F478105

General Info

Members Datasets Scaffolds Average Seq Length
733 362 733 163

Family's Representative Sequence

Representative Sequence 3300048918|Ga0496115_0148508|Ga0496115_0148508_921_1505
Length 194
Sequence MPKKRHTFTKAGTARAYKRCGPAPRPAQPEDKMLEFHVGDKAVYPAQGVAEVVGIDAKEISGTVHKFYVLRVLDSDMRILVPIDKAEQVGLREVAKEDQIKEVYDILKEKELHIDKQTWNRRYRGFMEKIKTGSLFEVAEVFRDLYRLKNQKTLSFGERRMLDTAKNLIVKELSVAKNTTEAKVEKDLEKIFSC

Samples

Sample ID Description Type Environment
1 3300002868 Avena fatua rhizosphere microbial communities - H2_Bulk_Litter_10 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
2 3300002870 Avena fatua rhizosphere microbial communities - H1_Bulk_Litter_6 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
3 3300003162 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
4 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
5 3300003300 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
6 3300003305 Avena fatua rhizosphere microbial communities - H3_Rhizo_Litter_13 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
7 3300003308 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
8 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
9 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
10 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
11 3300003735 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_23 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
12 3300004785 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-1 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
13 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
14 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
15 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
16 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
17 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
18 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
19 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
20 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
21 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
22 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
23 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
24 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
25 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
26 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
27 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
28 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
29 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
30 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
31 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
32 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
33 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
34 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
35 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
36 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
37 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
38 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
39 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
40 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
41 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
42 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
43 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
44 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
45 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
46 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
47 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
48 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
49 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
50 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
51 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
52 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
53 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
54 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
55 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
56 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
57 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
58 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
59 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
60 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
61 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
62 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
63 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
64 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
65 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
66 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
67 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
68 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
69 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
70 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
71 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
72 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
73 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
74 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
75 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
76 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
77 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
78 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
79 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
80 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
81 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
82 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
84 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
85 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
86 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
87 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
88 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
89 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
90 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
91 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
92 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
93 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
94 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
95 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
97 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
98 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
99 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
100 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
101 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
102 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
103 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
104 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
105 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
106 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
107 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
108 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
109 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
110 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
111 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
112 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
113 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
114 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
115 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
116 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
117 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
118 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
119 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
120 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
121 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
122 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
123 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
124 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
175 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
179 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
180 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
181 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
182 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
183 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
184 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
185 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
186 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
187 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
188 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
189 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
190 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
191 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
192 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
193 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
194 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
195 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
196 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
197 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
198 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
199 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
200 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
201 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
202 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
203 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
204 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
205 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
206 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
207 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
208 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
209 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
210 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
211 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
212 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
213 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
214 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
215 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
216 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
217 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
218 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
219 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
220 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
221 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
222 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
223 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
224 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
225 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
226 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
227 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
228 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
229 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
230 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
231 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
232 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
233 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
234 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
235 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
236 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
237 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
238 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
239 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
240 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
241 3300041446 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaT Metatranscriptome Rhizoplane
242 3300041455 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaT Metatranscriptome Rhizoplane
243 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
244 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
245 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
246 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
247 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
248 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
249 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
250 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
251 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
252 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
253 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
254 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
255 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
256 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
257 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
258 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
259 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
260 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
261 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
262 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
263 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
264 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
265 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
266 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
267 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
268 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
269 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
270 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
271 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
272 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
273 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
274 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
275 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
276 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
277 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
278 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
279 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
280 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
281 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
282 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
283 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
284 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
285 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
286 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
287 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
288 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
289 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
290 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
291 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
292 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
293 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
294 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
295 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
296 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
297 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
298 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
299 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
300 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
301 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
302 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
303 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
304 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
305 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
306 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
307 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
308 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
309 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
310 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
311 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
312 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
313 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
314 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
315 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
316 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
317 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
318 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
319 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
320 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
321 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
322 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
323 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
324 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
325 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
326 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
327 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
328 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
329 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
330 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
331 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
332 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
333 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
334 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
335 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
336 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
337 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
338 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
339 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
340 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
341 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
342 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
343 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
344 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
345 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
346 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
347 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
348 3300053144 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 endosphere Metagenome Endosphere
349 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
350 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
351 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
352 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
353 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
354 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
355 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
356 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
357 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
358 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
359 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
360 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
361 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
362 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.18
Metatranscriptomes 6.82
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.68
Nodule 0
Rhizoplane 3.68
Rhizosphere 87.59
Stem 0
Stem Tuber 0
Unclassified 5.05

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0006767J43181_103406 3300002868 Bacteria 753
2 Ga0006763J43179_104556 3300002870 Bacteria 735
3 Ga0006778J45830_1019747 3300003162 Bacteria 927
4 Ga0006759J45824_1009006 3300003163 Bacteria 3640
5 Ga0006758J48902_1010140 3300003300 Bacteria 742
6 Ga0006770J48903_1020700 3300003305 Bacteria 681
7 Ga0006777J48905_1063988 3300003308 Bacteria 921
8 rootH1_10017798 3300003323 Bacteria 8997
9 Ga0007417J51691_1062475 3300003544 Bacteria 735
10 Ga0032354_1024924 3300003693 Bacteria 3788
11 Ga0006780_1012978 3300003735 Bacteria 794
12 Ga0058858_1001068 3300004785 Bacteria 609
13 Ga0058859_10037633 3300004798 Bacteria 789
14 Ga0058859_10058200 3300004798 Bacteria 723
15 Ga0058859_11799976 3300004798 Bacteria 892
16 Ga0058859_11807595 3300004798 Unclassified 897
17 Ga0058863_11731370 3300004799 Unclassified 917
18 Ga0058863_11858214 3300004799 Bacteria 580
19 Ga0058863_11948672 3300004799 Bacteria 742
20 Ga0058861_10028637 3300004800 Bacteria 781
21 Ga0058861_10044879 3300004800 Bacteria 750
22 Ga0058861_10072934 3300004800 Bacteria 676
23 Ga0058861_11912080 3300004800 Bacteria 634
24 Ga0058860_10120307 3300004801 Bacteria 812
25 Ga0058860_12053824 3300004801 Bacteria 621
26 Ga0058860_12103954 3300004801 Bacteria 911
27 Ga0058860_12209524 3300004801 Bacteria 773
28 Ga0058862_10089401 3300004803 Bacteria 691
29 Ga0058862_12606125 3300004803 Bacteria 619
30 Ga0058862_12795608 3300004803 Bacteria 807
31 Ga0058862_12802071 3300004803 Unclassified 594
32 Ga0065712_10235307 3300005290 Bacteria 993
33 Ga0065715_10446724 3300005293 Unclassified 830
34 Ga0070658_10005201 3300005327 Bacteria 10587
35 Ga0070658_10039648 3300005327 Bacteria 3799
36 Ga0070658_10151981 3300005327 Bacteria 1939
37 Ga0070676_10010598 3300005328 Bacteria 5001
38 Ga0070683_100007795 3300005329 Bacteria 9067
39 Ga0070683_100095265 3300005329 Bacteria 2799
40 Ga0070683_100145389 3300005329 Bacteria 2246
41 Ga0070683_100245232 3300005329 Bacteria 1704
42 Ga0070683_100486418 3300005329 Unclassified 1178
43 Ga0070683_101498062 3300005329 Bacteria 648
44 Ga0070690_100005437 3300005330 Bacteria 7157
45 Ga0070690_100018706 3300005330 Bacteria 4189
46 Ga0070690_100071796 3300005330 Bacteria 2249
47 Ga0070690_100210387 3300005330 Bacteria 1358
48 Ga0070670_100249953 3300005331 Bacteria 1545
49 Ga0070670_100336200 3300005331 Bacteria 1325
50 Ga0070677_10155161 3300005333 Bacteria 1069
51 Ga0068869_100086742 3300005334 Unclassified 2347
52 Ga0068869_100184302 3300005334 Bacteria 1638
53 Ga0068869_100219777 3300005334 Bacteria 1505
54 Ga0068869_100862082 3300005334 Bacteria 782
55 Ga0068869_101075749 3300005334 Bacteria 703
56 Ga0070680_100119345 3300005336 Bacteria 2200
57 Ga0070680_100230372 3300005336 Bacteria 1564
58 Ga0070680_101040631 3300005336 Bacteria 707
59 Ga0070682_100004298 3300005337 Bacteria 7911
60 Ga0070682_100171913 3300005337 Bacteria 1507
61 Ga0070682_100429614 3300005337 Bacteria 1006
62 Ga0070682_100779355 3300005337 Bacteria 775
63 Ga0068868_100127115 3300005338 Unclassified 2083
64 Ga0068868_100146484 3300005338 Bacteria 1942
65 Ga0068868_100270410 3300005338 Bacteria 1436
66 Ga0070689_100000014 3300005340 Bacteria 185640
67 Ga0070689_100037336 3300005340 Bacteria 3714
68 Ga0070689_100046691 3300005340 Bacteria 3338
69 Ga0070689_100092152 3300005340 Bacteria 2390
70 Ga0070689_100286957 3300005340 Unclassified 1367
71 Ga0070689_100490444 3300005340 Bacteria 1051
72 Ga0070689_100537387 3300005340 Bacteria 1006
73 Ga0070687_100000637 3300005343 Bacteria 11614
74 Ga0070687_100149715 3300005343 Bacteria 1368
75 Ga0070692_10171243 3300005345 Bacteria 1252
76 Ga0070692_10213450 3300005345 Bacteria 1137
77 Ga0070692_10905992 3300005345 Bacteria 610
78 Ga0070668_100011396 3300005347 Bacteria 6624
79 Ga0070669_100022080 3300005353 Bacteria 4552
80 Ga0070675_100069692 3300005354 Bacteria 2914
81 Ga0070675_100142301 3300005354 Bacteria 2051
82 Ga0070671_101093360 3300005355 Unclassified 700
83 Ga0070674_100078018 3300005356 Bacteria 2360
84 Ga0070674_100235237 3300005356 Bacteria 1432
85 Ga0070673_100000555 3300005364 Bacteria 20114
86 Ga0070673_100034675 3300005364 Bacteria 3821
87 Ga0070673_100161161 3300005364 Bacteria 1908
88 Ga0070673_100212906 3300005364 Bacteria 1670
89 Ga0070673_101872717 3300005364 Unclassified 569
90 Ga0070688_100031115 3300005365 Bacteria 3208
91 Ga0070688_100204884 3300005365 Bacteria 1382
92 Ga0070688_100206470 3300005365 Unclassified 1377
93 Ga0070688_100375360 3300005365 Bacteria 1047
94 Ga0070659_100358206 3300005366 Bacteria 1225
95 Ga0070667_100397437 3300005367 Bacteria 1254
96 Ga0070667_100562141 3300005367 Bacteria 1049
97 Ga0070709_10343786 3300005434 Unclassified 1101
98 Ga0070714_101194858 3300005435 Bacteria 742
99 Ga0070713_100308105 3300005436 Bacteria 1460
100 Ga0070713_100455194 3300005436 Unclassified 1202
101 Ga0070710_10107256 3300005437 Unclassified 1673
102 Ga0070710_10313822 3300005437 Unclassified 1027
103 Ga0070701_10012877 3300005438 Bacteria 3787
104 Ga0070701_10233544 3300005438 Unclassified 1103
105 Ga0070701_10248081 3300005438 Bacteria 1074
106 Ga0070711_100251259 3300005439 Unclassified 1387
107 Ga0070705_100064679 3300005440 Bacteria 2186
108 Ga0070705_100458562 3300005440 Bacteria 958
109 Ga0070705_100505838 3300005440 Bacteria 918
110 Ga0070700_100056685 3300005441 Bacteria 2457
111 Ga0070700_101081596 3300005441 Bacteria 664
112 Ga0070708_100239897 3300005445 Bacteria 1702
113 Ga0070708_100307439 3300005445 Bacteria 1493
114 Ga0070678_100017410 3300005456 Bacteria 4626
115 Ga0070662_100678156 3300005457 Bacteria 871
116 Ga0070681_10039022 3300005458 Bacteria 4761
117 Ga0070681_10089395 3300005458 Bacteria 3032
118 Ga0070681_10255727 3300005458 Bacteria 1664
119 Ga0070681_10374590 3300005458 Bacteria 1334
120 Ga0070681_10687205 3300005458 Unclassified 939
121 Ga0068867_100036835 3300005459 Bacteria 3553
122 Ga0068867_100644592 3300005459 Bacteria 929
123 Ga0070685_10036407 3300005466 Unclassified 2782
124 Ga0070685_10405878 3300005466 Bacteria 945
125 Ga0070685_10446920 3300005466 Bacteria 905
126 Ga0070685_10535699 3300005466 Unclassified 834
127 Ga0070706_100044331 3300005467 Bacteria 4109
128 Ga0070706_100053704 3300005467 Bacteria 3719
129 Ga0070706_100502678 3300005467 Bacteria 1128
130 Ga0070706_101069847 3300005467 Unclassified 743
131 Ga0070706_101164673 3300005467 Bacteria 709
132 Ga0070698_100001555 3300005471 Bacteria 25472
133 Ga0070698_100031473 3300005471 Bacteria 5501
134 Ga0070698_100378060 3300005471 Bacteria 1349
135 Ga0070699_100130956 3300005518 Bacteria 2211
136 Ga0070679_100024718 3300005530 Bacteria 5887
137 Ga0070679_100046846 3300005530 Bacteria 4310
138 Ga0070679_100123082 3300005530 Bacteria 2577
139 Ga0070684_100020180 3300005535 Bacteria 5529
140 Ga0070684_100126031 3300005535 Bacteria 2307
141 Ga0070684_100310446 3300005535 Bacteria 1448
142 Ga0070684_100311799 3300005535 Bacteria 1445
143 Ga0070684_100394316 3300005535 Unclassified 1276
144 Ga0070684_100665791 3300005535 Bacteria 969
145 Ga0068853_100868153 3300005539 Bacteria 866
146 Ga0070672_100021741 3300005543 Bacteria 4698
147 Ga0070672_100120858 3300005543 Unclassified 2144
148 Ga0070686_100102762 3300005544 Bacteria 1933
149 Ga0070686_100179626 3300005544 Bacteria 1503
150 Ga0070695_100794347 3300005545 Unclassified 758
151 Ga0070696_100572343 3300005546 Bacteria 908
152 Ga0070693_100431066 3300005547 Unclassified 921
153 Ga0070665_100017791 3300005548 Bacteria 7135
154 Ga0070665_100553430 3300005548 Unclassified 1163
155 Ga0070665_100737658 3300005548 Unclassified 998
156 Ga0070665_100899637 3300005548 Bacteria 898
157 Ga0070665_101056925 3300005548 Bacteria 824
158 Ga0070704_100280151 3300005549 Bacteria 1381
159 Ga0070704_100436241 3300005549 Bacteria 1125
160 Ga0068855_100022861 3300005563 Bacteria 7494
161 Ga0068855_100377664 3300005563 Bacteria 1557
162 Ga0068855_101414345 3300005563 Bacteria 716
163 Ga0070664_100335725 3300005564 Bacteria 1372
164 Ga0070664_101359286 3300005564 Bacteria 671
165 Ga0068857_100210635 3300005577 Bacteria 1773
166 Ga0068857_100983401 3300005577 Bacteria 812
167 Ga0068856_100033363 3300005614 Bacteria 5040
168 Ga0068856_100124689 3300005614 Bacteria 2579
169 Ga0068856_100138125 3300005614 Bacteria 2443
170 Ga0068856_100619911 3300005614 Bacteria 1103
171 Ga0068856_100732906 3300005614 Bacteria 1009
172 Ga0070702_100030529 3300005615 Bacteria 2939
173 Ga0070702_100842071 3300005615 Unclassified 713
174 Ga0068852_100327667 3300005616 Bacteria 1489
175 Ga0068859_100175781 3300005617 Bacteria 2223
176 Ga0068864_100189684 3300005618 Bacteria 1884
177 Ga0068861_100181385 3300005719 Unclassified 1753
178 Ga0068861_100288465 3300005719 Unclassified 1416
179 Ga0068863_100060378 3300005841 Bacteria 3586
180 Ga0068863_100060693 3300005841 Bacteria 3576
181 Ga0068863_101108776 3300005841 Bacteria 796
182 Ga0068858_101460560 3300005842 Bacteria 674
183 Ga0068860_101010563 3300005843 Bacteria 850
184 Ga0068860_101181934 3300005843 Unclassified 785
185 Ga0068862_100051189 3300005844 Bacteria 3531
186 Ga0068862_100986125 3300005844 Bacteria 833
187 Ga0097621_100269462 3300006237 Bacteria 1496
188 Ga0068871_100186909 3300006358 Bacteria 1783
189 Ga0068871_100236550 3300006358 Bacteria 1587
190 Ga0068871_100378155 3300006358 Bacteria 1258
191 Ga0068871_100432700 3300006358 Bacteria 1177
192 Ga0075428_100099931 3300006844 Bacteria 3164
193 Ga0075428_100409091 3300006844 Bacteria 1454
194 Ga0075428_100496197 3300006844 Bacteria 1306
195 Ga0075428_101993830 3300006844 Unclassified 602
196 Ga0075428_102148790 3300006844 Bacteria 577
197 Ga0075430_100468418 3300006846 Bacteria 1040
198 Ga0075430_100604573 3300006846 Bacteria 905
199 Ga0075430_101005690 3300006846 Bacteria 687
200 Ga0075431_100673859 3300006847 Bacteria 1013
201 Ga0075434_101269391 3300006871 Bacteria 748
202 Ga0075429_100016106 3300006880 Bacteria 6476
203 Ga0075429_100025611 3300006880 Bacteria 5120
204 Ga0075429_100120669 3300006880 Bacteria 2292
205 Ga0068865_100021367 3300006881 Bacteria 4207
206 Ga0097620_100175774 3300006931 Bacteria 2223
207 Ga0075435_100052581 3300007076 Bacteria 3282
208 Ga0075435_100251661 3300007076 Unclassified 1504
209 Ga0099795_10026665 3300007788 Unclassified 1948
210 Ga0105250_10249548 3300009092 Bacteria 758
211 Ga0105240_10000261 3300009093 Bacteria 104567
212 Ga0105240_10056624 3300009093 Unclassified 4905
213 Ga0105240_10413916 3300009093 Bacteria 1516
214 Ga0105240_10567824 3300009093 Bacteria 1253
215 Ga0105240_10674777 3300009093 Bacteria 1130
216 Ga0111539_10010727 3300009094 Bacteria 11532
217 Ga0111539_10027557 3300009094 Bacteria 6940
218 Ga0111539_11247359 3300009094 Bacteria 863
219 Ga0111539_11710388 3300009094 Bacteria 729
220 Ga0105245_10000149 3300009098 Bacteria 66131
221 Ga0105245_10386618 3300009098 Bacteria 1395
222 Ga0105245_10833426 3300009098 Bacteria 962
223 Ga0114129_10911327 3300009147 Unclassified 1113
224 Ga0114129_12832497 3300009147 Bacteria 575
225 Ga0105243_10266489 3300009148 Bacteria 1536
226 Ga0105243_10288692 3300009148 Bacteria 1481
227 Ga0105241_11624293 3300009174 Bacteria 626
228 Ga0105248_10524001 3300009177 Bacteria 1336
229 Ga0105248_11198455 3300009177 Unclassified 858
230 Ga0105248_11277189 3300009177 Bacteria 830
231 Ga0105248_12154383 3300009177 Bacteria 634
232 Ga0105237_10000062 3300009545 Bacteria 144236
233 Ga0105237_10126013 3300009545 Bacteria 2555
234 Ga0105237_10233412 3300009545 Bacteria 1841
235 Ga0105238_10018097 3300009551 Bacteria 7164
236 Ga0105238_10339966 3300009551 Bacteria 1489
237 Ga0105238_10608562 3300009551 Bacteria 1101
238 Ga0105238_10924681 3300009551 Unclassified 891
239 Ga0105238_11022354 3300009551 Bacteria 848
240 Ga0105238_11134594 3300009551 Bacteria 805
241 Ga0105238_11374055 3300009551 Bacteria 733
242 Ga0105249_10028685 3300009553 Bacteria 5023
243 Ga0105249_10034840 3300009553 Bacteria 4563
244 Ga0105249_10282279 3300009553 Bacteria 1659
245 Ga0105249_11011169 3300009553 Bacteria 900
246 Ga0105239_10149195 3300010375 Bacteria 2609
247 Ga0105239_10446986 3300010375 Unclassified 1466
248 Ga0105239_12347512 3300010375 Bacteria 621
249 Ga0157371_10482225 3300013102 Bacteria 914
250 Ga0157369_10139736 3300013105 Bacteria 2563
251 Ga0157374_10031333 3300013296 Bacteria 4833
252 Ga0157374_10237419 3300013296 Unclassified 1792
253 Ga0157374_10321406 3300013296 Bacteria 1533
254 Ga0157374_10500330 3300013296 Bacteria 1220
255 Ga0157374_10614906 3300013296 Bacteria 1097
256 Ga0157374_10878055 3300013296 Bacteria 914
257 Ga0157378_10092416 3300013297 Bacteria 2753
258 Ga0157378_10094569 3300013297 Bacteria 2721
259 Ga0157378_10127395 3300013297 Bacteria 2353
260 Ga0157378_10299314 3300013297 Bacteria 1556
261 Ga0157378_10371988 3300013297 Bacteria 1401
262 Ga0163162_10481773 3300013306 Bacteria 1372
263 Ga0163162_11418384 3300013306 Bacteria 790
264 Ga0163162_12230965 3300013306 Bacteria 629
265 Ga0157372_10419594 3300013307 Bacteria 1559
266 Ga0157372_11228119 3300013307 Bacteria 866
267 Ga0157372_11954574 3300013307 Bacteria 674
268 Ga0157375_10521241 3300013308 Bacteria 1352
269 Ga0157375_11017422 3300013308 Bacteria 968
270 Ga0163163_10247634 3300014325 Bacteria 1832
271 Ga0163163_10266392 3300014325 Bacteria 1764
272 Ga0157380_10191869 3300014326 Bacteria 1805
273 Ga0157380_10969772 3300014326 Bacteria 881
274 Ga0157377_10306998 3300014745 Bacteria 1049
275 Ga0157376_10150460 3300014969 Bacteria 2098
276 Ga0157376_10352311 3300014969 Bacteria 1409
277 Ga0157376_10585612 3300014969 Unclassified 1108
278 Ga0157376_10970374 3300014969 Unclassified 871
279 Ga0157376_12122341 3300014969 Unclassified 600
280 Ga0206356_10416233 3300020070 Unclassified 796
281 Ga0206352_10930255 3300020078 Bacteria 527
282 Ga0206352_11231561 3300020078 Bacteria 565
283 Ga0206352_11250444 3300020078 Unclassified 638
284 Ga0206350_11425950 3300020080 Unclassified 554
285 Ga0206353_10934020 3300020082 Bacteria 558
286 Ga0206353_11912490 3300020082 Bacteria 920
287 Ga0206353_12007426 3300020082 Bacteria 574
288 Ga0213872_10091065 3300021361 Bacteria 1365
289 Ga0213874_10099193 3300021377 Bacteria 966
290 Ga0213876_10103309 3300021384 Bacteria 1511
291 Ga0213876_10264700 3300021384 Bacteria 914
292 Ga0224712_10362701 3300022467 Bacteria 686
293 Ga0207697_10065641 3300025315 Bacteria 1515
294 Ga0207653_10072387 3300025885 Bacteria 1180
295 Ga0207692_10085877 3300025898 Unclassified 1694
296 Ga0207688_10081808 3300025901 Bacteria 1845
297 Ga0207699_10311250 3300025906 Unclassified 1102
298 Ga0207645_10003612 3300025907 Bacteria 11702
299 Ga0207705_10018431 3300025909 Bacteria 4992
300 Ga0207705_10040703 3300025909 Bacteria 3334
301 Ga0207705_10353530 3300025909 Bacteria 1132
302 Ga0207684_10040963 3300025910 Bacteria 3928
303 Ga0207707_10335988 3300025912 Unclassified 1303
304 Ga0207707_10600145 3300025912 Unclassified 932
305 Ga0207707_10690862 3300025912 Unclassified 857
306 Ga0207695_10001635 3300025913 Bacteria 36218
307 Ga0207695_10161010 3300025913 Bacteria 2176
308 Ga0207695_10286807 3300025913 Bacteria 1539
309 Ga0207671_10000140 3300025914 Bacteria 111643
310 Ga0207671_10081202 3300025914 Bacteria 2431
311 Ga0207671_10260767 3300025914 Bacteria 1364
312 Ga0207671_10928554 3300025914 Bacteria 687
313 Ga0207693_10165904 3300025915 Bacteria 1738
314 Ga0207660_10052199 3300025917 Bacteria 2910
315 Ga0207660_10215820 3300025917 Bacteria 1504
316 Ga0207660_10399731 3300025917 Bacteria 1106
317 Ga0207662_10001434 3300025918 Bacteria 11559
318 Ga0207662_10019856 3300025918 Bacteria 3829
319 Ga0207662_10022717 3300025918 Bacteria 3599
320 Ga0207662_10336348 3300025918 Bacteria 1011
321 Ga0207662_10426201 3300025918 Unclassified 903
322 Ga0207652_10002792 3300025921 Bacteria 14648
323 Ga0207652_10006188 3300025921 Bacteria 9670
324 Ga0207652_10013232 3300025921 Bacteria 6683
325 Ga0207652_10020065 3300025921 Bacteria 5504
326 Ga0207652_10046132 3300025921 Bacteria 3717
327 Ga0207652_10085864 3300025921 Bacteria 2758
328 Ga0207652_10089290 3300025921 Bacteria 2706
329 Ga0207681_10019671 3300025923 Bacteria 4269
330 Ga0207694_10301344 3300025924 Bacteria 1320
331 Ga0207694_10697357 3300025924 Unclassified 856
332 Ga0207694_10874358 3300025924 Unclassified 760
333 Ga0207694_10889563 3300025924 Bacteria 753
334 Ga0207650_10202670 3300025925 Bacteria 1590
335 Ga0207650_10295477 3300025925 Unclassified 1322
336 Ga0207650_10625559 3300025925 Bacteria 906
337 Ga0207659_10051985 3300025926 Bacteria 2917
338 Ga0207659_10082026 3300025926 Bacteria 2386
339 Ga0207659_10505329 3300025926 Bacteria 1024
340 Ga0207659_10915494 3300025926 Bacteria 754
341 Ga0207687_10000526 3300025927 Bacteria 25654
342 Ga0207687_10175271 3300025927 Unclassified 1657
343 Ga0207687_10184076 3300025927 Bacteria 1620
344 Ga0207687_10316616 3300025927 Bacteria 1262
345 Ga0207700_10419432 3300025928 Unclassified 1175
346 Ga0207690_10336023 3300025932 Bacteria 1191
347 Ga0207706_10074130 3300025933 Bacteria 2993
348 Ga0207686_10455862 3300025934 Bacteria 984
349 Ga0207709_10131077 3300025935 Bacteria 1709
350 Ga0207709_10175998 3300025935 Bacteria 1506
351 Ga0207670_10000003 3300025936 Bacteria 760449
352 Ga0207670_10002754 3300025936 Bacteria 9256
353 Ga0207670_10013353 3300025936 Bacteria 4839
354 Ga0207670_10024078 3300025936 Bacteria 3801
355 Ga0207670_10030666 3300025936 Bacteria 3436
356 Ga0207670_10076250 3300025936 Bacteria 2333
357 Ga0207670_10709534 3300025936 Unclassified 833
358 Ga0207704_10009349 3300025938 Bacteria 4726
359 Ga0207704_10012288 3300025938 Bacteria 4248
360 Ga0207691_10120325 3300025940 Unclassified 2328
361 Ga0207711_10369105 3300025941 Bacteria 1331
362 Ga0207689_10459039 3300025942 Bacteria 1065
363 Ga0207661_10035952 3300025944 Bacteria 3863
364 Ga0207661_10241825 3300025944 Bacteria 1602
365 Ga0207661_10701172 3300025944 Bacteria 931
366 Ga0207661_11205822 3300025944 Bacteria 696
367 Ga0207661_11727273 3300025944 Bacteria 571
368 Ga0207679_10809071 3300025945 Bacteria 855
369 Ga0207667_10049364 3300025949 Bacteria 4444
370 Ga0207667_10433651 3300025949 Bacteria 1336
371 Ga0207651_10001985 3300025960 Bacteria 9618
372 Ga0207651_10060180 3300025960 Bacteria 2635
373 Ga0207651_10564354 3300025960 Bacteria 991
374 Ga0207712_10117111 3300025961 Bacteria 2009
375 Ga0207712_10204728 3300025961 Bacteria 1567
376 Ga0207712_10992524 3300025961 Bacteria 745
377 Ga0207668_10107941 3300025972 Bacteria 2082
378 Ga0207640_10950790 3300025981 Bacteria 753
379 Ga0207658_10779427 3300025986 Bacteria 867
380 Ga0207658_11678133 3300025986 Bacteria 580
381 Ga0207677_10037003 3300026023 Bacteria 3186
382 Ga0207677_10188314 3300026023 Bacteria 1630
383 Ga0207677_10870869 3300026023 Bacteria 810
384 Ga0207703_10032822 3300026035 Bacteria 4112
385 Ga0207703_10864716 3300026035 Unclassified 865
386 Ga0207703_11396313 3300026035 Bacteria 674
387 Ga0207678_11094763 3300026067 Bacteria 705
388 Ga0207708_10004519 3300026075 Bacteria 10237
389 Ga0207702_10024695 3300026078 Bacteria 4987
390 Ga0207702_10146425 3300026078 Bacteria 2144
391 Ga0207702_10166958 3300026078 Bacteria 2015
392 Ga0207702_10171046 3300026078 Bacteria 1992
393 Ga0207702_10187462 3300026078 Bacteria 1909
394 Ga0207641_10233486 3300026088 Bacteria 1710
395 Ga0207641_11371555 3300026088 Unclassified 708
396 Ga0207648_10052397 3300026089 Bacteria 3567
397 Ga0207676_10121380 3300026095 Bacteria 2205
398 Ga0207676_10192480 3300026095 Bacteria 1796
399 Ga0207676_10960686 3300026095 Bacteria 840
400 Ga0207674_10093047 3300026116 Bacteria 3004
401 Ga0207674_10298608 3300026116 Bacteria 1560
402 Ga0207674_10457219 3300026116 Bacteria 1234
403 Ga0207674_10912614 3300026116 Bacteria 847
404 Ga0207675_100086590 3300026118 Bacteria 2942
405 Ga0207683_10010985 3300026121 Bacteria 7721
406 Ga0207683_10031446 3300026121 Bacteria 4607
407 Ga0207683_10578615 3300026121 Unclassified 1039
408 Ga0207698_10205230 3300026142 Bacteria 1768
409 Ga0207698_10517355 3300026142 Bacteria 1164
410 Ga0207698_10877910 3300026142 Bacteria 903
411 Ga0207428_10031981 3300027907 Bacteria 4333
412 Ga0268266_10017339 3300028379 Bacteria 6145
413 Ga0268266_11013872 3300028379 Unclassified 803
414 Ga0268266_11971810 3300028379 Bacteria 557
415 Ga0268265_10127206 3300028380 Bacteria 2111
416 Ga0268264_10707640 3300028381 Bacteria 1001
417 Ga0265326_10033289 3300028558 Bacteria 1467
418 Ga0265319_1090029 3300028563 Unclassified 969
419 Ga0265319_1118774 3300028563 Bacteria 825
420 Ga0265318_10000110 3300028577 Bacteria 75921
421 Ga0265318_10000678 3300028577 Bacteria 23115
422 Ga0265336_10008055 3300028666 Bacteria 3715
423 Ga0307517_10048705 3300028786 Bacteria 4354
424 Ga0307515_10034085 3300028794 Bacteria 8355
425 Ga0265338_10001473 3300028800 Bacteria 38143
426 Ga0265338_10198104 3300028800 Bacteria 1516
427 Ga0265338_10705035 3300028800 Unclassified 696
428 Ga0265330_10001283 3300031235 Bacteria 14689
429 Ga0265330_10001591 3300031235 Bacteria 13037
430 Ga0265332_10000070 3300031238 Bacteria 86771
431 Ga0265332_10003169 3300031238 Bacteria 8006
432 Ga0265332_10007480 3300031238 Bacteria 4938
433 Ga0265332_10127037 3300031238 Unclassified 1070
434 Ga0265328_10001530 3300031239 Bacteria 10677
435 Ga0265328_10002763 3300031239 Bacteria 7857
436 Ga0265328_10002834 3300031239 Bacteria 7745
437 Ga0265320_10000040 3300031240 Bacteria 131841
438 Ga0265320_10028248 3300031240 Bacteria 2915
439 Ga0265320_10053692 3300031240 Bacteria 1946
440 Ga0265325_10060051 3300031241 Bacteria 1933
441 Ga0265329_10000562 3300031242 Bacteria 19213
442 Ga0265329_10005698 3300031242 Bacteria 5007
443 Ga0265340_10104943 3300031247 Bacteria 1311
444 Ga0265339_10000504 3300031249 Bacteria 30429
445 Ga0265339_10005031 3300031249 Bacteria 8892
446 Ga0265339_10012768 3300031249 Bacteria 5108
447 Ga0265331_10000083 3300031250 Bacteria 131846
448 Ga0265331_10001199 3300031250 Bacteria 19544
449 Ga0265331_10310063 3300031250 Unclassified 707
450 Ga0265316_10000532 3300031344 Bacteria 42948
451 Ga0265316_10007776 3300031344 Bacteria 10038
452 Ga0265316_10073174 3300031344 Bacteria 2640
453 Ga0307513_10003393 3300031456 Bacteria 21651
454 Ga0307509_10000039 3300031507 Bacteria 185329
455 Ga0307509_10007659 3300031507 Bacteria 14033
456 Ga0307509_10035298 3300031507 Bacteria 5490
457 Ga0307509_10248233 3300031507 Bacteria 1566
458 Ga0265313_10001169 3300031595 Bacteria 25109
459 Ga0265313_10012957 3300031595 Bacteria 5047
460 Ga0265313_10023987 3300031595 Bacteria 3271
461 Ga0265313_10034747 3300031595 Bacteria 2546
462 Ga0307508_10013069 3300031616 Bacteria 7592
463 Ga0307508_10066437 3300031616 Bacteria 3175
464 Ga0307508_10262111 3300031616 Bacteria 1323
465 Ga0265314_10000099 3300031711 Bacteria 131848
466 Ga0265314_10002880 3300031711 Bacteria 17079
467 Ga0265314_10006401 3300031711 Bacteria 10433
468 Ga0265314_10115351 3300031711 Bacteria 1700
469 Ga0265314_10281018 3300031711 Bacteria 942
470 Ga0265342_10001302 3300031712 Bacteria 23407
471 Ga0265342_10004892 3300031712 Bacteria 10376
472 Ga0265342_10008352 3300031712 Bacteria 7435
473 Ga0265342_10259405 3300031712 Unclassified 925
474 Ga0316576_10385674 3300031727 Bacteria 1040
475 Ga0316578_10144825 3300031728 Bacteria 1431
476 Ga0316578_10496947 3300031728 Unclassified 719
477 Ga0307516_10075810 3300031730 Bacteria 3217
478 Ga0307516_10267632 3300031730 Bacteria 1397
479 Ga0307410_11300987 3300031852 Bacteria 636
480 Ga0307406_10025561 3300031901 Bacteria 3536
481 Ga0307406_10247327 3300031901 Bacteria 1341
482 Ga0307415_100558722 3300032126 Bacteria 1011
483 Ga0316583_10000564 3300032133 Bacteria 11232
484 Ga0316588_1017041 3300033528 Bacteria 1616
485 Ga0373950_0000007 3300034818 Bacteria 392070
486 Ga0373950_0000025 3300034818 Bacteria 177524
487 Ga0373949_0000089 3300035090 Bacteria 34401
488 Ga0373936_0000051 3300035113 Bacteria 68197
489 Ga0373939_0163340 3300035114 Unclassified 819
490 Ga0373941_0090094 3300035115 Bacteria 1051
491 Ga0373945_0023665 3300035116 Bacteria 2124
492 Ga0373953_0004266 3300035117 Bacteria 4541
493 Ga0373954_0002028 3300035118 Bacteria 8418
494 Ga0373954_0040879 3300035118 Bacteria 2161
495 Ga0373956_0022718 3300035119 Bacteria 2687
496 Ga0373957_0061399 3300035120 Unclassified 1456
497 Ga0373957_0231217 3300035120 Bacteria 775
498 Ga0373943_0023787 3300035170 Bacteria 2851
499 Ga0373943_0097141 3300035170 Unclassified 1534
500 Ga0373943_0626134 3300035170 Unclassified 635
501 Ga0373946_0227509 3300035171 Unclassified 903
502 Ga0373946_0620171 3300035171 Bacteria 562
503 Ga0373955_0009187 3300035172 Bacteria 4623
504 Ga0373955_0140590 3300035172 Bacteria 1415
505 Ga0373955_0316113 3300035172 Bacteria 943
506 Ga0373961_0000224 3300035241 Bacteria 26575
507 Ga0373931_0641585 3300035691 Bacteria 697
508 Ga0373935_0131049 3300035692 Bacteria 1685
509 Ga0373935_1211280 3300035692 Bacteria 563
510 Ga0373933_0009700 3300035724 Bacteria 5267
511 Ga0373933_0028117 3300035724 Bacteria 3242
512 Ga0373933_0149311 3300035724 Bacteria 1480
513 Ga0373947_0206087 3300035725 Bacteria 1288
514 Ga0373947_0572081 3300035725 Bacteria 770
515 Ga0373937_0007030 3300036401 Bacteria 9714
516 Ga0373937_0030878 3300036401 Bacteria 4852
517 Ga0373937_0059205 3300036401 Bacteria 3520
518 Ga0373937_0392005 3300036401 Bacteria 1317
519 Ga0373937_1098140 3300036401 Bacteria 744
520 Ga0316582_0067945 3300036647 Bacteria 2300
521 Ga0316582_0192459 3300036647 Bacteria 1390
522 Ga0373925_0119200 3300037068 Bacteria 2047
523 Ga0395899_0010207 3300037312 Bacteria 7196
524 Ga0395899_0270864 3300037312 Bacteria 1158
525 Ga0395900_0051544 3300037418 Bacteria 4238
526 Ga0395898_0200046 3300037466 Bacteria 1908
527 Ga0395901_0093973 3300038443 Bacteria 3140
528 Ga0395901_1358719 3300038443 Bacteria 670
529 Ga0400490_09742 3300038726 Bacteria 1104
530 Ga0400486_26412 3300038742 Bacteria 1625
531 Ga0400487_17411 3300039110 Bacteria 1020
532 Ga0436365_0144452 3300039437 Bacteria 1765
533 Ga0436365_1142460 3300039437 Unclassified 716
534 Ga0436365_1374615 3300039437 Bacteria 954
535 Ga0436361_1124647 3300039447 Bacteria 1411
536 Ga0436363_0126406 3300039450 Bacteria 1424
537 Ga0436363_0206308 3300039450 Bacteria 864
538 Ga0436363_1191399 3300039450 Bacteria 1128
539 Ga0436363_1532933 3300039450 Bacteria 877
540 Ga0436362_0410859 3300039453 Bacteria 630
541 Ga0451794_26880 3300041446 Bacteria 881
542 Ga0451801_12450 3300041455 Bacteria 672
543 Ga0451800_0653755 3300041459 Bacteria 941
544 Ga0451802_0745752 3300041460 Bacteria 730
545 Ga0451807_0331189 3300041486 Bacteria 1037
546 Ga0451807_1082726 3300041486 Bacteria 1740
547 Ga0451837_0610383 3300041494 Unclassified 1064
548 Ga0451851_0662761 3300041507 Bacteria 812
549 Ga0451577_0028049 3300042876 Bacteria 5094
550 Ga0451577_0073767 3300042876 Bacteria 3044
551 Ga0451577_0942138 3300042876 Bacteria 777
552 Ga0466969_0005206 3300044656 Bacteria 6920
553 Ga0466966_0008662 3300044684 Bacteria 6733
554 Ga0453684_0258239 3300044712 Bacteria 1997
555 Ga0453684_0401411 3300044712 Bacteria 1535
556 Ga0453684_0852535 3300044712 Unclassified 979
557 Ga0466959_0115533 3300045049 Bacteria 1912
558 Ga0451576_0868193 3300045051 Unclassified 947
559 Ga0466967_1369745 3300045976 Bacteria 705
560 Ga0495641_0049030 3300046461 Bacteria 1935
561 Ga0495651_0057249 3300046462 Bacteria 2993
562 Ga0495651_0119138 3300046462 Bacteria 1942
563 Ga0495650_0016574 3300046471 Bacteria 3727
564 Ga0495652_0216038 3300046529 Bacteria 1444
565 Ga0495640_0290109 3300046533 Bacteria 1018
566 Ga0495586_0022639 3300046535 Bacteria 3353
567 Ga0495634_0038740 3300046642 Bacteria 3248
568 Ga0495599_0377960 3300046678 Bacteria 846
569 Ga0495623_0059615 3300046679 Bacteria 2396
570 Ga0495658_0692271 3300046683 Bacteria 653
571 Ga0495613_0190191 3300046689 Bacteria 1451
572 Ga0495649_0062956 3300046694 Bacteria 1994
573 Ga0495600_0313483 3300046809 Bacteria 988
574 Ga0495600_0469873 3300046809 Bacteria 776
575 Ga0495636_0437317 3300047318 Bacteria 627
576 Ga0495674_0005331 3300047319 Bacteria 12335
577 Ga0495680_0639782 3300047322 Unclassified 708
578 Ga0495675_0345440 3300047444 Bacteria 876
579 Ga0495686_0003163 3300047472 Bacteria 14518
580 Ga0495602_0148994 3300048088 Bacteria 1842
581 Ga0495602_0991327 3300048088 Bacteria 555
582 Ga0496100_0549764 3300048903 Bacteria 893
583 Ga0496101_0108609 3300048904 Unclassified 2086
584 Ga0496101_0276686 3300048904 Bacteria 1311
585 Ga0496101_0435746 3300048904 Unclassified 1034
586 Ga0496102_0986410 3300048905 Bacteria 763
587 Ga0496104_0133170 3300048907 Bacteria 2388
588 Ga0496104_0170460 3300048907 Bacteria 2087
589 Ga0496106_0217159 3300048909 Unclassified 1524
590 Ga0496106_0281010 3300048909 Bacteria 1334
591 Ga0496107_0053449 3300048910 Bacteria 2914
592 Ga0496108_0031085 3300048911 Bacteria 4428
593 Ga0496109_0332703 3300048912 Bacteria 1434
594 Ga0496112_0188973 3300048915 Bacteria 2022
595 Ga0496112_0358087 3300048915 Bacteria 1401
596 Ga0496114_0000221 3300048917 Bacteria 41396
597 Ga0496114_0025157 3300048917 Bacteria 4863
598 Ga0496114_0056185 3300048917 Bacteria 3284
599 Ga0496114_0175248 3300048917 Bacteria 1871
600 Ga0496114_0188085 3300048917 Bacteria 1805
601 Ga0496115_0036453 3300048918 Bacteria 3894
602 Ga0496115_0148508 3300048918 Bacteria 1935
603 Ga0501309_082223 3300049129 Bacteria 541
604 Ga0501305_072556 3300049161 Bacteria 607
605 Ga0501292_005036 3300049515 Bacteria 1829
606 Ga0501292_030382 3300049515 Bacteria 906
607 Ga0501298_034645 3300049521 Unclassified 1005
608 Ga0501299_005357 3300049522 Bacteria 1968
609 Ga0501031_0245963 3300049568 Bacteria 1163
610 Ga0501034_0000120 3300049571 Bacteria 144382
611 Ga0501034_0205682 3300049571 Bacteria 1925
612 Ga0501036_0019572 3300049572 Bacteria 5684
613 Ga0501036_0028864 3300049572 Bacteria 4689
614 Ga0501036_0958534 3300049572 Bacteria 701
615 Ga0501037_0061101 3300049573 Bacteria 2748
616 Ga0501038_0090462 3300049574 Bacteria 2565
617 Ga0501039_0549923 3300049575 Bacteria 906
618 Ga0501043_0004638 3300049579 Bacteria 11141
619 Ga0501043_0202594 3300049579 Bacteria 1540
620 Ga0501046_0002602 3300049580 Bacteria 16862
621 Ga0501047_0000009 3300049581 Bacteria 436619
622 Ga0501047_0010805 3300049581 Bacteria 8630
623 Ga0501047_0040344 3300049581 Bacteria 4514
624 Ga0501048_0001111 3300049582 Bacteria 20205
625 Ga0501067_0000026 3300049583 Bacteria 90750
626 Ga0501067_0001676 3300049583 Bacteria 12179
627 Ga0501067_0002509 3300049583 Bacteria 10134
628 Ga0501067_0093438 3300049583 Bacteria 1670
629 Ga0501068_0004507 3300049584 Bacteria 7580
630 Ga0501068_0007971 3300049584 Bacteria 5873
631 Ga0501068_0102758 3300049584 Unclassified 1772
632 Ga0501069_0113067 3300049585 Bacteria 1547
633 Ga0501069_0595022 3300049585 Bacteria 663
634 Ga0501069_0665764 3300049585 Bacteria 627
635 Ga0501070_0000323 3300049586 Bacteria 43475
636 Ga0501070_0007402 3300049586 Bacteria 9323
637 Ga0501070_0121017 3300049586 Bacteria 2163
638 Ga0501070_0164521 3300049586 Bacteria 1828
639 Ga0501070_0352458 3300049586 Bacteria 1194
640 Ga0501071_0359796 3300049587 Bacteria 1108
641 Ga0501071_1022448 3300049587 Unclassified 638
642 Ga0501072_0000100 3300049588 Bacteria 64147
643 Ga0501072_0378468 3300049588 Unclassified 1123
644 Ga0501073_0000179 3300049589 Bacteria 41581
645 Ga0501073_0006633 3300049589 Bacteria 8619
646 Ga0501073_0026312 3300049589 Bacteria 4169
647 Ga0501073_0026634 3300049589 Bacteria 4140
648 Ga0501073_1003457 3300049589 Bacteria 574
649 Ga0501074_0006979 3300049590 Bacteria 8158
650 Ga0501074_0070404 3300049590 Bacteria 2515
651 Ga0501074_0123028 3300049590 Bacteria 1855
652 Ga0501074_0397286 3300049590 Unclassified 978
653 Ga0501076_0765097 3300049592 Bacteria 797
654 Ga0501077_0286176 3300049593 Bacteria 1049
655 Ga0501202_071090 3300049652 Bacteria 802
656 Ga0501207_016274 3300049654 Bacteria 1152
657 Ga0501216_002169 3300049660 Bacteria 2759
658 Ga0501217_014693 3300049661 Bacteria 1772
659 Ga0501223_030652 3300049663 Bacteria 1046
660 Ga0501227_004086 3300049665 Bacteria 3140
661 Ga0501227_025238 3300049665 Bacteria 1393
662 Ga0501230_003894 3300049667 Bacteria 2016
663 Ga0501233_003013 3300049668 Bacteria 3010
664 Ga0501233_097967 3300049668 Bacteria 772
665 Ga0501229_007702 3300049706 Bacteria 1342
666 Ga0501079_0000231 3300049741 Bacteria 33351
667 Ga0501079_0547243 3300049741 Bacteria 910
668 Ga0501080_0169585 3300049742 Bacteria 2013
669 Ga0501080_0494492 3300049742 Bacteria 1093
670 Ga0501080_0604532 3300049742 Bacteria 973
671 Ga0501080_0769943 3300049742 Bacteria 845
672 Ga0501081_0049321 3300049743 Bacteria 2899
673 Ga0501083_0000679 3300049744 Bacteria 22147
674 Ga0501083_0005169 3300049744 Bacteria 9233
675 Ga0501083_0030120 3300049744 Bacteria 3729
676 Ga0501083_0099926 3300049744 Bacteria 1913
677 Ga0501083_0572148 3300049744 Bacteria 735
678 Ga0501267_006506 3300049764 Bacteria 1124
679 Ga0501035_0360667 3300049822 Bacteria 1215
680 Ga0501044_0084199 3300049823 Bacteria 3214
681 Ga0501044_0532850 3300049823 Bacteria 1073
682 nmdc:mga05p37_1275176_c1 3300050507 Unclassified 751
683 nmdc:mga09592_11194_c1 3300050508 Bacteria 7299
684 nmdc:mga09592_225222_c1 3300050508 Bacteria 1625
685 nmdc:mga09592_49581_c1 3300050508 Bacteria 3540
686 nmdc:mga0qj67_618341_c1 3300050509 Bacteria 866
687 nmdc:mga06r32_780854_c1 3300050510 Bacteria 917
688 nmdc:mga08y16_18519_c1 3300050511 Bacteria 7336
689 nmdc:mga08y16_4304_c1 3300050511 Bacteria 14867
690 nmdc:mga08y16_872549_c1 3300050511 Bacteria 888
691 nmdc:mga0n895_531242_c1 3300050512 Unclassified 1183
692 nmdc:mga0n895_566321_c1 3300050512 Bacteria 1141
693 nmdc:mga0rr50_55729_c1 3300050513 Bacteria 2950
694 nmdc:mga0rr50_745392_c1 3300050513 Bacteria 836
695 Ga0495601_0006774 3300053077 Bacteria 6712
696 Ga0495619_0282760 3300053085 Bacteria 1150
697 Ga0500578_0332261 3300053086 Unclassified 893
698 Ga0500578_0381990 3300053086 Bacteria 816
699 Ga0500566_0000579 3300053094 Bacteria 20621
700 Ga0500566_0003002 3300053094 Bacteria 10080
701 Ga0500566_0121323 3300053094 Bacteria 1409
702 Ga0500640_005031 3300053095 Bacteria 4877
703 Ga0500554_000343 3300053102 Bacteria 9996
704 Ga0500562_017858 3300053108 Unclassified 1831
705 Ga0500595_000685 3300053119 Bacteria 20274
706 Ga0500597_104467 3300053120 Bacteria 1231
707 Ga0500607_107670 3300053121 Bacteria 1372
708 Ga0500614_000877 3300053123 Bacteria 7604
709 Ga0500614_004426 3300053123 Bacteria 2967
710 Ga0500642_0006684 3300053130 Bacteria 3819
711 Ga0500642_0012433 3300053130 Bacteria 3087
712 Ga0500655_115102 3300053133 Bacteria 569
713 Ga0500564_196995 3300053138 Bacteria 830
714 Ga0500568_0007462 3300053139 Bacteria 5361
715 Ga0500568_0021106 3300053139 Bacteria 2807
716 Ga0500585_031417 3300053144 Bacteria 1829
717 Ga0500588_0152870 3300053146 Bacteria 836
718 Ga0500603_015209 3300053150 Bacteria 1809
719 Ga0500603_023447 3300053150 Bacteria 1536
720 Ga0500636_0058726 3300053177 Bacteria 2248
721 Ga0500637_0050830 3300053178 Bacteria 2362
722 Ga0500601_029908 3300053737 Bacteria 645
723 Ga0501084_0000313 3300054114 Bacteria 36799
724 Ga0501084_0832079 3300054114 Bacteria 777
725 Ga0500661_020082 3300055283 Bacteria 1188
726 Ga0587084_083633 3300059477 Bacteria 622
727 Ga0587073_0262591 3300059492 Bacteria 546
728 Ga0587082_090755 3300059504 Bacteria 651
729 Ga0587092_063664 3300059512 Bacteria 695
730 Ga0587072_100176 3300059643 Bacteria 649
731 Ga0587111_0216772 3300060346 Bacteria 550
732 Ga0501082_0000571 3300060353 Bacteria 32825
733 Ga0501082_0008410 3300060353 Bacteria 8903

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031728 Ga0316578_10496947 Ga0316578_104969471 159
2 3300032133 Ga0316583_10000564 Ga0316583_1000056410 159
3 3300033528 Ga0316588_1017041 Ga0316588_10170412 159
4 3300034818 Ga0373950_0000025 Ga0373950_0000025_96688_97254 159
5 3300036647 Ga0316582_0067945 Ga0316582_0067945_55_534 159
6 3300036647 Ga0316582_0192459 Ga0316582_0192459_110_589 159
7 3300042876 Ga0451577_0073767 Ga0451577_0073767_2428_2907 159
8 3300049571 Ga0501034_0000120 Ga0501034_0000120_85020_85586 159
9 3300049572 Ga0501036_0028864 Ga0501036_0028864_4073_4639 159
10 3300049574 Ga0501038_0090462 Ga0501038_0090462_1683_2249 159
11 3300049579 Ga0501043_0004638 Ga0501043_0004638_4306_4872 159
12 3300049580 Ga0501046_0002602 Ga0501046_0002602_5321_5887 159
13 3300049581 Ga0501047_0000009 Ga0501047_0000009_252973_253539 159
14 3300049582 Ga0501048_0001111 Ga0501048_0001111_8307_8873 159
15 3300049584 Ga0501068_0004507 Ga0501068_0004507_6178_6744 159
16 3300049588 Ga0501072_0000100 Ga0501072_0000100_38881_39447 159
17 3300049590 Ga0501074_0006979 Ga0501074_0006979_6027_6593 159
18 3300049593 Ga0501077_0286176 Ga0501077_0286176_239_805 159
19 3300049741 Ga0501079_0000231 Ga0501079_0000231_17565_18131 159
20 3300049742 Ga0501080_0494492 Ga0501080_0494492_137_703 159
21 3300049744 Ga0501083_0000679 Ga0501083_0000679_14390_14956 159
22 3300049823 Ga0501044_0532850 Ga0501044_0532850_408_974 159
23 3300054114 Ga0501084_0000313 Ga0501084_0000313_17175_17741 159
24 3300060353 Ga0501082_0000571 Ga0501082_0000571_31997_32563 159
25 3300003308 Ga0006777J48905_1063988 Ga0006777J48905_10639881 160
26 3300003544 Ga0007417J51691_1062475 Ga0007417J51691_10624752 160
27 3300003735 Ga0006780_1012978 Ga0006780_10129781 160
28 3300004785 Ga0058858_1001068 Ga0058858_10010681 160
29 3300004798 Ga0058859_10037633 Ga0058859_100376331 160
30 3300004798 Ga0058859_10058200 Ga0058859_100582001 160
31 3300004798 Ga0058859_11799976 Ga0058859_117999761 160
32 3300004798 Ga0058859_11807595 Ga0058859_118075952 160
33 3300004799 Ga0058863_11731370 Ga0058863_117313701 160
34 3300004799 Ga0058863_11858214 Ga0058863_118582141 160
35 3300004799 Ga0058863_11948672 Ga0058863_119486721 160
36 3300004800 Ga0058861_10028637 Ga0058861_100286372 160
37 3300004800 Ga0058861_10072934 Ga0058861_100729341 160
38 3300004800 Ga0058861_11912080 Ga0058861_119120801 160
39 3300004801 Ga0058860_10120307 Ga0058860_101203071 160
40 3300004801 Ga0058860_12053824 Ga0058860_120538241 160
41 3300004801 Ga0058860_12103954 Ga0058860_121039542 160
42 3300004801 Ga0058860_12209524 Ga0058860_122095241 160
43 3300004803 Ga0058862_12606125 Ga0058862_126061251 160
44 3300004803 Ga0058862_12795608 Ga0058862_127956081 160
45 3300004803 Ga0058862_12802071 Ga0058862_128020711 160
46 3300005290 Ga0065712_10235307 Ga0065712_102353072 160
47 3300005293 Ga0065715_10446724 Ga0065715_104467242 160
48 3300005327 Ga0070658_10005201 Ga0070658_100052014 160
49 3300005327 Ga0070658_10151981 Ga0070658_101519812 160
50 3300005328 Ga0070676_10010598 Ga0070676_100105984 160
51 3300005329 Ga0070683_100007795 Ga0070683_1000077958 160
52 3300005329 Ga0070683_100145389 Ga0070683_1001453894 160
53 3300005329 Ga0070683_100245232 Ga0070683_1002452323 160
54 3300005329 Ga0070683_100486418 Ga0070683_1004864181 160
55 3300005329 Ga0070683_101498062 Ga0070683_1014980621 160
56 3300005330 Ga0070690_100005437 Ga0070690_1000054376 160
57 3300005330 Ga0070690_100018706 Ga0070690_1000187063 160
58 3300005330 Ga0070690_100071796 Ga0070690_1000717964 160
59 3300005330 Ga0070690_100210387 Ga0070690_1002103872 160
60 3300005331 Ga0070670_100249953 Ga0070670_1002499532 160
61 3300005331 Ga0070670_100336200 Ga0070670_1003362002 160
62 3300005333 Ga0070677_10155161 Ga0070677_101551611 160
63 3300005334 Ga0068869_100086742 Ga0068869_1000867422 160
64 3300005334 Ga0068869_100184302 Ga0068869_1001843021 160
65 3300005334 Ga0068869_100219777 Ga0068869_1002197772 160
66 3300005334 Ga0068869_100862082 Ga0068869_1008620822 160
67 3300005336 Ga0070680_100119345 Ga0070680_1001193451 160
68 3300005336 Ga0070680_101040631 Ga0070680_1010406311 160
69 3300005337 Ga0070682_100004298 Ga0070682_1000042989 160
70 3300005337 Ga0070682_100171913 Ga0070682_1001719131 160
71 3300005337 Ga0070682_100429614 Ga0070682_1004296141 160
72 3300005337 Ga0070682_100779355 Ga0070682_1007793551 160
73 3300005338 Ga0068868_100127115 Ga0068868_1001271152 160
74 3300005338 Ga0068868_100146484 Ga0068868_1001464843 160
75 3300005340 Ga0070689_100000014 Ga0070689_10000001444 160
76 3300005340 Ga0070689_100037336 Ga0070689_1000373366 160
77 3300005340 Ga0070689_100046691 Ga0070689_1000466914 160
78 3300005340 Ga0070689_100092152 Ga0070689_1000921522 160
79 3300005340 Ga0070689_100286957 Ga0070689_1002869571 160
80 3300005340 Ga0070689_100490444 Ga0070689_1004904442 160
81 3300005340 Ga0070689_100537387 Ga0070689_1005373871 160
82 3300005343 Ga0070687_100000637 Ga0070687_10000063712 160
83 3300005343 Ga0070687_100149715 Ga0070687_1001497151 160
84 3300005345 Ga0070692_10171243 Ga0070692_101712432 160
85 3300005345 Ga0070692_10905992 Ga0070692_109059921 160
86 3300005347 Ga0070668_100011396 Ga0070668_1000113966 160
87 3300005353 Ga0070669_100022080 Ga0070669_1000220804 160
88 3300005354 Ga0070675_100069692 Ga0070675_1000696923 160
89 3300005354 Ga0070675_100142301 Ga0070675_1001423012 160
90 3300005355 Ga0070671_101093360 Ga0070671_1010933601 160
91 3300005356 Ga0070674_100078018 Ga0070674_1000780184 160
92 3300005356 Ga0070674_100235237 Ga0070674_1002352372 160
93 3300005364 Ga0070673_100000555 Ga0070673_10000055510 160
94 3300005364 Ga0070673_100034675 Ga0070673_1000346754 160
95 3300005364 Ga0070673_100161161 Ga0070673_1001611612 160
96 3300005364 Ga0070673_100212906 Ga0070673_1002129062 160
97 3300005365 Ga0070688_100031115 Ga0070688_1000311154 160
98 3300005365 Ga0070688_100375360 Ga0070688_1003753601 160
99 3300005366 Ga0070659_100358206 Ga0070659_1003582062 160
100 3300005367 Ga0070667_100397437 Ga0070667_1003974371 160
101 3300005367 Ga0070667_100562141 Ga0070667_1005621411 160
102 3300005434 Ga0070709_10343786 Ga0070709_103437861 160
103 3300005436 Ga0070713_100308105 Ga0070713_1003081053 160
104 3300005436 Ga0070713_100455194 Ga0070713_1004551941 160
105 3300005437 Ga0070710_10107256 Ga0070710_101072562 160
106 3300005437 Ga0070710_10313822 Ga0070710_103138222 160
107 3300005438 Ga0070701_10012877 Ga0070701_100128773 160
108 3300005438 Ga0070701_10233544 Ga0070701_102335441 160
109 3300005439 Ga0070711_100251259 Ga0070711_1002512592 160
110 3300005440 Ga0070705_100064679 Ga0070705_1000646792 160
111 3300005440 Ga0070705_100458562 Ga0070705_1004585621 160
112 3300005440 Ga0070705_100505838 Ga0070705_1005058382 160
113 3300005441 Ga0070700_100056685 Ga0070700_1000566851 160
114 3300005441 Ga0070700_101081596 Ga0070700_1010815961 160
115 3300005445 Ga0070708_100239897 Ga0070708_1002398972 160
116 3300005445 Ga0070708_100307439 Ga0070708_1003074392 160
117 3300005456 Ga0070678_100017410 Ga0070678_1000174106 160
118 3300005457 Ga0070662_100678156 Ga0070662_1006781561 160
119 3300005458 Ga0070681_10255727 Ga0070681_102557272 160
120 3300005458 Ga0070681_10374590 Ga0070681_103745902 160
121 3300005458 Ga0070681_10687205 Ga0070681_106872051 160
122 3300005459 Ga0068867_100036835 Ga0068867_1000368353 160
123 3300005459 Ga0068867_100644592 Ga0068867_1006445921 160
124 3300005466 Ga0070685_10036407 Ga0070685_100364071 160
125 3300005466 Ga0070685_10405878 Ga0070685_104058782 160
126 3300005466 Ga0070685_10446920 Ga0070685_104469201 160
127 3300005466 Ga0070685_10535699 Ga0070685_105356991 160
128 3300005467 Ga0070706_100044331 Ga0070706_1000443313 160
129 3300005467 Ga0070706_100053704 Ga0070706_1000537042 160
130 3300005467 Ga0070706_101069847 Ga0070706_1010698471 160
131 3300005471 Ga0070698_100001555 Ga0070698_10000155515 160
132 3300005471 Ga0070698_100378060 Ga0070698_1003780601 160
133 3300005518 Ga0070699_100130956 Ga0070699_1001309562 160
134 3300005530 Ga0070679_100046846 Ga0070679_1000468463 160
135 3300005535 Ga0070684_100020180 Ga0070684_1000201807 160
136 3300005535 Ga0070684_100126031 Ga0070684_1001260312 160
137 3300005535 Ga0070684_100310446 Ga0070684_1003104461 160
138 3300005535 Ga0070684_100394316 Ga0070684_1003943161 160
139 3300005535 Ga0070684_100665791 Ga0070684_1006657911 160
140 3300005539 Ga0068853_100868153 Ga0068853_1008681531 160
141 3300005543 Ga0070672_100021741 Ga0070672_1000217416 160
142 3300005543 Ga0070672_100120858 Ga0070672_1001208583 160
143 3300005544 Ga0070686_100102762 Ga0070686_1001027622 160
144 3300005544 Ga0070686_100179626 Ga0070686_1001796261 160
145 3300005545 Ga0070695_100794347 Ga0070695_1007943471 160
146 3300005546 Ga0070696_100572343 Ga0070696_1005723431 160
147 3300005547 Ga0070693_100431066 Ga0070693_1004310662 160
148 3300005548 Ga0070665_100017791 Ga0070665_1000177913 160
149 3300005548 Ga0070665_100737658 Ga0070665_1007376582 160
150 3300005548 Ga0070665_100899637 Ga0070665_1008996372 160
151 3300005548 Ga0070665_101056925 Ga0070665_1010569252 160
152 3300005549 Ga0070704_100280151 Ga0070704_1002801511 160
153 3300005549 Ga0070704_100436241 Ga0070704_1004362412 160
154 3300005563 Ga0068855_100022861 Ga0068855_1000228616 160
155 3300005563 Ga0068855_100377664 Ga0068855_1003776642 160
156 3300005563 Ga0068855_101414345 Ga0068855_1014143451 160
157 3300005564 Ga0070664_100335725 Ga0070664_1003357252 160
158 3300005564 Ga0070664_101359286 Ga0070664_1013592861 160
159 3300005577 Ga0068857_100210635 Ga0068857_1002106353 160
160 3300005577 Ga0068857_100983401 Ga0068857_1009834011 160
161 3300005614 Ga0068856_100033363 Ga0068856_1000333636 160
162 3300005614 Ga0068856_100138125 Ga0068856_1001381251 160
163 3300005614 Ga0068856_100619911 Ga0068856_1006199111 160
164 3300005615 Ga0070702_100030529 Ga0070702_1000305292 160
165 3300005615 Ga0070702_100842071 Ga0070702_1008420711 160
166 3300005616 Ga0068852_100327667 Ga0068852_1003276672 160
167 3300005617 Ga0068859_100175781 Ga0068859_1001757814 160
168 3300005618 Ga0068864_100189684 Ga0068864_1001896842 160
169 3300005719 Ga0068861_100181385 Ga0068861_1001813852 160
170 3300005719 Ga0068861_100288465 Ga0068861_1002884651 160
171 3300005841 Ga0068863_100060378 Ga0068863_1000603784 160
172 3300005841 Ga0068863_100060693 Ga0068863_1000606933 160
173 3300005841 Ga0068863_101108776 Ga0068863_1011087761 160
174 3300005842 Ga0068858_101460560 Ga0068858_1014605601 160
175 3300005843 Ga0068860_101010563 Ga0068860_1010105632 160
176 3300005843 Ga0068860_101181934 Ga0068860_1011819341 160
177 3300005844 Ga0068862_100051189 Ga0068862_1000511894 160
178 3300005844 Ga0068862_100986125 Ga0068862_1009861251 160
179 3300006358 Ga0068871_100186909 Ga0068871_1001869091 160
180 3300006358 Ga0068871_100236550 Ga0068871_1002365502 160
181 3300006358 Ga0068871_100378155 Ga0068871_1003781552 160
182 3300006358 Ga0068871_100432700 Ga0068871_1004327001 160
183 3300006846 Ga0075430_101005690 Ga0075430_1010056901 160
184 3300006871 Ga0075434_101269391 Ga0075434_1012693912 160
185 3300006880 Ga0075429_100025611 Ga0075429_1000256112 160
186 3300006880 Ga0075429_100120669 Ga0075429_1001206693 160
187 3300006881 Ga0068865_100021367 Ga0068865_1000213676 160
188 3300006931 Ga0097620_100175774 Ga0097620_1001757744 160
189 3300007076 Ga0075435_100052581 Ga0075435_1000525813 160
190 3300007788 Ga0099795_10026665 Ga0099795_100266652 160
191 3300009092 Ga0105250_10249548 Ga0105250_102495481 160
192 3300009093 Ga0105240_10000261 Ga0105240_1000026150 160
193 3300009093 Ga0105240_10056624 Ga0105240_100566244 160
194 3300009093 Ga0105240_10413916 Ga0105240_104139162 160
195 3300009093 Ga0105240_10567824 Ga0105240_105678242 160
196 3300009094 Ga0111539_10027557 Ga0111539_100275574 160
197 3300009098 Ga0105245_10000149 Ga0105245_1000014965 160
198 3300009098 Ga0105245_10833426 Ga0105245_108334262 160
199 3300009147 Ga0114129_10911327 Ga0114129_109113271 160
200 3300009148 Ga0105243_10266489 Ga0105243_102664892 160
201 3300009148 Ga0105243_10288692 Ga0105243_102886921 160
202 3300009177 Ga0105248_10524001 Ga0105248_105240012 160
203 3300009177 Ga0105248_11277189 Ga0105248_112771891 160
204 3300009177 Ga0105248_12154383 Ga0105248_121543831 160
205 3300009545 Ga0105237_10000062 Ga0105237_1000006293 160
206 3300009545 Ga0105237_10233412 Ga0105237_102334122 160
207 3300009551 Ga0105238_10018097 Ga0105238_100180973 160
208 3300009551 Ga0105238_10339966 Ga0105238_103399661 160
209 3300009551 Ga0105238_10608562 Ga0105238_106085622 160
210 3300009551 Ga0105238_11134594 Ga0105238_111345941 160
211 3300009553 Ga0105249_10028685 Ga0105249_100286856 160
212 3300009553 Ga0105249_10034840 Ga0105249_100348403 160
213 3300009553 Ga0105249_10282279 Ga0105249_102822792 160
214 3300009553 Ga0105249_11011169 Ga0105249_110111692 160
215 3300010375 Ga0105239_10149195 Ga0105239_101491952 160
216 3300010375 Ga0105239_10446986 Ga0105239_104469862 160
217 3300010375 Ga0105239_12347512 Ga0105239_123475121 160
218 3300013102 Ga0157371_10482225 Ga0157371_104822252 160
219 3300013105 Ga0157369_10139736 Ga0157369_101397362 160
220 3300013296 Ga0157374_10031333 Ga0157374_100313337 160
221 3300013296 Ga0157374_10237419 Ga0157374_102374193 160
222 3300013296 Ga0157374_10321406 Ga0157374_103214062 160
223 3300013296 Ga0157374_10878055 Ga0157374_108780551 160
224 3300013297 Ga0157378_10092416 Ga0157378_100924165 160
225 3300013297 Ga0157378_10094569 Ga0157378_100945693 160
226 3300013297 Ga0157378_10299314 Ga0157378_102993142 160
227 3300013297 Ga0157378_10371988 Ga0157378_103719882 160
228 3300013306 Ga0163162_10481773 Ga0163162_104817732 160
229 3300013306 Ga0163162_11418384 Ga0163162_114183841 160
230 3300013306 Ga0163162_12230965 Ga0163162_122309651 160
231 3300013307 Ga0157372_11228119 Ga0157372_112281191 160
232 3300013307 Ga0157372_11954574 Ga0157372_119545741 160
233 3300013308 Ga0157375_10521241 Ga0157375_105212412 160
234 3300013308 Ga0157375_11017422 Ga0157375_110174222 160
235 3300014325 Ga0163163_10247634 Ga0163163_102476342 160
236 3300014326 Ga0157380_10191869 Ga0157380_101918693 160
237 3300014326 Ga0157380_10969772 Ga0157380_109697721 160
238 3300014745 Ga0157377_10306998 Ga0157377_103069981 160
239 3300014969 Ga0157376_10150460 Ga0157376_101504602 160
240 3300014969 Ga0157376_10585612 Ga0157376_105856122 160
241 3300014969 Ga0157376_10970374 Ga0157376_109703741 160
242 3300014969 Ga0157376_12122341 Ga0157376_121223411 160
243 3300020070 Ga0206356_10416233 Ga0206356_104162332 160
244 3300020078 Ga0206352_11250444 Ga0206352_112504441 160
245 3300020082 Ga0206353_11912490 Ga0206353_119124902 160
246 3300020082 Ga0206353_12007426 Ga0206353_120074261 160
247 3300021377 Ga0213874_10099193 Ga0213874_100991931 160
248 3300021384 Ga0213876_10103309 Ga0213876_101033091 160
249 3300021384 Ga0213876_10264700 Ga0213876_102647001 160
250 3300022467 Ga0224712_10362701 Ga0224712_103627011 160
251 3300025315 Ga0207697_10065641 Ga0207697_100656412 160
252 3300025885 Ga0207653_10072387 Ga0207653_100723871 160
253 3300025898 Ga0207692_10085877 Ga0207692_100858773 160
254 3300025901 Ga0207688_10081808 Ga0207688_100818082 160
255 3300025906 Ga0207699_10311250 Ga0207699_103112501 160
256 3300025907 Ga0207645_10003612 Ga0207645_1000361210 160
257 3300025909 Ga0207705_10018431 Ga0207705_100184314 160
258 3300025909 Ga0207705_10040703 Ga0207705_100407032 160
259 3300025910 Ga0207684_10040963 Ga0207684_100409633 160
260 3300025912 Ga0207707_10335988 Ga0207707_103359881 160
261 3300025912 Ga0207707_10600145 Ga0207707_106001452 160
262 3300025912 Ga0207707_10690862 Ga0207707_106908621 160
263 3300025913 Ga0207695_10001635 Ga0207695_1000163510 160
264 3300025913 Ga0207695_10161010 Ga0207695_101610102 160
265 3300025913 Ga0207695_10286807 Ga0207695_102868072 160
266 3300025914 Ga0207671_10000140 Ga0207671_100001407 160
267 3300025914 Ga0207671_10260767 Ga0207671_102607672 160
268 3300025914 Ga0207671_10928554 Ga0207671_109285542 160
269 3300025915 Ga0207693_10165904 Ga0207693_101659042 160
270 3300025917 Ga0207660_10052199 Ga0207660_100521993 160
271 3300025917 Ga0207660_10399731 Ga0207660_103997311 160
272 3300025918 Ga0207662_10001434 Ga0207662_1000143412 160
273 3300025918 Ga0207662_10019856 Ga0207662_100198563 160
274 3300025918 Ga0207662_10022717 Ga0207662_100227173 160
275 3300025918 Ga0207662_10336348 Ga0207662_103363482 160
276 3300025918 Ga0207662_10426201 Ga0207662_104262011 160
277 3300025921 Ga0207652_10002792 Ga0207652_100027928 160
278 3300025921 Ga0207652_10006188 Ga0207652_100061888 160
279 3300025921 Ga0207652_10013232 Ga0207652_100132325 160
280 3300025921 Ga0207652_10085864 Ga0207652_100858643 160
281 3300025923 Ga0207681_10019671 Ga0207681_100196714 160
282 3300025924 Ga0207694_10697357 Ga0207694_106973572 160
283 3300025924 Ga0207694_10889563 Ga0207694_108895631 160
284 3300025925 Ga0207650_10202670 Ga0207650_102026702 160
285 3300025925 Ga0207650_10295477 Ga0207650_102954772 160
286 3300025925 Ga0207650_10625559 Ga0207650_106255591 160
287 3300025926 Ga0207659_10051985 Ga0207659_100519853 160
288 3300025926 Ga0207659_10082026 Ga0207659_100820262 160
289 3300025926 Ga0207659_10505329 Ga0207659_105053292 160
290 3300025926 Ga0207659_10915494 Ga0207659_109154941 160
291 3300025927 Ga0207687_10000526 Ga0207687_1000052611 160
292 3300025927 Ga0207687_10175271 Ga0207687_101752712 160
293 3300025927 Ga0207687_10184076 Ga0207687_101840762 160
294 3300025928 Ga0207700_10419432 Ga0207700_104194322 160
295 3300025932 Ga0207690_10336023 Ga0207690_103360231 160
296 3300025933 Ga0207706_10074130 Ga0207706_100741304 160
297 3300025934 Ga0207686_10455862 Ga0207686_104558622 160
298 3300025935 Ga0207709_10131077 Ga0207709_101310772 160
299 3300025935 Ga0207709_10175998 Ga0207709_101759982 160
300 3300025936 Ga0207670_10000003 Ga0207670_10000003109 160
301 3300025936 Ga0207670_10002754 Ga0207670_100027549 160
302 3300025936 Ga0207670_10013353 Ga0207670_100133536 160
303 3300025936 Ga0207670_10024078 Ga0207670_100240781 160
304 3300025936 Ga0207670_10030666 Ga0207670_100306661 160
305 3300025936 Ga0207670_10076250 Ga0207670_100762502 160
306 3300025936 Ga0207670_10709534 Ga0207670_107095341 160
307 3300025938 Ga0207704_10009349 Ga0207704_100093493 160
308 3300025938 Ga0207704_10012288 Ga0207704_100122886 160
309 3300025940 Ga0207691_10120325 Ga0207691_101203253 160
310 3300025941 Ga0207711_10369105 Ga0207711_103691051 160
311 3300025942 Ga0207689_10459039 Ga0207689_104590392 160
312 3300025944 Ga0207661_10035952 Ga0207661_100359522 160
313 3300025944 Ga0207661_10241825 Ga0207661_102418251 160
314 3300025944 Ga0207661_10701172 Ga0207661_107011722 160
315 3300025944 Ga0207661_11727273 Ga0207661_117272731 160
316 3300025945 Ga0207679_10809071 Ga0207679_108090712 160
317 3300025949 Ga0207667_10049364 Ga0207667_100493643 160
318 3300025949 Ga0207667_10433651 Ga0207667_104336512 160
319 3300025960 Ga0207651_10001985 Ga0207651_100019856 160
320 3300025960 Ga0207651_10060180 Ga0207651_100601803 160
321 3300025960 Ga0207651_10564354 Ga0207651_105643541 160
322 3300025961 Ga0207712_10117111 Ga0207712_101171114 160
323 3300025961 Ga0207712_10204728 Ga0207712_102047282 160
324 3300025972 Ga0207668_10107941 Ga0207668_101079413 160
325 3300025981 Ga0207640_10950790 Ga0207640_109507901 160
326 3300025986 Ga0207658_10779427 Ga0207658_107794271 160
327 3300025986 Ga0207658_11678133 Ga0207658_116781331 160
328 3300026023 Ga0207677_10037003 Ga0207677_100370033 160
329 3300026023 Ga0207677_10870869 Ga0207677_108708691 160
330 3300026035 Ga0207703_10032822 Ga0207703_100328224 160
331 3300026035 Ga0207703_10864716 Ga0207703_108647162 160
332 3300026035 Ga0207703_11396313 Ga0207703_113963131 160
333 3300026067 Ga0207678_11094763 Ga0207678_110947631 160
334 3300026075 Ga0207708_10004519 Ga0207708_100045193 160
335 3300026078 Ga0207702_10024695 Ga0207702_100246953 160
336 3300026078 Ga0207702_10166958 Ga0207702_101669581 160
337 3300026078 Ga0207702_10171046 Ga0207702_101710462 160
338 3300026078 Ga0207702_10187462 Ga0207702_101874622 160
339 3300026088 Ga0207641_10233486 Ga0207641_102334862 160
340 3300026088 Ga0207641_11371555 Ga0207641_113715552 160
341 3300026089 Ga0207648_10052397 Ga0207648_100523974 160
342 3300026095 Ga0207676_10121380 Ga0207676_101213802 160
343 3300026095 Ga0207676_10192480 Ga0207676_101924802 160
344 3300026095 Ga0207676_10960686 Ga0207676_109606861 160
345 3300026116 Ga0207674_10093047 Ga0207674_100930473 160
346 3300026116 Ga0207674_10298608 Ga0207674_102986082 160
347 3300026116 Ga0207674_10457219 Ga0207674_104572192 160
348 3300026116 Ga0207674_10912614 Ga0207674_109126142 160
349 3300026118 Ga0207675_100086590 Ga0207675_1000865902 160
350 3300026121 Ga0207683_10010985 Ga0207683_100109856 160
351 3300026121 Ga0207683_10031446 Ga0207683_100314463 160
352 3300026121 Ga0207683_10578615 Ga0207683_105786151 160
353 3300026142 Ga0207698_10205230 Ga0207698_102052302 160
354 3300026142 Ga0207698_10877910 Ga0207698_108779101 160
355 3300027907 Ga0207428_10031981 Ga0207428_100319814 160
356 3300028379 Ga0268266_10017339 Ga0268266_100173396 160
357 3300028379 Ga0268266_11013872 Ga0268266_110138721 160
358 3300028379 Ga0268266_11971810 Ga0268266_119718101 160
359 3300028380 Ga0268265_10127206 Ga0268265_101272062 160
360 3300028381 Ga0268264_10707640 Ga0268264_107076402 160
361 3300028558 Ga0265326_10033289 Ga0265326_100332892 160
362 3300028563 Ga0265319_1090029 Ga0265319_10900292 160
363 3300028563 Ga0265319_1118774 Ga0265319_11187741 160
364 3300028577 Ga0265318_10000110 Ga0265318_1000011053 160
365 3300028577 Ga0265318_10000678 Ga0265318_100006785 160
366 3300028666 Ga0265336_10008055 Ga0265336_100080555 160
367 3300028786 Ga0307517_10048705 Ga0307517_100487052 160
368 3300028794 Ga0307515_10034085 Ga0307515_100340858 160
369 3300028800 Ga0265338_10001473 Ga0265338_1000147320 160
370 3300028800 Ga0265338_10198104 Ga0265338_101981042 160
371 3300028800 Ga0265338_10705035 Ga0265338_107050351 160
372 3300031235 Ga0265330_10001283 Ga0265330_100012838 160
373 3300031235 Ga0265330_10001591 Ga0265330_100015914 160
374 3300031238 Ga0265332_10000070 Ga0265332_1000007060 160
375 3300031238 Ga0265332_10003169 Ga0265332_100031694 160
376 3300031238 Ga0265332_10007480 Ga0265332_100074802 160
377 3300031238 Ga0265332_10127037 Ga0265332_101270371 160
378 3300031239 Ga0265328_10001530 Ga0265328_100015304 160
379 3300031239 Ga0265328_10002763 Ga0265328_100027633 160
380 3300031239 Ga0265328_10002834 Ga0265328_100028344 160
381 3300031240 Ga0265320_10000040 Ga0265320_100000408 160
382 3300031240 Ga0265320_10028248 Ga0265320_100282484 160
383 3300031240 Ga0265320_10053692 Ga0265320_100536922 160
384 3300031241 Ga0265325_10060051 Ga0265325_100600512 160
385 3300031242 Ga0265329_10000562 Ga0265329_100005622 160
386 3300031242 Ga0265329_10005698 Ga0265329_100056982 160
387 3300031247 Ga0265340_10104943 Ga0265340_101049433 160
388 3300031249 Ga0265339_10000504 Ga0265339_100005048 160
389 3300031249 Ga0265339_10005031 Ga0265339_100050317 160
390 3300031249 Ga0265339_10012768 Ga0265339_100127682 160
391 3300031250 Ga0265331_10000083 Ga0265331_1000008394 160
392 3300031250 Ga0265331_10001199 Ga0265331_1000119912 160
393 3300031250 Ga0265331_10310063 Ga0265331_103100631 160
394 3300031344 Ga0265316_10000532 Ga0265316_1000053220 160
395 3300031344 Ga0265316_10007776 Ga0265316_100077763 160
396 3300031344 Ga0265316_10073174 Ga0265316_100731743 160
397 3300031456 Ga0307513_10003393 Ga0307513_100033933 160
398 3300031507 Ga0307509_10000039 Ga0307509_1000003950 160
399 3300031507 Ga0307509_10007659 Ga0307509_1000765912 160
400 3300031507 Ga0307509_10035298 Ga0307509_100352983 160
401 3300031507 Ga0307509_10248233 Ga0307509_102482332 160
402 3300031595 Ga0265313_10001169 Ga0265313_100011698 160
403 3300031595 Ga0265313_10012957 Ga0265313_100129572 160
404 3300031595 Ga0265313_10023987 Ga0265313_100239875 160
405 3300031595 Ga0265313_10034747 Ga0265313_100347472 160
406 3300031616 Ga0307508_10013069 Ga0307508_100130696 160
407 3300031616 Ga0307508_10262111 Ga0307508_102621112 160
408 3300031711 Ga0265314_10000099 Ga0265314_100000998 160
409 3300031711 Ga0265314_10002880 Ga0265314_100028806 160
410 3300031711 Ga0265314_10006401 Ga0265314_100064018 160
411 3300031711 Ga0265314_10281018 Ga0265314_102810182 160
412 3300031712 Ga0265342_10001302 Ga0265342_100013024 160
413 3300031712 Ga0265342_10004892 Ga0265342_100048923 160
414 3300031712 Ga0265342_10008352 Ga0265342_100083526 160
415 3300031712 Ga0265342_10259405 Ga0265342_102594052 160
416 3300031730 Ga0307516_10075810 Ga0307516_100758102 160
417 3300031852 Ga0307410_11300987 Ga0307410_113009871 160
418 3300031901 Ga0307406_10025561 Ga0307406_100255612 160
419 3300031901 Ga0307406_10247327 Ga0307406_102473272 160
420 3300032126 Ga0307415_100558722 Ga0307415_1005587222 160
421 3300034818 Ga0373950_0000007 Ga0373950_0000007_304069_304560 160
422 3300035090 Ga0373949_0000089 Ga0373949_0000089_19764_20252 160
423 3300035113 Ga0373936_0000051 Ga0373936_0000051_38612_39100 160
424 3300035114 Ga0373939_0163340 Ga0373939_0163340_201_689 160
425 3300035115 Ga0373941_0090094 Ga0373941_0090094_482_970 160
426 3300035116 Ga0373945_0023665 Ga0373945_0023665_1429_1926 160
427 3300035117 Ga0373953_0004266 Ga0373953_0004266_3457_3945 160
428 3300035118 Ga0373954_0002028 Ga0373954_0002028_7754_8242 160
429 3300035118 Ga0373954_0040879 Ga0373954_0040879_1364_1852 160
430 3300035119 Ga0373956_0022718 Ga0373956_0022718_2138_2626 160
431 3300035120 Ga0373957_0061399 Ga0373957_0061399_695_1186 160
432 3300035120 Ga0373957_0231217 Ga0373957_0231217_169_657 160
433 3300035170 Ga0373943_0097141 Ga0373943_0097141_515_1012 160
434 3300035170 Ga0373943_0626134 Ga0373943_0626134_34_522 160
435 3300035171 Ga0373946_0227509 Ga0373946_0227509_14_502 160
436 3300035171 Ga0373946_0620171 Ga0373946_0620171_37_525 160
437 3300035172 Ga0373955_0009187 Ga0373955_0009187_2583_3071 160
438 3300035172 Ga0373955_0316113 Ga0373955_0316113_47_535 160
439 3300035241 Ga0373961_0000224 Ga0373961_0000224_12244_12732 160
440 3300035691 Ga0373931_0641585 Ga0373931_0641585_196_684 160
441 3300035692 Ga0373935_1211280 Ga0373935_1211280_64_552 160
442 3300035724 Ga0373933_0009700 Ga0373933_0009700_835_1323 160
443 3300035724 Ga0373933_0028117 Ga0373933_0028117_1369_1860 160
444 3300035724 Ga0373933_0149311 Ga0373933_0149311_826_1314 160
445 3300035725 Ga0373947_0206087 Ga0373947_0206087_51_539 160
446 3300035725 Ga0373947_0572081 Ga0373947_0572081_74_571 160
447 3300036401 Ga0373937_0007030 Ga0373937_0007030_9193_9681 160
448 3300036401 Ga0373937_0030878 Ga0373937_0030878_157_645 160
449 3300036401 Ga0373937_0392005 Ga0373937_0392005_63_551 160
450 3300036401 Ga0373937_1098140 Ga0373937_1098140_139_627 160
451 3300037068 Ga0373925_0119200 Ga0373925_0119200_1400_1897 160
452 3300037312 Ga0395899_0010207 Ga0395899_0010207_2054_2539 160
453 3300037312 Ga0395899_0270864 Ga0395899_0270864_557_1042 160
454 3300037418 Ga0395900_0051544 Ga0395900_0051544_2644_3129 160
455 3300037466 Ga0395898_0200046 Ga0395898_0200046_559_1044 160
456 3300038443 Ga0395901_0093973 Ga0395901_0093973_2295_2780 160
457 3300038443 Ga0395901_1358719 Ga0395901_1358719_100_585 160
458 3300038726 Ga0400490_09742 Ga0400490_09742_188_709 160
459 3300038742 Ga0400486_26412 Ga0400486_26412_207_728 160
460 3300039110 Ga0400487_17411 Ga0400487_17411_429_950 160
461 3300039437 Ga0436365_0144452 Ga0436365_0144452_251_739 160
462 3300039437 Ga0436365_1142460 Ga0436365_1142460_24_512 160
463 3300039437 Ga0436365_1374615 Ga0436365_1374615_219_704 160
464 3300039450 Ga0436363_1191399 Ga0436363_1191399_360_848 160
465 3300039450 Ga0436363_1532933 Ga0436363_1532933_94_579 160
466 3300039453 Ga0436362_0410859 Ga0436362_0410859_76_564 160
467 3300041446 Ga0451794_26880 Ga0451794_26880_133_633 160
468 3300041455 Ga0451801_12450 Ga0451801_12450_144_659 160
469 3300041459 Ga0451800_0653755 Ga0451800_0653755_45_533 160
470 3300041460 Ga0451802_0745752 Ga0451802_0745752_125_622 160
471 3300041486 Ga0451807_0331189 Ga0451807_0331189_508_996 160
472 3300041494 Ga0451837_0610383 Ga0451837_0610383_178_663 160
473 3300042876 Ga0451577_0028049 Ga0451577_0028049_2488_2976 160
474 3300042876 Ga0451577_0942138 Ga0451577_0942138_45_530 160
475 3300044712 Ga0453684_0258239 Ga0453684_0258239_108_608 160
476 3300044712 Ga0453684_0401411 Ga0453684_0401411_747_1235 160
477 3300044712 Ga0453684_0852535 Ga0453684_0852535_446_940 160
478 3300046461 Ga0495641_0049030 Ga0495641_0049030_949_1437 160
479 3300046462 Ga0495651_0119138 Ga0495651_0119138_561_1049 160
480 3300046471 Ga0495650_0016574 Ga0495650_0016574_2236_2724 160
481 3300046533 Ga0495640_0290109 Ga0495640_0290109_385_873 160
482 3300046535 Ga0495586_0022639 Ga0495586_0022639_2710_3198 160
483 3300046642 Ga0495634_0038740 Ga0495634_0038740_2374_2862 160
484 3300046678 Ga0495599_0377960 Ga0495599_0377960_203_691 160
485 3300046694 Ga0495649_0062956 Ga0495649_0062956_380_868 160
486 3300046809 Ga0495600_0313483 Ga0495600_0313483_125_610 160
487 3300046809 Ga0495600_0469873 Ga0495600_0469873_159_647 160
488 3300047319 Ga0495674_0005331 Ga0495674_0005331_1757_2245 160
489 3300047322 Ga0495680_0639782 Ga0495680_0639782_120_608 160
490 3300047472 Ga0495686_0003163 Ga0495686_0003163_9339_9827 160
491 3300048088 Ga0495602_0991327 Ga0495602_0991327_46_534 160
492 3300048903 Ga0496100_0549764 Ga0496100_0549764_354_851 160
493 3300048904 Ga0496101_0108609 Ga0496101_0108609_718_1215 160
494 3300048904 Ga0496101_0276686 Ga0496101_0276686_285_773 160
495 3300048904 Ga0496101_0435746 Ga0496101_0435746_210_698 160
496 3300048905 Ga0496102_0986410 Ga0496102_0986410_72_569 160
497 3300048907 Ga0496104_0133170 Ga0496104_0133170_1465_1953 160
498 3300048907 Ga0496104_0170460 Ga0496104_0170460_836_1324 160
499 3300048909 Ga0496106_0217159 Ga0496106_0217159_398_895 160
500 3300048909 Ga0496106_0281010 Ga0496106_0281010_540_1028 160
501 3300048910 Ga0496107_0053449 Ga0496107_0053449_1528_2025 160
502 3300048911 Ga0496108_0031085 Ga0496108_0031085_2471_2968 160
503 3300048912 Ga0496109_0332703 Ga0496109_0332703_41_538 160
504 3300048915 Ga0496112_0358087 Ga0496112_0358087_12_509 160
505 3300048917 Ga0496114_0000221 Ga0496114_0000221_10344_10841 160
506 3300048917 Ga0496114_0025157 Ga0496114_0025157_1413_1901 160
507 3300048917 Ga0496114_0056185 Ga0496114_0056185_536_1087 160
508 3300048917 Ga0496114_0175248 Ga0496114_0175248_200_688 160
509 3300048917 Ga0496114_0188085 Ga0496114_0188085_159_653 160
510 3300048918 Ga0496115_0036453 Ga0496115_0036453_2506_3003 160
511 3300049515 Ga0501292_005036 Ga0501292_005036_352_840 160
512 3300049515 Ga0501292_030382 Ga0501292_030382_266_799 160
513 3300049521 Ga0501298_034645 Ga0501298_034645_405_890 160
514 3300049522 Ga0501299_005357 Ga0501299_005357_973_1461 160
515 3300049568 Ga0501031_0245963 Ga0501031_0245963_452_937 160
516 3300049571 Ga0501034_0205682 Ga0501034_0205682_65_550 160
517 3300049572 Ga0501036_0019572 Ga0501036_0019572_3399_3950 160
518 3300049572 Ga0501036_0958534 Ga0501036_0958534_117_602 160
519 3300049573 Ga0501037_0061101 Ga0501037_0061101_342_827 160
520 3300049575 Ga0501039_0549923 Ga0501039_0549923_18_509 160
521 3300049579 Ga0501043_0202594 Ga0501043_0202594_741_1226 160
522 3300049581 Ga0501047_0010805 Ga0501047_0010805_3136_3621 160
523 3300049581 Ga0501047_0040344 Ga0501047_0040344_1950_2435 160
524 3300049583 Ga0501067_0000026 Ga0501067_0000026_85961_86452 160
525 3300049583 Ga0501067_0001676 Ga0501067_0001676_6103_6600 160
526 3300049583 Ga0501067_0093438 Ga0501067_0093438_598_1086 160
527 3300049584 Ga0501068_0007971 Ga0501068_0007971_4822_5313 160
528 3300049584 Ga0501068_0102758 Ga0501068_0102758_11_499 160
529 3300049585 Ga0501069_0113067 Ga0501069_0113067_373_861 160
530 3300049585 Ga0501069_0595022 Ga0501069_0595022_154_645 160
531 3300049585 Ga0501069_0665764 Ga0501069_0665764_62_547 160
532 3300049586 Ga0501070_0000323 Ga0501070_0000323_42827_43318 160
533 3300049586 Ga0501070_0007402 Ga0501070_0007402_3196_3684 160
534 3300049586 Ga0501070_0121017 Ga0501070_0121017_41_526 160
535 3300049586 Ga0501070_0164521 Ga0501070_0164521_996_1487 160
536 3300049586 Ga0501070_0352458 Ga0501070_0352458_86_571 160
537 3300049587 Ga0501071_0359796 Ga0501071_0359796_570_1061 160
538 3300049587 Ga0501071_1022448 Ga0501071_1022448_28_513 160
539 3300049588 Ga0501072_0378468 Ga0501072_0378468_383_871 160
540 3300049589 Ga0501073_0000179 Ga0501073_0000179_35798_36289 160
541 3300049589 Ga0501073_0006633 Ga0501073_0006633_377_874 160
542 3300049589 Ga0501073_0026312 Ga0501073_0026312_136_627 160
543 3300049589 Ga0501073_0026634 Ga0501073_0026634_2992_3483 160
544 3300049589 Ga0501073_1003457 Ga0501073_1003457_78_563 160
545 3300049590 Ga0501074_0070404 Ga0501074_0070404_1310_1795 160
546 3300049590 Ga0501074_0123028 Ga0501074_0123028_713_1204 160
547 3300049590 Ga0501074_0397286 Ga0501074_0397286_41_529 160
548 3300049592 Ga0501076_0765097 Ga0501076_0765097_171_743 160
549 3300049652 Ga0501202_071090 Ga0501202_071090_222_710 160
550 3300049654 Ga0501207_016274 Ga0501207_016274_270_758 160
551 3300049660 Ga0501216_002169 Ga0501216_002169_182_670 160
552 3300049661 Ga0501217_014693 Ga0501217_014693_440_928 160
553 3300049663 Ga0501223_030652 Ga0501223_030652_425_913 160
554 3300049665 Ga0501227_004086 Ga0501227_004086_1484_1972 160
555 3300049665 Ga0501227_025238 Ga0501227_025238_589_1077 160
556 3300049667 Ga0501230_003894 Ga0501230_003894_805_1293 160
557 3300049668 Ga0501233_003013 Ga0501233_003013_1626_2114 160
558 3300049668 Ga0501233_097967 Ga0501233_097967_20_508 160
559 3300049706 Ga0501229_007702 Ga0501229_007702_527_1015 160
560 3300049741 Ga0501079_0547243 Ga0501079_0547243_349_840 160
561 3300049742 Ga0501080_0169585 Ga0501080_0169585_953_1444 160
562 3300049742 Ga0501080_0769943 Ga0501080_0769943_300_788 160
563 3300049743 Ga0501081_0049321 Ga0501081_0049321_2348_2839 160
564 3300049744 Ga0501083_0005169 Ga0501083_0005169_1204_1695 160
565 3300049744 Ga0501083_0030120 Ga0501083_0030120_3137_3628 160
566 3300049744 Ga0501083_0099926 Ga0501083_0099926_371_859 160
567 3300049744 Ga0501083_0572148 Ga0501083_0572148_89_580 160
568 3300049764 Ga0501267_006506 Ga0501267_006506_499_987 160
569 3300049822 Ga0501035_0360667 Ga0501035_0360667_469_954 160
570 3300049823 Ga0501044_0084199 Ga0501044_0084199_35_520 160
571 3300050507 nmdc:mga05p37_1275176_c1 nmdc:mga05p37_1275176_c1_67_552 160
572 3300050508 nmdc:mga09592_11194_c1 nmdc:mga09592_11194_c1_6622_7107 160
573 3300050508 nmdc:mga09592_225222_c1 nmdc:mga09592_225222_c1_627_1112 160
574 3300050511 nmdc:mga08y16_18519_c1 nmdc:mga08y16_18519_c1_4581_5078 160
575 3300050512 nmdc:mga0n895_566321_c1 nmdc:mga0n895_566321_c1_481_969 160
576 3300050513 nmdc:mga0rr50_55729_c1 nmdc:mga0rr50_55729_c1_517_1005 160
577 3300050513 nmdc:mga0rr50_745392_c1 nmdc:mga0rr50_745392_c1_222_710 160
578 3300053077 Ga0495601_0006774 Ga0495601_0006774_3378_3866 160
579 3300053086 Ga0500578_0332261 Ga0500578_0332261_138_626 160
580 3300053086 Ga0500578_0381990 Ga0500578_0381990_234_722 160
581 3300053094 Ga0500566_0000579 Ga0500566_0000579_7196_7684 160
582 3300053094 Ga0500566_0003002 Ga0500566_0003002_3828_4316 160
583 3300053094 Ga0500566_0121323 Ga0500566_0121323_309_848 160
584 3300053095 Ga0500640_005031 Ga0500640_005031_4087_4575 160
585 3300053102 Ga0500554_000343 Ga0500554_000343_7407_7895 160
586 3300053108 Ga0500562_017858 Ga0500562_017858_1168_1656 160
587 3300053119 Ga0500595_000685 Ga0500595_000685_8848_9336 160
588 3300053120 Ga0500597_104467 Ga0500597_104467_685_1173 160
589 3300053121 Ga0500607_107670 Ga0500607_107670_234_722 160
590 3300053123 Ga0500614_000877 Ga0500614_000877_1657_2145 160
591 3300053123 Ga0500614_004426 Ga0500614_004426_1826_2365 160
592 3300053130 Ga0500642_0006684 Ga0500642_0006684_2369_2857 160
593 3300053130 Ga0500642_0012433 Ga0500642_0012433_2007_2495 160
594 3300053133 Ga0500655_115102 Ga0500655_115102_68_556 160
595 3300053138 Ga0500564_196995 Ga0500564_196995_35_523 160
596 3300053139 Ga0500568_0007462 Ga0500568_0007462_1705_2193 160
597 3300053139 Ga0500568_0021106 Ga0500568_0021106_1985_2470 160
598 3300053144 Ga0500585_031417 Ga0500585_031417_1308_1796 160
599 3300053146 Ga0500588_0152870 Ga0500588_0152870_193_681 160
600 3300053150 Ga0500603_015209 Ga0500603_015209_992_1531 160
601 3300053150 Ga0500603_023447 Ga0500603_023447_976_1464 160
602 3300053177 Ga0500636_0058726 Ga0500636_0058726_1456_1995 160
603 3300053178 Ga0500637_0050830 Ga0500637_0050830_1322_1861 160
604 3300053737 Ga0500601_029908 Ga0500601_029908_41_529 160
605 3300054114 Ga0501084_0832079 Ga0501084_0832079_92_583 160
606 3300055283 Ga0500661_020082 Ga0500661_020082_334_873 160
607 3300059477 Ga0587084_083633 Ga0587084_083633_26_514 160
608 3300059504 Ga0587082_090755 Ga0587082_090755_65_553 160
609 3300059512 Ga0587092_063664 Ga0587092_063664_98_586 160
610 3300059643 Ga0587072_100176 Ga0587072_100176_80_568 160
611 3300060353 Ga0501082_0008410 Ga0501082_0008410_883_1374 160
612 3300003323 rootH1_10017798 rootH1_100177988 161
613 3300004800 Ga0058861_10044879 Ga0058861_100448791 161
614 3300004803 Ga0058862_10089401 Ga0058862_100894011 161
615 3300005327 Ga0070658_10039648 Ga0070658_100396485 161
616 3300005329 Ga0070683_100095265 Ga0070683_1000952651 161
617 3300005334 Ga0068869_101075749 Ga0068869_1010757491 161
618 3300005336 Ga0070680_100230372 Ga0070680_1002303722 161
619 3300005338 Ga0068868_100270410 Ga0068868_1002704102 161
620 3300005345 Ga0070692_10213450 Ga0070692_102134501 161
621 3300005364 Ga0070673_101872717 Ga0070673_1018727171 161
622 3300005365 Ga0070688_100204884 Ga0070688_1002048842 161
623 3300005365 Ga0070688_100206470 Ga0070688_1002064701 161
624 3300005435 Ga0070714_101194858 Ga0070714_1011948582 161
625 3300005438 Ga0070701_10248081 Ga0070701_102480812 161
626 3300005458 Ga0070681_10039022 Ga0070681_100390225 161
627 3300005458 Ga0070681_10089395 Ga0070681_100893953 161
628 3300005467 Ga0070706_100502678 Ga0070706_1005026781 161
629 3300005467 Ga0070706_101164673 Ga0070706_1011646731 161
630 3300005471 Ga0070698_100031473 Ga0070698_1000314732 161
631 3300005530 Ga0070679_100024718 Ga0070679_1000247186 161
632 3300005530 Ga0070679_100123082 Ga0070679_1001230823 161
633 3300005535 Ga0070684_100311799 Ga0070684_1003117992 161
634 3300005548 Ga0070665_100553430 Ga0070665_1005534302 161
635 3300005614 Ga0068856_100124689 Ga0068856_1001246892 161
636 3300005614 Ga0068856_100732906 Ga0068856_1007329061 161
637 3300006237 Ga0097621_100269462 Ga0097621_1002694622 161
638 3300006844 Ga0075428_100099931 Ga0075428_1000999313 161
639 3300006844 Ga0075428_100409091 Ga0075428_1004090912 161
640 3300006844 Ga0075428_101993830 Ga0075428_1019938302 161
641 3300006844 Ga0075428_102148790 Ga0075428_1021487901 161
642 3300006846 Ga0075430_100468418 Ga0075430_1004684182 161
643 3300006846 Ga0075430_100604573 Ga0075430_1006045732 161
644 3300006847 Ga0075431_100673859 Ga0075431_1006738591 161
645 3300006880 Ga0075429_100016106 Ga0075429_1000161062 161
646 3300007076 Ga0075435_100251661 Ga0075435_1002516612 161
647 3300009093 Ga0105240_10674777 Ga0105240_106747771 161
648 3300009094 Ga0111539_10010727 Ga0111539_100107277 161
649 3300009094 Ga0111539_11247359 Ga0111539_112473592 161
650 3300009094 Ga0111539_11710388 Ga0111539_117103881 161
651 3300009098 Ga0105245_10386618 Ga0105245_103866181 161
652 3300009147 Ga0114129_12832497 Ga0114129_128324971 161
653 3300009174 Ga0105241_11624293 Ga0105241_116242931 161
654 3300009177 Ga0105248_11198455 Ga0105248_111984551 161
655 3300009545 Ga0105237_10126013 Ga0105237_101260133 161
656 3300009551 Ga0105238_10924681 Ga0105238_109246812 161
657 3300009551 Ga0105238_11022354 Ga0105238_110223541 161
658 3300009551 Ga0105238_11374055 Ga0105238_113740552 161
659 3300013296 Ga0157374_10500330 Ga0157374_105003301 161
660 3300013296 Ga0157374_10614906 Ga0157374_106149062 161
661 3300013297 Ga0157378_10127395 Ga0157378_101273952 161
662 3300013307 Ga0157372_10419594 Ga0157372_104195941 161
663 3300014325 Ga0163163_10266392 Ga0163163_102663922 161
664 3300014969 Ga0157376_10352311 Ga0157376_103523112 161
665 3300020078 Ga0206352_10930255 Ga0206352_109302551 161
666 3300020078 Ga0206352_11231561 Ga0206352_112315611 161
667 3300020080 Ga0206350_11425950 Ga0206350_114259501 161
668 3300020082 Ga0206353_10934020 Ga0206353_109340201 161
669 3300021361 Ga0213872_10091065 Ga0213872_100910652 161
670 3300025909 Ga0207705_10353530 Ga0207705_103535302 161
671 3300025914 Ga0207671_10081202 Ga0207671_100812022 161
672 3300025917 Ga0207660_10215820 Ga0207660_102158202 161
673 3300025921 Ga0207652_10020065 Ga0207652_100200655 161
674 3300025921 Ga0207652_10046132 Ga0207652_100461323 161
675 3300025921 Ga0207652_10089290 Ga0207652_100892903 161
676 3300025924 Ga0207694_10301344 Ga0207694_103013442 161
677 3300025924 Ga0207694_10874358 Ga0207694_108743581 161
678 3300025927 Ga0207687_10316616 Ga0207687_103166161 161
679 3300025944 Ga0207661_11205822 Ga0207661_112058221 161
680 3300025961 Ga0207712_10992524 Ga0207712_109925242 161
681 3300026023 Ga0207677_10188314 Ga0207677_101883142 161
682 3300026078 Ga0207702_10146425 Ga0207702_101464252 161
683 3300026142 Ga0207698_10517355 Ga0207698_105173552 161
684 3300031616 Ga0307508_10066437 Ga0307508_100664372 161
685 3300031711 Ga0265314_10115351 Ga0265314_101153512 161
686 3300031727 Ga0316576_10385674 Ga0316576_103856741 161
687 3300031730 Ga0307516_10267632 Ga0307516_102676322 161
688 3300035170 Ga0373943_0023787 Ga0373943_0023787_443_931 161
689 3300035172 Ga0373955_0140590 Ga0373955_0140590_266_754 161
690 3300035692 Ga0373935_0131049 Ga0373935_0131049_1034_1522 161
691 3300036401 Ga0373937_0059205 Ga0373937_0059205_937_1425 161
692 3300039447 Ga0436361_1124647 Ga0436361_1124647_489_977 161
693 3300039450 Ga0436363_0126406 Ga0436363_0126406_145_633 161
694 3300039450 Ga0436363_0206308 Ga0436363_0206308_118_645 161
695 3300041486 Ga0451807_1082726 Ga0451807_1082726_814_1305 161
696 3300041507 Ga0451851_0662761 Ga0451851_0662761_16_504 161
697 3300044656 Ga0466969_0005206 Ga0466969_0005206_4257_4745 161
698 3300044684 Ga0466966_0008662 Ga0466966_0008662_5817_6305 161
699 3300045049 Ga0466959_0115533 Ga0466959_0115533_507_995 161
700 3300045051 Ga0451576_0868193 Ga0451576_0868193_268_801 161
701 3300045976 Ga0466967_1369745 Ga0466967_1369745_38_526 161
702 3300046462 Ga0495651_0057249 Ga0495651_0057249_694_1182 161
703 3300046529 Ga0495652_0216038 Ga0495652_0216038_739_1227 161
704 3300046679 Ga0495623_0059615 Ga0495623_0059615_785_1273 161
705 3300046683 Ga0495658_0692271 Ga0495658_0692271_52_540 161
706 3300046689 Ga0495613_0190191 Ga0495613_0190191_344_832 161
707 3300047318 Ga0495636_0437317 Ga0495636_0437317_24_512 161
708 3300047444 Ga0495675_0345440 Ga0495675_0345440_284_772 161
709 3300048088 Ga0495602_0148994 Ga0495602_0148994_600_1088 161
710 3300048915 Ga0496112_0188973 Ga0496112_0188973_183_671 161
711 3300048918 Ga0496115_0148508 Ga0496115_0148508_921_1505 161
712 3300049129 Ga0501309_082223 Ga0501309_082223_36_524 161
713 3300049161 Ga0501305_072556 Ga0501305_072556_101_589 161
714 3300049583 Ga0501067_0002509 Ga0501067_0002509_9180_9665 161
715 3300049742 Ga0501080_0604532 Ga0501080_0604532_458_949 161
716 3300050508 nmdc:mga09592_49581_c1 nmdc:mga09592_49581_c1_1928_2416 161
717 3300050509 nmdc:mga0qj67_618341_c1 nmdc:mga0qj67_618341_c1_241_729 161
718 3300050510 nmdc:mga06r32_780854_c1 nmdc:mga06r32_780854_c1_417_905 161
719 3300050511 nmdc:mga08y16_4304_c1 nmdc:mga08y16_4304_c1_8204_8692 161
720 3300050511 nmdc:mga08y16_872549_c1 nmdc:mga08y16_872549_c1_117_605 161
721 3300050512 nmdc:mga0n895_531242_c1 nmdc:mga0n895_531242_c1_541_1029 161
722 3300053085 Ga0495619_0282760 Ga0495619_0282760_450_938 161
723 3300059492 Ga0587073_0262591 Ga0587073_0262591_14_502 161
724 3300060346 Ga0587111_0216772 Ga0587111_0216772_36_524 161
725 3300002868 Ga0006767J43181_103406 Ga0006767J43181_1034061 162
726 3300002870 Ga0006763J43179_104556 Ga0006763J43179_1045561 162
727 3300003162 Ga0006778J45830_1019747 Ga0006778J45830_10197471 162
728 3300003163 Ga0006759J45824_1009006 Ga0006759J45824_10090061 162
729 3300003300 Ga0006758J48902_1010140 Ga0006758J48902_10101401 162
730 3300003305 Ga0006770J48903_1020700 Ga0006770J48903_10207001 162
731 3300003693 Ga0032354_1024924 Ga0032354_10249241 162
732 3300006844 Ga0075428_100496197 Ga0075428_1004961972 162
733 3300031728 Ga0316578_10144825 Ga0316578_101448252 162

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF21095

CarD_C

CarD, C-terminal domain

102

189

0.96

PF02559

CarD_TRCF_RID

CarD-like/TRCF RID domain

36

95

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
7kim-assembly1.cif.gz_M mycobacterium tuberculosis wt rnap transcription closed promoter complex with whib7 transcription factor 0.8661 3 159
4xlr-assembly1.cif.gz_M crystal structure of t.aquaticus transcription initiation complex with card containing bubble promoter and rna 0.8622 3 159
4xls-assembly2.cif.gz_N crystal structure of t. aquaticus transcription initiation complex with card containing upstream fork promoter. 0.8591 3 159
2lqk-assembly1.cif.gz_A nmr solution structure of the n-terminal domain of the cdnl protein from thermus thermophilus 0.8585 2 64
6vw0-assembly1.cif.gz_M mycobacterium tuberculosis rnap s456l mutant open promoter complex 0.8518 3 162
ID Description Score Start End Superfamily
4kbmB01 Mainly Beta;Beta Barrel;Thrombin, subunit H; 0.948 3 60 2.40.10.170
4kbmB02 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;CarD-like, C-terminal domain 0.9411 62 162 1.20.58.1290
4kbmB02 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;CarD-like, C-terminal domain 0.9315 62 162 1.20.58.1290
4kbmB01 Mainly Beta;Beta Barrel;Thrombin, subunit H; 0.9159 3 60 2.40.10.170
2lqkA00 Mainly Beta;Beta Barrel;Thrombin, subunit H; 0.8585 2 64 2.40.10.170
ID Description Score Start End GO Terms
AF-A0A6I3CRD3-F1-model_v4 CarD family transcriptional regulator 0.9502 66 162 GO:0009303
AF-A0A3M1SAV7-F1-model_v4 CarD-like/TRCF RNAP-interacting domain-containing protein 0.9477 1 161 GO:0009303
AF-A0A257JGR4-F1-model_v4 CarD family transcriptional regulator 0.9476 2 64 GO:0009303
AF-A0A3E0P0Z8-F1-model_v4 CarD family transcriptional regulator 0.9465 3 161 GO:0009303
AF-A0A3M1VQQ5-F1-model_v4 CarD family transcriptional regulator 0.945 4 159 GO:0009303

Feature Viewer

pLDDT pTM Quality
88.4 0.78 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map