717 | Ga0070673_1018727171 | 161 |
| 622 | 3300005365 | Ga0070688_100204884 | Ga0070688_1002048842 | 161 |
| 623 | 3300005365 | Ga0070688_100206470 | Ga0070688_1002064701 | 161 |
| 624 | 3300005435 | Ga0070714_101194858 | Ga0070714_1011948582 | 161 |
| 625 | 3300005438 | Ga0070701_10248081 | Ga0070701_102480812 | 161 |
| 626 | 3300005458 | Ga0070681_10039022 | Ga0070681_100390225 | 161 |
| 627 | 3300005458 | Ga0070681_10089395 | Ga0070681_100893953 | 161 |
| 628 | 3300005467 | Ga0070706_100502678 | Ga0070706_1005026781 | 161 |
| 629 | 3300005467 | Ga0070706_101164673 | Ga0070706_1011646731 | 161 |
| 630 | 3300005471 | Ga0070698_100031473 | Ga0070698_1000314732 | 161 |
| 631 | 3300005530 | Ga0070679_100024718 | Ga0070679_1000247186 | 161 |
| 632 | 3300005530 | Ga0070679_100123082 | Ga0070679_1001230823 | 161 |
| 633 | 3300005535 | Ga0070684_100311799 | Ga0070684_1003117992 | 161 |
| 634 | 3300005548 | Ga0070665_100553430 | Ga0070665_1005534302 | 161 |
| 635 | 3300005614 | Ga0068856_100124689 | Ga0068856_1001246892 | 161 |
| 636 | 3300005614 | Ga0068856_100732906 | Ga0068856_1007329061 | 161 |
| 637 | 3300006237 | Ga0097621_100269462 | Ga0097621_1002694622 | 161 |
| 638 | 3300006844 | Ga0075428_100099931 | Ga0075428_1000999313 | 161 |
| 639 | 3300006844 | Ga0075428_100409091 | Ga0075428_1004090912 | 161 |
| 640 | 3300006844 | Ga0075428_101993830 | Ga0075428_1019938302 | 161 |
| 641 | 3300006844 | Ga0075428_102148790 | Ga0075428_1021487901 | 161 |
| 642 | 3300006846 | Ga0075430_100468418 | Ga0075430_1004684182 | 161 |
| 643 | 3300006846 | Ga0075430_100604573 | Ga0075430_1006045732 | 161 |
| 644 | 3300006847 | Ga0075431_100673859 | Ga0075431_1006738591 | 161 |
| 645 | 3300006880 | Ga0075429_100016106 | Ga0075429_1000161062 | 161 |
| 646 | 3300007076 | Ga0075435_100251661 | Ga0075435_1002516612 | 161 |
| 647 | 3300009093 | Ga0105240_10674777 | Ga0105240_106747771 | 161 |
| 648 | 3300009094 | Ga0111539_10010727 | Ga0111539_100107277 | 161 |
| 649 | 3300009094 | Ga0111539_11247359 | Ga0111539_112473592 | 161 |
| 650 | 3300009094 | Ga0111539_11710388 | Ga0111539_117103881 | 161 |
| 651 | 3300009098 | Ga0105245_10386618 | Ga0105245_103866181 | 161 |
| 652 | 3300009147 | Ga0114129_12832497 | Ga0114129_128324971 | 161 |
| 653 | 3300009174 | Ga0105241_11624293 | Ga0105241_116242931 | 161 |
| 654 | 3300009177 | Ga0105248_11198455 | Ga0105248_111984551 | 161 |
| 655 | 3300009545 | Ga0105237_10126013 | Ga0105237_101260133 | 161 |
| 656 | 3300009551 | Ga0105238_10924681 | Ga0105238_109246812 | 161 |
| 657 | 3300009551 | Ga0105238_11022354 | Ga0105238_110223541 | 161 |
| 658 | 3300009551 | Ga0105238_11374055 | Ga0105238_113740552 | 161 |
| 659 | 3300013296 | Ga0157374_10500330 | Ga0157374_105003301 | 161 |
| 660 | 3300013296 | Ga0157374_10614906 | Ga0157374_106149062 | 161 |
| 661 | 3300013297 | Ga0157378_10127395 | Ga0157378_101273952 | 161 |
| 662 | 3300013307 | Ga0157372_10419594 | Ga0157372_104195941 | 161 |
| 663 | 3300014325 | Ga0163163_10266392 | Ga0163163_102663922 | 161 |
| 664 | 3300014969 | Ga0157376_10352311 | Ga0157376_103523112 | 161 |
| 665 | 3300020078 | Ga0206352_10930255 | Ga0206352_109302551 | 161 |
| 666 | 3300020078 | Ga0206352_11231561 | Ga0206352_112315611 | 161 |
| 667 | 3300020080 | Ga0206350_11425950 | Ga0206350_114259501 | 161 |
| 668 | 3300020082 | Ga0206353_10934020 | Ga0206353_109340201 | 161 |
| 669 | 3300021361 | Ga0213872_10091065 | Ga0213872_100910652 | 161 |
| 670 | 3300025909 | Ga0207705_10353530 | Ga0207705_103535302 | 161 |
| 671 | 3300025914 | Ga0207671_10081202 | Ga0207671_100812022 | 161 |
| 672 | 3300025917 | Ga0207660_10215820 | Ga0207660_102158202 | 161 |
| 673 | 3300025921 | Ga0207652_10020065 | Ga0207652_100200655 | 161 |
| 674 | 3300025921 | Ga0207652_10046132 | Ga0207652_100461323 | 161 |
| 675 | 3300025921 | Ga0207652_10089290 | Ga0207652_100892903 | 161 |
| 676 | 3300025924 | Ga0207694_10301344 | Ga0207694_103013442 | 161 |
| 677 | 3300025924 | Ga0207694_10874358 | Ga0207694_108743581 | 161 |
| 678 | 3300025927 | Ga0207687_10316616 | Ga0207687_103166161 | 161 |
| 679 | 3300025944 | Ga0207661_11205822 | Ga0207661_112058221 | 161 |
| 680 | 3300025961 | Ga0207712_10992524 | Ga0207712_109925242 | 161 |
| 681 | 3300026023 | Ga0207677_10188314 | Ga0207677_101883142 | 161 |
| 682 | 3300026078 | Ga0207702_10146425 | Ga0207702_101464252 | 161 |
| 683 | 3300026142 | Ga0207698_10517355 | Ga0207698_105173552 | 161 |
| 684 | 3300031616 | Ga0307508_10066437 | Ga0307508_100664372 | 161 |
| 685 | 3300031711 | Ga0265314_10115351 | Ga0265314_101153512 | 161 |
| 686 | 3300031727 | Ga0316576_10385674 | Ga0316576_103856741 | 161 |
| 687 | 3300031730 | Ga0307516_10267632 | Ga0307516_102676322 | 161 |
| 688 | 3300035170 | Ga0373943_0023787 | Ga0373943_0023787_443_931 | 161 |
| 689 | 3300035172 | Ga0373955_0140590 | Ga0373955_0140590_266_754 | 161 |
| 690 | 3300035692 | Ga0373935_0131049 | Ga0373935_0131049_1034_1522 | 161 |
| 691 | 3300036401 | Ga0373937_0059205 | Ga0373937_0059205_937_1425 | 161 |
| 692 | 3300039447 | Ga0436361_1124647 | Ga0436361_1124647_489_977 | 161 |
| 693 | 3300039450 | Ga0436363_0126406 | Ga0436363_0126406_145_633 | 161 |
| 694 | 3300039450 | Ga0436363_0206308 | Ga0436363_0206308_118_645 | 161 |
| 695 | 3300041486 | Ga0451807_1082726 | Ga0451807_1082726_814_1305 | 161 |
| 696 | 3300041507 | Ga0451851_0662761 | Ga0451851_0662761_16_504 | 161 |
| 697 | 3300044656 | Ga0466969_0005206 | Ga0466969_0005206_4257_4745 | 161 |
| 698 | 3300044684 | Ga0466966_0008662 | Ga0466966_0008662_5817_6305 | 161 |
| 699 | 3300045049 | Ga0466959_0115533 | Ga0466959_0115533_507_995 | 161 |
| 700 | 3300045051 | Ga0451576_0868193 | Ga0451576_0868193_268_801 | 161 |
| 701 | 3300045976 | Ga0466967_1369745 | Ga0466967_1369745_38_526 | 161 |
| 702 | 3300046462 | Ga0495651_0057249 | Ga0495651_0057249_694_1182 | 161 |
| 703 | 3300046529 | Ga0495652_0216038 | Ga0495652_0216038_739_1227 | 161 |
| 704 | 3300046679 | Ga0495623_0059615 | Ga0495623_0059615_785_1273 | 161 |
| 705 | 3300046683 | Ga0495658_0692271 | Ga0495658_0692271_52_540 | 161 |
| 706 | 3300046689 | Ga0495613_0190191 | Ga0495613_0190191_344_832 | 161 |
| 707 | 3300047318 | Ga0495636_0437317 | Ga0495636_0437317_24_512 | 161 |
| 708 | 3300047444 | Ga0495675_0345440 | Ga0495675_0345440_284_772 | 161 |
| 709 | 3300048088 | Ga0495602_0148994 | Ga0495602_0148994_600_1088 | 161 |
| 710 | 3300048915 | Ga0496112_0188973 | Ga0496112_0188973_183_671 | 161 |
| 711 | 3300048918 | Ga0496115_0148508 | Ga0496115_0148508_921_1505 | 161 |
| 712 | 3300049129 | Ga0501309_082223 | Ga0501309_082223_36_524 | 161 |
| 713 | 3300049161 | Ga0501305_072556 | Ga0501305_072556_101_589 | 161 |
| 714 | 3300049583 | Ga0501067_0002509 | Ga0501067_0002509_9180_9665 | 161 |
| 715 | 3300049742 | Ga0501080_0604532 | Ga0501080_0604532_458_949 | 161 |
| 716 | 3300050508 | nmdc:mga09592_49581_c1 | nmdc:mga09592_49581_c1_1928_2416 | 161 |
| 717 | 3300050509 | nmdc:mga0qj67_618341_c1 | nmdc:mga0qj67_618341_c1_241_729 | 161 |
| 718 | 3300050510 | nmdc:mga06r32_780854_c1 | nmdc:mga06r32_780854_c1_417_905 | 161 |
| 719 | 3300050511 | nmdc:mga08y16_4304_c1 | nmdc:mga08y16_4304_c1_8204_8692 | 161 |
| 720 | 3300050511 | nmdc:mga08y16_872549_c1 | nmdc:mga08y16_872549_c1_117_605 | 161 |
| 721 | 3300050512 | nmdc:mga0n895_531242_c1 | nmdc:mga0n895_531242_c1_541_1029 | 161 |
| 722 | 3300053085 | Ga0495619_0282760 | Ga0495619_0282760_450_938 | 161 |
| 723 | 3300059492 | Ga0587073_0262591 | Ga0587073_0262591_14_502 | 161 |
| 724 | 3300060346 | Ga0587111_0216772 | Ga0587111_0216772_36_524 | 161 |
| 725 | 3300002868 | Ga0006767J43181_103406 | Ga0006767J43181_1034061 | 162 |
| 726 | 3300002870 | Ga0006763J43179_104556 | Ga0006763J43179_1045561 | 162 |
| 727 | 3300003162 | Ga0006778J45830_1019747 | Ga0006778J45830_10197471 | 162 |
| 728 | 3300003163 | Ga0006759J45824_1009006 | Ga0006759J45824_10090061 | 162 |
| 729 | 3300003300 | Ga0006758J48902_1010140 | Ga0006758J48902_10101401 | 162 |
| 730 | 3300003305 | Ga0006770J48903_1020700 | Ga0006770J48903_10207001 | 162 |
| 731 | 3300003693 | Ga0032354_1024924 | Ga0032354_10249241 | 162 |
| 732 | 3300006844 | Ga0075428_100496197 | Ga0075428_1004961972 | 162 |
| 733 | 3300031728 | Ga0316578_10144825 | Ga0316578_101448252 | 162 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7kim-assembly1.cif.gz_M | mycobacterium tuberculosis wt rnap transcription closed promoter complex with whib7 transcription factor | 0.8661 | 3 | 159 |
| 4xlr-assembly1.cif.gz_M | crystal structure of t.aquaticus transcription initiation complex with card containing bubble promoter and rna | 0.8622 | 3 | 159 |
| 4xls-assembly2.cif.gz_N | crystal structure of t. aquaticus transcription initiation complex with card containing upstream fork promoter. | 0.8591 | 3 | 159 |
| 2lqk-assembly1.cif.gz_A | nmr solution structure of the n-terminal domain of the cdnl protein from thermus thermophilus | 0.8585 | 2 | 64 |
| 6vw0-assembly1.cif.gz_M | mycobacterium tuberculosis rnap s456l mutant open promoter complex | 0.8518 | 3 | 162 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4kbmB01 | Mainly Beta;Beta Barrel;Thrombin, subunit H; | 0.948 | 3 | 60 | 2.40.10.170 |
| 4kbmB02 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;CarD-like, C-terminal domain | 0.9411 | 62 | 162 | 1.20.58.1290 |
| 4kbmB02 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;CarD-like, C-terminal domain | 0.9315 | 62 | 162 | 1.20.58.1290 |
| 4kbmB01 | Mainly Beta;Beta Barrel;Thrombin, subunit H; | 0.9159 | 3 | 60 | 2.40.10.170 |
| 2lqkA00 | Mainly Beta;Beta Barrel;Thrombin, subunit H; | 0.8585 | 2 | 64 | 2.40.10.170 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6I3CRD3-F1-model_v4 | CarD family transcriptional regulator | 0.9502 | 66 | 162 |
GO:0009303
|
| AF-A0A3M1SAV7-F1-model_v4 | CarD-like/TRCF RNAP-interacting domain-containing protein | 0.9477 | 1 | 161 |
GO:0009303
|
| AF-A0A257JGR4-F1-model_v4 | CarD family transcriptional regulator | 0.9476 | 2 | 64 |
GO:0009303
|
| AF-A0A3E0P0Z8-F1-model_v4 | CarD family transcriptional regulator | 0.9465 | 3 | 161 |
GO:0009303
|
| AF-A0A3M1VQQ5-F1-model_v4 | CarD family transcriptional regulator | 0.945 | 4 | 159 |
GO:0009303
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar